WorldWideScience

Sample records for broadcast system ebs

  1. Emergency Broadcast System Based On GIS

    Science.gov (United States)

    Junfeng, Kang; Baoyu, Wang; Xueying, Jiang; Xiaosheng, Liu

    2017-02-01

    Nowadays, disaster occurs more and more frequently, which brings huge losses to the society. Presented a GIS based emergency broadcast system (GIS-EBS), to provide rapid, accurate information to the public, can reduce the people’s losses maximum. Different from the traditional radio data system (RDS), by adding broadcasting terminal control instruction on the FM signal, GIS-EBS extended the RDS protocol, which can control each radio terminal’s state. And through the extended RDS protocol, GIS-EBS can broadcast and release the emergency information to the right place and the people most in need in the shortest time.

  2. THE CONCEPT OF INTEGRATED ENGINEERING AND BUSINESS (EB EDUCATION SYSTEM

    Directory of Open Access Journals (Sweden)

    Michał Charlak

    2013-12-01

    Full Text Available In our approach to engineering and business education system an engineer is a man working as creator and user of technical products. We stress that the process of understanding and gaining knowledge of technical reality and creativity of engineers are the essential for EB concept . Next, we describe briefly three perspectives for building the system of innovative product origination as a basis for EB system: 1 designer’s perspective; 2 business perspective. 3 consumer perspective.

  3. Transmission Quality Measurements in DAB+ Broadcast System

    Directory of Open Access Journals (Sweden)

    Gilski Przemysław

    2017-12-01

    Full Text Available In the age of digital media, delivering broadcast content to customers at an acceptable level of quality is one of the most challenging tasks. The most important factor is the efficient use of available resources, including bandwidth. An appropriate way of managing the digital multiplex is essential for both the economic and technical issues. In this paper we describe transmission quality measurements in the DAB+ broadcast system. We provide a methodology for analysing parameters and factors related with the efficiency and reliability of a digital radio link. We describe a laboratory stand that can be used for transmission quality assessment on a regional and national level.

  4. Digital Broadcasting in Hawaii: The Aloha System

    Science.gov (United States)

    Abramson, Norman

    1974-01-01

    A look at the ALOHA SYSTEM research project at the University of Hawaii, which developed and built a computer-communication network based upon the use of UHF radio broadcast channels for console to computer and computer to computer communication. (Author)

  5. Disposal systems evaluations and tool development : Engineered Barrier System (EBS) evaluation.

    Energy Technology Data Exchange (ETDEWEB)

    Rutqvist, Jonny (LBNL); Liu, Hui-Hai (LBNL); Steefel, Carl I. (LBNL); Serrano de Caro, M. A. (LLNL); Caporuscio, Florie Andre (LANL); Birkholzer, Jens T. (LBNL); Blink, James A. (LLNL); Sutton, Mark A. (LLNL); Xu, Hongwu (LANL); Buscheck, Thomas A. (LLNL); Levy, Schon S. (LANL); Tsang, Chin-Fu (LBNL); Sonnenthal, Eric (LBNL); Halsey, William G. (LLNL); Jove-Colon, Carlos F.; Wolery, Thomas J. (LLNL)

    2011-01-01

    Key components of the nuclear fuel cycle are short-term storage and long-term disposal of nuclear waste. The latter encompasses the immobilization of used nuclear fuel (UNF) and radioactive waste streams generated by various phases of the nuclear fuel cycle, and the safe and permanent disposition of these waste forms in geological repository environments. The engineered barrier system (EBS) plays a very important role in the long-term isolation of nuclear waste in geological repository environments. EBS concepts and their interactions with the natural barrier are inherently important to the long-term performance assessment of the safety case where nuclear waste disposition needs to be evaluated for time periods of up to one million years. Making the safety case needed in the decision-making process for the recommendation and the eventual embracement of a disposal system concept requires a multi-faceted integration of knowledge and evidence-gathering to demonstrate the required confidence level in a deep geological disposal site and to evaluate long-term repository performance. The focus of this report is the following: (1) Evaluation of EBS in long-term disposal systems in deep geologic environments with emphasis on the multi-barrier concept; (2) Evaluation of key parameters in the characterization of EBS performance; (3) Identification of key knowledge gaps and uncertainties; and (4) Evaluation of tools and modeling approaches for EBS processes and performance. The above topics will be evaluated through the analysis of the following: (1) Overview of EBS concepts for various NW disposal systems; (2) Natural and man-made analogs, room chemistry, hydrochemistry of deep subsurface environments, and EBS material stability in near-field environments; (3) Reactive Transport and Coupled Thermal-Hydrological-Mechanical-Chemical (THMC) processes in EBS; and (4) Thermal analysis toolkit, metallic barrier degradation mode survey, and development of a Disposal Systems

  6. Reactive Transport and Coupled THM Processes in Engineering Barrier Systems (EBS)

    Energy Technology Data Exchange (ETDEWEB)

    Steefel, Carl; Rutqvist, Jonny; Tsang, Chin-Fu; Liu, Hui-Hai; Sonnenthal, Eric; Houseworth, Jim; Birkholzer, Jens

    2010-08-31

    Geological repositories for disposal of high-level nuclear wastes generally rely on a multi-barrier system to isolate radioactive wastes from the biosphere. The multi-barrier system typically consists of a natural barrier system, including repository host rock and its surrounding subsurface environment, and an engineering barrier system (EBS). EBS represents the man-made, engineered materials placed within a repository, including the waste form, waste canisters, buffer materials, backfill and seals (OECD, 2003). EBS plays a significant role in the containment and long-term retardation of radionuclide release. EBS is involved in complex thermal, hydrogeological, mechanical, chemical and biological processes, such as heat release due to radionuclide decay, multiphase flow (including gas release due to canister corrosion), swelling of buffer materials, radionuclide diffusive transport, waste dissolution and chemical reactions. All these processes are related to each other. An in-depth understanding of these coupled processes is critical for the performance assessment (PA) for EBS and the entire repository. Within the EBS group of Used Fuel Disposition (UFD) Campaign, LBNL is currently focused on (1) thermal-hydraulic-mechanical-chemical (THMC) processes in buffer materials (bentonite) and (2) diffusive transport in EBS associated with clay host rock, with a long-term goal to develop a full understanding of (and needed modeling capabilities to simulate) impacts of coupled processes on radionuclide transport in different components of EBS, as well as the interaction between near-field host rock (e.g., clay) and EBS and how they effect radionuclide release. This final report documents the progress that LBNL has made in its focus areas. Specifically, Section 2 summarizes progress on literature review for THMC processes and reactive-diffusive radionuclide transport in bentonite. The literature review provides a picture of the state-of-the-art of the relevant research areas

  7. Media and Politics: Re-Thinking the Indonesian Broadcasting System

    Directory of Open Access Journals (Sweden)

    Masduki Masduki

    2017-10-01

    Full Text Available The emergence of the policy of broadcasting liberalization in the established democracies of Europe and North America, which is indicated by the absence of state intervention to broadcasting governance has been influencing broadcasting policy in the new democracies, including Indonesia. Is it true that Indonesia adopts a liberal broadcasting policy? This paper outlines two issues. First, the academic debate surrounding broadcasting system in the world. Second, discussion as stated by scholars on a thesis of the enactment of the liberal media system in Indonesia that is primarily based on the broadcasting policies after Suharto’s reign of power, among others Law 32/2002 on Broadcasting. Based on the intensive literature review, it can be concluded that the broadcasting system prevailing in Indonesia is not purely liberal, but a mix of liberal and authoritarian model, a unique character that also occurs in the post-communist and post-authoritarian states in Asia, Africa and Eastern Europe. This mix is indicated within the last fifteen years through the adoption of public and community broadcasters and the establishment of Komisi Penyiaran Indonesia (KPI as an independent regulator that were accompanied with the existing control of the ruling government to public broadcasters (RRI & TVRI; the weak mandate of KPI and the omission of commercial broadcasting domination.

  8. Broadcast Communication by System Frequency Modulation

    DEFF Research Database (Denmark)

    Douglass, Philip James; You, Shi; Heussen, Kai

    2012-01-01

    Load controllers available today can measure AC system frequency and react to frequency deviations. A system operator can communicate to frequency sensitive loads by changing the set-points of the system’s dispatchable frequency regulation resources. Explicitly signaling system state by generating...... off-nominal system frequency values is a novel narrowband broadcast communications channel between system operators and frequency sensitive distributed energy resources (FS-DER). The feasibility of the proposed system is evaluated on an existing island power system in Denmark. This study shows...... these constraints, the proposed system would allow operators to dispatch FS-DER in a robust manner, without using an external digital control channel. By dispatching FS-DER, their well known role as a power balancing resource can be expanded to include energy balancing services....

  9. Evaluation of the Petrifilm™ EB and TEMPO(®) EB systems with ISO 21528-2:2004 method for the count of Enterobacteriaceae in milk.

    Science.gov (United States)

    Cirolini, Andréia; Miotto, Marília; Machado, Fernanda Morgana; da Silva, Helen Silvestre; Ogliari, Paulo José; Vieira, Cleide Rosana Werneck

    2013-01-01

    The development of alternative microbiological techniques is driven by the necessity to meet the current needs to deliver rapid results in the manufacturing process of foods, but it is important that these methods be evaluated for each application. The objective of the present study was to assess the Petrifilm™ EB and the TEMPO(®) EB systems with ISO 21528-2:2004 for the count of Enterobacteriaceae in pasteurized and UHT milk samples. We analyzed the microflora of 141 pasteurized milk samples, 15 samples of artificially contaminated pasteurized milk and 15 samples of artificially contaminated UHT milk. Investigation of the method Petrifilm™ EB and ISO 21528:2 regression analysis showed a high correlation in the samples, r = 0.90 for the microflora of pasteurized milk, r = 0.98 for artificially contaminated pasteurized milk and r = 0.99 for the artificially contaminated UHT milk. In evaluating the system TEMPO EB ® method and ISO 21528:2 correlation was also significant in the analyzed samples, with r = 0.86 for the microflora of pasteurized milk, r = 0.96 for artificially contaminated pasteurized milk and r = 0.99 for artificially contaminated UHT milk. No statistically significant differences were observed between the three methods conducted to analyze artificially contaminated pasteurized and UHT milk at three inoculum levels. In conclusion, the Petrifilm™ EB system and the TEMPO(®) EB system may be an alternative to the ISO 21528-2:2004 for the Enterobacteriaceae assay for milk as because of the ease-of-operation and the time reduction achieved for conducting the microbiological assay using these systems.

  10. Evaluation of the PetrifilmTM EB and TEMPO® EB systems with ISO 21528-2:2004 method for the count of Enterobacteriaceae in milk

    Directory of Open Access Journals (Sweden)

    Andréia Cirolini

    2013-09-01

    Full Text Available The development of alternative microbiological techniques is driven by the necessity to meet the current needs to deliver rapid results in the manufacturing process of foods, but it is important that these methods be evaluated for each application. The objective of the present study was to assess the PetrifilmTM EB and the TEMPO® EB systems with ISO 21528-2:2004 for the count of Enterobacteriaceae in pasteurized and UHT milk samples. We analyzed the microflora of 141 pasteurized milk samples, 15 samples of artificially contaminated pasteurized milk and 15 samples of artificially contaminated UHT milk. Investigation of the method PetrifilmTM EB and ISO 21528:2 regression analysis showed a high correlation in the samples, r = 0.90 for the microflora of pasteurized milk, r = 0.98 for artificially contaminated pasteurized milk and r = 0.99 for the artificially contaminated UHT milk. In evaluating the system TEMPO EB ® method and ISO 21528:2 correlation was also significant in the analyzed samples, with r = 0.86 for the microflora of pasteurized milk, r = 0.96 for artificially contaminated pasteurized milk and r = 0.99 for artificially contaminated UHT milk. No statistically significant differences were observed between the three methods conducted to analyze artificially contaminated pasteurized and UHT milk at three inoculum levels. In conclusion, the PetrifilmTM EB system and the TEMPO® EB system may be an alternative to the ISO 21528-2:2004 for the Enterobacteriaceae assay for milk as because of the ease-of-operation and the time reduction achieved for conducting the microbiological assay using these systems.

  11. International Collaborations on Engineered Barrier Systems: Brief Overview of SKB-EBS Activities.

    Energy Technology Data Exchange (ETDEWEB)

    Jove-Colon, Carlos F. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-10-01

    Research collaborations with international partners on the behavior and performance of engineered barrier systems (EBS) are an important aspect of the DOE-NE Used Fuel Disposition Campaign strategy in the evaluation of disposal design concepts. These international partnerships are a cost-effective way of engaging in key R&D activities with common goals resulting in effective scientific knowledge exchanges thus enhancing existing and future research programs in the USA. This report provides a brief description of the activities covered by the Swedish Nuclear Fuel and Waste Management Company (SKB) EBS Task Force (TF) (referred hereafter as SKB EBS TF) and potential future directions for engagement of the DOE-NE UFDC program in relevant R&D activities. Emphasis is given to SKB EBS TF activities that are still ongoing and aligned to the UFDC R&D program. This include utilization of data collected in the bentonite rock interaction experiment (BRIE) and data sets from benchmark experiments produced by the chemistry or “C” part of the SKB EBS TF. Potential applications of information generated by this program include comparisons/tests between model and data (e.g., reactive diffusion), development and implementation of coupled-process models (e.g., HM), and code/model benchmarking.

  12. The Educational Project for Media Literacy Using Radio Broadcasting System

    OpenAIRE

    北村, 順生; Kitamura, Yorio

    2009-01-01

    This report outlines the educational project for media literacy using radio broadcasting system. The practical activity to produce a radio program are very effective on the students to cultivate their media literacy.

  13. Transmission techniques for emergent multicast and broadcast systems

    CERN Document Server

    da Silva, Mario Marques; Dinis, Rui; Souto, Nuno; Silva, Joao Carlos

    2010-01-01

    Describing efficient transmission schemes for broadband wireless systems, Transmission Techniques for Emergent Multicast and Broadcast Systems examines advances in transmission techniques and receiver designs capable of supporting the emergent wireless needs for multimedia broadcast and multicast service (MBMS) requirements. It summarizes the research and development taking place in wireless communications for multimedia MBMS and addresses the means to improved spectral efficiency to allow for increased user bit rate, as well as increased capacity of the digital cellular radio network.The text

  14. Digital terrestrial television broadcasting technology and system

    CERN Document Server

    2015-01-01

    Now under massive deployment worldwide, digital terrestrial television broadcasting (DTTB) offers one of the most attractive ways to deliver digital TV over the VHF/UHF band. Written by a team of experts for specialists and non-specialists alike, this book serves as a comprehensive guide to DTTB. It covers the fundamentals of channel coding and modulation technologies used in DTTB, as well as receiver technology for synchronization, channel estimation, and equalization. It also covers the recently introduced Chinese DTTB standard, using the SFN network in Hong Kong as an example.

  15. Effect Through Broadcasting System Access Point For Video Transmission

    Directory of Open Access Journals (Sweden)

    Leni Marlina

    2015-08-01

    Full Text Available Most universities are already implementing wired and wireless network that is used to access integrated information systems and the Internet. At present it is important to do research on the influence of the broadcasting system through the access point for video transmitter learning in the university area. At every university computer network through the access point must also use the cable in its implementation. These networks require cables that will connect and transmit data from one computer to another computer. While wireless networks of computers connected through radio waves. This research will be a test or assessment of how the influence of the network using the WLAN access point for video broadcasting means learning from the server to the client. Instructional video broadcasting from the server to the client via the access point will be used for video broadcasting means of learning. This study aims to understand how to build a wireless network by using an access point. It also builds a computer server as instructional videos supporting software that can be used for video server that will be emitted by broadcasting via the access point and establish a system of transmitting video from the server to the client via the access point.

  16. Development of a speech recognition system for Spanish broadcast news

    NARCIS (Netherlands)

    Niculescu, A.I.; de Jong, Franciska M.G.

    2008-01-01

    This paper reports on the development process of a speech recognition system for Spanish broadcast news within the MESH FP6 project. The system uses the SONIC recognizer developed at the Center for Spoken Language Research (CSLR), University of Colorado. Acoustic and language models were trained

  17. Monitoring of the Process of System Information Broadcasting in Time

    Science.gov (United States)

    Mironowicz, P.; Korbicz, J. K.; Horodecki, P.

    2017-04-01

    One of the problems of quantum physics is how a measurement turns quantum, noncopyable data, towards copyable classical knowledge. We use the quantum state discrimination in a central system model to show how its evolution leads to the broadcasting of the information, and how orthogonalization and decoherence factors allow us to monitor the distance of the state in question to the one perfectly broadcasting information, in any moment of time not just asymptotically. We illustrate this in the spin-spin model where the distance is shown to be typically small and provide the related time scales.

  18. An Efficient Live TV Scheduling System for 4G LTE Broadcast

    KAUST Repository

    Lau, Chun Pong

    2016-01-01

    Traditional live television (TV) broadcasting systems are proven to be spectrum inefficient. Therefore, researchers propose to provide TV services on fourth-generation (4G) long-term evolution (LTE) networks. However, static broadcast, a typical broadcasting method over cellular network, is inefficient in terms of radio resource usage. To solve this problem, the audience-driven live TV scheduling (ADTVS) framework is proposed, to maximize radio resource usage when providing TV broadcasting services over LTE networks. ADTVS, a system-level scheduling framework, considers both available radio resources and audience preferences, in order to dynamically schedule TV channels for broadcasting at various time and locations. By conducting a simulation using real-life data and scenarios, it is shown that ADTVS significantly outperforms the static broadcast method. Numerical results indicate that, on average, ADTVS enables substantial improvement to broadcast efficiency and conserves considerable amount of radio resources, while forgoing less than 5% of user services compared to the benchmark system.

  19. Eb- en vloedschaar systemen in de Nederlandse getijwateren - Ebb and Flood channel systems in the Netherlands tidal waters

    NARCIS (Netherlands)

    Stive, M.J.F.; Van der Spek, A.; Zitman, T.; Van Veen, J.

    1950-01-01

    The present paper, "Eb- en vloedschaarsystemen in de Nederlandse getijwateren" (Ebb- and floodchannel systems in the Dutch tidal waters), which was published in 1950, should be considered as Van Veen's most important publication since his thesis. It summarizes the results of 20 years of intensive

  20. An ebCMOS camera system for marine bioluminescence observation: The LuSEApher prototype

    Energy Technology Data Exchange (ETDEWEB)

    Dominjon, A., E-mail: a.dominjon@ipnl.in2p3.fr [CNRS/IN2P3, Institut de Physique Nucleaire de Lyon, Villeurbanne F-69622 (France); Ageron, M. [CNRS/IN2P3, Centre de Physique des Particules de Marseille, Marseille, F-13288 (France); Barbier, R. [CNRS/IN2P3, Institut de Physique Nucleaire de Lyon, Villeurbanne F-69622 (France); Universite de Lyon, Universite Lyon 1, Lyon F-69003 (France); Billault, M.; Brunner, J. [CNRS/IN2P3, Centre de Physique des Particules de Marseille, Marseille, F-13288 (France); Cajgfinger, T. [CNRS/IN2P3, Institut de Physique Nucleaire de Lyon, Villeurbanne F-69622 (France); Universite de Lyon, Universite Lyon 1, Lyon F-69003 (France); Calabria, P. [CNRS/IN2P3, Institut de Physique Nucleaire de Lyon, Villeurbanne F-69622 (France); Chabanat, E. [CNRS/IN2P3, Institut de Physique Nucleaire de Lyon, Villeurbanne F-69622 (France); Universite de Lyon, Universite Lyon 1, Lyon F-69003 (France); Chaize, D.; Doan, Q.T.; Guerin, C.; Houles, J.; Vagneron, L. [CNRS/IN2P3, Institut de Physique Nucleaire de Lyon, Villeurbanne F-69622 (France)

    2012-12-11

    The ebCMOS camera, called LuSEApher, is a marine bioluminescence recorder device adapted to extreme low light level. This prototype is based on the skeleton of the LUSIPHER camera system originally developed for fluorescence imaging. It has been installed at 2500 m depth off the Mediterranean shore on the site of the ANTARES neutrino telescope. The LuSEApher camera is mounted on the Instrumented Interface Module connected to the ANTARES network for environmental science purposes (European Seas Observatory Network). The LuSEApher is a self-triggered photo detection system with photon counting ability. The presentation of the device is given and its performances such as the single photon reconstruction, noise performances and trigger strategy are presented. The first recorded movies of bioluminescence are analyzed. To our knowledge, those types of events have never been obtained with such a sensitivity and such a frame rate. We believe that this camera concept could open a new window on bioluminescence studies in the deep sea.

  1. ROBUS-2: A Fault-Tolerant Broadcast Communication System

    Science.gov (United States)

    Torres-Pomales, Wilfredo; Malekpour, Mahyar R.; Miner, Paul S.

    2005-01-01

    The Reliable Optical Bus (ROBUS) is the core communication system of the Scalable Processor-Independent Design for Enhanced Reliability (SPIDER), a general-purpose fault-tolerant integrated modular architecture currently under development at NASA Langley Research Center. The ROBUS is a time-division multiple access (TDMA) broadcast communication system with medium access control by means of time-indexed communication schedule. ROBUS-2 is a developmental version of the ROBUS providing guaranteed fault-tolerant services to the attached processing elements (PEs), in the presence of a bounded number of faults. These services include message broadcast (Byzantine Agreement), dynamic communication schedule update, clock synchronization, and distributed diagnosis (group membership). The ROBUS also features fault-tolerant startup and restart capabilities. ROBUS-2 is tolerant to internal as well as PE faults, and incorporates a dynamic self-reconfiguration capability driven by the internal diagnostic system. This version of the ROBUS is intended for laboratory experimentation and demonstrations of the capability to reintegrate failed nodes, dynamically update the communication schedule, and tolerate and recover from correlated transient faults.

  2. 47 CFR 73.758 - System specifications for digitally modulated emissions in the HF broadcasting service.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false System specifications for digitally modulated emissions in the HF broadcasting service. 73.758 Section 73.758 Telecommunication FEDERAL COMMUNICATIONS... § 73.758 System specifications for digitally modulated emissions in the HF broadcasting service. (a...

  3. EBS Radionuclide Transport Abstraction

    Energy Technology Data Exchange (ETDEWEB)

    J. Prouty

    2006-07-14

    The purpose of this report is to develop and analyze the engineered barrier system (EBS) radionuclide transport abstraction model, consistent with Level I and Level II model validation, as identified in Technical Work Plan for: Near-Field Environment and Transport: Engineered Barrier System: Radionuclide Transport Abstraction Model Report Integration (BSC 2005 [DIRS 173617]). The EBS radionuclide transport abstraction (or EBS RT Abstraction) is the conceptual model used in the total system performance assessment (TSPA) to determine the rate of radionuclide releases from the EBS to the unsaturated zone (UZ). The EBS RT Abstraction conceptual model consists of two main components: a flow model and a transport model. Both models are developed mathematically from first principles in order to show explicitly what assumptions, simplifications, and approximations are incorporated into the models used in the TSPA. The flow model defines the pathways for water flow in the EBS and specifies how the flow rate is computed in each pathway. Input to this model includes the seepage flux into a drift. The seepage flux is potentially split by the drip shield, with some (or all) of the flux being diverted by the drip shield and some passing through breaches in the drip shield that might result from corrosion or seismic damage. The flux through drip shield breaches is potentially split by the waste package, with some (or all) of the flux being diverted by the waste package and some passing through waste package breaches that might result from corrosion or seismic damage. Neither the drip shield nor the waste package survives an igneous intrusion, so the flux splitting submodel is not used in the igneous scenario class. The flow model is validated in an independent model validation technical review. The drip shield and waste package flux splitting algorithms are developed and validated using experimental data. The transport model considers advective transport and diffusive transport

  4. Digital Audio Radio Broadcast Systems Laboratory Testing Nearly Complete

    Science.gov (United States)

    2005-01-01

    Radio history continues to be made at the NASA Lewis Research Center with the completion of phase one of the digital audio radio (DAR) testing conducted by the Consumer Electronics Group of the Electronic Industries Association. This satellite, satellite/terrestrial, and terrestrial digital technology will open up new audio broadcasting opportunities both domestically and worldwide. It will significantly improve the current quality of amplitude-modulated/frequency-modulated (AM/FM) radio with a new digitally modulated radio signal and will introduce true compact-disc-quality (CD-quality) sound for the first time. Lewis is hosting the laboratory testing of seven proposed digital audio radio systems and modes. Two of the proposed systems operate in two modes each, making a total of nine systems being tested. The nine systems are divided into the following types of transmission: in-band on-channel (IBOC), in-band adjacent-channel (IBAC), and new bands. The laboratory testing was conducted by the Consumer Electronics Group of the Electronic Industries Association. Subjective assessments of the audio recordings for each of the nine systems was conducted by the Communications Research Center in Ottawa, Canada, under contract to the Electronic Industries Association. The Communications Research Center has the only CCIR-qualified (Consultative Committee for International Radio) audio testing facility in North America. The main goals of the U.S. testing process are to (1) provide technical data to the Federal Communication Commission (FCC) so that it can establish a standard for digital audio receivers and transmitters and (2) provide the receiver and transmitter industries with the proper standards upon which to build their equipment. In addition, the data will be forwarded to the International Telecommunications Union to help in the establishment of international standards for digital audio receivers and transmitters, thus allowing U.S. manufacturers to compete in the

  5. Ground-Based Global Navigation Satellite System Combined Broadcast Ephemeris Data (hourly files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) Combined Broadcast Ephemeris Data (hourly files of all distinct navigation messages...

  6. Ground-Based Global Navigation Satellite System Mixed Broadcast Ephemeris Data (daily files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) Mixed Broadcast Ephemeris Data (daily files) from the NASA Crustal Dynamics Data...

  7. Ground-Based Global Navigation Satellite System Combined Broadcast Ephemeris Data (daily files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) Combined Broadcast Ephemeris Data (daily files of all distinct navigation messages...

  8. EBS Radionuclide Transport Abstraction

    Energy Technology Data Exchange (ETDEWEB)

    J.D. Schreiber

    2005-08-25

    The purpose of this report is to develop and analyze the engineered barrier system (EBS) radionuclide transport abstraction model, consistent with Level I and Level II model validation, as identified in ''Technical Work Plan for: Near-Field Environment and Transport: Engineered Barrier System: Radionuclide Transport Abstraction Model Report Integration'' (BSC 2005 [DIRS 173617]). The EBS radionuclide transport abstraction (or EBS RT Abstraction) is the conceptual model used in the total system performance assessment for the license application (TSPA-LA) to determine the rate of radionuclide releases from the EBS to the unsaturated zone (UZ). The EBS RT Abstraction conceptual model consists of two main components: a flow model and a transport model. Both models are developed mathematically from first principles in order to show explicitly what assumptions, simplifications, and approximations are incorporated into the models used in the TSPA-LA. The flow model defines the pathways for water flow in the EBS and specifies how the flow rate is computed in each pathway. Input to this model includes the seepage flux into a drift. The seepage flux is potentially split by the drip shield, with some (or all) of the flux being diverted by the drip shield and some passing through breaches in the drip shield that might result from corrosion or seismic damage. The flux through drip shield breaches is potentially split by the waste package, with some (or all) of the flux being diverted by the waste package and some passing through waste package breaches that might result from corrosion or seismic damage. Neither the drip shield nor the waste package survives an igneous intrusion, so the flux splitting submodel is not used in the igneous scenario class. The flow model is validated in an independent model validation technical review. The drip shield and waste package flux splitting algorithms are developed and validated using experimental data. The transport

  9. Investigating the Potential Barrier Function of Nanostructured Materials Formed in Engineered Barrier Systems (EBS) Designed for Nuclear Waste Isolation.

    Science.gov (United States)

    Cuevas, Jaime; Ruiz, Ana Isabel; Fernández, Raúl

    2018-02-21

    Clay and cement are known nano-colloids originating from natural processes or traditional materials technology. Currently, they are used together as part of the engineered barrier system (EBS) to isolate high-level nuclear waste (HLW) metallic containers in deep geological repositories (DGR). The EBS should prevent radionuclide (RN) migration into the biosphere until the canisters fail, which is not expected for approximately 10 3  years. The interactions of cementitious materials with bentonite swelling clay have been the scope of our research team at the Autonomous University of Madrid (UAM) with participation in several European Union (EU) projects from 1998 up to now. Here, we describe the mineral and chemical nature and microstructure of the alteration rim generated by the contact between concrete and bentonite. Its ability to buffer the surrounding chemical environment may have potential for further protection against RN migration. © 2018 The Chemical Society of Japan & Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. Ground-Based Global Navigation Satellite System (GNSS) GLONASS Broadcast Ephemeris Data (hourly files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) GLObal NAvigation Satellite System (GLONASS) Broadcast Ephemeris Data (hourly files)...

  11. Ground-Based Global Navigation Satellite System (GNSS) GLONASS Broadcast Ephemeris Data (daily files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) GLObal NAvigation Satellite System (GLONASS) Broadcast Ephemeris Data (daily files)...

  12. Satellite broadcasting

    Science.gov (United States)

    Gregory, D.; Rainger, P.; Harvey, R. V.; Jennings, A.

    Questions related to direct broadcasting satellites are addressed with attention given to celestial mechanics, synchronous orbits, propagation, international plans, domestic installation, related laws and system costs. The role of the World Administrative Planning Conference (WARC) organization is discussed and contrasted with that of the regional administrative radio conference. Topics related to the field of law include coverage and overspill, regulation and control, copyrights and international organizations. Alternative ways of estimating direct broadcasting system costs are presented with consideration given to satellite costs as a function of mass, launch costs and system costs as a function of power.

  13. Synchronous Design and Test of Distributed Passive Radar Systems Based on Digital Broadcasting and Television

    Directory of Open Access Journals (Sweden)

    Wan Xianrong

    2017-02-01

    Full Text Available Digital broadcasting and television are important classes of illuminators of opportunity for passive radars. Distributed and multistatic structure are the development trends for passive radars. Most modern digital broadcasting and television systems work on a network, which not only provides a natural condition to distributed passive radar but also puts forward higher requirements on the design of passive radar systems. Among those requirements, precise synchronization among the receivers and transmitters as well as among multiple receiving stations, which mainly involves frequency and time synchronization, is the first to be solved. To satisfy the synchronization requirements of distributed passive radars, a synchronization scheme based on GPS is presented in this paper. Moreover, an effective scheme based on the China Mobile Multimedia Broadcasting signal is proposed to test the system synchronization performance. Finally, the reliability of the synchronization design is verified via the distributed multistatic passive radar experiments.

  14. New Generation of Broadcasting Satellite Systems: New Markets and Business Developments

    Science.gov (United States)

    Perrot, Bruno; Michel, Cyril; Villaret, Stéfanie

    2002-01-01

    Since the deployment of the first Digital Broadcasting Satellite Systems, European satellite operators and service providers have been faced with the continuously increasing demand for Digital Broadcasting Services. Their success is built on the availability of the MPEG and DVB standards. Undoubtedly, conventional digital television broadcasting is today the `Killer' application. Various service providers already offer multimedia applications through DVB-S systems based upon the `Push' technology. Although these services do not currently represent the core business for broadcasting satellite operators, their percentage is increasing. `Push' technology services include Data Carousel, Webcasting, Turbo Internet, File casting and so on. Such technology can support the implementation of different emerging multimedia services scenarios from Newsgroups, Network collaborative learning, and tele-medicine, to others that may be invented in the near future. The penetration rate of multi-channel television reception is still increasing. Broadcasting satellites benefit both from the development of new, more segmented and sophisticated offers and from the development of Internet services. Satellite is likely to enter these new markets at different levels of the value chain: Even if the satellite has demonstrated its capacity to fully serve the television, combinations with other networks may be necessary to address the new markets: at the consumer premises, Internet-related services will require a return path; at the backbone level, satellite becomes a component of a full telecommunications solution. This article focuses on the European market and proposes:

  15. MIT-QCRI Arabic Dialect Identification System for the 2017 Multi-Genre Broadcast Challenge

    OpenAIRE

    Shon, Suwon; Ali, Ahmed; Glass, James

    2017-01-01

    In order to successfully annotate the Arabic speech con- tent found in open-domain media broadcasts, it is essential to be able to process a diverse set of Arabic dialects. For the 2017 Multi-Genre Broadcast challenge (MGB-3) there were two possible tasks: Arabic speech recognition, and Arabic Dialect Identification (ADI). In this paper, we describe our efforts to create an ADI system for the MGB-3 challenge, with the goal of distinguishing amongst four major Arabic dialects, as well as Moder...

  16. Carrier phase synchronization system for improved amplitude modulation and television broadcast reception

    Science.gov (United States)

    Smith, Stephen F [Loudon, TN; Moore, James A [Powell, TN

    2011-02-01

    Systems and methods are described for carrier phase synchronization for improved AM and TV broadcast reception. A method includes synchronizing the phase of a carrier frequency of a broadcast signal with the phase of a remote reference frequency. An apparatus includes a receiver to detect the phase of a reference signal; a phase comparator coupled to the reference signal-phase receiver; a voltage controlled oscillator coupled to the phase comparator; and a phase-controlled radio frequency output coupled to the voltage controlled oscillator.

  17. Carrier phase synchronization system for improved amplitude modulation and television broadcast reception

    Science.gov (United States)

    Smith, Stephen F [Loudon, TN; Moore, James A [Powell, TN

    2009-09-08

    Systems and methods are described for carrier phase synchronization for improved AM and TV broadcast reception. A method includes synchronizing the phase of a carrier frequency of a broadcast signal with the phase of a remote reference frequency. An apparatus includes a receiver to detect the phase of a reference signal; a phase comparator coupled to the reference signal-phase receiver; a voltage controlled oscillator coupled to the phase comparator; and a phase-controlled radio frequency output coupled to the voltage controlled oscillator.

  18. The ISPI HPT Model Applied to a University Television Broadcast System Upgrade

    Science.gov (United States)

    Bobbert, Dana; Robinson, Michael; Martin, Florence

    2012-01-01

    This is a case study describing the application of the traditional ISPI [International Society for Performance Improvement] human performance technology (HPT) model at CHWK, a campus television channel broadcast from a southeastern American university cable system. CHWK's issues with delivery options, labor-intense work flow, and continual staff…

  19. System Level Evaluation of Innovative Coded MIMO-OFDM Systems for Broadcasting Digital TV

    Directory of Open Access Journals (Sweden)

    Y. Nasser

    2008-01-01

    Full Text Available Single-frequency networks (SFNs for broadcasting digital TV is a topic of theoretical and practical interest for future broadcasting systems. Although progress has been made in the characterization of its description, there are still considerable gaps in its deployment with MIMO technique. The contribution of this paper is multifold. First, we investigate the possibility of applying a space-time (ST encoder between the antennas of two sites in SFN. Then, we introduce a 3D space-time-space block code for future terrestrial digital TV in SFN architecture. The proposed 3D code is based on a double-layer structure designed for intercell and intracell space time-coded transmissions. Eventually, we propose to adapt a technique called effective exponential signal-to-noise ratio (SNR mapping (EESM to predict the bit error rate (BER at the output of the channel decoder in the MIMO systems. The EESM technique as well as the simulations results will be used to doubly check the efficiency of our 3D code. This efficiency is obtained for equal and unequal received powers whatever is the location of the receiver by adequately combining ST codes. The 3D code is then a very promising candidate for SFN architecture with MIMO transmission.

  20. Ground-Based Global Navigation Satellite System (GNSS) SBAS Broadcast Ephemeris Data (sub-hourly files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) Satellite-Based Augmentation System (SBAS) Broadcast Ephemeris Data (sub-hourly...

  1. Ground-Based Global Navigation Satellite System (GNSS) QZSS Broadcast Ephemeris Data (daily files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) Quasi-Zenith Satellite System (QZSS) Broadcast Ephemeris Data (daily files) from the...

  2. Ground-Based Global Navigation Satellite System (GNSS) QZSS Broadcast Ephemeris Data (sub-hourly files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) Quasi-Zenith Satellite System (QZSS) Broadcast Ephemeris Data (sub-hourly files) from...

  3. Ground-Based Global Navigation Satellite System (GNSS) SBAS Broadcast Ephemeris Data (daily files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) Satellite-Based Augmentation System (SBAS) Broadcast Ephemeris Data (daily files)...

  4. Ground-Based Global Navigation Satellite System (GNSS) GLONASS Broadcast Ephemeris Data (sub-hourly files) from NASA CDDIS - Cloned

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) GLObal NAvigation Satellite System (GLONASS) Broadcast Ephemeris Data (sub-hourly...

  5. Ground-Based Global Navigation Satellite System (GNSS) QZSS Broadcast Ephemeris Data (hourly files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) Quasi-Zenith Satellite System (QZSS) Broadcast Ephemeris Data (hourly files) from the...

  6. Ground-Based Global Navigation Satellite System (GNSS) SBAS Broadcast Ephemeris Data (hourly files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) Satellite-Based Augmentation System (SBAS) Broadcast Ephemeris Data (hourly files)...

  7. Asynchronous broadcast for ordered delivery between compute nodes in a parallel computing system where packet header space is limited

    Science.gov (United States)

    Kumar, Sameer

    2010-06-15

    Disclosed is a mechanism on receiving processors in a parallel computing system for providing order to data packets received from a broadcast call and to distinguish data packets received at nodes from several incoming asynchronous broadcast messages where header space is limited. In the present invention, processors at lower leafs of a tree do not need to obtain a broadcast message by directly accessing the data in a root processor's buffer. Instead, each subsequent intermediate node's rank id information is squeezed into the software header of packet headers. In turn, the entire broadcast message is not transferred from the root processor to each processor in a communicator but instead is replicated on several intermediate nodes which then replicated the message to nodes in lower leafs. Hence, the intermediate compute nodes become "virtual root compute nodes" for the purpose of replicating the broadcast message to lower levels of a tree.

  8. Radio broadcasting via satellite

    Science.gov (United States)

    Helm, Neil R.; Pritchard, Wilbur L.

    1990-10-01

    Market areas offering potential for future narrowband broadcast satellites are examined, including international public diplomacy, government- and advertising-supported, and business-application usages. Technical issues such as frequency allocation, spacecraft types, transmission parameters, and radio receiver characteristics are outlined. Service and system requirements, advertising revenue, and business communications services are among the economic issues discussed. The institutional framework required to provide an operational radio broadcast service is studied, and new initiatives in direct broadcast audio radio systems, encompassing studies, tests, in-orbit demonstrations of, and proposals for national and international commercial broadcast services are considered.

  9. Ground-Based Global Navigation Satellite System (GNSS) Galileo Broadcast Ephemeris Data (sub-hourly files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) Galileo Broadcast Ephemeris Data (sub-hourly files) from the NASA Crustal Dynamics...

  10. Ground-Based Global Navigation Satellite System Mixed Broadcast Ephemeris Data (sub-hourly files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) Mixed Broadcast Ephemeris Data (sub-hourly files) from the NASA Crustal Dynamics Data...

  11. Ground-Based Global Navigation Satellite System (GNSS) GPS Broadcast Ephemeris Data (hourly files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) GPS Broadcast Ephemeris Data (hourly files) from the NASA Crustal Dynamics Data...

  12. Ground-Based Global Navigation Satellite System (GNSS) Beidou Broadcast Ephemeris Data (sub-hourly files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) Beidou Broadcast Ephemeris Data (sub-hourly files) from the NASA Crustal Dynamics...

  13. Ground-Based Global Navigation Satellite System (GNSS) Galileo Broadcast Ephemeris Data (daily files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) Galileo Broadcast Ephemeris Data (daily files) from the NASA Crustal Dynamics Data...

  14. Ground-Based Global Navigation Satellite System (GNSS) GPS Broadcast Ephemeris Data (sub-hourly files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) GPS Broadcast Ephemeris Data (sub-hourly files) from the NASA Crustal Dynamics Data...

  15. Ground-Based Global Navigation Satellite System (GNSS) Beidou Broadcast Ephemeris Data (hourly files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) Beidou Broadcast Ephemeris Data (hourly files) from the NASA Crustal Dynamics Data...

  16. Ground-Based Global Navigation Satellite System (GNSS) GPS Broadcast Ephemeris Data (daily files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) GPS Broadcast Ephemeris Data (daily files) from the NASA Crustal Dynamics Data...

  17. Ground-Based Global Navigation Satellite System (GNSS) Beidou Broadcast Ephemeris Data (daily files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) Beidou Broadcast Ephemeris Data (daily files) from the NASA Crustal Dynamics Data...

  18. Ground-Based Global Navigation Satellite System (GNSS) Galileo Broadcast Ephemeris Data (hourly files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) Galileo Broadcast Ephemeris Data (hourly files) from the NASA Crustal Dynamics Data...

  19. The VISTA Speech Enhancement System for AM Radio Broadcasting

    Science.gov (United States)

    1990-01-29

    system was subjected to listening tests using an extensive data base (; 10’s of minutes) and was found to be generally natural and free of artifacts...histogram method, Is computed and, it and the new processed spech file are transferred back to the host in non-real-time. The procedure is then repeated

  20. The Effect of Two Receivers on Broadcast Molecular Communication Systems.

    Science.gov (United States)

    Lu, Yi; Higgins, Matthew D; Noel, Adam; Leeson, Mark S; Chen, Yunfei

    2016-12-01

    Molecular communication is a paradigm that utilizes molecules to exchange information between nano-machines. When considering such systems where multiple receivers are present, prior work has assumed for simplicity that they do not interfere with each other. This paper aims to address this issue and shows to what extent an interfering receiver, [Formula: see text], will have an impact on the target receiver, [Formula: see text], with respect to Bit Error Rate (BER) and capacity. Furthermore, approximations of the Binomial distribution are applied to reduce the complexity of calculations. Results show the sensitivity in communication performance due to the relative location of the interfering receiver. Critically, placing [Formula: see text] between the transmitter [Formula: see text] and [Formula: see text] causes a significant increase in BER or decrease in capacity.

  1. Monitoring and control systems for an EB flue gas treatment pilot plant—Part II. PC based data acquisition system

    Science.gov (United States)

    Szlachciak, J.; Kupczak, R.; Obstój, I.; Płomiński, M.; Sowiński, M.; Uzdowski, M.; Chmielewski, A.; Peryt, W.

    The computer monitoring system applied in the electric and thermal power plant in Kawȩczyn is described. Requirements for a computer monitoring and control system in an industrial flue gas cleaning plant is also presented.

  2. TV Recommendation and Personalization Systems: Integrating Broadcast and Video On demand Services

    Directory of Open Access Journals (Sweden)

    SOARES, M.

    2014-02-01

    Full Text Available The expansion of Digital Television and the convergence between conventional broadcasting and television over IP contributed to the gradual increase of the number of available channels and on demand video content. Moreover, the dissemination of the use of mobile devices like laptops, smartphones and tablets on everyday activities resulted in a shift of the traditional television viewing paradigm from the couch to everywhere, anytime from any device. Although this new scenario enables a great improvement in viewing experiences, it also brings new challenges given the overload of information that the viewer faces. Recommendation systems stand out as a possible solution to help a watcher on the selection of the content that best fits his/her preferences. This paper describes a web based system that helps the user navigating on broadcasted and online television content by implementing recommendations based on collaborative and content based filtering. The algorithms developed estimate the similarity between items and users and predict the rating that a user would assign to a particular item (television program, movie, etc.. To enable interoperability between different systems, programs? characteristics (title, genre, actors, etc. are stored according to the TV-Anytime standard. The set of recommendations produced are presented through a Web Application that allows the user to interact with the system based on the obtained recommendations.

  3. Broadcasting house

    DEFF Research Database (Denmark)

    Sattrup, Peter Andreas

    2008-01-01

    Regarding the transformation of the Danish Broadcasting Hq. (1934-1945) in Frederiksberg by Vilhelm Lauritzen into the Royal Danish Academy of Music. Analysis, principles, flexibility and change.......Regarding the transformation of the Danish Broadcasting Hq. (1934-1945) in Frederiksberg by Vilhelm Lauritzen into the Royal Danish Academy of Music. Analysis, principles, flexibility and change....

  4. CERN alerter—RSS based system for information broadcast to all CERN offices

    Science.gov (United States)

    Otto, R.

    2008-07-01

    Nearly every large organization uses a tool to broadcast messages and information across the internal campus (messages like alerts announcing interruption in services or just information about upcoming events). These tools typically allow administrators (operators) to send 'targeted' messages which are sent only to specific groups of users or computers, e/g only those located in a specified building or connected to a particular computing service. CERN has a long history of such tools: CERNVMS's SPM_quotMESSAGE command, Zephyr [2] and the most recent the NICE Alerter based on the NNTP protocol. The NICE Alerter used on all Windows-based computers had to be phased out as a consequence of phasing out NNTP at CERN. The new solution to broadcast information messages on the CERN campus continues to provide the service based on cross-platform technologies, hence minimizing custom developments and relying on commercial software as much as possible. The new system, called CERN Alerter, is based on RSS (Really Simple Syndication) [9] for the transport protocol and uses Microsoft SharePoint as the backend for database and posting interface. The windows-based client relies on Internet Explorer 7.0 with custom code to trigger the window pop-ups and the notifications for new events. Linux and Mac OS X clients could also rely on any RSS readers to subscribe to targeted notifications. The paper covers the architecture and implementation aspects of the new system.

  5. CERN Alerter - RSS based system for information broadcast to all CERN offices

    CERN Document Server

    Otto, R

    2008-01-01

    Nearly every large organization uses a tool to broadcast messages and information across the internal campus (messages like alerts announcing interruption in services or just information about upcoming events). These tools typically allow administrators (operators) to send "targeted" messages which are sent only to specific groups of users or computers, e/g only those located in a specified building or connected to a particular computing service. CERN has a long history of such tools: CERNVMS's SPM_quotMESSAGE command, Zephyr [2] and the most recent the NICE Alerter based on the NNTP protocol. The NICE Alerter used on all Windows-based computers had to be phased out as a consequence of phasing out NNTP at CERN. The new solution to broadcast information messages on the CERN campus continues to provide the service based on cross-platform technologies, hence minimizing custom developments and relying on commercial software as much as possible. The new system, called CERN Alerter, is based on RSS (Really Simple S...

  6. Digital terrestrial experimental television broadcasting studio system; Chijo digital jikken hoso soshutsu kiki

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-03-01

    Ahead of the start of the full digital terrestrial broadcasting scheduled for fiscal 2003, the Ministry of Posts and Telecommunications structured experimental systems in seven areas over the nation's land. The Company has received orders for four areas, and developed and supplied the pieces of equipment and devices. The system consists mainly of the following components: (1) an encoder to compress image signals into the moving picture experts Group 2 (MPEG2) signals; (2) a rate-free matrix to select signals for images and MPEG2 signals (an assembly of changeover switches); (3) a multiplexing device to multiplex MPEG2 signals; (4) a multi-rate server to accumulate and regenerate the MPEG2 signals; (5) an orthogonal frequency division multiplex (OFDM) modulator to modulate the multiplexed MPEG2 signals; (6) a splicer to switch the MPEG2 signals without interruption; and (7) an integrated control system to control MPEG2 devices. (translated by NEDO)

  7. Subjective and Objective Assessment of Perceived Audio Quality of Current Digital Audio Broadcasting Systems and Web-Casting Applications

    NARCIS (Netherlands)

    Pocta, P.; Beerends, J.G.

    2015-01-01

    This paper investigates the impact of different audio codecs typically deployed in current digital audio broadcasting (DAB) systems and web-casting applications, which represent a main source of quality impairment in these systems and applications, on the quality perceived by the end user. Both

  8. 47 CFR 73.756 - System specifications for double-sideband (DBS) modulated emissions in the HF broadcasting service.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false System specifications for double-sideband (DBS) modulated emissions in the HF broadcasting service. 73.756 Section 73.756 Telecommunication FEDERAL... Stations § 73.756 System specifications for double-sideband (DBS) modulated emissions in the HF...

  9. 47 CFR 73.757 - System specifications for single-sideband (SSB) modulated emissions in the HF broadcasting service.

    Science.gov (United States)

    2010-10-01

    ...) modulated emissions in the HF broadcasting service. 73.757 Section 73.757 Telecommunication FEDERAL... Stations § 73.757 System specifications for single-sideband (SSB) modulated emissions in the HF.... Note 2 to paragraph (b)(2): The SSB system adopted for the bands allocated exclusively to HF...

  10. Ground-Based Global Navigation Satellite System GLONASS (GLObal NAvigation Satellite System) Combined Broadcast Ephemeris Data (daily files) from NASA CDDIS

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset consists of ground-based Global Navigation Satellite System (GNSS) GLONASS Combined Broadcast Ephemeris Data (daily files of all distinct navigation...

  11. EB Frond wave energy converter - phase 2

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    The EB Frond project is a wave energy programme developed by The Engineering Business (EB) from an original idea at Lancaster University. The EB Frond is a wave generator with a collector vane on top of an arm that pivots near the seabed. Phase 1 of the project demonstrated the technical feasibility of the project and provided proof of concept. Phase 2 involved further assesment of the technical and commercial viability of the concept through the development of mathematical and physical modelling methods. The work involved small-scale (1/25th) testing in wave tanks at Newcastle and Lancaster Universities and the development, verification and validation of a time domain mathematical model. The decision by EB to put on hold its renewable generation programme meant that plans to test at an intermediate scale (1/16th), assess different survival strategies in extreme wave conditions, carry out site characterisation for full-scale systems and to produce a robust economic model were not fulfilled. However, the mathematical and physical modelling work was used to develop an economic model for the Frond system. This produced a predicted unit cost of electricity by a pre-commercial 5 MW demonstration farm of about 17 pence/kWh. The report discusses the small-scale testing, test results, mathematical modelling, analysis and interpretation, survivability, the economic model and the development route to full-scale production.

  12. Application of EB in Japan

    Energy Technology Data Exchange (ETDEWEB)

    Sunaga, Hiromi [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment

    2003-02-01

    Radiation processing using electron beam (EB) facilities other than gamma-ray facilities in Japan is introduced. After briefly presented the features of EB compared with gamma ray, present status of EB application is described. Polymerized materials for use of wire, cable, radial tire, heat shrinkable tube, foam polyethylene, PTFE, battery separator, and adsorbent material are known to be resulting from cross-linking, decomposition, and graft polymerization reactions. Environmental preservation includes electron flue gas treatment in the coal- or oil-fired power plants, research for volatile organic compounds (VOC) and dioxins, as well as wastewater and sludge treatment. Finally activity of JAERI in the related fields is overviewed with the authors prospects for utilization of low energy EB with low cost for surface treatment and functional materials. (S. Ohno)

  13. Hadamard quantum broadcast channels

    Science.gov (United States)

    Wang, Qingle; Das, Siddhartha; Wilde, Mark M.

    2017-10-01

    We consider three different communication tasks for quantum broadcast channels, and we determine the capacity region of a Hadamard broadcast channel for these various tasks. We define a Hadamard broadcast channel to be such that the channel from the sender to one of the receivers is entanglement-breaking and the channel from the sender to the other receiver is complementary to this one. As such, this channel is a quantum generalization of a degraded broadcast channel, which is well known in classical information theory. The first communication task we consider is classical communication to both receivers, the second is quantum communication to the stronger receiver and classical communication to other, and the third is entanglement-assisted classical communication to the stronger receiver and unassisted classical communication to the other. The structure of a Hadamard broadcast channel plays a critical role in our analysis: The channel to the weaker receiver can be simulated by performing a measurement channel on the stronger receiver's system, followed by a preparation channel. As such, we can incorporate the classical output of the measurement channel as an auxiliary variable and solve all three of the above capacities for Hadamard broadcast channels, in this way avoiding known difficulties associated with quantum auxiliary variables.

  14. Effect of precipitation, sorption and stable of isotope on maximum release rates of radionuclides from engineered barrier system (EBS) in deep repository.

    Science.gov (United States)

    Malekifarsani, A; Skachek, M A

    2009-10-01

    The basic function of the engineered barrier system (EBS) in geological disposal is to prevent or limit the release of radionuclides into the underground environment. For this purpose, the vitrified waste is contained in an overpack to isolate it from contact with groundwater for a certain initial period of time. However, it is impossible to ensure complete containment for all time. Therefore, the eventual release of nuclides must be minimized after the overpack fails (AEC, 1984. Radioactive waste processing and disposal measures; JNC, 2000a. Project to establish the scientific and technical basis for HLW disposal in Japan--first progress report-H3. Geological Environment in Japan, JNC TN1410 2000-002; JNC, 2000b. H12: project to establish the scientific and technical basis for HLW disposal in Japan--repository design and engineering technology, JNC TN1410 2000-003.). Low-permeability buffer material is installed between the overpack and the host rock to ensure that radionuclide release from the vitrified waste is limited by diffusive transport rather than advective transport in groundwater. Nuclides released from the waste form precipitate when their concentrations in the porewater result in their elemental solubility limits being exceeded. This limits the concentrations of many nuclides in the buffer and thus limits the release rates to the surrounding rock. High sorption coefficients act to delay the transport of certain nuclides during their migration through the buffer (PNC, development and management of the technical knowledge base for the geological disposal of HLW. Supporting report 2: repository engineering technology). The presence of isotopes of the same element has the effect of reducing the effective solubility of some nuclides; a lower nuclide concentration is required for precipitation to occur if the presence of any isotopes of the same element is taken into account. The calculated release rates of radionuclides from the EBS (per waste package) are

  15. Broadcast Stylebook.

    Science.gov (United States)

    United Press International, New York, NY.

    This booklet deals with the unique problem of writing and preparing news for the electronic media where it will be presented orally. The contents of this monograph include "The United Press International Broadcast Newswire,""The United Press International Audio Network,""Broadcast…

  16. Standard practice for prediction of the long-term behavior of materials, including waste forms, used in engineered barrier systems (EBS) for geological disposal of high-level radioactive waste

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2007-01-01

    1.1 This practice describes test methods and data analyses used to develop models for the prediction of the long-term behavior of materials, such as engineered barrier system (EBS) materials and waste forms, used in the geologic disposal of spent nuclear fuel (SNF) and other high-level nuclear waste in a geologic repository. The alteration behavior of waste form and EBS materials is important because it affects the retention of radionuclides by the disposal system. The waste form and EBS materials provide a barrier to release either directly (as in the case of waste forms in which the radionuclides are initially immobilized), or indirectly (as in the case of containment materials that restrict the ingress of groundwater or the egress of radionuclides that are released as the waste forms and EBS materials degrade). 1.1.1 Steps involved in making such predictions include problem definition, testing, modeling, and model confirmation. 1.1.2 The predictions are based on models derived from theoretical considerat...

  17. Native Radio Broadcasting in North America: An Overview of Systems in the United States and Canada.

    Science.gov (United States)

    Smith, Bruce L.; Brigham, Jerry C.

    1992-01-01

    Describes a study that examined the development of Native American (i.e., Indian, Inuit or Eskimo, and Aleut) radio broadcasting in Canada and the United States. Underlying cultural concerns are discussed, funding sources are explored, and further research is suggested. A directory of Native American radio stations in the United States is…

  18. Naval Communications Processing and Routing System (NAVCOMPARS): A Model for Broadcast Performance Analysis.

    Science.gov (United States)

    1983-03-01

    WORDS (e.,EM..e an Mouw. aide.i moseemor.am ~ Idmivilf by block rnhwe) NAVCOMPARS; Queuing Theory ; Multichannel Broadcast 201 ITRACT (ca~eeiu. on tvrs...by TPS, zo: = scord 9u:pcse:s. 26 A. H!SSIGE INPUT RATE in crder to determine a charactzeris:iJc mssage inpu- rate, statistics were examinsd at the

  19. The Puerto Rico Seismic Network Broadcast System: A user friendly GUI to broadcast earthquake messages, to generate shakemaps and to update catalogues

    Science.gov (United States)

    Velez, J.; Huerfano, V.; von Hillebrandt, C.

    2007-12-01

    The Puerto Rico Seismic Network (PRSN) has historically provided locations and magnitudes for earthquakes in the Puerto Rico and Virgin Islands (PRVI) region. PRSN is the reporting authority for the region bounded by latitudes 17.0N to 20.0N, and longitudes 63.5W to 69.0W. The main objective of the PRSN is to record, process, analyze, provide information and research local, regional and teleseismic earthquakes, providing high quality data and information to be able to respond to the needs of the emergency management, academic and research communities, and the general public. The PRSN runs Earthworm software (Johnson et al, 1995) to acquire and write waveforms to disk for permanent archival. Automatic locations and alerts are generated for events in Puerto Rico, the Intra America Seas, and the Atlantic by the EarlyBird system (Whitmore and Sokolowski, 2002), which monitors PRSN stations as well as some 40 additional stations run by networks operating in North, Central and South America and other sites in the Caribbean. PRDANIS (Puerto Rico Data Analysis and Information System) software, developed by PRSN, supports manual locations and analyst review of automatic locations of events within the PRSN area of responsibility (AOR), using all the broadband, strong-motion and short-period waveforms Rapidly available information regarding the geographic distribution of ground shaking in relation to the population and infrastructure at risk can assist emergency response communities in efficient and optimized allocation of resources following a large earthquake. The ShakeMap system developed by the USGS provides near real-time maps of instrumental ground motions and shaking intensity and has proven effective in rapid assessment of the extent of shaking and potential damage after significant earthquakes (Wald, 2004). In Northern and Southern California, the Pacific Northwest, and the states of Utah and Nevada, ShakeMaps are used for emergency planning and response, loss

  20. Long Baseline (Transoceanic) Surveying Using the Global Positioning System and Its Broadcast Ephemeris.

    Science.gov (United States)

    1982-09-01

    G)(1 In Equation j1), Pc Is the corresponding calculated range determined from the GPS broadcast ephemeris, the assumed site location, and the...B. Data whose A of Equation (1) differed from the A at the previous time epoch by more than 0.5 m were deleted. Also, if the consecutive good data did...90009 1 University of Colorado Boulder, CO 80302 1 AFGL-PHP Hanscom AFB Magnavox Research Laboratory Attn: Jack Klobuchar 1 2829 Moricopa St. Bedford, MA

  1. Comparative analysis of three ionospheric broadcast models for global navigation satellite systems

    Science.gov (United States)

    Li, Shuhui; Li, Lihua; Wang, Shuqing; Peng, Junhuan; Xu, Yujian; Zhao, Yaohui

    2017-04-01

    An ionospheric model and corresponding coefficients broadcasted via GNSS navigation message are generally used to estimate the time delay for single-frequency GNSS users. In this article, the capabilities of three ionospheric models, namely, Klobuchar model, NeQuick Galileo version (NeQuick G), and Neustrelitz TEC broadcast model (NTCM-BC), were assessed. The models were examined in two aspects: total electron content (TEC) prediction and ionospheric delay correction effects in single-point positioning. Results show that both NeQuick G and NTCM-BC models outperformed Klobuchar model for predicting global TEC values during all the test days. Compared with Slant TEC (STEC) along the receiver-to-satellite ray path derived from IGS global ionosphere map (GIMs), STEC from NeQuick G and NTCM-BC models tend to have less bias than those from Klobuchar model in most situations. The point positioning results were improved by applying ionospheric broadcast models especially at the mid- and low-latitude stations.

  2. Next generation mobile broadcasting

    CERN Document Server

    Gómez-Barquero, David

    2013-01-01

    Next Generation Mobile Broadcasting provides an overview of the past, present, and future of mobile multimedia broadcasting. The first part of the book-Mobile Broadcasting Worldwide-summarizes next-generation mobile broadcasting technologies currently available. This part covers the evolutions of the Japanese mobile broadcasting standard ISDB-T One-Seg, ISDB-Tmm and ISDB-TSB; the evolution of the South Korean T-DMB mobile broadcasting technology AT-DMB; the American mobile broadcasting standard ATSC-M/H; the Chinese broadcasting technologies DTMB and CMMB; second-generation digital terrestrial

  3. EB1 and EB3 promote cilia biogenesis by several centrosome-related mechanisms

    DEFF Research Database (Denmark)

    Schrøder, Jacob M; Larsen, Jesper; Komarova, Yulia

    2011-01-01

    surrounded by vesicles. Further, GST pull-down assays, mass spectrometry and immunoprecipitation indicated that EB1 and EB3 interact with proteins implicated in MT minus-end anchoring or vesicular trafficking to the cilia base, suggesting that EB1 and EB3 promote ciliogenesis by facilitating such trafficking...

  4. Improvement of unified mask data formats for EB writers

    Science.gov (United States)

    Suzuki, Toshio; Hirumi, Junji; Yoshioka, Nobuyuki; Hojyo, Yutaka; Kawase, Yuichi; Hara, Shigehiro; Kuriyama, Koki; Hoga, Morihisa; Watanabe, Satoshi W.; Kawase, Hidemichi; Kamimoto, Tomoko; Kato, Kokoro

    2004-08-01

    Mask data preparation (MDP) is a complicated process because many kinds of EB data files and jobdeck data files are used in mask manufacturers and EB data files continue to become bigger. Therefore we have developed unified mask data formats for Variable-Shaped-Beam (VSB) EB writers with efficient data compaction. The unified mask data formats are composed of a pattern data format for EB writers named "NEO" and a layout format named "MALY". We released NEO and MALY on April 2003. To evaluate NEO and MALY, we have made a prototype system of MDP such as a converter from design data to NEO/MALY and converters from NEO/MALY to each EB data. We have evaluated about functions and performance of the MDP flow using real design data in device manufacturers. As a result, some improvements in NEO and MALY were achieved and we have revised the specification of NEO and MALY as the final version. We have confirmed that NEO and MALY can be used for a set of unified mask data formats among VSB EB writers and can reduce complexity of mask data handling in mask manufacturers. They will be put to practical use in MDP flow.

  5. Socio-Economic Aspects of National Communication Systems. I. Radio Broadcasting in Austria. Communication and Society, 10.

    Science.gov (United States)

    Signitzer, Benno; Luger, Kurt

    The first in a series that examines the role of radio broadcasting in the process of socioeconomic and cultural change in three countries with different types of broadcasting organization--Austria, Czechoslovakia, and Venezuela--this volume focuses on Austria. It deals with the cultural implications of broadcasting structures and their ownership…

  6. Socio-Economic Aspects of National Communication Systems: II. Radio Broadcasting in Czechoslovakia. Communication and Society, 11.

    Science.gov (United States)

    Bunzlova, Alice; Slovak, Leopold

    The second in a series that examines the role of radio broadcasting in the process of socioeconomic and cultural change in three countries with different types of broadcasting organization--Austria, Czechoslovakia, and Venezuela--this volume focuses on Czechoslovakia. It deals with the cultural implications of broadcasting structures and their…

  7. Socio-Economic Aspects of National Communication Systems: III. Radio Broadcasting in Venezuela. Communication and Society, 12.

    Science.gov (United States)

    Capriles, Oswaldo; And Others

    The third in a series that examines the role of radio broadcasting in the process of socioeconomic and cultural change in three countries with different types of broadcasting organization--Austria, Czechoslovakia, and Venezuela--this volume focuses on Venezuela. An overview of radio broadcasting in Venezuela describes various aspects and provides…

  8. Between Mediation and Mediatisation: Identity Dynamics at Play in Online Self-Publishing [Self-Broadcasting] Systems

    Directory of Open Access Journals (Sweden)

    Anabelle KLEIN

    2010-01-01

    Full Text Available Based on research conducted in Belgium for ten years on the identity dynamics within online self-publishing, self-broadcasting systems, this paper examines the extent to which the ongoing age of self-publishing follows a twofold logic of Self-Mediation and Self-Mediatization. After proposing a specific definition of the latter two concepts, the concept of “extimacy” will be implemented to shed light on the dynamics of Self-Mediation and Self-Mediatisation.

  9. Experience with glycol-cooling-systems in broadcasting vehicles; Erfahrungen beim Einsatz eines Glykol-Klimasystems in Fernsehuebertragungswagen

    Energy Technology Data Exchange (ETDEWEB)

    Ebinger, I.; Pieper, W. [NOSKE-KAESER GmbH, Hamburg (Germany); Bumb, G. [Karosseriewerk Kraemer GmbH, Gross-Gerau (Germany)

    2004-05-01

    Broadcasting Vehicles are equipped with highly sensible technology. Due to the extremely fast development in the electronic sector the number of installed units in these vehicles (as well as installed heat loads) is permanently increasing. High quantities of heat loads must be compensated in small interior spaces. At the same time the vehicles are also working places for the staff. For these people it is essential to have a comfortable climate. The experience with Glycol-cooling-systems in Braodcasting Vehicles is presented in this article. (orig.)

  10. Financing Public Service Broadcasting

    DEFF Research Database (Denmark)

    Berg, Christian Edelvold; Lund, Anker Brink

    2012-01-01

    Recently several European countries have abolished the traditional public service licence fee system, replacing it with direct public funding. But except for Iceland, the Nordic countries have not followed suit. The article discusses this development within a comparative framework of Public Service...... Broadcasting (PSB) financing regimes in Europe, concluding that Denmark, Finland, Iceland, Norway, and Sweden may still be considered conventional, licence fee PSB countries, but with some interesting differences in relation to competitive and market oriented alternatives of resource provision...

  11. Gossip-Based Broadcast

    Science.gov (United States)

    Leitão, João; Pereira, José; Rodrigues, Luís

    Gossip, or epidemic, protocols have emerged as a powerful strategy to implement highly scalable and resilient reliable broadcast primitives on large scale peer-to-peer networks. Epidemic protocols are scalable because they distribute the load among all nodes in the system and resilient because they have an intrinsic level of redundancy that masks node and network failures. This chapter provides an introduction to gossip-based broadcast on large-scale unstructured peer-to-peer overlay networks: it surveys the main results in the field, discusses techniques to build and maintain the overlays that support efficient dissemination strategies, and provides an in-depth discussion and experimental evaluation of two concrete protocols, named HyParView and Plumtree.

  12. Mobile Communication Networks and Digital Television Broadcasting Systems in the Same Frequency Bands – Advanced Co-Existence Scenarios

    Directory of Open Access Journals (Sweden)

    L. Polak

    2014-04-01

    Full Text Available The increasing demand for wireless multimedia services provided by modern communication systems with stable services is a key feature of advanced markets. On the other hand, these systems can many times operate in a neighboring or in the same frequency bands. Therefore, numerous unwanted co-existence scenarios can occur. The aim of this paper is to summarize our results which were achieved during exploration and measurement of the co-existences between still used and upcoming mobile networks (from GSM to LTE and digital terrestrial television broadcasting (DVB systems. For all of these measurements and their evaluation universal measurement testbed has been proposed and used. Results presented in this paper are a significant part of our activities in work package WP5 in the ENIAC JU project “Agile RF Transceivers and Front-Ends for Future Smart Multi-Standard Communications Applications (ARTEMOS”.

  13. Automatic Dependent Surveillance Broadcast (ADS-B) System for Ownership and Traffic Situational Awareness

    Science.gov (United States)

    Arteaga, Ricardo A. (Inventor)

    2016-01-01

    The present invention proposes an automatic dependent surveillance broadcast (ADS-B) architecture and process, in which priority aircraft and ADS-B IN traffic information are included in the transmission of data through the telemetry communications to a remote ground control station. The present invention further proposes methods for displaying general aviation traffic information in three and/or four dimension trajectories using an industry standard Earth browser for increased situation awareness and enhanced visual acquisition of traffic for conflict detection. The present invention enable the applications of enhanced visual acquisition of traffic, traffic alerts, and en-route and terminal surveillance used to augment pilot situational awareness through ADS-B IN display and information in three or four dimensions for self-separation awareness.

  14. Broadcasting in Mexico.

    Science.gov (United States)

    de Noriega, Luis Antonio; Leach, Frances

    This monograph traces the growth of Mexico's broadcasting services against the background of that country's geographical, cultural, demographic, economic, and political structures. Specific areas dealt with within the six chapters of the monograph are: (1) the national environment for broadcasting; (2) the advent and development of broadcasting in…

  15. Applied Anthropology in Broadcasting

    Science.gov (United States)

    Eiselein, E. B.

    1976-01-01

    Three different applied media anthropology projects are described. These projects stem from the broadcasters' legal need to know about the community (community ascertainment), the broadcasters' need to know about the station audience (audience profile), and the broadcasters' desire to change a community (action projects). (Author)

  16. Integrated Display and Simulation for Automatic Dependent Surveillance-Broadcast and Traffic Collision Avoidance System Data Fusion.

    Science.gov (United States)

    Wang, Yanran; Xiao, Gang; Dai, Zhouyun

    2017-11-13

    Automatic Dependent Surveillance-Broadcast (ADS-B) is the direction of airspace surveillance development. Research analyzing the benefits of Traffic Collision Avoidance System (TCAS) and ADS-B data fusion is almost absent. The paper proposes an ADS-B minimum system from ADS-B In and ADS-B Out. In ADS-B In, a fusion model with a variable sampling Variational Bayesian-Interacting Multiple Model (VSVB-IMM) algorithm is proposed for integrated display and an airspace traffic situation display is developed by using ADS-B information. ADS-B Out includes ADS-B Out transmission based on a simulator platform and an Unmanned Aerial Vehicle (UAV) platform. This paper describes the overall implementation of ADS-B minimum system, including theoretical model design, experimental simulation verification, engineering implementation, results analysis, etc. Simulation and implementation results show that the fused system has better performance than each independent subsystem and it can work well in engineering applications.

  17. Broadcast Network Coverage with Multicell Cooperation

    Directory of Open Access Journals (Sweden)

    Hongxiang Li

    2010-01-01

    Full Text Available Multicell cooperation has been identified as one of the underlying principles for future wireless communication systems. This paper studies the benefits of multicell cooperation in broadcast TV network from an information theoretical perspective. We define outage capacity as the figure of merit and derive the broadcast coverage area to evaluate such system. Specifically, we calculate the broadcast coverage area with given common information rate and outage probabilities when multiple base stations collaboratively transmit the broadcast signals. For the general MIMO case where receivers have multiple antennas, we provide simulation results to illustrate the expanded coverage area. In all cases, our results show that the coverage of a TV broadcast network can be significantly improved by multicell cooperation.

  18. 47 CFR 76.1506 - Carriage of television broadcast signals.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Carriage of television broadcast signals. 76.1506 Section 76.1506 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO... television broadcast signals. (a) The provisions of Subpart D shall apply to open video systems in accordance...

  19. 46 CFR 121.506 - Emergency broadcast placard.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Emergency broadcast placard. 121.506 Section 121.506... MISCELLANEOUS SYSTEMS AND EQUIPMENT Radio § 121.506 Emergency broadcast placard. A durable placard must be posted next to all radiotelephone installations with the emergency broadcast instructions and information...

  20. 46 CFR 121.510 - Recommended emergency broadcast instructions.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Recommended emergency broadcast instructions. 121.510... CONTROL AND MISCELLANEOUS SYSTEMS AND EQUIPMENT Radio § 121.510 Recommended emergency broadcast instructions. The following emergency broadcast instructions, when placed on a placard, will satisfy the...

  1. Co-existence of TV Broadcast and Wireless Systems for Public ...

    African Journals Online (AJOL)

    Akorede

    ABSTRACT: The spectrum sharing between primary TV systems (Channels 9 and 35) and Public Safety Networks. (PSNs) is ... the safety networks can co-exist with the TV systems without causing harmful interference with the suggested separation ... communication systems and management of relevant information.

  2. Technology Evaluation of Programmable Communicating Thermostats with Radio Broadcast Data System Communications

    Energy Technology Data Exchange (ETDEWEB)

    Herter, Karen; Wayland, Seth

    2008-10-31

    Programmable Communicating Thermostats are thermostats that can be programmed by the user to respond to signals indicating a grid-level system emergency or pricing event. The California Energy Commission is considering standards that would include a requirement for Programmable Communicating Thermostats in residential and small commercial applications. The current specification for Programmable Communicating Thermostats requires Radio Data System communications to Programmable Communicating Thermostats. This study tested the signal strength and reliability of Radio Data System signals at 40 customer sites within the Sacramento Municipal Utility District, which is serviced by 17 radio stations that already transmit Radio Data System signals. The study also tested the functionality of a commercially available Programmable Communicating Thermostat for compliance with California Energy Commission design standards. Test results demonstrated that Radio Data System is capable of reliably sending price and emergency signals. This study also provides evidence that existing Programmable Communicating Thermostats, on receiving a Radio Data System pricing or event signal, are capable of automatically increasing set points to a customer-determined or utility-determined level, thus providing air-conditioning demand response within seconds or just a few (less than 5) minutes.

  3. Educational Broadcasting--Radio.

    Science.gov (United States)

    Ahamed, Uvais; Grimmett, George

    This manual is intended for those who must conduct educational radio broadcasting training courses in Asia-Pacific countries without the resources of experienced personnel, as well as for individuals to use in self-learning situations. The selection of material has been influenced by the need to use broadcasting resources effectively in programs…

  4. Broadcast Coded Slotted ALOHA

    DEFF Research Database (Denmark)

    Ivanov, Mikhail; Brännström, Frederik; Graell i Amat, Alexandre

    2016-01-01

    We propose an uncoordinated medium access control (MAC) protocol, called all-to-all broadcast coded slotted ALOHA (B-CSA) for reliable all-to-all broadcast with strict latency constraints. In B-CSA, each user acts as both transmitter and receiver in a half-duplex mode. The half-duplex mode gives...

  5. 1972 Broadcasting Yearbook.

    Science.gov (United States)

    Broadcasting Publications, Inc., Washington, DC.

    The 1972 broadcasting yearbook provides complete information about the broadcast industry. An opening section offers a television (TV) directory, various TV statistics, such as demographics, distributions, sales, and rankings, which can be used for market strategies, and other useful information for those involved in communications. A section on…

  6. Trapping of normal EB1 ligands in aggresomes formed by an EB1 deletion mutant

    Directory of Open Access Journals (Sweden)

    Askham Jon M

    2005-04-01

    Full Text Available Abstract Background EB1 is a microtubule tip-associated protein that interacts with the APC tumour suppressor protein and the p150glued subunit of dynactin. We previously reported that an EB1 deletion mutant that retains both of these interactions but does not directly associate with microtubules (EB1-ΔN2-GFP spontaneously formed perinuclear aggregates when expressed in COS-7 cells. Results In the present study live imaging indicated that EB1-ΔN2-GFP aggregates underwent dynamic microtubule-dependent changes in morphology and appeared to be internally cohesive. EB1-ΔN2-GFP aggregates were phase-dense structures that displayed microtubule-dependent accumulation around the centrosome, were immunoreactive for both the 20s subunit of the proteasome and ubiquitin, and induced the collapse of the vimentin cytoskeleton. Fractionation studies revealed that a proportion of EB1-ΔN2-GFP was detergent-insoluble and ubiquitylated, indicating that EB1-ΔN2-GFP aggregates are aggresomes. Immunostaining also revealed that APC and p150glued were present in EB1-ΔN2-GFP aggregates, whereas EB3 was not. Furthermore, evidence for p150glued degradation was found in the insoluble fraction of EB1-ΔN2-GFP transfected cultures. Conclusion Our data indicate that aggresomes can be internally cohesive and may not represent a simple "aggregate of aggregates" assembled around the centrosome. Our observations also indicate that a partially misfolded protein may retain the ability to interact with its normal physiological ligands, leading to their co-assembly into aggresomes. This supports the idea that the trapping and degradation of co-aggregated proteins might contribute to human pathologies characterised by aggresome formation.

  7. Research on the Integration of IT Network Technology and TV Production and Broadcasting System

    Science.gov (United States)

    Zhang, Wenqing

    2017-12-01

    In recent years, based on the development of China’s economy and the progress of science and technology, China’s TV industry has made great progress and provided a new platform for residents to understand the social situation. In this situation, in order to protect the efficiency of the TV system and the steady improvement on quality, technical staff have strengthened the rational use of IT technology, and as a basis to promote the sound of television production system. Based on this, this paper focuses on the connotation of IT network technology, and discusses the integration of the design and TV production system, hoping to realize the sustainable development of China’s TV industry.

  8. Co-existence of TV broadcast and wireless systems for public safety ...

    African Journals Online (AJOL)

    The spectrum sharing between primary TV systems (Channels 9 and 35) and Public Safety Networks (PSNs) is presented in this article. The networks to be deployed within Television White Space (TVWS) in Ilorin metropolis of Kwara State operate on a secondary basis spatially, without causing harmful interference to ...

  9. Adaptive Data Broadcast in Hybrid Networks

    National Research Council Canada - National Science Library

    Stathatos, Konstantinos; Roussopoulos, Nick; Baras, John S

    1997-01-01

    .... The goal is to build highly scalable systems with small response time. In this paper, we describe a technique that continuously adapts the broadcast content to match the hot-spot of the workload...

  10. Exploiting the Automatic Dependent Surveillance-Broadcast System via False Target Injection

    Science.gov (United States)

    2012-03-01

    IEEE Xplore . 8. Hal Stoen. (2001) VFR Flight. Retrieved February 15, 2012 from http://stoenworks.com/vfr%20flight.html 9. Cohen, B., & Smith, A...7. Gilbert, G. (1973). Historical development of the air traffic control system. IEEE Transactions on Communications, 364-375. Retrieved from...1998. Proceedings., 17th DASC. the AIAA/ IEEE /SAE,2 F44/1- F44/8 vol.2. 10. Livack, G. S., McDaniel, J. I., Battiste, V., & Johnson, W. W. (2000

  11. Coordinated Broadcast-based Request-Reply and Group Management for Tightly-Coupled Wireless Systems

    OpenAIRE

    Koutsoubelias, Manos; Lalis, Spyros

    2016-01-01

    As the domain of cyber-physical systems continues to grow, an increasing number of tightly-coupled distributed applications will be implemented on top of wireless networking technologies. Some of these applications, including collaborative robotic teams, work in a coordinated fashion, whereby a distinguished node takes control decisions and sends commands to other nodes, which in turn perform the requested action/operation and send back a reply/acknowledgment. The implementation of such inter...

  12. Near field and altered zone environmental report Volume I: technical bases for EBS design

    Energy Technology Data Exchange (ETDEWEB)

    Wilder, D. G., LLNL

    1997-08-01

    This report presents an updated summary of results for the waste package (WP) and engineered barrier system (EBS) evaluations, including materials testing, waste-form characterization, EBS performance assessments, and near-field environment (NFE) characterization. Materials testing, design criteria and concept development, and waste-form characterization all require an understanding of the environmental conditions that will interact with the WP and EBS. The Near-Field Environment Report (NFER) was identified in the Waste Package Plan (WPP) (Harrison- Giesler, 1991) as the formal means for transmitting and documenting this information.

  13. PAPR Reduction Approach Based on Channel Estimation Pilots for Next Generations Broadcasting Systems

    Directory of Open Access Journals (Sweden)

    Anh-Tai Ho

    2011-01-01

    Full Text Available A novel peak-to-average power ratio (PAPR reduction technique for orthogonal frequency division multiplexing (OFDM systems is addressed. Instead of using dedicated pilots for PAPR reduction as with tone reservation (TR method selected by the DVB-T2 standard, we propose to use existing pilots used for channel estimation. In this way, we avoid the use of reserved tone pilots and then improve the spectral efficiency of the system. In order to allow their recovery at the receiver, these pilots have to follow particular laws which permit their blind detection and avoid sending side information. In this work, we propose and investigate a multiplicative law operating in discrete frequency domain. The operation in discrete domain aims at reducing degradation due to detection and estimation error in continuous domain. Simulation results are performed using the new DVB-T2 standard parameters. Its performance is compared to the DVB-T2 PAPR gradient algorithm and to the second-order cone programming (SOCP competitive technique proposed in the literature. We show that the proposed technique is efficient in terms of PAPR reduction value and of spectral efficiency while the channel estimation performance is maintained.

  14. Prezygotic barriers to hybridization in marine broadcast spawners: reproductive timing and mating system variation.

    Directory of Open Access Journals (Sweden)

    Carla A Monteiro

    Full Text Available Sympatric assemblages of congeners with incomplete reproductive barriers offer the opportunity to study the roles that ecological and non-ecological factors play in reproductive isolation. While interspecific asynchrony in gamete release and gametic incompatibility are known prezygotic barriers to hybridization, the role of mating system variation has been emphasized in plants. Reproductive isolation between the sibling brown algal species Fucus spiralis, Fucus guiryi (selfing hermaphrodite and Fucus vesiculosus (dioecious was studied because they form hybrids in parapatry in the rocky intertidal zone, maintain species integrity over a broad geographic range, and have contrasting mating systems. We compared reproductive synchrony (spawning overlap between the three species at several temporal scales (yearly/seasonal, semilunar/tidal, and hourly during single tides. Interspecific patterns of egg release were coincident at seasonal (single peak in spring to early summer to semilunar timescales. Synthesis of available data indicated that spawning is controlled by semidiurnal tidal and daily light-dark cues, and not directly by semilunar cycles. Importantly, interspecific shifts in timing detected at the hourly scale during single tides were consistent with a partial ecological prezygotic hybridization barrier. The species displayed patterns of gamete release consistent with a power law distribution, indicating a high degree of reproductive synchrony, while the hypothesis of weaker selective constraints for synchrony in selfing versus outcrossing species was supported by observed spawning in hermaphrodites over a broader range of tidal phase than in outcrossers. Synchronous gamete release is critical to the success of external fertilization, while high-energy intertidal environments may offer only limited windows of reproductive opportunity. Within these windows, however, subtle variations in reproductive timing have evolved with the potential to

  15. Prezygotic Barriers to Hybridization in Marine Broadcast Spawners: Reproductive Timing and Mating System Variation

    Science.gov (United States)

    Monteiro, Carla A.; Serrão, Ester A.; Pearson, Gareth A.

    2012-01-01

    Sympatric assemblages of congeners with incomplete reproductive barriers offer the opportunity to study the roles that ecological and non-ecological factors play in reproductive isolation. While interspecific asynchrony in gamete release and gametic incompatibility are known prezygotic barriers to hybridization, the role of mating system variation has been emphasized in plants. Reproductive isolation between the sibling brown algal species Fucus spiralis, Fucus guiryi (selfing hermaphrodite) and Fucus vesiculosus (dioecious) was studied because they form hybrids in parapatry in the rocky intertidal zone, maintain species integrity over a broad geographic range, and have contrasting mating systems. We compared reproductive synchrony (spawning overlap) between the three species at several temporal scales (yearly/seasonal, semilunar/tidal, and hourly during single tides). Interspecific patterns of egg release were coincident at seasonal (single peak in spring to early summer) to semilunar timescales. Synthesis of available data indicated that spawning is controlled by semidiurnal tidal and daily light-dark cues, and not directly by semilunar cycles. Importantly, interspecific shifts in timing detected at the hourly scale during single tides were consistent with a partial ecological prezygotic hybridization barrier. The species displayed patterns of gamete release consistent with a power law distribution, indicating a high degree of reproductive synchrony, while the hypothesis of weaker selective constraints for synchrony in selfing versus outcrossing species was supported by observed spawning in hermaphrodites over a broader range of tidal phase than in outcrossers. Synchronous gamete release is critical to the success of external fertilization, while high-energy intertidal environments may offer only limited windows of reproductive opportunity. Within these windows, however, subtle variations in reproductive timing have evolved with the potential to form ecological

  16. Prezygotic barriers to hybridization in marine broadcast spawners: reproductive timing and mating system variation.

    Science.gov (United States)

    Monteiro, Carla A; Serrão, Ester A; Pearson, Gareth A

    2012-01-01

    Sympatric assemblages of congeners with incomplete reproductive barriers offer the opportunity to study the roles that ecological and non-ecological factors play in reproductive isolation. While interspecific asynchrony in gamete release and gametic incompatibility are known prezygotic barriers to hybridization, the role of mating system variation has been emphasized in plants. Reproductive isolation between the sibling brown algal species Fucus spiralis, Fucus guiryi (selfing hermaphrodite) and Fucus vesiculosus (dioecious) was studied because they form hybrids in parapatry in the rocky intertidal zone, maintain species integrity over a broad geographic range, and have contrasting mating systems. We compared reproductive synchrony (spawning overlap) between the three species at several temporal scales (yearly/seasonal, semilunar/tidal, and hourly during single tides). Interspecific patterns of egg release were coincident at seasonal (single peak in spring to early summer) to semilunar timescales. Synthesis of available data indicated that spawning is controlled by semidiurnal tidal and daily light-dark cues, and not directly by semilunar cycles. Importantly, interspecific shifts in timing detected at the hourly scale during single tides were consistent with a partial ecological prezygotic hybridization barrier. The species displayed patterns of gamete release consistent with a power law distribution, indicating a high degree of reproductive synchrony, while the hypothesis of weaker selective constraints for synchrony in selfing versus outcrossing species was supported by observed spawning in hermaphrodites over a broader range of tidal phase than in outcrossers. Synchronous gamete release is critical to the success of external fertilization, while high-energy intertidal environments may offer only limited windows of reproductive opportunity. Within these windows, however, subtle variations in reproductive timing have evolved with the potential to form ecological

  17. The Role of Microtubule End Binding (EB) Proteins in Ciliogenesis

    DEFF Research Database (Denmark)

    Schrøder, Jacob Morville

    centrosomal MT array and abnormally long centriole-associated rootlet filaments. Cells lacking EB1 also had stumpy cilia and a disorganized centrosomal MT array, but rootlet filaments appeared normal. Further, live imaging revealed increased release frequency of MTs from the centrosome upon EB1 or EB3......EB1 is a small microtubule (MT)-binding protein that associates preferentially with MT plus ends. EB1 plays a role in regulating MT dynamics, localizing other MT-associated proteins to the plus end, and in regulating interactions of MTs with the cell cortex, mitotic kinetochores and different......, are required for assembly of primary cilia in cultured human cells. The EB3 - siRNA ciliary phenotype could be rescued by GFP-EB1 expression, and GFP-EB3 over expression resulted in elongated cilia. Transmission electron microscopy (TEM) revealed that EB3-depleted cells possess stumpy cilia, a disorganized...

  18. 47 CFR 27.1201 - EBS eligibility.

    Science.gov (United States)

    2010-10-01

    ... institution or to a governmental organization engaged in the formal education of enrolled students or to a... Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES MISCELLANEOUS WIRELESS COMMUNICATIONS SERVICES Broadband Radio Service and Educational Broadband Service § 27.1201 EBS eligibility. (a...

  19. Analysis and Implement of Broadcast Program Monitoring Data

    Directory of Open Access Journals (Sweden)

    Song Jin Bao

    2016-01-01

    Full Text Available With the rapid development of the radio and TV industry and the implementation of INT (the integration of telecommunications networks, cable TV networks and the Internet, the contents of programs and advertisements is showing massive, live and interactive trends. In order to meet the security of radio and television, the broadcast of information have to be controlled and administered. In order to master the latest information of public opinion trends through radio and television network, it is necessary research the specific industry applications of broadcast program monitoring. In this paper, the importance of broadcast monitoring in public opinion analysis is firstly analysed. The monitoring radio and television programs broadcast system architecture is proposed combining with the practice, focusing on the technical requirements and implementation process of program broadcast, advertisement broadcast and TV station broadcast monitoring. The more efficient information is generated through statistical analysis, which provides data analysis for radio and television public opinion analysis.

  20. Implications of Internet on Broadcasting

    DEFF Research Database (Denmark)

    Henten, Anders; Tadayoni, Reza

    One of the main challenges within broadcasting research in the recent years has been to understand the evolution from traditional broadcasting to digital broadcasting. The aim of this paper is to step further and give an analysis of Internet’s influence on traditional broadcasting services...

  1. Direct Broadcast Satellite: Radio Program

    Science.gov (United States)

    Hollansworth, James E.

    1992-01-01

    NASA is committed to providing technology development that leads to the introduction of new commercial applications for communications satellites. The Direct Broadcast Satellite-Radio (DBS-R) Program is a joint effort between The National Aeronautics and Space Administration (NASA) and The United States Information Agency/Voice of America (USIA/VOA) directed at this objective. The purpose of this program is to define the service and develop the technology for a direct-to-listener satellite sound broadcasting system. The DBS-R Program, as structured by NASA and VOA, is now a three-phase program designed to help the U.S. commercial communications satellite and receiver industry bring about this new communications service. Major efforts are being directed towards frequency planning hardware and service development, service demonstration, and experimentation with new satellite and receiver technology.

  2. EB detoxification of liquid hazardous wastes

    Energy Technology Data Exchange (ETDEWEB)

    Tata, A.; Giuliani, S. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dip. Innovazione; Diaco, L. [Hitesys s.p.a., Aprilia, Rome (Italy)

    1996-07-01

    In the work, an engineering approach to technical solutions, considering accelerated electron beams as radiation source, is carried out, in order to allow and evaluate an effective recovery of drinking water from highly chemically polluted groundwaters. In connection with different engineering technical and economic parameters (suitable doses, EB-machine type, plant features, etc.) and with reference to 1-100 ton/hr contaminated stream flowrate range (2-50 kGy as considered absorbed dose range), a specifically developed computer code was run. Analysis results, based on investment and functioning cost figures evaluated with reference to industrial plant management scenarios, are treatment unit costs showing a noticeable economic attractiveness of radiation EB-technologies in the field of considered applications.

  3. Unified mask data formats for EB writers

    Science.gov (United States)

    Kuriyama, Koki; Suzuki, Toshio; Hirumi, Junji; Yoshioka, Nobuyuki; Hojo, Yutaka; Kawase, Yuichi; Hara, Shigehiro; Hoga, Morihisa; Watanabe, Satoshi W.; Inoue, Masa; Kawase, Hidemuchi; Kamimoto, Tomoko

    2003-08-01

    Mask data preparation is a complicated process because many kinds of pattern files and jobdeck files flow into mask manufacturers. This situation has a significant impact on data preparation operations especially in mask manufacturers. In this paper, we propose a solution to this problem: use of unified mask data formats for EB writers and a model of data preparation flow from a device manufacturer to an EB writer. The unified formats consist of pattern data format named "NEO", and mask layout format named "MALY". NEO is a stream format which retains upper compatibility to GDSII and has higher compression rate than GDSII. NEO is intended to be a general input format of Variable-Shaped-Beam (VSB) mask writers in principle, not particularly designed for any specific equipment or software. Data conversion process between mask writers being taken into account, NEO requires some constraints for VSB mask writers, such as removal of overlapping figures. Due to many differences in jobdeck syntax and functions among mask writers, it is a complicated task to edit or modify a jobdeck, and convert it into another format. MALY is a text-based format whose purpose is to standardize mask layout information among mask writers. This unification of mask layout information optimized for EB writers is expected to reduce workload of mask data preparation significantly. Besides the information described in MALY, some other information specific to the target EB writer, such as drawing parameters, has to be prepared separately. This paper illustrates a model of data flow and benefits of using these unified formats. The format and the data flow are effective in reducing data handling cost, providing flexible data handling solution. Applying the handling flow using NEO and MALY would result in reducing the load on mask manufacturers. Moreover, device manufacturers would be freed from the need to specify the mask writer to be used when ordering masks to mask manufacturers.

  4. A TIRF microscopy assay to decode how tau regulates EB's tracking at microtubule ends.

    Science.gov (United States)

    Ramirez-Rios, Sacnicte; Serre, Laurence; Stoppin-Mellet, Virginie; Prezel, Elea; Vinit, Angélique; Courriol, Emilie; Fourest-Lieuvin, Anne; Delaroche, Julie; Denarier, Eric; Arnal, Isabelle

    2017-01-01

    Tau is a major microtubule-associated protein (MAP) mainly expressed in the brain. Tau binds the lattice of microtubules and favors their elongation and bundling. Recent studies have shown that tau is also a partner of end-binding proteins (EBs) in neurons. EBs belong to the protein family of the plus-end tracking proteins that preferentially associate with the growing plus-ends of microtubules and control microtubule end behavior and anchorage to intracellular organelles. Reconstituted cell-free systems using purified proteins are required to understand the precise mechanisms by which tau influences EB localization on microtubules and how the concerted activity of these two MAPs modulates microtubule dynamics. We developed an in vitro assay combining TIRF microscopy and site-directed mutagenesis to dissect the interaction of tau with EBs and to study how this interaction affects microtubule dynamics. Here, we describe the detailed procedures to purify proteins (tubulin, tau, and EBs), prepare the samples for TIRF microscopy, and analyze microtubule dynamics, and EB binding at microtubule ends in the presence of tau. © 2017 Elsevier Inc. All rights reserved.

  5. Using MPEG- at the Consumer Terminal in Broadcasting

    Directory of Open Access Journals (Sweden)

    Lalmas Mounia

    2002-01-01

    Full Text Available The European Union IST research programme SAMBITS (System for Advanced Multimedia Broadcast and IT Services project is using Digital Video Broadcasting (DVB, the DVB Multimedia Home Platform (MHP standard, MPEG- and MPEG- in a studio production and multimedia terminal system to integrate broadcast data and Internet data. This involves using data delivery over multiple paths and the use of a back channel for interaction. MPEG- is being used to identify programme content and to construct queries to allow users to identify and retrieve interesting related content. Searching for content is being carried out using the HySpirit search engine. The paper deals with terminal design issues, the use of MPEG- for broadcasting applications and using a consumer broadcasting terminal for searching for material related to a broadcast.

  6. Single photon detection and localization accuracy with an ebCMOS camera

    Energy Technology Data Exchange (ETDEWEB)

    Cajgfinger, T. [CNRS/IN2P3, Institut de Physique Nucléaire de Lyon, Villeurbanne F-69622 (France); Dominjon, A., E-mail: agnes.dominjon@nao.ac.jp [Université de Lyon, Université de Lyon 1, Lyon 69003 France. (France); Barbier, R. [CNRS/IN2P3, Institut de Physique Nucléaire de Lyon, Villeurbanne F-69622 (France); Université de Lyon, Université de Lyon 1, Lyon 69003 France. (France)

    2015-07-01

    The CMOS sensor technologies evolve very fast and offer today very promising solutions to existing issues facing by imaging camera systems. CMOS sensors are very attractive for fast and sensitive imaging thanks to their low pixel noise (1e-) and their possibility of backside illumination. The ebCMOS group of IPNL has produced a camera system dedicated to Low Light Level detection and based on a 640 kPixels ebCMOS with its acquisition system. After reminding the principle of detection of an ebCMOS and the characteristics of our prototype, we confront our camera to other imaging systems. We compare the identification efficiency and the localization accuracy of a point source by four different photo-detection devices: the scientific CMOS (sCMOS), the Charge Coupled Device (CDD), the Electron Multiplying CCD (emCCD) and the Electron Bombarded CMOS (ebCMOS). Our ebCMOS camera is able to identify a single photon source in less than 10 ms with a localization accuracy better than 1 µm. We report as well efficiency measurement and the false positive identification of the ebCMOS camera by identifying more than hundreds of single photon sources in parallel. About 700 spots are identified with a detection efficiency higher than 90% and a false positive percentage lower than 5. With these measurements, we show that our target tracking algorithm can be implemented in real time at 500 frames per second under a photon flux of the order of 8000 photons per frame. These results demonstrate that the ebCMOS camera concept with its single photon detection and target tracking algorithm is one of the best devices for low light and fast applications such as bioluminescence imaging, quantum dots tracking or adaptive optics.

  7. Digital terrestrial broadcasting receiver in the U.K; Eikoku chijoha digital hoso jushinki

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    Digital terrestrial broadcasting is broadcasted in parallel with existing UHF analog broadcasting, whereas each of allocated channel frequencies can transmit five to six programs simultaneously. Each home can receive a number of programs with the existing antenna without a need of installing a new satellite antenna or cable. Among the countries of the world running forward to digitization of broadcasting all at once, the U.K. develops advancing movements and leads the world by starting the digital terrestrial broadcasting. In addition to the digitized broadcasting of conventional analog broadcasting programs, the `Ondigitals` (broadcasting operators) have started newly the pay broadcasting. Toshiba has been selected as one of the six developers and manufacturers of digital terrestrial broadcasting receivers, and has developed the digital terrestrial broadcasting receiver DTB2000. For the modulation system, the orthogonal frequency division multiplex (OFDM) was chosen as a system being strong against ghost and most suitable for digital terrestrial broadcasting. In addition, the receiver is equipped with software download function by using the broadcasting waves, and the common interface being the communication specification specified in the DVB (digital video broadcasting) to provide future function expandability. (translated by NEDO)

  8. Radio Broadcast Technology

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 1. Radio Broadcast Technology. Harsh Vardhan. General Article Volume 7 Issue 1 January 2002 pp 53-63. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/007/01/0053-0063. Keywords. Hertzian ...

  9. Virtue Broadcasting - directorate change

    CERN Multimedia

    2003-01-01

    The Board of Virtue Broadcasting Plc ("Virtue") have announced the appointment of Mr. Klaus Ackerstaff as the CEO of the main Board. He began his professional career at CERN, where he was responsible for the IT infrastructure of the OPAL (particle physics) project (1/2 page).

  10. 47 CFR 73.1700 - Broadcast day.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Broadcast day. 73.1700 Section 73.1700 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Rules Applicable to All Broadcast Stations § 73.1700 Broadcast day. The term broadcast day means that...

  11. 46 CFR 184.506 - Emergency broadcast placard.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Emergency broadcast placard. 184.506 Section 184.506 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) VESSEL CONTROL AND MISCELLANEOUS SYSTEMS AND EQUIPMENT Radio § 184.506 Emergency broadcast...

  12. Broadcast, Denial-of-Service, and Secure Communication

    DEFF Research Database (Denmark)

    Vigo, Roberto; Nielson, Flemming; Nielson, Hanne Riis

    2013-01-01

    A main challenge in the design of wireless-based Cyber-Physical Systems consists in balancing the need for security and the effect of broadcast communication with the limited capabilities and reliability of sensor nodes. We present a calculus of broadcasting processes that enables to reason about...

  13. EB1 is required for primary cilia assembly in fibroblasts

    DEFF Research Database (Denmark)

    Schrøder, Jacob M; Schneider, Linda; Christensen, Søren T

    2007-01-01

    EB1 is a small microtubule (MT)-binding protein that associates preferentially with MT plus ends and plays a role in regulating MT dynamics. EB1 also targets other MT-associated proteins to the plus end and thereby regulates interactions of MTs with the cell cortex, mitotic kinetochores, and diff......EB1 is a small microtubule (MT)-binding protein that associates preferentially with MT plus ends and plays a role in regulating MT dynamics. EB1 also targets other MT-associated proteins to the plus end and thereby regulates interactions of MTs with the cell cortex, mitotic kinetochores...

  14. Study on the heat-resistant EB curing composites

    Energy Technology Data Exchange (ETDEWEB)

    Bao Jianwen; Li Yang [Institute of Aeronautical Materials, Beijing (China); Li Fengmei [Institute of Low Energy Nuclear Physics, Beijing Normal Univ., Beijing (China)

    2000-03-01

    There are many advantages in the EB-curing process of composites. Heat-resistant EB-curing composites could substitute for polyimide composites used in aeronautical engine. The effects of catalyst and dose on the cured resin were investigated. The heat-resistance of the resin cured by EB was evaluated by dynamic mechanical thermal analysis (DMTA). The experiment result shows that the mechanical property of the composites cured by EB could meet the needs of the aeronautical engine in 250degC. (author)

  15. From Broadcast to Podcast

    DEFF Research Database (Denmark)

    Fibiger, Bo

    2007-01-01

    This paper will present the development from broadcasted educational television up to the actual use of streaming video and mobile units in eLearning. The paper will discuss the following topics: what can we learn from history? – and what are the new challenges and possibilities in mobile...... technologies? What we can learn from history is that new technologies provide new didactic possibilities. On the other hand, most of the uses are based on remediation of former formats. Despite the possibilities for interaction and integration, most video in the screen are formatted as traditional broadcasted...... television. Today the new video technologies can be labelled the three P’s: production, portability, and panorama/3D. The challenge is how to develop new formats and new didactics for the integration of the new technology in learning environments....

  16. Broadcasting a message in a parallel computer

    Science.gov (United States)

    Berg, Jeremy E [Rochester, MN; Faraj, Ahmad A [Rochester, MN

    2011-08-02

    Methods, systems, and products are disclosed for broadcasting a message in a parallel computer. The parallel computer includes a plurality of compute nodes connected together using a data communications network. The data communications network optimized for point to point data communications and is characterized by at least two dimensions. The compute nodes are organized into at least one operational group of compute nodes for collective parallel operations of the parallel computer. One compute node of the operational group assigned to be a logical root. Broadcasting a message in a parallel computer includes: establishing a Hamiltonian path along all of the compute nodes in at least one plane of the data communications network and in the operational group; and broadcasting, by the logical root to the remaining compute nodes, the logical root's message along the established Hamiltonian path.

  17. Development of productive process for long coated conductors by EB evaporation

    Energy Technology Data Exchange (ETDEWEB)

    Mori, M. [Chubu Electric Power Co., Inc., 20-1 Kitasekiyama, Ohdaka-cho, Midori-ku, Nagoya 459-8522 (Japan)], E-mail: Mori.Masami2@chuden.co.jp; Watanabe, T.; Suda, N.; Kashima, N.; Nagaya, S. [Chubu Electric Power Co., Inc., 20-1 Kitasekiyama, Ohdaka-cho, Midori-ku, Nagoya 459-8522 (Japan); Izumi, T.; Shiohara, Y. [ISTEC-SRL, 1-10-13, Shinonome, Koto-ku, Tokyo 135-0062 (Japan)

    2007-10-01

    We have installed original EB evaporation system and verified the performance of CeO{sub 2} buffer layers fabricated by EB evaporation method in the YBCO coated conductor in comparison with those fabricated by PLD method. The I{sub c} values of YBCO coated conductors obtained by same deposition for CVD-YBCO were 135 A (EB-CeO{sub 2} sample) and 126 A (PLD-CeO{sub 2} sample). Though the values of {delta}{phi} for the EB-CeO{sub 2} layer and PLD-CeO{sub 2} layer were different, the I{sub c} values of the YBCO were about the same. This result was shown that the CeO{sub 2} layer of {delta}{phi} = 10 deg. obtained by EB evaporation was equivalent in performance for YBCO coated conductors to the CeO{sub 2} layer of {delta}{phi} = 4 deg. obtained by PLD method. The influence of CeO{sub 2} film thickness for high speed production was examined. The I{sub c} did not show the remarkable difference with the reduction of CeO{sub 2} film thickness. The range of the I{sub c} was only about 20% of the maximum I{sub c} value, regardless of the progress by 5 times in the production speed of CeO{sub 2} buffer layers.

  18. Broadcast sound technology

    CERN Document Server

    Talbot-Smith, Michael

    1990-01-01

    Broadcast Sound Technology provides an explanation of the underlying principles of modern audio technology. Organized into 21 chapters, the book first describes the basic sound; behavior of sound waves; aspects of hearing, harming, and charming the ear; room acoustics; reverberation; microphones; phantom power; loudspeakers; basic stereo; and monitoring of audio signal. Subsequent chapters explore the processing of audio signal, sockets, sound desks, and digital audio. Analogue and digital tape recording and reproduction, as well as noise reduction, are also explained.

  19. Mobile Broadcast DRM Based on User Identity Card

    Directory of Open Access Journals (Sweden)

    Byung-Rae Lee

    2007-11-01

    Full Text Available The current mobile broadcast systems do not provide efficient solution for consumption of service and content based on the user identity card such as a smartcard. This prevents users from consuming broadcast service and contents independent of a specific terminal (e.g., the one used for registration or purchase. To provide usage of broadcast services based on the user identity card, mutual authentication needs to be established among the service provider, the terminal, and the user identity card whenever the terminal is changed. The crucial element for this is assuring the service provider, the terminal, and the user identity card by authenticating each entity to the other entities. In this paper, we propose the new authentication scheme, which provides efficient scheme for three kinds of mutual authentications among the service provider, the terminal, and the user identity card. We also construct mobile broadcast DRM system based on the proposed authentication scheme for consumption of broadcast services with multiple terminals.

  20. A Stochastic Broadcast Pi-Calculus

    DEFF Research Database (Denmark)

    Song, Lei; Nielson, Flemming; Nielsen, Bo Friis

    2011-01-01

    In this paper we propose a stochastic broadcast PI-calculus which can be used to model server-client based systems where synchronization is always governed by only one participant. Therefore, there is no need to determine the joint synchronization rates. We also take immediate transitions...

  1. 47 CFR 73.1217 - Broadcast hoaxes.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Broadcast hoaxes. 73.1217 Section 73.1217 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Rules Applicable to All Broadcast Stations § 73.1217 Broadcast hoaxes. No licensee or permittee of any...

  2. Development of Intent Information Changes to Revised Minimum Aviation System Performance Standards for Automatic Dependent Surveillance Broadcast (RTCA/DO-242A)

    Science.gov (United States)

    Barhydt, Richard; Warren, Anthony W.

    2002-01-01

    RTCA Special Committee 186 has recently adopted a series of changes to the original Minimum Aviation System Performance Standards (MASPS) for Automatic Dependent Surveillance Broadcast (ADS-B). The new document will be published as DO-242A. Major changes to the MASPS include a significant restructuring and expansion of the intent parameters for future ADS-B systems. ADS-B provides a means for aircraft to exchange information about their intended trajectories with each other and with ground systems. NASA and Boeing have played significant roles in recommending these changes and providing supporting analysis. The intent changes are anticipated to provide substantial benefits to several programs and operational concepts under development by the two organizations. Major changes include the addition of Target State reports and the replacement of Trajectory Change Point reports with Trajectory Change reports. These changes have been designed to better reflect the capabilities of existing and future aircraft avionics, while providing benefits to current and proposed applications. DO-242A implements intent information elements that can be supported by current avionics systems and data buses. Provisions are made for future incorporation of other intent elements, as needed to meet operational requirements. This document summarizes the reasons for the DO-242A intent changes and provides a detailed overview of current and future intended ADS-B MASPS changes related to aircraft intent.

  3. Large-System Analysis of Joint User Selection and Vector Precoding with Zero-Forcing Transmit Beamforming for MIMO Broadcast Channels

    CERN Document Server

    Takeuchi, Keigo; Kawabata, Tsutomu

    2012-01-01

    Multiple-input multiple-output (MIMO) broadcast channels (BCs) (MIMO-BCs) with perfect channel state information (CSI) at the transmitter are considered. As joint user selection (US) and vector precoding (VP) (US-VP) with zero-forcing transmit beamforming (ZF-BF), US and continuous VP (CVP) (US-CVP) and data-dependent US (DD-US) are investigated. The replica method, developed in statistical physics, is used to analyze the energy penalties for the two US-VP schemes in the large-system limit, where the number of users, the number of selected users, and the number of transmit antennas tend to infinity with their ratios kept constant. Four observations are obtained in the large-system limit: First, the assumptions of replica symmetry (RS) and 1-step replica symmetry breaking (1RSB) for DD-US can provide acceptable approximations for low and moderate system loads, respectively. Secondly, DD-US outperforms CVP with random US in terms of the energy penalty for low-to-moderate system loads. Thirdly, the asymptotic en...

  4. Broadcasting children's music

    OpenAIRE

    Bignell, Jonathan

    2017-01-01

    Broadcasting children’s music on television and radio is motivated by, and aims to serve, adults’ perceptions of children’s wants and needs. Children’s music in general is shaped by the understanding of what ‘childhood’ means and, in turn, supports adults’ assumptions about childhood. This article develops these ideas in an analysis of examples from the history of British radio and television, beginning in the 1920s and continuing until the growing penetration of online interactive media chal...

  5. Capability of a Mobile Monitoring System to Provide Real-Time Data Broadcasting and Near Real-Time Source Attribution

    Science.gov (United States)

    Erickson, M.; Olaguer, J.; Wijesinghe, A.; Colvin, J.; Neish, B.; Williams, J.

    2014-12-01

    It is becoming increasingly important to understand the emissions and health effects of industrial facilities. Many areas have no or limited sustained monitoring capabilities, making it difficult to quantify the major pollution sources affecting human health, especially in fence line communities. Developments in real-time monitoring and micro-scale modeling offer unique ways to tackle these complex issues. This presentation will demonstrate the capability of coupling real-time observations with micro-scale modeling to provide real-time information and near real-time source attribution. The Houston Advanced Research Center constructed the Mobile Acquisition of Real-time Concentrations (MARC) laboratory. MARC consists of a Ford E-350 passenger van outfitted with a Proton Transfer Reaction Mass Spectrometer (PTR-MS) and meteorological equipment. This allows for the fast measurement of various VOCs important to air quality. The data recorded from the van is uploaded to an off-site database and the information is broadcast to a website in real-time. This provides for off-site monitoring of MARC's observations, which allows off-site personnel to provide immediate input to the MARC operators on how to best achieve project objectives. The information stored in the database can also be used to provide near real-time source attribution. An inverse model has been used to ascertain the amount, location, and timing of emissions based on MARC measurements in the vicinity of industrial sites. The inverse model is based on a 3D micro-scale Eulerian forward and adjoint air quality model known as the HARC model. The HARC model uses output from the Quick Urban and Industrial Complex (QUIC) wind model and requires a 3D digital model of the monitored facility based on lidar or industrial permit data. MARC is one of the instrument platforms deployed during the 2014 Benzene and other Toxics Exposure Study (BEE-TEX) in Houston, TX. The main goal of the study is to quantify and explain the

  6. Data broadcasting: merging digital broadcasting with the Internet

    DEFF Research Database (Denmark)

    2001-01-01

    This fully revised and updated edition of Data Broadcasting presents an exhaustive overview of the specific data broadcasting and bordering technologies concerned. Answering a wealth of questions, it describes this new technology in detail, examining how it differs from established technologies, ...

  7. A Network of Direct Broadcast Antenna Systems to Provide Real-Time Infrared and Microwave Sounder Data for Numerical Weather Prediction

    Science.gov (United States)

    Gumley, L.

    2013-12-01

    The Space Science and Engineering Center at the University of Wisconsin-Madison is creating a network of direct broadcast satellite data reception stations to acquire and process infrared and microwave sounder data in real-time from polar orbiting meteorological satellites and deliver the resulting products to NOAA with low latency for assimilation in NCEP numerical weather prediction models. The network will include 4 antenna sites that will be operated directly by SSEC, including Madison WI, Honolulu HI, Miami FL, and Mayaguez PR. The network will also include partner antenna sites not directly controlled by SSEC, including Corvallis OR, Monterey CA, Suitland MD, Fairbanks AK, and Guam. All of the antenna sites will have a combined X/L-band reception system capable of receiving data via direct broadcast from polar orbiting satellites including Suomi NPP and JPSS-1, Metop-A/B, POES,Terra, and Aqua. Each site will collect raw data from these satellites locally, process it to Level 1 (SDR) and Level 2 (EDR) products, and transmit the products back to SSEC for delivery to NOAA/NCEP. The primary purpose of the antenna systems is to provide real-time infrared and microwave sounder data from Metop and Suomi-NPP to NOAA to support data assimilation for NOAA/NCEP operational numerical weather prediction models. At present, NOAA/NCEP use of advanced infrared (CrIS, IASI, AIRS) and microwave (ATMS, AMSU) sounder data over North America in NWP data assimilation is limited because of the latency of the products in relation to the cutoff times for assimilation runs. This network will deliver infrared and microwave sounder data to NCEP with the lowest latency possible, via the reception and processing of data received via direct broadcast. CIMSS/SSEC is managing the procurement and installation of the antenna systems at the two new sites, and will operate the stations remotely. NOAA will establish the reception priorities (Metop and SNPP will be at the highest priority) and

  8. Now Broadcasting in Planck Definition

    Energy Technology Data Exchange (ETDEWEB)

    Hogan, Craig [Fermilab

    2013-07-08

    If reality has finite information content, space has finite fidelity. The quantum wave function that encodes spatial relationships may be limited to information that can be transmitted in a "Planck broadcast", with a bandwidth given by the inverse of the Planck time, about $2\\times 10^{43}$ bits per second. Such a quantum system can resemble classical space-time on large scales, but locality emerges only gradually and imperfectly. Massive bodies are never perfectly at rest, but very slightly and slowly fluctuate in transverse position, with a spectrum of variation given by the Planck time. This distinctive new kind of noise associated with quantum geometry would not have been noticed up to now, but may be detectable in a new kind of experiment.

  9. EB1 is required for spindle symmetry in mammalian mitosis.

    Directory of Open Access Journals (Sweden)

    Anke Brüning-Richardson

    Full Text Available Most information about the roles of the adenomatous polyposis coli protein (APC and its binding partner EB1 in mitotic cells has come from siRNA studies. These suggest functions in chromosomal segregation and spindle positioning whose loss might contribute to tumourigenesis in cancers initiated by APC mutation. However, siRNA-based approaches have drawbacks associated with the time taken to achieve significant expression knockdown and the pleiotropic effects of EB1 and APC gene knockdown. Here we describe the effects of microinjecting APC- or EB1- specific monoclonal antibodies and a dominant-negative EB1 protein fragment into mammalian mitotic cells. The phenotypes observed were consistent with the roles proposed for EB1 and APC in chromosomal segregation in previous work. However, EB1 antibody injection also revealed two novel mitotic phenotypes, anaphase-specific cortical blebbing and asymmetric spindle pole movement. The daughters of microinjected cells displayed inequalities in microtubule content, with the greatest differences seen in the products of mitoses that showed the severest asymmetry in spindle pole movement. Daughters that inherited the least mobile pole contained the fewest microtubules, consistent with a role for EB1 in processes that promote equality of astral microtubule function at both poles in a spindle. We propose that these novel phenotypes represent APC-independent roles for EB1 in spindle pole function and the regulation of cortical contractility in the later stages of mitosis. Our work confirms that EB1 and APC have important mitotic roles, the loss of which could contribute to CIN in colorectal tumour cells.

  10. Antiviral activity of the EB peptide against zoonotic poxviruses

    Directory of Open Access Journals (Sweden)

    Altmann Sharon E

    2012-01-01

    Full Text Available Abstract Background The EB peptide is a 20-mer that was previously shown to have broad spectrum in vitro activity against several unrelated viruses, including highly pathogenic avian influenza, herpes simplex virus type I, and vaccinia, the prototypic orthopoxvirus. To expand on this work, we evaluated EB for in vitro activity against the zoonotic orthopoxviruses cowpox and monkeypox and for in vivo activity in mice against vaccinia and cowpox. Findings In yield reduction assays, EB had an EC50 of 26.7 μM against cowpox and 4.4 μM against monkeypox. The EC50 for plaque reduction was 26.3 μM against cowpox and 48.6 μM against monkeypox. A scrambled peptide had no inhibitory activity against either virus. EB inhibited cowpox in vitro by disrupting virus entry, as evidenced by a reduction of the release of virus cores into the cytoplasm. Monkeypox was also inhibited in vitro by EB, but at the attachment stage of infection. EB showed protective activity in mice infected intranasally with vaccinia when co-administered with the virus, but had no effect when administered prophylactically one day prior to infection or therapeutically one day post-infection. EB had no in vivo activity against cowpox in mice. Conclusions While EB did demonstrate some in vivo efficacy against vaccinia in mice, the limited conditions under which it was effective against vaccinia and lack of activity against cowpox suggest EB may be more useful for studying orthopoxvirus entry and attachment in vitro than as a therapeutic against orthopoxviruses in vivo.

  11. Evolution of broadcast content distribution

    CERN Document Server

    Beutler, Roland

    2017-01-01

    This book discusses opportunities for broadcasters that arise with the advent of broadband networks, both fixed and mobile. It discusses how the traditional way of distributing audio-visual content over broadcasting networks has been complemented by the usage of broadband networks. The author shows how this also gives the possibility to offer new types of interactive or so-called nonlinear services. The book illustrates how change in distribution technology is accelerating the need for broadcasters around the world to adapt their content distribution strategy and how it will impact the portfolios of content they offer. Outlines the shift in broadcast content distribution paradigms and related strategic issues Provides an overview of the new broadcasting ecosystem encompassing new types of content, user habits, expectations, and devices Discusses complementary usage of different distribution technologies and platforms.

  12. Studies on EB radiation effect on PA610

    Energy Technology Data Exchange (ETDEWEB)

    Yang Kebin; Zhang Huaming; Li Xiurong; Xiong Ruilin [Sichuan Forever Group Co. Ltd., China Academy of Engineering Physics, Miangany (China)

    2000-03-01

    Radiation effect of PA610 with polyfunctional monomer trially isocyanurate (TAIC) was studied, the results show that crosslinking effect of EB radiation on PA610 is obvious. After the PA610 samples were radiated by EB with dosage 75KGY, the physical characters of PA610 materials were greatly improved, especially their tensile strength being increased about 18% and their impact strength about 50%, but their water and oil absorption were decreased. So, EB radiation can enhance PA610 materials physical strength, resistance to solvents and water and increase their thermal-deformation temperature. (author)

  13. Real-time data compression of broadcast video signals

    Science.gov (United States)

    Shalkauser, Mary Jo W. (Inventor); Whyte, Wayne A., Jr. (Inventor); Barnes, Scott P. (Inventor)

    1991-01-01

    A non-adaptive predictor, a nonuniform quantizer, and a multi-level Huffman coder are incorporated into a differential pulse code modulation system for coding and decoding broadcast video signals in real time.

  14. Recent and future applications of video compression in broadcasting

    Science.gov (United States)

    Drury, G. M.

    1995-02-01

    This paper considers the role of video compression in the transmission of television signals. It highlights contribution and distribution as well as direct-to-home broadcasting applications on satellite which are current and describes aspects of the standards, technology and systems required to support them. Some aspects of system performance are discussed together with a brief summary of future developments particularly on other media than those traditionally used by broadcasters.

  15. Broadcasting, Reacting, Engaging

    DEFF Research Database (Denmark)

    Etter, Michael

    2014-01-01

    Purpose - Symmetric communication and relationship building are core principles of public relations, which have been highlighted for CSR communication. In this paper three different communication strategies for CSR communication in Twitter are developed, of which each contributes differently...... to the ideals of symmetric communication and relationship building. The framework is then applied to analyze how companies use the micro-blogging service Twitter for CSR communication. Design/methodology/approach - Social network analysis is used to identify the 30 most central corporate accounts in a CSR...... Twitter-Network. From these accounts over 40´000 tweets are extracted and manually coded. Anova is applied to investigate differences in the weighting of CSR topics between the different strategies. Findings - The analysis reveals that corporations adhere to a broadcasting strategy or a reactive strategy...

  16. TV Broadcast Efficiency in 5G Networks from Subscriber Prospective

    KAUST Repository

    Lau, Chun Pong

    2015-12-06

    The flexibility of radio access network facilitated by 5G networks opens the gateway of deploying dynamic strategies for broadcasting TV channels in an efficient way. Currently, spectrum efficiency and bandwidth efficiency are the two common metrics measuring the efficiency of a system. These metrics assess the net bitrate for a unit of spectrum bandwidth. However, there is a lack of measurement, quantifying the effectiveness of a broadcasting strategy from the user perspective. In this paper, we introduce a novel measurement approach, called broadcast efficiency which considers the mobile user as a main reference. Broadcast efficiency is calculated as the number of served audiences per unit of radio resource. From numerical analysis, we show that broadcasting unpopular TV channels dramatically decreases the broadcast efficiency. This finding is evaluated by employing multiple distributions on the size of audience among TV channels. Furthermore, by conducting a real-life simulation, we discover that a high broadcast efficiency may result in a low percentage of served audiences if the audiences of TV channels are quite evenly distributed.

  17. Broadcasted Location-Aware Data Cache for Vehicular Application

    Directory of Open Access Journals (Sweden)

    Fukuda Akira

    2007-01-01

    Full Text Available There has been increasing interest in the exploitation of advances in information technology, for example, mobile computing and wireless communications in ITS (intelligent transport systems. Classes of applications that can benefit from such an infrastructure include traffic information, roadside businesses, weather reports, entertainment, and so on. There are several wireless communication methods currently available that can be utilized for vehicular applications, such as cellular phone networks, DSRC (dedicated short-range communication, and digital broadcasting. While a cellular phone network is relatively slow and a DSRC has a very small communication area, one-segment digital terrestrial broadcasting service was launched in Japan in 2006, high-performance digital broadcasting for mobile hosts has been available recently. However, broadcast delivery methods have the drawback that clients need to wait for the required data items to appear on the broadcast channel. In this paper, we propose a new cache system to effectively prefetch and replace broadcast data using "scope" (an available area of location-dependent data and "mobility specification" (a schedule according to the direction in which a mobile host moves. We numerically evaluate the cache system on the model close to the traffic road environment, and implement the emulation system to evaluate this location-aware data delivery method for a concrete vehicular application that delivers geographic road map data to a car navigation system.

  18. Broadcasted Location-Aware Data Cache for Vehicular Application

    Directory of Open Access Journals (Sweden)

    Kenya Sato

    2007-05-01

    Full Text Available There has been increasing interest in the exploitation of advances in information technology, for example, mobile computing and wireless communications in ITS (intelligent transport systems. Classes of applications that can benefit from such an infrastructure include traffic information, roadside businesses, weather reports, entertainment, and so on. There are several wireless communication methods currently available that can be utilized for vehicular applications, such as cellular phone networks, DSRC (dedicated short-range communication, and digital broadcasting. While a cellular phone network is relatively slow and a DSRC has a very small communication area, one-segment digital terrestrial broadcasting service was launched in Japan in 2006, high-performance digital broadcasting for mobile hosts has been available recently. However, broadcast delivery methods have the drawback that clients need to wait for the required data items to appear on the broadcast channel. In this paper, we propose a new cache system to effectively prefetch and replace broadcast data using “scope” (an available area of location-dependent data and “mobility specification” (a schedule according to the direction in which a mobile host moves. We numerically evaluate the cache system on the model close to the traffic road environment, and implement the emulation system to evaluate this location-aware data delivery method for a concrete vehicular application that delivers geographic road map data to a car navigation system.

  19. 47 CFR 73.1692 - Broadcast station construction near or installation on an AM broadcast tower.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Broadcast station construction near or installation on an AM broadcast tower. 73.1692 Section 73.1692 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Rules Applicable to All Broadcast...

  20. Automatic Dialect Detection in Arabic Broadcast Speech

    OpenAIRE

    Ali, Ahmed; Bell, Peter; Renals, Steve

    2015-01-01

    We investigate different approaches for dialect identification in Arabic broadcast speech, using phonetic, lexical features obtained from a speech recognition system, and acoustic features using the i-vector framework. We studied both generative and discriminate classifiers, and we combined these featuresusing a multi-class Support Vector Machine (SVM).We validated our results on an Arabic/English language identification task, with an accuracy of 100%. We used these features in a binary class...

  1. Automatic Dialect Detection in Arabic Broadcast Speech

    OpenAIRE

    Ali, Ahmed; Dehak, Najim; Cardinal, Patrick; Khurana, Sameer; Yella, Sree Harsha; Glass, James; Bell, Peter; Renals, Steve

    2016-01-01

    In this paper, we investigate different approaches for dialect identification in Arabic broadcast speech. These methods are based on phonetic and lexical features obtained from a speech recognition system, and bottleneck features using the i-vector framework. We studied both generative and discriminative classifiers, and we combined these features using a multi-class Support Vector Machine (SVM). We validated our results on an Arabic/English language identification task, with an accuracy of 1...

  2. Unified broadcast in sensor networks

    DEFF Research Database (Denmark)

    Hansen, Morten Tranberg; Jurdak, Raja; Kusy, Branislav

    2011-01-01

    Complex sensor network applications include multiple services such as collection, dissemination, time synchronization, and failure detection protocols. Many of these protocols require local state maintenance through periodic broadcasts which leads to high control overhead. Recent attempts...

  3. EB/UV treatment of protective coatings for porous materials

    Energy Technology Data Exchange (ETDEWEB)

    Bemporad, E.; Carassiti, F.; Tata, A.; Gallinaro, G.; Paris, M

    2000-03-01

    A method for improving surface properties of porous inorganic materials is presented. The method is particularly tailored to cement-based materials in order to obtain properties suitable for mechanical applications such as dies manufacturing, where hardness, abrasion resistance and low friction are requested. The coating system is based upon using two coatings of different characteristics. The underlying base coating layer is infiltrated in air on three different formulations of hardened cement composite. Two different bi-component resins, one relatively soft and the other relatively hard, were tested as underlying surface coating. The outer surface coating, based upon a bi-component resin characterized by high hardness, is added after hardening and curing of the first layer. Both coatings were chemically hardened and then cured with EB. UV curing is also suitable for the outer surface coating. An experimental campaign was carried out in order to evaluate the influence of radiation processing as curing treatment with reference to particular investigated materials. Hardness and resistance to peeling of coating systems have been measured and are presented. (author)

  4. EB/UV treatment of protective coatings for porous materials

    Science.gov (United States)

    Bemporad, E.; Carassiti, F.; Tata, A.; Gallinaro, G.; Paris, M.

    2000-03-01

    A method for improving surface properties of porous inorganic materials is presented. The method is particularly tailored to cement-based materials in order to obtain properties suitable for mechanical applications such as dies manufacturing, where hardness, abrasion resistance and low friction are requested. The coating system is based upon using two coatings of different characteristics. The underlying base coating layer is infiltrated in air on three different formulations of hardened cement composite. Two different bi-component resins, one relatively soft and the other relatively hard, were tested as underlying surface coating. The outer surface coating, based upon a bi-component resin characterized by high hardness, is added after hardening and curing of the first layer. Both coatings were chemically hardened and then cured with EB. UV curing is also suitable for the outer surface coating. An experimental campaign was carried out in order to evaluate the influence of radiation processing as curing treatment with reference to particular investigated materials. Hardness and resistance to peeling of coating systems have been measured and are presented.

  5. Co-existence of TV Broadcast and Wireless Systems for Public Safety Networks in the TV White Space

    Directory of Open Access Journals (Sweden)

    L. Kabiru

    2016-12-01

    Full Text Available The spectrum sharing between primary TV systems (Channels 9 and 35 and Public Safety Networks (PSNs is presented in this article. The networks to be deployed within Television White Space (TVWS in Ilorin metropolis of Kwara State operate on a secondary basis spatially, without causing harmful interference to incumbent TV users. In order to guarantee the protection of incumbent TV users both in VHF and UHF bands, minimum separation distances were suggested considering field strengths of 36 dBu and 41 dBu as the protected contours for the two bands respectively. The effects of varying the transmit power and the antenna height of the secondary system on the coverage area are emphasized in this work. Aggregate interference effect from the multiple secondary systems on the TV service coverage was also investigated. The performances of VHF and UHF bands were also verified when used for secondary transmission both at lower and higher transmit power scenarios. The results of this work show that the safety networks can co-exist with the TV systems without causing harmful interference with the suggested separation distances at the edge of the noise-limited service area, where the signal-to-noise ratio is 16 dB as recommended by the International Telecommunication Union-Radio sector (ITU-R.

  6. Toward a model of strategic influence, international broadcasting, and global engagement

    National Research Council Canada - National Science Library

    Hacker, Kenneth L; Mendez, Vanessa R

    2016-01-01

    This article explores how strategic communication, public diplomacy, international governmental broadcasting, and social media networking can be brought together in a system of strategic influence and global engagement...

  7. An interference cancellation strategy for broadcast in hierarchical cell structure

    KAUST Repository

    Yang, Yuli

    2014-12-01

    In this paper, a hierarchical cell structure is considered, where public safety broadcasting is fulfilled in a femtocell located within a macrocell. In the femtocell, also known as local cell, an access point broadcasts to each local node (LN) over an orthogonal frequency sub-band independently. Since the local cell shares the spectrum licensed to the macrocell, a given LN is interfered by transmissions of the macrocell user (MU) in the same sub-band. To improve the broadcast performance in the local cell, a novel scheme is proposed to mitigate the interference from the MU to the LN while achieving diversity gain. For the sake of performance evaluation, ergodic capacity of the proposed scheme is quantified and a corresponding closed-form expression is obtained. By comparing with the traditional scheme that suffers from the MU\\'s interference, numerical results substantiate the advantage of the proposed scheme and provide a useful tool for the broadcast design in hierarchical cell systems.

  8. A Reinforcement Learning Model Equipped with Sensors for Generating Perception Patterns: Implementation of a Simulated Air Navigation System Using ADS-B (Automatic Dependent Surveillance-Broadcast) Technology.

    Science.gov (United States)

    Álvarez de Toledo, Santiago; Anguera, Aurea; Barreiro, José M; Lara, Juan A; Lizcano, David

    2017-01-19

    Over the last few decades, a number of reinforcement learning techniques have emerged, and different reinforcement learning-based applications have proliferated. However, such techniques tend to specialize in a particular field. This is an obstacle to their generalization and extrapolation to other areas. Besides, neither the reward-punishment (r-p) learning process nor the convergence of results is fast and efficient enough. To address these obstacles, this research proposes a general reinforcement learning model. This model is independent of input and output types and based on general bioinspired principles that help to speed up the learning process. The model is composed of a perception module based on sensors whose specific perceptions are mapped as perception patterns. In this manner, similar perceptions (even if perceived at different positions in the environment) are accounted for by the same perception pattern. Additionally, the model includes a procedure that statistically associates perception-action pattern pairs depending on the positive or negative results output by executing the respective action in response to a particular perception during the learning process. To do this, the model is fitted with a mechanism that reacts positively or negatively to particular sensory stimuli in order to rate results. The model is supplemented by an action module that can be configured depending on the maneuverability of each specific agent. The model has been applied in the air navigation domain, a field with strong safety restrictions, which led us to implement a simulated system equipped with the proposed model. Accordingly, the perception sensors were based on Automatic Dependent Surveillance-Broadcast (ADS-B) technology, which is described in this paper. The results were quite satisfactory, and it outperformed traditional methods existing in the literature with respect to learning reliability and efficiency.

  9. A Reinforcement Learning Model Equipped with Sensors for Generating Perception Patterns: Implementation of a Simulated Air Navigation System Using ADS-B (Automatic Dependent Surveillance-Broadcast Technology

    Directory of Open Access Journals (Sweden)

    Santiago Álvarez de Toledo

    2017-01-01

    Full Text Available Over the last few decades, a number of reinforcement learning techniques have emerged, and different reinforcement learning-based applications have proliferated. However, such techniques tend to specialize in a particular field. This is an obstacle to their generalization and extrapolation to other areas. Besides, neither the reward-punishment (r-p learning process nor the convergence of results is fast and efficient enough. To address these obstacles, this research proposes a general reinforcement learning model. This model is independent of input and output types and based on general bioinspired principles that help to speed up the learning process. The model is composed of a perception module based on sensors whose specific perceptions are mapped as perception patterns. In this manner, similar perceptions (even if perceived at different positions in the environment are accounted for by the same perception pattern. Additionally, the model includes a procedure that statistically associates perception-action pattern pairs depending on the positive or negative results output by executing the respective action in response to a particular perception during the learning process. To do this, the model is fitted with a mechanism that reacts positively or negatively to particular sensory stimuli in order to rate results. The model is supplemented by an action module that can be configured depending on the maneuverability of each specific agent. The model has been applied in the air navigation domain, a field with strong safety restrictions, which led us to implement a simulated system equipped with the proposed model. Accordingly, the perception sensors were based on Automatic Dependent Surveillance-Broadcast (ADS-B technology, which is described in this paper. The results were quite satisfactory, and it outperformed traditional methods existing in the literature with respect to learning reliability and efficiency.

  10. Performance Analysis of Reuse Distance in Cooperative Broadcasting

    Directory of Open Access Journals (Sweden)

    Jimmi Grönkvist

    2016-01-01

    Full Text Available Cooperative broadcasting is a promising technique for robust broadcast with low overhead and delay in mobile ad hoc networks. The technique is attractive for mission-oriented mobile communication, where a majority of the traffic is of broadcast nature. In cooperative broadcasting, all nodes simultaneously retransmit packets. The receiver utilizes cooperative diversity in the simultaneously received signals. The retransmissions continue until all nodes are reached. After the packet has traveled a specific number of hops out from the source, denoted as reuse distance, the source node transmits a new broadcast packet in the time slot used for the previous broadcast packet. If the reuse distance is too small, interference causes packet loss in intermediate nodes. In the literature, a reuse distance of three is common. With an analysis based on a realistic interference model and real terrain data, we show that a reuse distance of at least four is necessary to avoid packet loss in sparsely connected networks, especially for high spectral efficiencies. For frequency hopping, widely used in military systems, we propose a novel method. This method almost eliminates interference for a reuse distance of three, increasing the throughput by 33% compared to systems with a reuse distance of four.

  11. Broadcasting Children’s Music

    Directory of Open Access Journals (Sweden)

    Jonathan Bignell

    2017-09-01

    Full Text Available Broadcasting children’s music on television and radio is motivated by, and aims to serve, adults’ perceptions of children’s wants and needs. Children’s music in general is shaped by the understanding of what ‘childhood’ means and, in turn, supports adults’ assumptions about childhood. This article develops these ideas in an analysis of examples from the history of British radio and television, beginning in the 1920s and continuing until the growing penetration of online interactive media challenged the status of broadcasting in the early 21st century. The article discusses examples of different kinds of children’s music in a broadcast context, including the broadcast of commercial recordings of music for children, such as versions of traditional songs and nursery rhymes as well as pop music aimed at children. It also considers the significance of signature tunes and repeated musical sequences from long-lived and well-loved children’s programmes, because they play key roles in differentiating children’s programmes from each other and distinguishing children’s music from music aimed at adults. Broadcast programmes frequently include music that does not play a central role, when it is used as an accompaniment to drama, entertainment performance or animation. But such music contributes to programmes’ tone and shapes their mode of address to an imagined child audience. Entertainment shows or magazine programmes include music performances alongside non-musical sequences and can use music to, for example, mark an occasion for sing-along activities or accompany games. The social function of broadcasting for children watching or listening at home or at school, usually with an adult or other children, is constituted in part by these varied forms of children’s music. These forms of music shape conceptions of childhood through particular kinds of listening practices and ways of belonging to an audience.

  12. Internet broadcast of hockey: a scale prototype

    Science.gov (United States)

    Boyd, Jeffrey E.; Sayles, Maxwell; Olsen, Luke; Tarjan, Paul

    2003-12-01

    We present a system for the broadcast of hockey games over the internet. The system allows users to experience the hockey game while it is in progress. Our system uses generic content description servers that acquire information from an external source, process it, and serve the processed data to client systems. Dynamic configuration of the servers allows us to use them in a variety of roles. For example, video information servers, like an MPEG-7 camera, produce XML documents that describe the motion of objects in the scene in addition to unprocessed video. Unlike an MPEG-7 camera, our video information servers interact with client systems, and can change their behavior through dynamic configuration. In an alternate configuration, a content description server acts as a game server in our hockey broadcast system. The game server forms an environment model that encapsulates the state of the hockey game and serves data from the model to clients. We developed and tested our system using a 1/32-scale model of a hockey rink. Early results using data acquired at a real rink indicate that the system performs as expected.

  13. Broadcast and Aggregation in BBC

    DEFF Research Database (Denmark)

    Hüttel, Hans; Kiilerich Pratas, Nuno

    2015-01-01

    In this paper we introduce a process calculus BBC that has both forms of communication. For both many-to-one and one-to-many communication, it is often a natural assumption that communication is bounded; this reflects two distinct aspects of the limitations of a medium. In the case of broadcast......, the bound limits the number of possible recipients of a message. In the case of collection, the bound limits the number of messages that can be received. For this reason, BBC uses a notion of bounded broadcast and collection. Moreover, the syntax of the calculus introduces an explicit notion of connectivity...

  14. An Identity-Based (IDB) Broadcast Encryption Scheme with Personalized Messages (BEPM).

    Science.gov (United States)

    Xu, Ke; Liao, Yongjian; Qiao, Li; Liu, Zhangyun; Yang, Xiaowei

    2015-01-01

    A broadcast encryption scheme with personalized messages (BEPM) is a scheme in which a broadcaster transmits not only encrypted broadcast messages to a subset of recipients but also encrypted personalized messages to each user individually. Several broadcast encryption (BE) schemes allow a broadcaster encrypts a message for a subset S of recipients with public keys and any user in S can decrypt the message with his/her private key. However, these BE schemes can not provide an efficient way to transmit encrypted personalized messages to each user individually. In this paper, we propose a broadcast encryption scheme with a transmission of personalized messages. Besides, the scheme is based on multilinear maps ensure constant ciphertext size and private key size of each user and the scheme can achieve statically security. More realistically, the scheme can be applied to the Conditional Access System (CAS) of pay television (pay-TV) efficiently and safely.

  15. DOE-Managed HLW and SNF Research: FY15 EBS and Thermal Analysis Work Package Status.

    Energy Technology Data Exchange (ETDEWEB)

    Matteo, Edward N. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Hadgu, Teklu [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States)

    2015-11-01

    This report examines the technical elements necessary to evaluate EBS concepts and perform thermal analysis of DOE-Managed SNF and HLW in the disposal settings of primary interest – argillite, crystalline, salt, and deep borehole. As the disposal design concept is composed of waste inventory, geologic setting, and engineered concept of operation, the engineered barrier system (EBS) falls into the last component of engineered concept of operation. The waste inventory for DOE-Managed HLW and SNF is closely examined, with specific attention to the number of waste packages, the size of waste packages, and the thermal output per package. As expected, the DOE-Managed HLW and SNF inventory has a much smaller volume, and hence smaller number of canisters, as well a lower thermal output, relative to a waste inventory that would include commercial spent nuclear fuel (CSNF). A survey of available data and methods from previous studies of thermal analysis indicates that, in some cases, thermo-hydrologic modeling will be necessary to appropriately address the problem. This report also outlines scope for FY16 work -- a key challenge identified is developing a methodology to effectively and efficiently evaluate EBS performance in each disposal setting on the basis of thermal analyses results.

  16. Evolution of public opinions in closed societies influenced by broadcast media

    Science.gov (United States)

    Fan, Kangqi; Pedrycz, Witold

    2017-04-01

    Studies on opinion evolution in a closed society can help people design strategies to emancipate from the control of public opinions and prevent the diffusion of extremism. In this work, the social judgment based opinion (SJBO) dynamics model is extended to explore the collective debates in a closed system that consists of a social network and a broadcast network. The broadcast network is a group of channels through which the so-called broadcast media or mainstream media transmit the same opinion to social agents. Numerical experiments show that the broadcast media can assimilate most of the agents when contrarians are absent. Including agents' diverse attitudes toward the broadcast media, although downsizes the supporters of broadcast media, fails to make contrarians outnumber the supporters. The dominance of broadcast media in a closed system can be overturned by introducing a small number of inflexible contrarians. Influenced by the competition between contrarians and broadcast media, few centrists survive the collective debates. The scale of supporters is maximized when agents neither have their own initial opinions nor have access to the contrarians, whereas the development of contrarians can be boosted when agents start with non-zero opinions and the repulsion to broadcast media is taken into consideration.

  17. Unsupervised Speaker Change Detection for Broadcast News Segmentation

    DEFF Research Database (Denmark)

    Jørgensen, Kasper Winther; Mølgaard, Lasse Lohilahti; Hansen, Lars Kai

    2006-01-01

    This paper presents a speaker change detection system for news broadcast segmentation based on a vector quantization (VQ) approach. The system does not make any assumption about the number of speakers or speaker identity. The system uses mel frequency cepstral coefficients and change detection...

  18. Cable Television and Satellite Broadcasting

    Science.gov (United States)

    1990-05-31

    homes by the end teevision per week. However, accorigtthIne op that de a ay anthr 4 million hoesby - tohoe pendent Broadcast Authority’s (IBA...France to create a leisure desire to buy cable TV. park and a production studio for cartoons. 8 The Role of Public Service Providers In the Next Decade

  19. Hybridisation of Slovene public broadcasting

    OpenAIRE

    Volčič, Zala; Zajc, Melita

    2015-01-01

    Public broadcasting institutions have existed as central and publicly funded national institutions, providing services in the public interest. The coincidence of technological, political and economic circumstances in the last 20 years or so, however, has challenged their monopoly position. Technological developments - specifically digitalisation - have expanded spectrum availability. In some cases, public television has been commercialised, privatised or marginalised by the introduction of co...

  20. Can broadcasting make a difference?

    Science.gov (United States)

    Lozare, B V

    1989-01-01

    Communication has untapped potential as a catalyst for community power in developing countries. Greater clarity is needed, however, on the channels of communication that will best integrate the contributions of diverse private and public agencies to meeting development needs. Also needed is a greater emphasis on strategic rather than technical aspects of communication. Most studies of communication have focused on the individual radio listener or television viewer, thereby ignoring the influence of broader forces. A concern for psychological determinants of decision making has led to a neglect of systemic factors. Another major error has been the failure to design longitudinal studies, or at least to collect information at 2 points in time. All of these observations point to a need to study power (economic, political, and social) as a crucial variable in understanding development. Moreover, there is a need for more attention to the role and impact of broadcasting on conflict management--an approach that requires abandoning traditional consensus models of communication. Yet another problem has been blind acceptance of the assumption that development communication and development support communication are unitary concepts that are universally applicable in all countries, all social and cultural contexts, and all development conditions. This unitary approach leads to the false conclusion that there is a grand model of development, and all communication personnel have to do is to see how radio and television fit into this conceptual framework. Finally, there has been a failure to appreciate fully the magnitude of poverty. If true development (defined as the capability of a people to go from where they are to where they want to be) is to occur, these strategic issues must be given serious attention.

  1. Water vapor estimation using digital terrestrial broadcasting waves

    Science.gov (United States)

    Kawamura, S.; Ohta, H.; Hanado, H.; Yamamoto, M. K.; Shiga, N.; Kido, K.; Yasuda, S.; Goto, T.; Ichikawa, R.; Amagai, J.; Imamura, K.; Fujieda, M.; Iwai, H.; Sugitani, S.; Iguchi, T.

    2017-03-01

    A method of estimating water vapor (propagation delay due to water vapor) using digital terrestrial broadcasting waves is proposed. Our target is to improve the accuracy of numerical weather forecast for severe weather phenomena such as localized heavy rainstorms in urban areas through data assimilation. In this method, we estimate water vapor near a ground surface from the propagation delay of digital terrestrial broadcasting waves. A real-time delay measurement system with a software-defined radio technique is developed and tested. The data obtained using digital terrestrial broadcasting waves show good agreement with those obtained by ground-based meteorological observation. The main features of this observation are, no need for transmitters (receiving only), applicable wherever digital terrestrial broadcasting is available and its high time resolution. This study shows a possibility to estimate water vapor using digital terrestrial broadcasting waves. In the future, we will investigate the impact of these data toward numerical weather forecast through data assimilation. Developing a system that monitors water vapor near the ground surface with time and space resolutions of 30 s and several kilometers would improve the accuracy of the numerical weather forecast of localized severe weather phenomena.

  2. Counter-Based Broadcast Scheme Considering Reachability, Network Density, and Energy Efficiency for Wireless Sensor Networks.

    Science.gov (United States)

    Jung, Ji-Young; Seo, Dong-Yoon; Lee, Jung-Ryun

    2018-01-04

    A wireless sensor network (WSN) is emerging as an innovative method for gathering information that will significantly improve the reliability and efficiency of infrastructure systems. Broadcast is a common method to disseminate information in WSNs. A variety of counter-based broadcast schemes have been proposed to mitigate the broadcast-storm problems, using the count threshold value and a random access delay. However, because of the limited propagation of the broadcast-message, there exists a trade-off in a sense that redundant retransmissions of the broadcast-message become low and energy efficiency of a node is enhanced, but reachability become low. Therefore, it is necessary to study an efficient counter-based broadcast scheme that can dynamically adjust the random access delay and count threshold value to ensure high reachability, low redundant of broadcast-messages, and low energy consumption of nodes. Thus, in this paper, we first measure the additional coverage provided by a node that receives the same broadcast-message from two neighbor nodes, in order to achieve high reachability with low redundant retransmissions of broadcast-messages. Second, we propose a new counter-based broadcast scheme considering the size of the additional coverage area, distance between the node and the broadcasting node, remaining battery of the node, and variations of the node density. Finally, we evaluate performance of the proposed scheme compared with the existing counter-based broadcast schemes. Simulation results show that the proposed scheme outperforms the existing schemes in terms of saved rebroadcasts, reachability, and total energy consumption.

  3. The Great Époque of the Consumption of Imported Broadcasts. West European Television Channels and Polish Audiences during the System Transition

    Directory of Open Access Journals (Sweden)

    Patryk Wasiak

    2014-06-01

    Full Text Available This article shows how Polish audiences “domesticated” West European television content available with satellite dishes and semi legal cable TVs during the turnover of the 1980s and 1990s. Based on analysis of viewers’ memoirs and content of magazines dedicated to satellite television, this article discusses how Poles considered channels available with Astra satellite as an attractive entertainment juxtaposed with dull national broadcaster TVP. As this article shows, they primarily “domesticated” German late night erotic shows symbolized by Tutti Frutti and music video available with MTV Europe.

  4. The Regulation of Broadcasting in the United States: A Comparative Analysis. Publication No. 75-6.

    Science.gov (United States)

    Mosco, Vincent

    An analysis of the American system of broadcasting and its regulation by the Federal Communications Commission sought to compare decision-making processes and outcomes in four cases involving innovations in the broadcasting market. The innovations, which were chosen to exemplify common elements in the commission's decision-making, included…

  5. CHAOS: User-driven Development of a Metadata Scheme for Radio Broadcast Archives

    DEFF Research Database (Denmark)

    Lund, Haakon; Bogers, Toine; Larsen, Birger

    2013-01-01

    CHAOS (Cultural Heritage Archive Open System) is a digital platform for Danish radio broadcasts. Radio broadcasts are an important and vibrant part of our cultural heritage, but providing efficient and effective access to such archives is challenging for lack of a solid digital infrastructure. Th...... of the multi-tiered metadata scheme used in CHAOS....

  6. Application of calorimeters for 5 MeV EB and bremsstrahlung dosimetry

    DEFF Research Database (Denmark)

    Sato, T.; Takahashi, T.; Saito, T.

    1993-01-01

    Graphite and water calorimeters, which were developed for use a 10 MeV electron beams (EB) at Riso National Laboratory, were used for process validation and routine dosimeter calibration at a 5 MeV EB. Water calorimeters were used for reference measurements for 5 MeV EB, the response was found...... at 5 MeV EB. Graphite calorimeters gave reproducible readings within 3.3 % relative errors (95 % confidence level) for X-ray measurement....

  7. Global Broadcast Service An Assessment of Potential Military-Commercial Integration

    National Research Council Canada - National Science Library

    Tempia, Frank

    1999-01-01

    ... effective and efficient approach to implement such a system as GBS. This paper first will describe briefly the technology employed in satellite direct broadcast systems such as GBS and DirecPC and the communications requirements these systems satisfy...

  8. Radiosynoviorthesis in the reflection of Evidence-based Medicine (EbM); Die Radiosynoviorthese im Spiegel der Evidenz-basierten Medizin (EbM)

    Energy Technology Data Exchange (ETDEWEB)

    Kampen, W.U. [Klinik fuer Nuklearmedizin, Universitaetsklinikum Schleswig-Holstein, Campus Kiel (Germany)

    2006-03-15

    This paper summarizes the literature on clinical efficacy of radiosynoviorthesis with respect to the criteria of evidence-based medicine (EbM). Each therapy has to face up to the success and the costs of other treatment modalities, especially in times of scarce financial resources of our health care system. For many physicians and scientists, evidence-based medicine, which means weighting clinical trials by several quality factors like randomization, blinding or comparison with a placebo seems to be the ''philosophers'stone'' to some extent. Concerning radiosynoviorthesis, the existence of clinical studies with a high quality according to the EbM is sometimes negated. However, this statement cannot be abided after extensive revision of the literature. The nuclear medicine physician practising radiosynoviorthesis should be provided with arguments from the literature supporting his personal experience for successful discussions with referring colleques. This is achieved by listing the respective papers especially of evidence classes Ib and IIa with a short summary of each of them. Some critical remarks on evidence-based medicine if used as the only basis of therapeutic practise complete this paper. (orig.)

  9. Reliable Delay Constrained Multihop Broadcasting in VANETs

    Directory of Open Access Journals (Sweden)

    Koubek Martin

    2010-01-01

    Full Text Available Vehicular communication is regarded as a major innovative feature for in-car technology. While improving road safety is unanimously considered the major driving factor for the deployment of Intelligent Vehicle Safety Systems, the challenges relating to reliable multi-hop broadcasting are exigent in vehicular networking. In fact, safety applications must rely on very accurate and up-to-date information about the surrounding environment, which in turn requires the use of accurate positioning systems and smart communication protocols for exchanging information. Communications protocols for VANETs must guarantee fast and reliable delivery of information to all vehicles in the neighbourhood, where the wireless communication medium is shared and highly unreliable with limited bandwidth. In this paper, we focus on mechanisms that improve the reliability of broadcasting protocols, where the emphasis is on satisfying the delay requirements for safety applications. We present the Pseudoacknowledgments (PACKs scheme and compare this with existing methods over varying vehicle densities in an urban scenario using the network simulator OPNET.

  10. Structuring Broadcast Audio for Information Access

    Science.gov (United States)

    Gauvain, Jean-Luc; Lamel, Lori

    2003-12-01

    One rapidly expanding application area for state-of-the-art speech recognition technology is the automatic processing of broadcast audiovisual data for information access. Since much of the linguistic information is found in the audio channel, speech recognition is a key enabling technology which, when combined with information retrieval techniques, can be used for searching large audiovisual document collections. Audio indexing must take into account the specificities of audio data such as needing to deal with the continuous data stream and an imperfect word transcription. Other important considerations are dealing with language specificities and facilitating language portability. At Laboratoire d'Informatique pour la Mécanique et les Sciences de l'Ingénieur (LIMSI), broadcast news transcription systems have been developed for seven languages: English, French, German, Mandarin, Portuguese, Spanish, and Arabic. The transcription systems have been integrated into prototype demonstrators for several application areas such as audio data mining, structuring audiovisual archives, selective dissemination of information, and topic tracking for media monitoring. As examples, this paper addresses the spoken document retrieval and topic tracking tasks.

  11. 76 FR 56657 - Unlicensed Operation in the TV Broadcast Bands

    Science.gov (United States)

    2011-09-14

    ... manufacturers to begin marketing unlicensed communications devices and systems that operate on frequencies in..., December 6, 2010. Synopsis As required by the Paperwork Reduction Act of 1995, (44 U.S.C. 3507), the... allow new and unlicensed wireless devices to operate in the broadcast television spectrum at locations...

  12. 46 CFR 184.510 - Recommended emergency broadcast instructions.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Recommended emergency broadcast instructions. 184.510 Section 184.510 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) VESSEL CONTROL AND MISCELLANEOUS SYSTEMS AND EQUIPMENT Radio § 184.510 Recommended...

  13. Resource development and experiments in automatic SA broadcast news transcription

    CSIR Research Space (South Africa)

    Kamper, H

    2012-05-01

    Full Text Available development purposes: a 20 hour corpus of South African English (SAE) broadcast news, a 109M word corpus of South African newspaper text collected for language modelling purposes, and a 60k word SAE pronunciation dictionary. The development of our system...

  14. Broadcasting in Iceland: Cultural Protectionism and U.S. Influence.

    Science.gov (United States)

    Hudson, Tim

    Icelanders are a highly literate people, their culture tied together by perhaps the most complete written tradition of any modern nation. No wonder, then, that the tiny island country seemed in no rush to develop a television broadcasting system. Indeed, it is questionable whether television would have been in demand at all if not for outside…

  15. Radio broadcasting: an attractive way of broadcasting astronomy

    Science.gov (United States)

    Mosoia, C.

    2008-06-01

    Astronomy is full of beautiful skyscapes, shining stars and huge planets. The vast majority of them can be transformed into tactile images and complemented by audio descriptions. These translations of visual information into raised lines, shapes and textures can be felt with the fingertips instead of viewed with the eyes. In this way, the beauties of the Universe enter the universe of blind and visually impaired people. Happily, we all have radio broadcasting as an important source of information and entertainment. Science radio programmes can bring the real music of the spheres (as Pythagoras once suggested) to the audience.

  16. 47 CFR 73.1206 - Broadcast of telephone conversations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Broadcast of telephone conversations. 73.1206 Section 73.1206 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Rules Applicable to All Broadcast Stations § 73.1206 Broadcast of telephone...

  17. 47 CFR 73.24 - Broadcast facilities; showing required.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Broadcast facilities; showing required. 73.24 Section 73.24 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES AM Broadcast Stations § 73.24 Broadcast facilities; showing required. An...

  18. 47 CFR 73.4091 - Direct broadcast satellites.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Direct broadcast satellites. 73.4091 Section 73.4091 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Rules Applicable to All Broadcast Stations § 73.4091 Direct broadcast satellites. (a) See...

  19. 47 CFR 73.6011 - Protection of TV broadcast stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Protection of TV broadcast stations. 73.6011 Section 73.6011 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Class A Television Broadcast Stations § 73.6011 Protection of TV broadcast...

  20. 47 CFR 73.624 - Digital television broadcast stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Digital television broadcast stations. 73.624... RADIO BROADCAST SERVICES Television Broadcast Stations § 73.624 Digital television broadcast stations. (a) Digital television (“DTV”) broadcast stations are assigned channels 6 MHz wide. Initial...

  1. 47 CFR 73.1211 - Broadcast of lottery information.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Broadcast of lottery information. 73.1211... RADIO BROADCAST SERVICES Rules Applicable to All Broadcast Stations § 73.1211 Broadcast of lottery... paragraph (c) of this section, shall broadcast any advertisement of or information concerning any lottery...

  2. Broadcast copies reveal the quantumness of correlations.

    Science.gov (United States)

    Piani, M; Christandl, M; Mora, C E; Horodecki, P

    2009-06-26

    We study the quantumness of bipartite correlations by proposing a quantity that combines a measure of total correlations-mutual information-with the notion of broadcast copies-i.e., generally nonfactorized copies-of bipartite states. By analyzing how our quantity increases with the number of broadcast copies, we are able to classify classical, separable, and entangled states. This motivates the definition of the broadcast regularization of mutual information, the asymptotic minimal mutual information per broadcast copy, which we show to have many properties of an entanglement measure.

  3. 76 FR 55817 - Broadcast Applications and Proceedings; Fairness Doctrine and Digital Broadcast Television...

    Science.gov (United States)

    2011-09-09

    ... COMMISSION 47 CFR Parts 1, 73 and 76 Broadcast Applications and Proceedings; Fairness Doctrine and Digital Broadcast Television Redistribution Control; Fairness Doctrine, Personal Attacks, Political Editorials and... legal effect and are obsolete. The deleted rules include ] the fairness doctrine, broadcast flag rules...

  4. 47 CFR 1.4000 - Restrictions impairing reception of television broadcast signals, direct broadcast satellite...

    Science.gov (United States)

    2010-10-01

    ... any commercial non-broadcast communications signals transmitted via wireless technology to and/or from... Transmit Fixed Wireless Communications Signals § 1.4000 Restrictions impairing reception of television... broadcast signals, direct broadcast satellite services or multichannel multipoint distribution services. 1...

  5. Lossless Compression of Broadcast Video

    DEFF Research Database (Denmark)

    Martins, Bo; Eriksen, N.; Faber, E.

    1998-01-01

    We investigate several techniques for lossless and near-lossless compression of broadcast video.The emphasis is placed on the emerging international standard for compression of continous-tone still images, JPEG-LS, due to its excellent compression performance and moderatecomplexity. Except for one...... artificial sequence containing uncompressible data all the 4:2:2, 8-bit test video material easily compresses losslessly to a rate below 125 Mbit/s. At this rate, video plus overhead can be contained in a single telecom 4th order PDH channel or a single STM-1 channel. Difficult 4:2:2, 10-bit test material...

  6. History of Satellite TV Broadcasting and Satellite Broadcasting Market in Turkey

    Directory of Open Access Journals (Sweden)

    Mihalis KUYUCU

    2015-09-01

    Full Text Available The present study analyses the satellite broadcasting that is the first important development that emerged as a result of digitalization in communication technologies and its reflections in Turkey. As the first milestone in the globalization of television broadcasting, satellite broadcasting provided substantial contribution towards the development of the media. Satellite bro adcasting both increased the broadcasting quality and geographical coverage of the television media. A conceptual study was carried out in the first part of the study in connection with the history of satellite broadcasting in Turkey and across the world. In the research part of the study, an analysis was performed on 160 television channels that broadcast in Turkey via Turksat Satellite. Economic structure of the television channels broadcasting in Turkey via satellite was studied and an analysis was perfo rmed on the operational structure of the channels. As a result of the study, it was emphasized that the television channels broadcasting via satellite platform also use other platforms for the purpose of spreading their broadcasts and television channel ow ners make investments in different branches of the media, too. Capital owners invest in different business areas other than the media although television channels broadcasting via Turksat mostly focus on thematic broadcasting and make effort to generate ec onomic income from advertisements. Delays are encountered in the course of the convergence between the new media and television channels that broadcast only from the satellite platform and such television channels experience more economic problems than the other channels. New media and many TV broadcasting platforms emerged as a result of the developments in the communication technologies. In television broadcasting, satellite platform is not an effective platform on its own. Channels make effort to reach t o more people by using other platforms in addition to

  7. Equilibria in a Random Viewer Model of Television Broadcasting

    DEFF Research Database (Denmark)

    Olai Hansen, Bodil; Keiding, Hans

    2014-01-01

    The authors considered a model of commercial television market with advertising with probabilistic viewer choice of channel, where private broadcasters may coexist with a public television broadcaster. The broadcasters influence the probability of getting viewer attention through the amount...

  8. Autoinhibition of TBCB regulates EB1-mediated microtubule dynamics.

    Science.gov (United States)

    Carranza, Gerardo; Castaño, Raquel; Fanarraga, Mónica L; Villegas, Juan Carlos; Gonçalves, João; Soares, Helena; Avila, Jesus; Marenchino, Marco; Campos-Olivas, Ramón; Montoya, Guillermo; Zabala, Juan Carlos

    2013-01-01

    Tubulin cofactors (TBCs) participate in the folding, dimerization, and dissociation pathways of the tubulin dimer. Among them, TBCB and TBCE are two CAP-Gly domain-containing proteins that together efficiently interact with and dissociate the tubulin dimer. In the study reported here we showed that TBCB localizes at spindle and midzone microtubules during mitosis. Furthermore, the motif DEI/M-COO(-) present in TBCB, which is similar to the EEY/F-COO(-) element characteristic of EB proteins, CLIP-170, and α-tubulin, is required for TBCE-TBCB heterodimer formation and thus for tubulin dimer dissociation. This motif is responsible for TBCB autoinhibition, and our analysis suggests that TBCB is a monomer in solution. Mutants of TBCB lacking this motif are derepressed and induce microtubule depolymerization through an interaction with EB1 associated with microtubule tips. TBCB is also able to bind to the chaperonin complex CCT containing α-tubulin, suggesting that it could escort tubulin to facilitate its folding and dimerization, recycling or degradation.

  9. Live broadcast from the Globe

    CERN Multimedia

    La tête au carréTuesday, 17 June 2008 between 2.00 and 3.00 p.m.“La tête au carré”, a France Inter radio programme devoted to science, will set up its sound booth at CERN for a special broadcast on the LHC.The journalist Mathieu Vidard will interview the following guests: - Pierre Van Hove, an experimental physicist working on CMS. He is a CNRS research scientist from the Institut Hubert Curien in Strasbourg, France.- Abdelhak Djouadi is a theoretical physicist. He is a research director at the CNRS’s Laboratoire de physique théorique at Orsay, France and holder of the CNRS silver medal.- Magali Gruwe, one of the engineers in charge of LHC operations at CERN.» To take part in this live broadcast, which is open to the public, come to the Globe at 1:30 p.m. The number of places is limited.» No specialist knowledge required.» See the programme's homepage

  10. Language Choice in Transnational Radio Broadcasting.

    Science.gov (United States)

    Wood, Richard E.

    1979-01-01

    Discusses the comparative strength of language use as measured by languages used in transnational radio broadcasting. Findings indicate that politics and Christian evangelism are the two major concerns dominating broadcasting and that language selection policy influences political, social, and cultural change. (JMF)

  11. Attitude of Programme Presenters towards Broadcasting of ...

    African Journals Online (AJOL)

    The study assessed the attitude of programme presenters towards broadcasting of agricultural programme on electronic media in Kwara state. A two-stage sampling technique was used in selecting a total of 120 respondents from the broadcasting stations in Kwara state. Frequency counts, percentages, means, standard ...

  12. Method of providing data broadcast/multicast

    NARCIS (Netherlands)

    Bosch, H.G.P.; Galonska, Johann; Mullender, Sape J.

    2006-01-01

    In one embodiment, a dedicated channel (e.g., is a coded composite transport channel) is configured for each user equipment in a broadcast group based on a first spreading code and a second spreading code. A same first spreading code is assigned to each user equipment in the broadcast group, and the

  13. Broadcast Media in Breton: Dawn at Last?

    Science.gov (United States)

    Moal, Stefan

    2000-01-01

    Discusses to what extent the broadcast media in the Breton language has acted as a vital link to language maintenance in Brittany. Highlights the background context of the Breton language, reasons for its decline, and what the broadcast media can do to help reverse language shift. (Author/VWL)

  14. Interface Supports Multiple Broadcast Transceivers for Flight Applications

    Science.gov (United States)

    Block, Gary L.; Whitaker, William D.; Dillon, James W.; Lux, James P.; Ahmad, Mohammad

    2011-01-01

    A wireless avionics interface provides a mechanism for managing multiple broadcast transceivers. This interface isolates the control logic required to support multiple transceivers so that the flight application does not have to manage wireless transceivers. All of the logic to select transceivers, detect transmitter and receiver faults, and take autonomous recovery action is contained in the interface, which is not restricted to using wireless transceivers. Wired, wireless, and mixed transceiver technologies are supported. This design s use of broadcast data technology provides inherent cross strapping of data links. This greatly simplifies the design of redundant flight subsystems. The interface fully exploits the broadcast data link to determine the health of other transceivers used to detect and isolate faults for fault recovery. The interface uses simplified control logic, which can be implemented as an intellectual-property (IP) core in a field-programmable gate array (FPGA). The interface arbitrates the reception of inbound data traffic appearing on multiple receivers. It arbitrates the transmission of outbound traffic. This system also monitors broadcast data traffic to determine the health of transmitters in the network, and then uses this health information to make autonomous decisions for routing traffic through transceivers. Multiple selection strategies are supported, like having an active transceiver with the secondary transceiver powered off except to send periodic health status reports. Transceivers can operate in round-robin for load-sharing and graceful degradation.

  15. Independence between Korean Government and Broadcasting Industry

    Directory of Open Access Journals (Sweden)

    Yi-Chih Huang

    2015-01-01

    Full Text Available The recent success of Hallyu (Korean Wave first driven by the spread of TV dramas received academic attention for its effective national policies. However, little is known about how national policy is implemented and local industry capacity is maintained even after market opening. Therefore, the aim of this paper attempts to explore how and why state governs broadcasting industry effectively. Historical institutionalism has been used to explain the way that Korean governments had taken to collaborate with the broadcasting industry. The relation between governments and broadcasting industry, the changes of broadcasting policies and authorities responsible for regulating TV industry are involved. Results of this study showed that strong state intervention in Korea did lead to oligopoly, and the governments dominated the industry by designing the market structure. To conclude, this study may be of importance in explaining the governed independence between Korean governments and broadcasting industry, as well as how it contributed to the stable productivity and export competitiveness.

  16. Safety message broadcast in vehicular networks

    CERN Document Server

    Bi, Yuanguo; Zhuang, Weihua; Zhao, Hai

    2017-01-01

    This book presents the current research on safety message dissemination in vehicular networks, covering medium access control and relay selection for multi-hop safety message broadcast. Along with an overall overview of the architecture, characteristics, and applications of vehicular networks, the authors discuss the challenging issues in the research on performance improvement for safety applications, and provide a comprehensive review of the research literature. A cross layer broadcast protocol is included to support efficient safety message broadcast by jointly considering geographical location, physical-layer channel condition, and moving velocity of vehicles in the highway scenario. To further support multi-hop safety message broadcast in a complex road layout, the authors propose an urban multi-hop broadcast protocol that utilizes a novel forwarding node selection scheme. Additionally, a busy tone based medium access control scheme is designed to provide strict priority to safety applications in vehicle...

  17. Random broadcast on random geometric graphs

    Energy Technology Data Exchange (ETDEWEB)

    Bradonjic, Milan [Los Alamos National Laboratory; Elsasser, Robert [UNIV OF PADERBORN; Friedrich, Tobias [ICSI/BERKELEY; Sauerwald, Tomas [ICSI/BERKELEY

    2009-01-01

    In this work, we consider the random broadcast time on random geometric graphs (RGGs). The classic random broadcast model, also known as push algorithm, is defined as: starting with one informed node, in each succeeding round every informed node chooses one of its neighbors uniformly at random and informs it. We consider the random broadcast time on RGGs, when with high probability: (i) RGG is connected, (ii) when there exists the giant component in RGG. We show that the random broadcast time is bounded by {Omicron}({radical} n + diam(component)), where diam(component) is a diameter of the entire graph, or the giant component, for the regimes (i), or (ii), respectively. In other words, for both regimes, we derive the broadcast time to be {Theta}(diam(G)), which is asymptotically optimal.

  18. 75 FR 6395 - Radio Broadcasting Services; AM or FM Proposals To Change the Community of License

    Science.gov (United States)

    2010-02-09

    ..., Facility ID 21494, BPH-20091211AFR, From MEXIA, TX, To MART, TX; TELEMEDIA BROADCASTING, INC., Station WGRQ...., Washington, DC 20554 or electronically via the Media Bureau's Consolidated Data Base System, http...

  19. A Scheduling Method to Reduce Waiting Time for Close-Range Broadcasting

    Directory of Open Access Journals (Sweden)

    Yusuke Gotoh

    2012-01-01

    Full Text Available Due to the recent popularization of digital broadcasting systems, close-range broadcasting using continuous media data, i.e. audio and video, has attracted great attention. For example, in a drama, after a user watches interesting content such as a highlight scene, he/she will watch the main program continuously. In close-range broadcasting, the necessary bandwidth for continuously playing the two types of data increases. Conventional methods reduce the necessary bandwidth by producing an effective broadcast schedule for continuous media data. However, these methods do not consider the broadcast schedule for two types of continuous media data. When the server schedules two types of continuous media data, waiting time that occurs from finishing the highlight scene to starting the main scene, may increase. In this paper, we propose a scheduling method to reduce the waiting time for close-range broadcasting. In our proposed method, by dividing two types of data and producing an effective broadcast schedule considering the available bandwidth, we can reduce the waiting time.

  20. 0dB Eb/N(0) burst mode SCPC modem with high coding gain FEC

    Science.gov (United States)

    Namiki, Junji; Ohtani, Susumu; Yasuda, Yutaka

    A digital SCPC modem for 0dB Eb/N(0) burst signal is described in this paper. When demodulation process is followed by a powerful error correction function, carrier phase and clock timing control systems should maintain control in a higher bit error rate (BER) environment so as to obtain a sufficient error correction performance. This paper presents new digital demodulator structure satisfying above mentioned requirements by using digital signal processors. A proposed demodulator has a new adaptive PLL called 'Beatless Pull-In PLL', and a highly reliable 'carrier detector' to detect carrier portion of preamble. A proposed demodulator has been manufactured, and a misacquisition probability was experimentally verified to be less than .0025 at C/N = 3 dB (Eb/N(0) = 0db).

  1. VizieR Online Data Catalog: Early-type EBs with intermediate orbital periods (Moe+, 2015)

    Science.gov (United States)

    Moe, M.; Di Stefano, R.

    2017-09-01

    In this study, we select the NB~96000 systems in the OGLE-I catalog (Udalski et al. 2008AcA....58...89U) with mean magnitudes 16.0V-IP) and typical dust reddenings E(V-I)~0.1-0.3 mag toward hot young stars in the LMC (Zaritsky et al. J/AJ/128/1606), these stars have luminosities and surface temperatures that correspond to B-type MS primaries. From this sample, we analyze the 221 systems that were identified as EBs with orbital periods P=20-50 days (Graczyk et al. 2011, J/AcA/61/103). (2 data files).

  2. Modeling of Slovak Language for Broadcast News Transcription

    Directory of Open Access Journals (Sweden)

    STAŠ Ján

    2015-10-01

    Full Text Available The paper describes recent progress in the development the Slovak language models for transcription of spontaneous speech such as broadcast news, educational talks and lectures, or meetings. This work extends previous research oriented on the automatic transcription of dictated speech and brings some new extensions for improving perplexity and robustness of the Slovak language models trained on the web-based and electronic language resources for being more precise in recognition of spontaneous speech. These improvements include better text preprocessing, document classification, class-based and filled pauses modeling, web-data augmentation and fast model adaptation to the target domain. Experiments have been performed on the four different evaluation data sets, including judicial and newspaper readings, broadcast news recordings and parliament proceedings with the Slovak transcription system. Preliminary results show significant decrease of the word error rate for multiple transcription system configurations of acoustic and language models.

  3. 47 CFR 74.705 - TV broadcast analog station protection.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false TV broadcast analog station protection. 74.705... EXPERIMENTAL RADIO, AUXILIARY, SPECIAL BROADCAST AND OTHER PROGRAM DISTRIBUTIONAL SERVICES Low Power TV, TV Translator, and TV Booster Stations § 74.705 TV broadcast analog station protection. (a) The TV broadcast...

  4. 47 CFR 73.4280 - Character evaluation of broadcast applicants.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Character evaluation of broadcast applicants. 73.4280 Section 73.4280 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Rules Applicable to All Broadcast Stations § 73.4280 Character...

  5. 47 CFR 73.4102 - FAA communications, broadcast of.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false FAA communications, broadcast of. 73.4102 Section 73.4102 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Rules Applicable to All Broadcast Stations § 73.4102 FAA communications...

  6. 47 CFR 73.1660 - Acceptability of broadcast transmitters.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Acceptability of broadcast transmitters. 73.1660 Section 73.1660 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Rules Applicable to All Broadcast Stations § 73.1660 Acceptability of...

  7. 47 CFR 15.117 - TV broadcast receivers.

    Science.gov (United States)

    2010-10-01

    ... portion of a TV broadcast receiver, tuning aids of the same type and comparable capability and quality... 47 Telecommunication 1 2010-10-01 2010-10-01 false TV broadcast receivers. 15.117 Section 15.117... TV broadcast receivers. (a) All TV broadcast receivers shipped in interstate commerce or imported...

  8. Gaze location prediction for broadcast football video.

    Science.gov (United States)

    Cheng, Qin; Agrafiotis, Dimitris; Achim, Alin M; Bull, David R

    2013-12-01

    The sensitivity of the human visual system decreases dramatically with increasing distance from the fixation location in a video frame. Accurate prediction of a viewer's gaze location has the potential to improve bit allocation, rate control, error resilience, and quality evaluation in video compression. Commercially, delivery of football video content is of great interest because of the very high number of consumers. In this paper, we propose a gaze location prediction system for high definition broadcast football video. The proposed system uses knowledge about the context, extracted through analysis of a gaze tracking study that we performed, to build a suitable prior map. We further classify the complex context into different categories through shot classification thus allowing our model to prelearn the task pertinence of each object category and build the prior map automatically. We thus avoid the limitation of assigning the viewers a specific task, allowing our gaze prediction system to work under free-viewing conditions. Bayesian integration of bottom-up features and top-down priors is finally applied to predict the gaze locations. Results show that the prediction performance of the proposed model is better than that of other top-down models that we adapted to this context.

  9. EBAA: An efficient broadcast authentication scheme for ADS-B communication based on IBS-MR

    Directory of Open Access Journals (Sweden)

    Yang Haomiao

    2014-06-01

    Full Text Available Automatic dependent surveillance-broadcast (ADS-B systems can broadcast satellite-based aircraft position, identification, etc., periodically, and are now on track to replace radar to become the backbone of next-generation air traffic management (ATM systems. However, ADS-B systems suffer severe cyber-security problems due to the broadcast-type data link and the lack of designed-in security measures. Especially, since ADS-B messages are unauthenticated, it is easy to insert fake aircraft into a system via spoofing or insertion of false messages. Unfortunately, the authentication for ADS-B messages has not yet been well studied. In this paper, based on identity-based signature with message recovery (IBS-MR, an efficient broadcast authentication scheme for ADS-B messages is proposed. The security analysis demonstrates that the scheme can achieve authenticity and integrity of ADS-B broadcast messages, as well as adaptive evolution of broadcasters’ private keys. The performance evaluation shows that the scheme is computationally efficient for typical avionics devices with limited resources. Furthermore, the scheme achieves low communication overhead since broadcast messages can be recovered from signatures, and thus it is suitable for low-bandwidth ADS-B data link.

  10. Madis Habakuk : aasta pärast alustab EBS Indias / Madis Habakuk ; interv. Taivo Paju

    Index Scriptorium Estoniae

    Habakuk, Madis, 1938-

    2003-01-01

    EBS Grupp tegutseb juba Hiinas ning kavatseb laieneda Indiasse. EBS Grupi president selgitab, kuidas toimub töötajate juhtimine ja kontroll suure vahemaa tagant, milline peaks olema usalduse ja kontrolli vahekord, ning mida mõista lojaalsuse all ettevõttes

  11. The Digital Dividend of Terrestrial Broadcasting

    CERN Document Server

    Beutler, Roland

    2012-01-01

    The “digital revolution” of the last two decades has pervaded innumerable aspects of our daily lives and changed our planet irreversibly. The shift from analog to digital broadcasting has facilitated a seemingly infinite variety of new applications—audience interactivity being but one example. The greater efficiency and compression of digital media have endowed broadcasters with a “digital dividend” of spare transmission capacity over and above the requirements of terrestrial broadcasting. The question is, who will use it, and how? Comparing the European experience with that of broadcasters elsewhere in the world, the author sketches the current status of international frequency management, quantifies the value of the “dividend” itself, analyzes the details of the analog-to-digital switchovers already completed, and posits what the future holds for the sector. As we grapple with new devices, inconceivable a mere generation ago, that allow us to access digital media instantly, anywhere and at any...

  12. Injection molded optical backplane for broadcast architecture

    Science.gov (United States)

    Rosenberg, Paul; Mathai, Sagi; Sorin, Wayne V.; McLaren, Moray; Straznicky, Joseph; Panotopoulos, Georgios; Warren, David; Morris, Terry; Tan, Michael R. T.

    2012-01-01

    A low cost, blind mate, injection molded optical backplane is presented. The optical backplane is comprised of 12 channel optical broadcast buses, operating at 10Gbps/channel with six blindmate optical output ports spaced 1U apart.

  13. 8 CFR 204.13 - How can the International Broadcasting Bureau of the United States Broadcasting Board of...

    Science.gov (United States)

    2010-01-01

    ... description of the job to be performed; and (ii) The broadcasting expertise held by the alien, including how... the BBG, may petition for an alien (and the alien's accompanying spouse and children) to work as a... broadcasts; hosts for news broadcasts, news analysis, editorial and other broadcast features; or a news...

  14. Farm broadcasters call for regional network.

    Science.gov (United States)

    1989-03-01

    The United Nations Economic and Social Commission for Asia and the Pacific (ESCAP) laid the groundwork for a 5 day symposium on farm broadcasting in Bangkok in November 1988. ESCAP Executive Secretary S.A.M.S. Kibria discussed in his statement the idea of a regional rural broadcasting network for Asia and the Pacific. Several other pertinent points stated the following: Government funding was needed to support rural broadcasting; special funding and attention needs to be devoted to disadvantaged groups and marginal farmers; broadcasting should play a more significant role in South Pacific islands where it would not educate but also bring the people together. It was suggested that a proposed training manual for basic radio operation be printed in the local languages. Since 1980, there have 14 seminar-training programs held throughout Asia and the Pacific. Workshops open dialogue on ways to coordinate government support and rural interests in radio programming. As well, rural broadcasters learn how to sharpen their skills and keep audiences interested. Correctly implemented and adequately funded, agricultural broadcast programs could improve the lives of millions in the Pacific and Asia.

  15. Three-dimensional television: a broadcaster's perspective

    Science.gov (United States)

    Jolly, S. J. E.; Armstrong, M.; Salmon, R. A.

    2009-02-01

    The recent resurgence of interest in the stereoscopic cinema and the increasing availability to the consumer of stereoscopic televisions and computer displays are leading broadcasters to consider, once again, the feasibility of stereoscopic broadcasting. High Definition Television is now widely deployed, and the R&D departments of broadcasters and consumer electronics manufacturers are starting to plan future enhancements to the experience of television. Improving the perception of depth via stereoscopy is a strong candidate technology. In this paper we will consider the challenges associated with the production, transmission and display of different forms of "three-dimensional" television. We will explore options available to a broadcaster wishing to start a 3D service using the technologies available at the present time, and consider how they could be improved to enable many more television programmes to be recorded and transmitted in a 3D-compatible form, paying particular attention to scenarios such as live broadcasting, where the workflows developed for the stereoscopic cinema are inapplicable. We will also consider the opportunities available for broadcasters to reach audiences with "three-dimensional" content via other media in the near future: for example, distributing content via the existing stereoscopic cinema network, or over the Internet to owners of stereoscopic computer displays.

  16. On the secrecy capacity of the broadcast wiretap channel with limited CSI feedback

    KAUST Repository

    Hyadi, Amal

    2016-10-27

    In this paper, we investigate the problem of secure broadcasting over block-fading channels with limited channel knowledge at the transmitter. More particularly, we analyze the effect of having imperfect channel state information (CSI) via a finite rate feedback on the throughput of a broadcast channel where the transmission is intended for multiple legitimate receivers in the presence of an eavesdropper. First, we partially characterize the ergodic secrecy capacity of the system when the source broadcasts the same information to all the receivers, i.e., common message transmission. Then, we look at the independent messages case, where the transmitter broadcasts multiple independent messages to the legitimate receivers. For this case, we present lower and upper bounds on the ergodic secrecy sum-capacity. In both scenarios, we show that the proposed lower and upper bounds coincide asymptotically as the capacity of the feedback links becomes large, hence, fully characterizing the secrecy capacity in this case.

  17. Broadcasting collective operation contributions throughout a parallel computer

    Science.gov (United States)

    Faraj, Ahmad [Rochester, MN

    2012-02-21

    Methods, systems, and products are disclosed for broadcasting collective operation contributions throughout a parallel computer. The parallel computer includes a plurality of compute nodes connected together through a data communications network. Each compute node has a plurality of processors for use in collective parallel operations on the parallel computer. Broadcasting collective operation contributions throughout a parallel computer according to embodiments of the present invention includes: transmitting, by each processor on each compute node, that processor's collective operation contribution to the other processors on that compute node using intra-node communications; and transmitting on a designated network link, by each processor on each compute node according to a serial processor transmission sequence, that processor's collective operation contribution to the other processors on the other compute nodes using inter-node communications.

  18. EB1 recognizes the nucleotide state of tubulin in the microtubule lattice.

    Directory of Open Access Journals (Sweden)

    Marija Zanic

    Full Text Available Plus-end-tracking proteins (+TIPs are localized at the fast-growing, or plus end, of microtubules, and link microtubule ends to cellular structures. One of the best studied +TIPs is EB1, which forms comet-like structures at the tips of growing microtubules. The molecular mechanisms by which EB1 recognizes and tracks growing microtubule ends are largely unknown. However, one clue is that EB1 can bind directly to a microtubule end in the absence of other proteins. Here we use an in vitro assay for dynamic microtubule growth with two-color total-internal-reflection-fluorescence imaging to investigate binding of mammalian EB1 to both stabilized and dynamic microtubules. We find that under conditions of microtubule growth, EB1 not only tip tracks, as previously shown, but also preferentially recognizes the GMPCPP microtubule lattice as opposed to the GDP lattice. The interaction of EB1 with the GMPCPP microtubule lattice depends on the E-hook of tubulin, as well as the amount of salt in solution. The ability to distinguish different nucleotide states of tubulin in microtubule lattice may contribute to the end-tracking mechanism of EB1.

  19. Radio broadcasting: a conceptual challenge in Latin America

    Directory of Open Access Journals (Sweden)

    Nelia R. Del Bianco

    2012-12-01

    Full Text Available The objective of this paper is to present the partial results of research carried out by the Observatory of Public Radio Broadcasting of Latin America on the changes occurring in the public radio and TV systems in 10 Latin American countries, under the aspects of functioning models, management, financing, and social participation. After the rising to power of governments linked to parties from the left, we verified that communication policies are being established, which aim at closing the gap between traditional state broadcasting stations and the notion of public. This considers the principles that characterize the action of this media, determined by UNESCO (2001: universality, diversity, independence, and differentiation of content in the programming. A hundred and forty broadcasting stations were analyzed from the perspective of being public based on two criteria: those that are under the control of the State direct or indirectly, by means of concessions for use without profit for foundations, companies, and public universities; and those that receive public financing. Based on the analysis of the data, five trend tendencies were observed: the construction of a new regulatory framework; the creation of public companies instead of legal centralized state structures; the institution of relatively autonomous deliberative councils responsible for overseeing the management of the stations; the diversification of funding sources in an attempt to reverse the dependence on government resources; and the renewal of the programming with the opening for independent production.

  20. Analysis and Transceiver Design for the MIMO Broadcast Channel

    CERN Document Server

    Hunger, Raphael

    2013-01-01

    This book deals with the optimization-based joint design of the transmit and receive filters in   MIMO broadcast channel in which the user terminals may be equipped with several antenna elements. Furthermore, the maximum performance of the system in the high power regime as well as the set of all feasible quality-of-service requirements is analyzed. First, a fundamental duality is derived that holds between the MIMO broadcast channel and virtual MIMO multiple access channel. This duality construct allows for the efficient solution of problems originally posed in the broadcast channel in the dual domain where a possibly hidden convexity can often be revealed. On the basis of the established duality result, the gradient-projection algorithm is introduced as a tool to solve constrained optimization problems to global optimality under certain conditions. The gradient-projection tool is then applied to solving the weighted sum rate maximization problem which is a central optimization that arises in any network u...

  1. Energy-Efficient Broadcasting Scheme for Smart Industrial Wireless Sensor Networks

    Directory of Open Access Journals (Sweden)

    Zhuangbin Chen

    2017-01-01

    Full Text Available In smart Industrial Wireless Sensor Networks (IWSNs, sensor nodes usually adopt a programmable technology. These smart devices can obtain new or special functions by reprogramming: they upgrade their soft systems through receiving new version of program codes. If sensor nodes need to be upgraded, the sink node will propagate program code packets to them through “one-to-many” broadcasting, and therefore new capabilities can be obtained, forming the so-called Software Defined Network (SDN. However, due to the high volume of code packet, the constraint energy of sensor node, and the unreliable link quality of wireless network, rapidly broadcasting the code packets to all nodes in network can be a challenge issue. In this paper, a novel Energy-efficient Broadcast scheme with adjustable broadcasting radius is proposed aiming to improve the performance of network upgrade. In our scheme, the nonhotspots sensor nodes take full advantage of their residual energy caused in data collection period to improve the packet reception probability and reduce the broadcasting delay of code packet transmission by enlarging the broadcasting radius, that is, the transmitting power. The theoretical analyses and experimental results show that, compared with previous work, our approach can averagely reduce the Network Upgrade Delay (NUD by 14.8%–45.2% and simultaneously increase the reliability without harming the lifetime of network.

  2. Adaptive Security of Broadcast Encryption, Revisited

    Directory of Open Access Journals (Sweden)

    Bingxin Zhu

    2017-01-01

    Full Text Available We provide a strong security notion for broadcast encryption, called adaptive security in the multichallenge setting (MA-security, where the adversary can adaptively have access to the key generation oracle and the encryption oracle many times (multichallenge. The adversary specially can query for the challenge ciphertexts on different target user sets adaptively, which generalizes the attacks against broadcast encryptions in the real world setting. Our general result shows that the reduction of the adaptive secure broadcast encryption will lose a factor of q in the MA setting, where q is the maximum number of encryption queries. In order to construct tighter MA-secure broadcast encryptions, we investigate Gentry and Water’s transformation and show that their transformation can preserve MA-security at the price of reduction loss on the advantage of the underlying symmetric key encryption. Furthermore, we remove the q-type assumption in Gentry and Water’s semistatically secure broadcast encryption by using Hofheinz-Koch-Striecks techniques. The resulting scheme instantiated in a composite order group is MA-secure with constant-size ciphertext header.

  3. Broadcast design in cognitive radio ad hoc networks

    CERN Document Server

    Song, Yi

    2014-01-01

    This SpringerBrief investigates the special challenges of broadcast design in cognitive radio (CR) ad hoc networks. It introduces two broadcast protocols in CR ad hoc networks: a quality-of-service based broadcast protocol under blind information and a fully-distributed broadcast protocol with collision avoidance. A novel unified analytical model is also presented to analyze the performance of the broadcast protocols. This is the first book dedicated to the unique broadcast design challenges in CR ad hoc networks. The authors also discuss the recent research on the performance analysis of broa

  4. Direct/community broadcast projects using space satellites

    Science.gov (United States)

    Frutkin, A. W.

    1975-01-01

    A review is presented of direct/community broadcast projects which are currently in preparation in India, Canada, and Japan. It is shown that the satellite broadcast experiments involved are conducted for practical domestic reasons. The broadcast activities in all three projects will not reach other countries' TV receivers unless those countries take deliberate steps to enable themselves to receive such broadcasts. It is pointed out that for technological reasons problems of intrusion and interference connected with the use of satellites in broadcast operations may be much easier to handle than similar problems related to conventional radio broadcasting.

  5. Boundary condition effects on the concept of EBS (substitute fuel) plants; Einfluss der Rahmenbedingungen auf das Konzept von EBS-Kraftwerken

    Energy Technology Data Exchange (ETDEWEB)

    Seeger, H.; Oldhafer, N. [umwelttechnik und ingenieure GmbH, Hannover (Germany)

    2006-07-01

    The lecture aims to develop the basic boundary conditions for the concept planning of EBS (Ersatzbrennstoff: substitute fuel) power plants based on existing experience of several projects. The following topics are discussed: the conceptual differences between an EBS plant and a waste incineration plant, the specific features of the fuel, the projected plant site, the appropriate engineering technology, vessel and firing equipment, fuel accumulation and storage. The analysis of the boundary conditions allows the development of an adequate conceptual design that can initiate further planning phases.

  6. Data of evolutionary structure change: 1I5EB-1XTVC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I5EB-1XTVC 1I5E 1XTV B C GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIET...PMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG-- EE HHHHHHHHHHH... 1XTV C 1XTVC 1XTV C 1XTVC 1XTV C 1XTVC

  7. Data of evolutionary structure change: 1I5EB-1XTVD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I5EB-1XTVD 1I5E 1XTV B D GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIET...PMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG-- EE HHHHHHHHHHH... 1XTV D 1XTVD 1XTV D 1XTVD 1XTV D 1XTVD

  8. Data of evolutionary structure change: 1I5EB-1XTVB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I5EB-1XTVB 1I5E 1XTV B B GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIET...PMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG-- EE HHHHHHHHHHH... 1XTV B 1XTVB 1XTV B 1XTVB 1XTV B 1XTVB

  9. Data of evolutionary structure change: 1I5EB-1XTVE [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I5EB-1XTVE 1I5E 1XTV B E GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIET...PMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG-- EE HHHHHHHHHHH... 1XTV E 1XTVE 1XTV E 1XTVE 1XTV E 1XTVE

  10. Data of evolutionary structure change: 1I5EB-1XTVG [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I5EB-1XTVG 1I5E 1XTV B G GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIET...PMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG-- EE HHHHHHHHHHH... 1XTV G 1XTVG 1XTV G 1XTVG 1XTV G 1XTVG

  11. Data of evolutionary structure change: 1I5EB-1XTVF [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I5EB-1XTVF 1I5E 1XTV B F GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIET...PMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG-- EE HHHHHHHHHHH... 1XTV F 1XTVF 1XTV F 1XTVF 1XTV F 1XTVF

  12. Data of evolutionary structure change: 1I5EB-1XTVH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I5EB-1XTVH 1I5E 1XTV B H GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIET...PMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG-- EE HHHHHHHHHHH... 1XTV H 1XTVH 1XTV H 1XTVH 1XTV H 1XTVH

  13. Data of evolutionary structure change: 1I5EB-1XTVA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I5EB-1XTVA 1I5E 1XTV B A GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIET...PMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG-- EE HHHHHHHHHHH... 1XTV A 1XTVA 1XTV A 1XTVA 1XTV A 1XTVA

  14. Nord ja EBS tahavad liituda Tallinna Ülikooliga / Igor Taro, Anu Mõistlik

    Index Scriptorium Estoniae

    Taro, Igor

    2001-01-01

    Erakõrgkoolid Akadeemia Nord ja EBS loodavad järgmisel õppeaastal saada allasutusteks Tallinna Ülikoolis, mida on asunud looma Tallinna Pedagoogikaülikool, Eesti Kunstiakadeemia ja Eesti Humanitaarinstituut

  15. Gas and RRR distribution in high purity Niobium EB welded in Ultra-High Vacuum

    Science.gov (United States)

    Anakhov, S.; Singer, X.; Singer, W.; Wen, H.

    2006-05-01

    Electron beam (EB) welding in UHV (ultra-high vacuum, 10-5÷10-8 mbar) is applied in the standard fabrication of high gradient niobium superconducting radio frequency (SRF) cavities of TESLA design. The quality of EB welding is critical for cavity performance. Experimental data of gas content (H2, O2, N2) and RRR (residual resistivity ratio) measurements in niobium (Nb) welding seams are presented. EB welding in UHV conditions allow to preserve low gas content (1÷3 wt. ppm hydrogen and 5÷7 ppm oxygen and nitrogen), essential for high values of RRR — 350÷400 units. Gas content redistribution in the electron beam welded and heat affected region take place in the welding process. Correlation between gas solubility parameters, RRR and thermal conductivity are presented. Mechanisms of gas solubility in EB welding process are discussed.

  16. Data of evolutionary structure change: 1E1EB-2RGMB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1EB-2RGMB 1E1E 2RGM B B QNGVQMLSPSEIPQRDWFPSDFTFGAATSAYQIEGAWNEDGKGESNWDHFCHNHPE...RILDGSNSDIGANSYHMYKTDVRLLKEMGMDAYRFSISWPRILPKGTKEGGINPDGIKYYRNLINLLLENGIEPYVTIFHWDVPQALEEKYGGFLDKSHK...A --------WLGGLSRAAFPKRFVFGTVTSAYQVEGMAASGGRGPSIWDAFAHT-PGNVAGNQNGDVATDQYHRYKEDVNLMKSLN...TPTSYSADWQVTYVFAK-NGKPIGPQANSNWLYIVPWGMYGCVNYIKQKYGNPTVVITENGMDQPAN----LSRDQYLRDTTRVHFYRSYLTQLKKAIDE... 2RGM B 2RGMB

  17. E.B. Forsythe National Wildlife Refuge : Annual narrative report : Calendar year 1992

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for E.B. Forsythe National Wildlife Refuge outlines Refuge accomplishments during the 1992 calendar year. The report begins with a...

  18. Translocational renal cell carcinoma (t(6;11)(p21;q12) with transcription factor EB (TFEB) amplification and an integrated precision approach: a case report.

    Science.gov (United States)

    Lilleby, Wolfgang; Vlatkovic, Ljiljana; Meza-Zepeda, Leonardo A; Revheim, Mona-Elisabeth; Hovig, Eivind

    2015-12-09

    Renal cell carcinoma with the distinct type of t(6;11)(p21;q12) translocation (transcription factor EB) is a rare neoplasm. In the present case study, we show for the first time an autophagy signature in a patient with transcription factor EB renal cell carcinoma. We attempted to characterize the mutational and expressional features of a t(6;11)(p21;q12) renal cell carcinoma, in an effort to address the potential for molecular guidance of personalized medical decision for a case in this renal cell carcinoma category. We report the case of a 42-year-old white man who had a late relapse of his renal cell carcinoma. The first diagnosis of clear cell renal carcinoma was derived from a histological examination; analyzing the metastasis and going back to the primary tumor it turned out to be a transcription factor EB-renal cell carcinoma. The treatment plan included local radiation and systemic therapy. As part of the multimodal approach, tumor samples for genetic assessment were obtained. However, there is no recommended standard therapy for transcription factor EB-renal cell carcinoma. Despite four lines of medical treatment with targeted therapy and one checkpoint inhibitor, all attempts to prolong the patient's survival failed. During the course of this unusual disease, we gained insights which, to the best of our knowledge, were unknown before in the expression of the gene signature linked to autophagy. This might in part explain the resistance to conventional targeted therapy acknowledged in our patient.

  19. POC caster: Broadcasting Agent Using Conversational Representation for Internet Community

    Science.gov (United States)

    Kubota, Hidekazu; Yamashita, Kouji; Fukuhara, Tomohiro; Nishida, Toyoaki

    We propose a broadcating agent system called {\\it POC caster} that generates understandable conversational representation from heterogeneous text-based opinions. POC caster introduces an opinion of a community member by a conversational method in Public Opinion Channel(POC) that is an interactive broadcasting system supporting community knowledge creation. The way to generate conversational representation from an opinion is consist of two processes. The first process is an analysis of an intention of the opinion by referring the last word of a sentence. The second process is applying some rules about intentions and positions of the sentences to make an understandable conversation. The psychological experiments about understandability of generated conversations are described.

  20. The Use of Television Format Adaptation in Denmark: Public Service Broadcasters Compared to Commercial Broadcasters

    DEFF Research Database (Denmark)

    Jensen, Pia Majbritt

    , a quantitative analysis of PSB and commercial schedules in Denmark is presented to establish the extent to which PSBs have employed formats between 2000 and 2012, and how this compares with commercial broadcasters. Secondly, a qualitative analysis looks into genre and the nature of the individual formats...... employed to assess any important differences between the formats in the two sectors. Most formats fall within entertainment and is well suited to providing the consumption friendly environment that commercial broadcasters seek to offer their advertising clients (Brennan 2012). Broadcasters also favour...

  1. Inhibition of hepatocellular cancer by EB1089: in vitro and in vive study.

    Science.gov (United States)

    Ghous, Zahid; Akhter, Javed; Pourgholami, Mohammad H; Morris, David L

    2008-01-01

    Despite significant antiproliferative potential, clinical application of 1,25 dihydroxy vitamin D3 [1,25(OH)2VD3] in the treatment of cancer has been hindered due to the development of hypercalcemia. Various derivatives of 1,25(OH)2VD3 have been synthesized to overcome this side-effect. Seocalcitol (EB1089) is a vitamin D analog that has been extensively studied and shown to have profoundly reduced hypercalcemic effects. Here the effects of EB1089 were evaluated in Hep 3B, SKHEP-1, PLC/PRF/5, HTC and Novikoff hepatocellular cancer (HCC) cell lines. In vitro, cells were treated with different concentrations of EB1089 (1-1000 nM). Analytical tests were then performed including cell count and 3H thymidine assay. For in vivo analysis, SKHEP-1 cells were xenografted into nude male mice. Twenty-four hours after inoculation, mice were randomly assigned to a control group (n=10) or one of the treatment groups (3 groups of 10 mice) receiving 0.02, 0.1 or 0.5 microg/kg/day of EB1089. Control animals received the vehicle (propylene glycol). To minimize the number of intraperitoneal injections, oral and intraperitoneal routes were used on alternate days. Tumor size was measured every third day and the volumes were estimated using the formula 0.5 x length x (width)2. In vitro: Proliferation of Hep 3B, PLC/PRF/5 and SKHEP-1 HCC cells was significantly inhibited at all EB1089 concentrations tested, while HTC cells only responded to 1000 nM concentration of EB1089. Proliferation of Novikoff cells was unaffected by the drug at all concentrations examined. In vivo: EB1089 effectively inhibited SKHEP-1 tumor growth without inducing hypercalcemia (p<0.05). Results of the present study indicate that EB1089 is an effective growth inhibitor of HCC tumors.

  2. Current Status and Performance Tests of Korea Heat Load Test Facility KoHLT-EB

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Sukkwon; Jin, Hyunggon; Shin, Kyuin; Choi, Boguen; Lee, Eohwak; Yoon, Jaesung; Lee, Dongwon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kim, Duckhoi; Cho, Seungyon [National Fusion Research Institute, Daejeon (Korea, Republic of)

    2013-05-15

    A commissioning test has been scheduled to establish the installation and preliminary performance experiments of the copper hypervapotron mockups. And a qualification test will be performed to evaluate the CuCrZr duct liner in the ITER neutral beam injection facility and the ITER first wall small-scale mockups of the semi-prototype, at up to 1.5 and 5 MW/m{sup 2} high heat flux. Also, this system will be used to test other PFCs for ITER and materials for tokamak reactors. Korean high heat flux test facility(KoHLT-EB; Korea Heat Load Test facility - Electron Beam) by using an electron beam system has been constructed in KAERI to perform the qualification test for ITER blanket FW semi-prototype mockups, hypervapotron cooling devices in fusion devices, and other ITER plasma facing components. The commissioning and performance tests with the supplier of e-gun system have been performed on November 2012. The high heat flux test for hypervapotron cooling device and calorimetry were performed to measure the surface heat flux, the temperature profile and cooling performance. Korean high heat flux test facility for the plasma facing components of nuclear fusion machines will be constructed to evaluate the performance of each component. This facility for the plasma facing materials will be equipped with an electron beam system with a 60 kV acceleration gun.

  3. 76 FR 42573 - Radio Broadcasting Services; Oklahoma and Texas

    Science.gov (United States)

    2011-07-19

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Oklahoma and Texas AGENCY: Federal Communications... Review filed by Rawhide Radio, LLC, Capstar TX Limited Partnership, Clear Channel Broadcasting Licenses...

  4. 76 FR 67375 - Radio Broadcasting Services; Various Locations

    Science.gov (United States)

    2011-11-01

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Various Locations AGENCY: Federal Communications..., Radio broadcasting. Federal Communications Commission. Nazifa Sawez, Assistant Chief, Audio Division... the new application procedures for radio stations to change their communities of license. However...

  5. 76 FR 71430 - Automatic Dependent Surveillance Broadcast (ADS-B)

    Science.gov (United States)

    2011-11-17

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Automatic Dependent Surveillance Broadcast (ADS-B) AGENCY: Department of.... FOR FURTHER INFORMATION CONTACT: Doug Arbuckle, Chief Scientist, Surveillance & Broadcast Services Pgm...

  6. 76 FR 3875 - Television Broadcasting Services; Decatur, IL

    Science.gov (United States)

    2011-01-21

    ... From the Federal Register Online via the Government Publishing Office ] FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Television Broadcasting Services; Decatur, IL AGENCY: Federal Communications... 73 Television, Television broadcasting. For the reasons discussed in the preamble, the Federal...

  7. 76 FR 5290 - Television Broadcasting Services; Huntsville, AL

    Science.gov (United States)

    2011-01-31

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Television Broadcasting Services; Huntsville, AL AGENCY: Federal Communications... Part 73 Television, Television broadcasting. For the reasons discussed in the preamble, the Federal...

  8. 76 FR 5120 - Television Broadcasting Services; El Paso, TX

    Science.gov (United States)

    2011-01-28

    ... From the Federal Register Online via the Government Publishing Office ] FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Television Broadcasting Services; El Paso, TX AGENCY: Federal Communications... 73 Television, Television broadcasting. For the reasons discussed in the preamble, the Federal...

  9. 75 FR 67077 - Television Broadcasting Services; Huntsville, AL

    Science.gov (United States)

    2010-11-01

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Television Broadcasting Services; Huntsville, AL AGENCY: Federal Communications... 73 Television, Television broadcasting. For the reasons discussed in the preamble, the Federal...

  10. 76 FR 13966 - Television Broadcasting Services; Topeka, KS

    Science.gov (United States)

    2011-03-15

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Television Broadcasting Services; Topeka, KS AGENCY: Federal Communications... 73 Television, Television broadcasting. Federal Communications Commission. Barbara A. Kreisman, Chief...

  11. 76 FR 54188 - Television Broadcasting Services; Montgomery, AL

    Science.gov (United States)

    2011-08-31

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Television Broadcasting Services; Montgomery, AL AGENCY: Federal Communications... 73 Television, Television broadcasting. Federal Communications Commission. Barbara A. Kreisman, Chief...

  12. 75 FR 3695 - Television Broadcasting Services; Birmingham, AL

    Science.gov (United States)

    2010-01-22

    ... COMMISSION 47 CFR Part 73 Television Broadcasting Services; Birmingham, AL AGENCY: Federal Communications... Alabama Educational Television Commission (``AETC''), the licensee of noncommercial educational station... 73 Television, Television broadcasting. For the reasons discussed in the preamble, the Federal...

  13. 76 FR 76337 - Television Broadcasting Services; Lincoln, NE

    Science.gov (United States)

    2011-12-07

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Television Broadcasting Services; Lincoln, NE AGENCY: Federal Communications... 73 Television, Television broadcasting. Federal Communications Commission Barbara A. Kreisman, Chief...

  14. 78 FR 266 - Radio Broadcasting Services; Maysville, GA

    Science.gov (United States)

    2013-01-03

    ...-270; RM-11676; DA 12-2024] Radio Broadcasting Services; Maysville, GA AGENCY: Federal Communications Commission. ACTION: Final rule. SUMMARY: The Audio Division, at the request of Appalachian Broadcasting... Review Act, see 5 U.S.C. 801(a)(1)(A). List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting...

  15. 75 FR 63431 - Radio Broadcasting Services; Willow Creek, CA

    Science.gov (United States)

    2010-10-15

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Willow Creek, CA AGENCY: Federal Communications... 47 CFR Part 73 Radio, Radio broadcasting. For the reasons discussed in the preamble, the Federal Communications Commission proposes to amend 47 CFR part 73 as follows: PART 73--RADIO BROADCAST SERVICES 1. The...

  16. 77 FR 58799 - Radio Broadcasting Services; Roaring Springs, TX

    Science.gov (United States)

    2012-09-24

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Roaring Springs, TX AGENCY: Federal Communications... 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications Commission. Nazifa Sawez, Assistant... Communications Commission proposes to amend 47 CFR part 73 as follows: PART 73--RADIO BROADCAST SERVICES 1. The...

  17. 78 FR 71557 - Radio Broadcasting Services; Tohatchi, New Mexico

    Science.gov (United States)

    2013-11-29

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Tohatchi, New Mexico AGENCY: Federal Communications... Radio, Radio broadcasting. Federal Communications Commission. Nazifa Sawez, Assistant Chief, Audio... proposes to amend 47 CFR part 73 as follows: PART 73--RADIO BROADCAST SERVICES 0 1. The authority citation...

  18. 76 FR 67397 - Radio Broadcasting Services; Llano, Texas

    Science.gov (United States)

    2011-11-01

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Llano, Texas AGENCY: Federal Communications Commission... 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications Commission. Nazifa Sawez, Assistant... Communications Commission proposes to amend 47 CFR part 73 as follows: PART 73--RADIO BROADCAST SERVICES 1. The...

  19. 78 FR 25591 - Radio Broadcasting Services; Crownpoint, New Mexico

    Science.gov (United States)

    2013-05-02

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Crownpoint, New Mexico AGENCY: Federal Communications... Act, see U.S.C. 801(a)(1)(A). List of Subjects in 47 CFR part 73 Radio, Radio broadcasting. Federal...--RADIO BROADCAST SERVICES 0 1. The authority citation for Part 73 continues to read as follows: Authority...

  20. 77 FR 50630 - Radio Broadcasting Services; Westfield, NY

    Science.gov (United States)

    2012-08-22

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Westfield, NY AGENCY: Federal Communications... Review Act, see 5 U.S.C. 801(a)(1)(A). List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting...: PART 73--RADIO BROADCAST SERVICES 0 1. The authority citation for part 73 continues to read as follows...

  1. 75 FR 62690 - Radio Broadcasting Services; Grants Pass, Oregon

    Science.gov (United States)

    2010-10-13

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Grants Pass, Oregon AGENCY: Federal Communications Commission. ACTION: Final rule. SUMMARY: The Audio Division, at the request of Three Rivers Broadcasting LLC...(a)(1)(A). List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. 0 For the reasons discussed...

  2. 77 FR 32900 - Radio Broadcasting Services; Llano, TX

    Science.gov (United States)

    2012-06-04

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Llano, TX AGENCY: Federal Communications Commission... Congressional Review Act, see U.S.C. 801(a)(1)(A). List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting...: PART 73--RADIO BROADCAST SERVICES 0 1. The authority citation for part 73 continues to read as follows...

  3. 75 FR 76293 - Radio Broadcasting Services; Peach Springs, AZ

    Science.gov (United States)

    2010-12-08

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Peach Springs, AZ AGENCY: Federal Communications... CFR Part 73 Radio, Radio broadcasting. 0 As stated in the preamble, the Federal Communications Commission amends 47 CFR part 73 as follows: PART 73--RADIO BROADCAST SERVICES 0 1. The authority citation...

  4. 78 FR 32 - Radio Broadcasting Services; Westley, CA

    Science.gov (United States)

    2013-01-02

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Westley, CA AGENCY: Federal Communications Commission.... 8. List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications Commission... Federal Communications Commission amends 47 CFR Part 73 as follows: PART 73--RADIO BROADCAST SERVICES 0 1...

  5. 47 CFR 74.102 - Uses of experimental broadcast stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Uses of experimental broadcast stations. 74.102 Section 74.102 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES EXPERIMENTAL RADIO, AUXILIARY, SPECIAL BROADCAST AND OTHER PROGRAM DISTRIBUTIONAL SERVICES Experimental...

  6. 47 CFR 1.502 - Emergency Broadcast Authorizations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Emergency Broadcast Authorizations. 1.502 Section 1.502 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL PRACTICE AND PROCEDURE Broadcast Applications and Proceedings § 1.502 Emergency Broadcast Authorizations. See § 73.913. General Filing...

  7. 47 CFR 74.101 - Experimental broadcast station.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Experimental broadcast station. 74.101 Section 74.101 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES EXPERIMENTAL RADIO, AUXILIARY, SPECIAL BROADCAST AND OTHER PROGRAM DISTRIBUTIONAL SERVICES Experimental...

  8. 47 CFR 101.1403 - Broadcast carriage requirements.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Broadcast carriage requirements. 101.1403... GHz Band § 101.1403 Broadcast carriage requirements. MVDDS licensees are not required to provide all... must-carry rules, nor the local signal carriage requirements of the Rural Local Broadcast Signal Act...

  9. 77 FR 73461 - Commission Seeks Comment on Broadcast Ownership Report

    Science.gov (United States)

    2012-12-10

    ... COMMISSION Commission Seeks Comment on Broadcast Ownership Report AGENCY: Federal Communications Commission... the Media Bureau's recently released report on the ownership of commercial broadcast stations, which... contained in the Media Bureau's recently released report on the ownership of commercial broadcast stations...

  10. 78 FR 25861 - Radio Broadcasting Services; Peach Springs, Arizona

    Science.gov (United States)

    2013-05-03

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Peach Springs, Arizona AGENCY: Federal Communications....S.C. 801(a)(1)(A). List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal...--RADIO BROADCAST SERVICES 0 1. The authority citation for Part 73 continues to read as follows: Authority...

  11. 78 FR 40402 - Radio Broadcasting Services; Roaring Springs, Texas

    Science.gov (United States)

    2013-07-05

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Roaring Springs, Texas AGENCY: Federal Communications... Table of Allotments and Changes of Community of License in the Radio Broadcast Services, 71 FR 76208, published December 20, 2006. List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal...

  12. 76 FR 36384 - Radio Broadcasting Services; Brackettville, TX

    Science.gov (United States)

    2011-06-22

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Brackettville, TX AGENCY: Federal Communications..., see 5 U.S.C. 801(a)(1)(A). List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal...--RADIO BROADCAST SERVICES 0 1. The authority citation for part 73 continues to read as follows: Authority...

  13. 78 FR 36683 - Radio Broadcasting Services; Summit, Mississippi

    Science.gov (United States)

    2013-06-19

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Summit, Mississippi AGENCY: Federal Communications... U.S.C. 801(a)(1)(A). List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal... Broadcasting, allots FM Channel 228A ] as a first local service at Summit, Mississippi. To accommodate that...

  14. 77 FR 58800 - Radio Broadcasting Services; Knox City, TX

    Science.gov (United States)

    2012-09-24

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Knox City, TX AGENCY: Federal Communications....415 and 1.420. ] List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications... Commission requests comment on a petition filed by Big Cat Broadcasting, LLC, proposing to amend the Table of...

  15. 75 FR 41123 - Radio Broadcasting Services; Gearhart, OR

    Science.gov (United States)

    2010-07-15

    ... COMMISSION 47 CFR Part 73 . Radio Broadcasting Services; Gearhart, OR AGENCY: Federal Communications... Radio, Radio broadcasting. For the reasons discussed in the preamble, the Federal Communications... comment on a petition filed by Black Hills Broadcasting, L.P. proposing the allotment of FM Channel 243A...

  16. 76 FR 13524 - Radio Broadcasting Services; Willow Creek, CA

    Science.gov (United States)

    2011-03-14

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Willow Creek, CA AGENCY: Federal Communications... Congressional Review Act, see U.S.C. 801(a)(1)(A). List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting... as follows: PART 73--RADIO BROADCAST SERVICES 0 1. The authority citation for part 73 continues to...

  17. 75 FR 76294 - Radio Broadcasting Services; Fairbanks, AK

    Science.gov (United States)

    2010-12-08

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Fairbanks, AK AGENCY: Federal Communications... Review Act, see U.S.C. 801(a)(1)(A). List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. 0 For... follows: PART 73--RADIO BROADCAST SERVICES 0 1. The authority citation for Part 73 continues to read as...

  18. 76 FR 37049 - Radio Broadcasting Services; Bastrop, LA

    Science.gov (United States)

    2011-06-24

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Bastrop, LA AGENCY: Federal Communications Commission... Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications Commission. Nazifa Sawez... Communications Commission proposes to amend 47 CFR Part 73 as follows: Part 73--Radio Broadcast Services 1. The...

  19. 78 FR 37474 - Radio Broadcasting Services; Dove Creek, Colorado

    Science.gov (United States)

    2013-06-21

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Dove Creek, Colorado AGENCY: Federal Communications... CFR Part 73 Radio, Radio broadcasting. Federal Communications Commission. Nazifa Sawez, Chief, Audio... amends 47 CFR part 73 as follows: PART 73--RADIO BROADCAST SERVICES 0 1. The authority citation for Part...

  20. 78 FR 26739 - Radio Broadcasting Services; Ehrenberg, Arizona

    Science.gov (United States)

    2013-05-08

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Ehrenberg, Arizona AGENCY: Federal Communications... Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications Commission. Nazifa Sawez... filed by S and H Broadcasting, LLC, proposing the substitution of Channel 228C2 for vacant Channel 286C2...

  1. 77 FR 23203 - Radio Broadcasting Services; Summit, MS

    Science.gov (United States)

    2012-04-18

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Summit, MS AGENCY: Federal Communications Commission... Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications Commission. Nazifa Sawez.... The Commission requests comment on a petition filed by Bowen Broadcasting, proposing to amend the...

  2. 77 FR 75946 - Radio Broadcasting Services; Dove Creek, CO

    Science.gov (United States)

    2012-12-26

    ... COMMISSION 47 CFR Part 73 . Radio Broadcasting Services; Dove Creek, CO AGENCY: Federal Communications... 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications Commission. Nazifa Sawez, Assistant... Communications Commission proposes to amend 47 CFR Part 73 as follows: PART 73--RADIO BROADCAST SERVICES 1. The...

  3. 77 FR 64758 - Radio Broadcasting Services; Randsburg, CA

    Science.gov (United States)

    2012-10-23

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Randsburg, CA AGENCY: Federal Communications... Radio, Radio broadcasting. Federal Communications Commission. Nazifa Sawez, Assistant Chief, Audio... amends 47 CFR Part 73 as follows: PART 73--RADIO BROADCAST SERVICES 0 1. The authority citation for part...

  4. 77 FR 50053 - Radio Broadcasting Services; Westley, CA

    Science.gov (United States)

    2012-08-20

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Westley, CA AGENCY: Federal Communications Commission... 73 Radio, Radio broadcasting. Federal Communications Commission. Peter H. Doyle, Chief, Audio... amends 47 CFR part 73 as follows: PART 73--RADIO BROADCAST SERVICES 0 1. The authority citation for part...

  5. 78 FR 4078 - Radio Broadcasting Services; Hebbronville, TX

    Science.gov (United States)

    2013-01-18

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Hebbronville, TX AGENCY: Federal Communications... Review Act, see 5 U.S.C. 801(a)(1)(A). List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting...: PART 73--RADIO BROADCAST SERVICES 0 1. The authority citation for part 73 continues to read as follows...

  6. 75 FR 82279 - Radio Broadcasting Services; Various Locations

    Science.gov (United States)

    2010-12-30

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Various Locations AGENCY: Federal Communications... Subjects in 47 CFR Part 73 Radio, Radio broadcasting. 0 As stated in the preamble, the Federal Communications Commission amends 47 CFR part 73 as follows: PART 73--RADIO BROADCASTING SERVICES 0 1. The...

  7. Religious Broadcasting in the Middle East : Content Analysis of ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This grant will allow the Arab Media Project at Cambridge, United Kingdom, to map out and conduct a content analysis of the religious broadcasting scene in the Middle East with a view to identifying the issues covered and values advocated in religious broadcasts. Since religious broadcasting is not limited to Islamic ...

  8. The practice of participation in broadcasting for development ...

    African Journals Online (AJOL)

    Key words: development communication, development broadcasting, development, journalism, participatory broadcasting, educational broadcasting, radio for development. Journal of Social Development in Africa Vol.20(1) 2005: 77-105. http://dx.doi.org/10.4314/jsda.v20i1.23895 · AJOL African Journals Online. HOW TO ...

  9. Broadcast Journalism Education and the Capstone Experience

    Science.gov (United States)

    Tanner, Andrea; Forde, Kathy Roberts; Besley, John C.; Weir, Tom

    2012-01-01

    This study assesses the current state of the television news capstone experience in accredited journalism and mass communication programs in the United States. Specifically, the authors employed a mixed-methods approach, interviewing 20 television news capstone instructors and conducting an analysis of broadcast journalism curriculum information…

  10. Crisis of Public Broadcasting Japan's Case.

    Science.gov (United States)

    Kabira, Chosei

    The public broadcasting service in Japan, the NHK, is a nongovernmental, noncommercial, and nonprofit making organization that is financed solely by fees collected from viewing households. At present, 80% of the total number of households in Japan have a contract with NHK and 96.5% of these households have actually paid the receiving fee to NHK.…

  11. A special broadcast of CERN's Video news

    CERN Multimedia

    2003-01-01

    A special edition of CERN's video news giving a complete update on the LHC project is to be broadcast in the Main Auditorium. After your lunch make a small detour to the Main Auditorium, where you see the big picture. On 14, 15 and 16 May, between 12:30 and 14:00, a special edition of CERN's video news bulletin will be broadcast in the Main Auditorium. You will have the chance get up-to-date on the LHC project and its experiments. With four years to go before the first collisions in the LHC, the LHC Project Leader Lyn Evans will present a status report on the construction of the accelerator. The spokesmen of the five LHC experiments (ALICE, ATLAS, CMS, LHCb and TOTEM) will explain how the work is going and what the state of play will be in four years' time. This special video news broadcast is the result of collaboration between the CERN Audiovisual Service, the Photo Service and the External communication section. The broadcast will begin with a brand-new programme title sequence. And just as in the real c...

  12. Eleanor Roosevelt's Radio Broadcasts in France

    NARCIS (Netherlands)

    Luscombe, Anya|info:eu-repo/dai/nl/339641428

    2017-01-01

    Eleanor Roosevelt wrote books, thousands of newspaper and magazine articles and was a regular broadcaster. Among the radio programs she hosted, and appeared on, were several for the Voice of America. While she was a US delegate to the United Nations in Paris in 1951 and 1952, Mrs. Roosevelt

  13. Video Broadcasting Using Queue Proportional Scheduling

    Directory of Open Access Journals (Sweden)

    Dimitris Toumpakaris

    2007-01-01

    using a Markov Chain approach leading to a method for approximating the packet delay distribution. Based on the resulting distribution, it is discussed how the video encoding rate can be chosen in order to reduce the expected distortion of streams transmitted through Broadcast Channels.

  14. Irish language broadcast media: the interaction of state language policy, broadcasters and their audiences

    OpenAIRE

    Ó hIfearnáin, Tadhg

    2000-01-01

    peer-reviewed The position of Irish on the airwaves now and through recent history has always been closely linked to the strength of the language in society, its position in public opinion and national language policy and the place of the state-owned broadcaster and its subsidiary channels within the broadcasting domain. Government legislation regulates the private and voluntary sectors, which may also receive indirect state subsidies for Irish language programming. It is therefore impos...

  15. Metadata elements preferred in searching and assessing relevance of archived television broadcast by scholars and students in media studies

    DEFF Research Database (Denmark)

    Kirkegaard, Brian

    The present doctoral work concerns the investigation of three aspects of scholars’ and students’ information seeking behaviour in a television broadcast context, and the associated implications for design and construction of metadata elements in surrogate records in future broadcast retrieval.......  Knowledge about these dimensions is translated to knowledge about the access points that are appropriate in surrogate records in future broadcast retrieval systems.  The appropriate access points are the metadata elements in surrogate records that ensure that users are provided with effective retrieval...

  16. A Broadcast Channel Assignment Mechanism based on The Broadcast Tree for Multi-radio Multi-channel Wireless Mesh Networks

    Science.gov (United States)

    Xia, Yan; Zeng, Yingzhi

    2016-02-01

    This paper proposed a broadcast Channel Assignment Mechanism on base of optimized Broadcast Tree for wireless Mesh network (WMN), which is created by Branch and Bound Method. The simulations show that our algorithm not only reduces the broadcast redundancy but also avoids the potential channel interferences produced by unnecessary relay nodes.

  17. 47 CFR 0.434 - Data bases and lists of authorized broadcast stations and pending broadcast applications.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Data bases and lists of authorized broadcast... Commission § 0.434 Data bases and lists of authorized broadcast stations and pending broadcast applications. Periodically the FCC makes available copies of its data bases and lists containing information about authorized...

  18. 47 CFR 73.753 - Antenna systems.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Antenna systems. 73.753 Section 73.753 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES International Broadcast Stations § 73.753 Antenna systems. All international broadcasting stations shall operate...

  19. 47 CFR 73.3572 - Processing of TV broadcast, Class A TV broadcast, low power TV, TV translators, and TV booster...

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Processing of TV broadcast, Class A TV broadcast, low power TV, TV translators, and TV booster applications. 73.3572 Section 73.3572... Rules Applicable to All Broadcast Stations § 73.3572 Processing of TV broadcast, Class A TV broadcast...

  20. [Effects of vitamin D analogue EB1089 on proliferation and apoptosis of hepatic carcinoma cells].

    Science.gov (United States)

    Luo, Wen-jing; Chen, Jing-yuan; Xu, Wen; Zhao, Fang; Chen, Yao-ming; Shen, Xue-feng

    2004-11-01

    This study aimed at investigating the effects of vitamin D analogue EB1089 on the proliferation and apoptosis of hepatic carcinoma cells. Hepatic carcinoma cell strain G(2) (Hep-G(2)) in which prominent vitamin D receptor (VDR) mRNA could be expressed and the cell strain T (HCC-T) negative in VDR gene expression were incubated in culture media with 100 nmol/L, 10 nmol/L and 1 nmol/L EB1089 for 2 d, 4 d and 6 d, respectively. Survival and proliferation of the cells were detected by blue tetrazolium colorimetric test and plate clone-forming test, the VDR mRNA expression was determined by reverse transcription-polymerase chain reaction (RT-PCR) and apoptosis of the cells was detected by flow cytometry (FCM) and electron microscopy. EB1089 could inhibit the proliferation of hepatocellular cell line Hep-G(2) that expressed prominent vitamin D receptor mRNA, the inhibitory rate is 17.5% approximately 72.1%. On the other hand, EB1089 had no anti-proliferative effect on hepatocellular cell line HCC-T in which the gene expression of vitamin D receptors was negative. The electron microscope results showed that EB1089 could induce apoptosis of hepatocarcinoma cells and the percentages of apoptotic cells measured by flow cytometer was 21.4%. Cell cycle progression was blocked at G(1) phase with EB1089. EB1089 could inhibit proliferation of human Hep-G(2), probably through VDR, and induce apoptosis of the cells.

  1. Two-qubit quantum cloning machine and quantum correlation broadcasting

    Science.gov (United States)

    Kheirollahi, Azam; Mohammadi, Hamidreza; Akhtarshenas, Seyed Javad

    2016-11-01

    Due to the axioms of quantum mechanics, perfect cloning of an unknown quantum state is impossible. But since imperfect cloning is still possible, a question arises: "Is there an optimal quantum cloning machine?" Buzek and Hillery answered this question and constructed their famous B-H quantum cloning machine. The B-H machine clones the state of an arbitrary single qubit in an optimal manner and hence it is universal. Generalizing this machine for a two-qubit system is straightforward, but during this procedure, except for product states, this machine loses its universality and becomes a state-dependent cloning machine. In this paper, we propose some classes of optimal universal local quantum state cloners for a particular class of two-qubit systems, more precisely, for a class of states with known Schmidt basis. We then extend our machine to the case that the Schmidt basis of the input state is deviated from the local computational basis of the machine. We show that more local quantum coherence existing in the input state corresponds to less fidelity between the input and output states. Also we present two classes of a state-dependent local quantum copying machine. Furthermore, we investigate local broadcasting of two aspects of quantum correlations, i.e., quantum entanglement and quantum discord, defined, respectively, within the entanglement-separability paradigm and from an information-theoretic perspective. The results show that although quantum correlation is, in general, very fragile during the broadcasting procedure, quantum discord is broadcasted more robustly than quantum entanglement.

  2. Modification of Prim’s algorithm on complete broadcasting graph

    Science.gov (United States)

    Dairina; Arif, Salmawaty; Munzir, Said; Halfiani, Vera; Ramli, Marwan

    2017-09-01

    Broadcasting is an information dissemination from one object to another object through communication between two objects in a network. Broadcasting for n objects can be solved by n - 1 communications and minimum time unit defined by ⌈2log n⌉ In this paper, weighted graph broadcasting is considered. The minimum weight of a complete broadcasting graph will be determined. Broadcasting graph is said to be complete if every vertex is connected. Thus to determine the minimum weight of complete broadcasting graph is equivalent to determine the minimum spanning tree of a complete graph. The Kruskal’s and Prim’s algorithm will be used to determine the minimum weight of a complete broadcasting graph regardless the minimum time unit ⌈2log n⌉ and modified Prim’s algorithm for the problems of the minimum time unit ⌈2log n⌉ is done. As an example case, here, the training of trainer problem is solved using these algorithms.

  3. 75 FR 52185 - Use of Microwave for Wireless Backhaul; Provision for Additional Flexibility To Broadcast...

    Science.gov (United States)

    2010-08-24

    ... users move to digital-based systems, we question whether it makes sense to maintain regulatory... on a proposal to permit substantially spatial reuse of scarce microwave spectrum, which may permit... broadcasters and other microwave users move to digital- based systems, we question whether it makes sense to...

  4. Broadcast authentication for wireless sensor networks using nested hashing and the Chinese remainder theorem.

    Science.gov (United States)

    Eldefrawy, Mohamed Hamdy; Khan, Muhammad Khurram; Alghathbar, Khaled; Cho, Eun-Suk

    2010-01-01

    Secure broadcasting is an essential feature for critical operations in wireless sensor network (WSNs). However, due to the limited resources of sensor networks, verifying the authenticity for broadcasted messages is a very difficult issue. μTESLA is a broadcast authentication protocol, which uses network-wide loose time synchronization with one-way hashed keys to provide the authenticity verification. However, it suffers from several flaws considering the delay tolerance, and the chain length restriction. In this paper, we propose a protocol which provides broadcast authentication for wireless sensor networks. This protocol uses a nested hash chain of two different hash functions and the Chinese Remainder Theorem (CRT). The two different nested hash functions are employed for the seed updating and the key generation. Each sensor node is challenged independently with a common broadcasting message using the CRT. Our algorithm provides forward and non-restricted key generation, and in addition, no time synchronization is required. Furthermore, receivers can instantly authenticate packets in real time. Moreover, the comprehensive analysis shows that this scheme is efficient and practical, and can achieve better performance than the μTESLA system.

  5. Broadcast Authentication for Wireless Sensor Networks Using Nested Hashing and the Chinese Remainder Theorem

    Directory of Open Access Journals (Sweden)

    Eun-Suk Cho

    2010-09-01

    Full Text Available Secure broadcasting is an essential feature for critical operations in wireless sensor network (WSNs. However, due to the limited resources of sensor networks, verifying the authenticity for broadcasted messages is a very difficult issue. μTESLA is a broadcast authentication protocol, which uses network-wide loose time synchronization with one-way hashed keys to provide the authenticity verification. However, it suffers from several flaws considering the delay tolerance, and the chain length restriction. In this paper, we propose a protocol which provides broadcast authentication for wireless sensor networks. This protocol uses a nested hash chain of two different hash functions and the Chinese Remainder Theorem (CRT. The two different nested hash functions are employed for the seed updating and the key generation. Each sensor node is challenged independently with a common broadcasting message using the CRT. Our algorithm provides forward and non-restricted key generation, and in addition, no time synchronization is required. Furthermore, receivers can instantly authenticate packets in real time. Moreover, the comprehensive analysis shows that this scheme is efficient and practical, and can achieve better performance than the μTESLA system.

  6. Managing aggression in global amnesia following herpes simplex virus encephalitis: The case of E.B.

    Science.gov (United States)

    Shannon, Tracy E; Griffin, Stefanie L

    2015-01-01

    This article describes an integrative approach to the case of EB, a 33 year old male who presented with agitation, delusional ideation and global amnesia after contracting herpes simplex virus encephalitis (HSVE) while in a state prison in 2004. Although several prior case studies have described outcome following acute onset of HSVE, this case presents a unique challenge for rehabilitation in several respects. First, EB's pre-morbid history is complicated; in contrast with prior HSVE case studies that have typically involved individuals with a relatively high level of pre-morbid functioning, EB presents with limited educational attainment and a prior history of several incarcerations for violent offenses. Post-injury, his presentation includes significant verbal aggression, threats of harm toward others, physical posturing and occasional physical aggression toward his caretakers. Third, EB presents with a fixed delusion that others are constantly taking advantage of him. These features are present in the context of global amnesia and relatively intact cognitive functioning in other domains. Following a brief review of prior HSVE case studies, this study reviews the outcomes of various pharmacological, cognitive, behavioural and integrative interventions designed for management of EB's aggression and agitation.

  7. Decision making models and human factors: TOPSIS and Ergonomic Behaviors (TOPSIS-EB

    Directory of Open Access Journals (Sweden)

    Mohammad

    2017-02-01

    Full Text Available An effective safety management requires attention to human factors as well as system compo-nents which make risky or safe situations at technical components. This study evaluates and ana-lyze ergonomic behaviors in order to select the best work shift group in an Iranian process in-dustry, in 2010.The methodology was based on the Ergonomic Behavior Sampling (EBS, and TOPSIS method. After specifying the unergonomic behaviors and with reference to the results of a pilot study, a sample of 1755 was determined, with a sampling accuracy of 5% and confi-dence level of 95%. However, in order to gain more confidence, 2631 observations were collect-ed. The results indicate that 43.6% of workers’ behaviors were unergonomic. The most frequent unergonomic behavior was amusing of legs while load lifting with 83.01% of total unergonomic behaviors observations. Using TOPSIS method, the most effective shift group and the least at-tractive alternatives for intervention were selected in this company. Findings declare high number of unergonomic behaviors. Catastrophic consequences of accidents in petrochemical industry ne-cessitate attention to workers’ ergonomic behaviors in the workplace and promotion of them.

  8. A role for the autophagy regulator Transcription Factor EB in amiodarone-induced phospholipidosis.

    Science.gov (United States)

    Buratta, Sandra; Urbanelli, Lorena; Ferrara, Giuseppina; Sagini, Krizia; Goracci, Laura; Emiliani, Carla

    2015-06-01

    The antiarrhythmic agent amiodarone, a cationic amphiphilic drug, is known to induce phospholipidosis, i.e. the accumulation of phospholipids within lysosomal structures to give multi-lamellar inclusion bodies. Despite the concerns raised about phospholipidosis in the recent years, the molecular mechanisms underlying amiodarone- or other cationic amphiphilic drug-induced phospholipidosis are still under investigation. Here we demonstrated that amiodarone doses able to induce phospholiposis according to NBD-PC uptake assay (1-12 μM, 24 h) activates Transcription Factor EB (TFEB), a pivotal regulator of the autophagic pathway, in human HepG2 cells. Further evidences confirmed the effect of amiodarone on the autophagic-lysosomal system in HepG2 and BEAS-2B cells: lysosomal β-hexosaminidase isoenzymes secretion, transcriptional up-regulation of the lysosomal β-hexosaminidase α-subunit, alteration of cathepsin B, D and L intracellular maturation in a cell- and protease-specific manner. Autophagy activation was also demonstrated by increased conversion of LC3-I into LC3-II and reduced phosphorylation of the mTORC1 target S6 kinase. Besides, we provided evidence that TFEB over-expression prevents amiodarone-induced phospholipid accumulation, suggesting that this transcription factor could be a possible target to develop strategies for phospholipidosis attenuation. Copyright © 2015 Elsevier Inc. All rights reserved.

  9. Kajian implementasi radio siaran digital di Indonesia [Study of digital radio broadcasting implementation in Indonesia

    Directory of Open Access Journals (Sweden)

    Amry Daulat Gultom

    2015-12-01

    Full Text Available Peraturan Menteri Komunikasi dan Informatika RI nomor 21 tahun 2009 tentang  Standar Penyiaran Digital Untuk Penyiaran Radio pada Pita VHF di Indonesia menyatakan bahwa dalam rangka mengatasi permasalahan penggunaan frekuensi VHF Band II untuk penyiaran radio FM yang tidak sesuai dengan rencana induk, serta tidak terpenuhinya permohonan untuk penggunaan kanal frekuensi dari masyarakat, maka perlu dicarikan saluran siaran alternatif dengan menggunakan sistem penyiaran radio digital standard DAB Family. Hingga saat ini belum ada perkembangan berarti terkait implementasinya, sehingga perlu dilakukan penelitian untuk mengetahui potensi radio siaran digital, kesiapan dari sisi pemerintah, operator, dan masyarakat, dan kendala yang dihadapi serta merumuskan strategi yang akan digunakan mengatasinya. Metode analisis yang digunakan adalah SWOT dan TOWS kualitatif dari data wawancara dan studi literatur. Hasil penelitian menunjukkan bahwa pihak stasiun radio sudah siap terhadap digitalisasi radio siaran, pihak pemerintah belum begitu siap karena belum adanya regulasi pendukung Permen Kominfo tentang standard radio digital, dan masyarakat juga belum siap karena kurangnya sosialisasi dan masih susah didapatkannya perangkat penerima siaran radio digital. Pengintegrasian penerima siaran radio digital pada kendaraan bermotor roda empat dan telepon genggam yang baru dapat meningkatkan keberadaan perangkat penerima siaran radio digital.*****The Minister of Communication and Information Regulation number 21 of 2009 on Digital Broadcasting Standards for VHF Band Radio Broadcasting in Indonesia stated that in order to overcome the problems of VHF Band II frequency utilization for FM radio broadcasting that is not in accordance with the master plan, as well as non-fulfillment of the request for frequency channels utilization of the society, neeed to find alternative broadcast channel by DAB Family digital radio broadcasting system. Until now there has no

  10. An Intelligent Broadcasting Algorithm for Early Warning Message Dissemination in VANETs

    Directory of Open Access Journals (Sweden)

    Ihn-Han Bae

    2015-01-01

    Full Text Available Vehicular ad hoc network (VANET has gained much attention recently to improve road safety, reduce traffic congestion, and enable efficient traffic management because of its many important applications in transportation. In this paper, an early warning intelligence broadcasting algorithm is proposed, EW-ICAST, to disseminate a safety message for VANETs. The proposed EW-ICAST uses not only the early warning system on the basis of time to collision (TTC but also the intelligent broadcasting algorithm on the basis of fuzzy logic. Thus, the EW-ICAST resolves effectively broadcast storm problem and meets time-critical requirement. The performance of EW-ICAST is evaluated through simulation and compared with that of other alert message dissemination algorithms. From the simulation results, we know that EW-ICAST is superior to Simple, P-persistence, and EDB algorithms.

  11. Metadata for the description of broadcast assets

    DEFF Research Database (Denmark)

    Efthimiadis, Efthimis N.; Mai, Jens Erik; Burrows, Paul E.

    2003-01-01

    and media companies to deal with the creationand maintenance of metadata, indexing and controlled vocabularies required for effective Media Asset Management of broadcasts. Panelist will provide perspectives of their organization or project, for example, the CPB's PB Core metadata element set, which...... is currently under development; the Disney Nomenclature Registry at Disney Corporation; and the ViDe (video access group) MPEG-7 and Dublin Core mapping....

  12. Secure Broadcasting with Uncertain Channel State Information

    KAUST Repository

    Hyadi, Amal

    2016-01-06

    We investigate the problem of secure broadcasting over fast fading channels with imperfect main channel state information (CSI) at the transmitter. In particular, we analyze the effect of the noisy estimation of the main CSI on the throughput of a broadcast channel where the transmission is intended for multiple legitimate receivers in the presence of an eavesdropper. Besides, we consider the realistic case where the transmitter is only aware of the statistics of the eavesdropper s CSI and not of its channel s realizations. First, we discuss the common message transmission case where the source broadcasts the same information to all the receivers, and we provide an upper and a lower bounds on the ergodic secrecy capacity. For this case, we show that the secrecy rate is limited by the legitimate receiver having, on average, the worst main channel link and we prove that a non-zero secrecy rate can still be achieved even when the CSI at the transmitter is noisy. Then, we look at the independent messages case where the transmitter broadcasts multiple messages to the receivers, and each intended user is interested in an independent message. For this case, we present an expression for the achievable secrecy sum-rate and an upper bound on the secrecy sum-capacity and we show that, in the limit of large number of legitimate receivers K, our achievable secrecy sum-rate follows the scaling law log((1-a ) log(K)), where is the estimation error variance of the main CSI. The special cases of high SNR, perfect and no-main CSI are also analyzed. Analytical derivations and numerical results are presented to illustrate the obtained expressions for the case of independent and identically distributed Rayleigh fading channels.

  13. Secure Broadcasting with Uncertain Channel State Information

    KAUST Repository

    Hyadi, Amal

    2017-03-13

    We investigate the problem of secure broadcasting over fast fading channels with imperfect main channel state information (CSI) at the transmitter. In particular, we analyze the effect of the noisy estimation of the main CSI on the throughput of a broadcast channel where the transmission is intended for multiple legitimate receivers in the presence of an eavesdropper. Besides, we consider the realistic case where the transmitter is only aware of the statistics of the eavesdropper\\'s CSI and not of its channel\\'s realizations. First, we discuss the common message transmission case where the source broadcasts the same information to all the receivers, and we provide an upper and a lower bounds on the ergodic secrecy capacity. For this case, we show that the secrecy rate is limited by the legitimate receiver having, on average, the worst main channel link and we prove that a non-zero secrecy rate can still be achieved even when the CSI at the transmitter is noisy. Then, we look at the independent messages case where the transmitter broadcasts multiple messages to the receivers, and each intended user is interested in an independent message. For this case, we present an expression for the achievable secrecy sum-rate and an upper bound on the secrecy sum-capacity and we show that, in the limit of large number of legitimate receivers K, our achievable secrecy sum-rate follows the scaling law log((1-a ) log(K)), where is the estimation error variance of the main CSI. The special cases of high SNR, perfect and no-main CSI are also analyzed. Analytical derivations and numerical results are presented to illustrate the obtained expressions for the case of independent and identically distributed Rayleigh fading channels.

  14. Buryat Ethnic Mentality and National Broadcasting

    Directory of Open Access Journals (Sweden)

    Dagbaev E.D.

    2016-01-01

    Full Text Available The article focuses on ways the national (in a regional aspect broadcasting impacts ethnic mind formation and its further development, the latter issues being under a main focus of Buryat State University scholars as well. They set an objective to investigate the issue from different angles, for this reason gathering within scientific projects into scholars’groups took place. In this case the group of educators, philologists and sociologists have focused on media which construct ethnic mind via interiorizing and cultivating ethnic-related ideas and images for five years. Providing a general outlook of the world, National Broadcasting (NB is a proper institutional mechanism that helps a person identify himself / herself among different ethnic groups. Ethnic identity and self-consciousness are manifested in various social and intercultural communications. This allows a person to become aware of the peculiarities of his / her and others’ ethnic communities. The outcomes of a sociological research held by the authors verify the significance of both the posed problems and the TV role. One may find theoretical and empirical data in Zandeeva, S.K. (2012, Dagbaeva, N.Zh.(2012, Dagbaev (2014, Dashinimaeva, P.P., et al (2015. Generally, national programs do contribute to integrating people of the same ethnicity into a common community, to shaping such moral qualities as humanity, love to motherland, respect for the elders and other ethnic nationalities. All these characteristics form proper rules of living in a tolerant community. At the same time, they contribute to strengthening of the feeling of ethnic unity. Beyond any doubt, NB needs a relevant assessment and interest to promote and advance its function in a modern society. On the one hand, telecommunications markets liberalize. On the other hand, broadcasting technologies have developed to a highest extent, leading to the increase of international competition [14]. Anyway, both directions force

  15. CHAOS: User-driven Development of a Metadata Scheme for Radio Broadcast Archives

    DEFF Research Database (Denmark)

    Lykke, Marianne; Bogers, Toine; Larsen, Birger

    2013-01-01

    CHAOS (Cultural Heritage Archive Open System) is a digital platform for Danish radio broadcasts. Radio broadcasts are an important and vibrant part of our cultural heritage, but providing efficient and effective access to such archives is challenging for lack of a solid digital infrastructure....... The Danish LARM project aims to meet this challenge by making one million hours of radio programs available to humanities researchers through the digital platform CHAOS. CHAOS is being built in close cooperation with the researchers involved in LARM. In this paper, we present the user-driven development...

  16. Stochastic dynamics of genetic broadcasting networks

    Science.gov (United States)

    Potoyan, Davit A.; Wolynes, Peter G.

    2017-11-01

    The complex genetic programs of eukaryotic cells are often regulated by key transcription factors occupying or clearing out of a large number of genomic locations. Orchestrating the residence times of these factors is therefore important for the well organized functioning of a large network. The classic models of genetic switches sidestep this timing issue by assuming the binding of transcription factors to be governed entirely by thermodynamic protein-DNA affinities. Here we show that relying on passive thermodynamics and random release times can lead to a "time-scale crisis" for master genes that broadcast their signals to a large number of binding sites. We demonstrate that this time-scale crisis for clearance in a large broadcasting network can be resolved by actively regulating residence times through molecular stripping. We illustrate these ideas by studying a model of the stochastic dynamics of the genetic network of the central eukaryotic master regulator NFκ B which broadcasts its signals to many downstream genes that regulate immune response, apoptosis, etc.

  17. Fundamental limitation on quantum broadcast networks

    Science.gov (United States)

    Bäuml, Stefan; Azuma, Koji

    2017-06-01

    The ability to distribute entanglement over complex quantum networks is an important step towards a quantum internet. Recently, there has been significant theoretical effort, mainly focusing on the distribution of bipartite entanglement via a simple quantum network composed only of bipartite quantum channels. There are, however, a number of quantum information processing protocols based on multipartite rather than bipartite entanglement. Whereas multipartite entanglement can be distributed by means of a network of such bipartite channels, a more natural way is to use a more general network, that is, a quantum broadcast network including quantum broadcast channels. In this work, we present a general framework for deriving upper bounds on the rates at which GHZ states or multipartite private states can be distributed among a number of different parties over an arbitrary quantum broadcast network. Our upper bounds are written in terms of the multipartite squashed entanglement, corresponding to a generalisation of recently derived bounds (Azuma et al, (2016), Nat. Commun. 7 13523). We also discuss how lower bounds can be obtained by combining a generalisation of an aggregated quantum repeater protocol with graph theoretic concepts.

  18. Validade convergente do tipo de vivência (EB no teste de Zulliger/SC = Convergent validity evidence of the personality Style (EB in Z-test/SC

    Directory of Open Access Journals (Sweden)

    Villemor-Amaral, Anna Elisa de

    2012-01-01

    Full Text Available O Zulliger foi adaptado para o Sistema Compreensivo de Exner numa amostra brasileira, pois embora o Sistema Compreensivo tenha sido desenvolvido para codificação e interpretação do método de Rorschach, a semelhança entre as duas técnicas levou a supor que o Zulliger poderia se beneficiar das mesmas vantagens alcançadas para o Rorschach. Esse estudo tem por objetivo verificar evidências de validade convergente para a classificação do Tipo de Vivência (EB no Zulliger, por meio de correlações com o indicador EB do Rorschach. Selecionaram-se de um banco de dados 51 protocolos de adultos, de ambos os sexos, com idade, escolaridade e nível socioeconômicos variados. As pessoas responderam a técnica de Zulliger e do Rorschach em dias consecutivos, alternando-se a ordem de aplicação das técnicas. Os resultados indicaram correlações significativas, mas apontam à necessidade de estabelecer novas proporções das variáveis que compõe o EB para a técnica de Zulliger

  19. Three New Pierce's Disease Pathogenicity Effectors Identified Using Xylella fastidiosa Biocontrol Strain EB92-1.

    Directory of Open Access Journals (Sweden)

    Shujian Zhang

    Full Text Available Xylella fastidiosa (X. fastidiosa infects a wide range of plant hosts and causes economically serious diseases, including Pierce's Disease (PD of grapevines. X. fastidiosa biocontrol strain EB92-1 was isolated from elderberry and is infectious and persistent in grapevines but causes only very slight symptoms under ideal conditions. The draft genome of EB92-1 revealed that it appeared to be missing genes encoding 10 potential PD pathogenicity effectors found in Temecula1. Subsequent PCR and sequencing analyses confirmed that EB92-1 was missing the following predicted effectors found in Temecula1: two type II secreted enzymes, including a lipase (LipA; PD1703 and a serine protease (PD0956; two identical genes encoding proteins similar to Zonula occludens toxins (Zot; PD0915 and PD0928, and at least one relatively short, hemagglutinin-like protein (PD0986. Leaves of tobacco and citrus inoculated with cell-free, crude protein extracts of E. coli BL21(DE3 overexpressing PD1703 exhibited a hypersensitive response (HR in less than 24 hours. When cloned into shuttle vector pBBR1MCS-5, PD1703 conferred strong secreted lipase activity to Xanthomonas citri, E. coli and X. fastidiosa EB92-1 in plate assays. EB92-1/PD1703 transformants also showed significantly increased disease symptoms on grapevines, characteristic of PD. Genes predicted to encode PD0928 (Zot and a PD0986 (hemagglutinin were also cloned into pBBR1MCS-5 and moved into EB92-1; both transformants also showed significantly increased symptoms on V. vinifera vines, characteristic of PD. Together, these results reveal that PD effectors include at least a lipase, two Zot-like toxins and a possibly redundant hemagglutinin, none of which are necessary for parasitic survival of X. fastidiosa populations in grapevines or elderberry.

  20. Three New Pierce's Disease Pathogenicity Effectors Identified Using Xylella fastidiosa Biocontrol Strain EB92-1.

    Science.gov (United States)

    Zhang, Shujian; Chakrabarty, Pranjib K; Fleites, Laura A; Rayside, Patricia A; Hopkins, Donald L; Gabriel, Dean W

    2015-01-01

    Xylella fastidiosa (X. fastidiosa) infects a wide range of plant hosts and causes economically serious diseases, including Pierce's Disease (PD) of grapevines. X. fastidiosa biocontrol strain EB92-1 was isolated from elderberry and is infectious and persistent in grapevines but causes only very slight symptoms under ideal conditions. The draft genome of EB92-1 revealed that it appeared to be missing genes encoding 10 potential PD pathogenicity effectors found in Temecula1. Subsequent PCR and sequencing analyses confirmed that EB92-1 was missing the following predicted effectors found in Temecula1: two type II secreted enzymes, including a lipase (LipA; PD1703) and a serine protease (PD0956); two identical genes encoding proteins similar to Zonula occludens toxins (Zot; PD0915 and PD0928), and at least one relatively short, hemagglutinin-like protein (PD0986). Leaves of tobacco and citrus inoculated with cell-free, crude protein extracts of E. coli BL21(DE3) overexpressing PD1703 exhibited a hypersensitive response (HR) in less than 24 hours. When cloned into shuttle vector pBBR1MCS-5, PD1703 conferred strong secreted lipase activity to Xanthomonas citri, E. coli and X. fastidiosa EB92-1 in plate assays. EB92-1/PD1703 transformants also showed significantly increased disease symptoms on grapevines, characteristic of PD. Genes predicted to encode PD0928 (Zot) and a PD0986 (hemagglutinin) were also cloned into pBBR1MCS-5 and moved into EB92-1; both transformants also showed significantly increased symptoms on V. vinifera vines, characteristic of PD. Together, these results reveal that PD effectors include at least a lipase, two Zot-like toxins and a possibly redundant hemagglutinin, none of which are necessary for parasitic survival of X. fastidiosa populations in grapevines or elderberry.

  1. Emergency department visits during an Olympic gold medal television broadcast.

    Science.gov (United States)

    Redelmeier, Donald A; Vermeulen, Marian J

    2011-01-01

    Practice pattern variations are often attributed to physician decision-making with no accounting for patient preferences. To test whether a mass media television broadcast unrelated to health was associated with changes in the rate and characteristics of visits for acute emergency care. Time-series analysis of emergency department visits for any reason. Population-based sample of all patients seeking emergency care in Ontario, Canada. The broadcast day was defined as the Olympic men's gold medal ice hockey game final. The control days were defined as the 6 Sundays before and after the broadcast day. A total of 99 447 visits occurred over the 7 Sundays, of which 13 990 occurred on the broadcast day. Comparing the broadcast day with control days, we found no significant difference in the hourly rate of visits before the broadcast (544 vs 537, p = 0.41) or after the broadcast (647 vs 639, p = 0.55). In contrast, we observed a significant reduction in hourly rate of visits during the broadcast (647 vs 783, p broadcast was particularly large for adult men with low triage severity. The greatest reductions were for patients with abdominal, musculoskeletal or traumatic disorders. Mass media television broadcasts can influence patient preferences and thereby lead to a decrease in emergency department visits.

  2. Applied socio-hydrology using volunteer geographic information (VGI) to integrate ecosystem-based adaptation (EbA) and disaster risk reduction (DRR)

    Science.gov (United States)

    Mendiondo, Eduardo; Taffarello, Denise; Mohor, Guilherme; Guzmán, Diego; Câmara de Freitas, Clarissa; Fava, Maria Clara; Restrepo, Camilo; Abreu, Fernando; Batalini, Marina; Lago, Cesar; Abe, Narumi; Rosa, Altair

    2017-04-01

    Socio-hydrology proposes to understand coupled human-water systems by conceptualizing its components to be dynamically connected by bi-directional feedbacks. For practical purposes, especially in developing countries of South America, socio-hydrology does integrate practical, empirical and theoretical fundamentals from citizens' knowledge and culture. This contribution shows South American examples of how volunteer geographic information (VGI) can help socio-hydrology to integrate emerging aspects with heavy feedbacks, exploding uncertainties and relevant scales of socio-hydrological scales. Here we select examples at different scales of using VGI to link aspects of ecosystem-based adaptation (EbA) and disaster risk reduction (DRR). On the one hand, we show some learning cases of EbA/VGI linked to socio-hydrology also related with water valuation, both monetary and non-monetary, under scenarios of changing conditions of land-use and land cover changes of strategic water supply systems in subtropical biomes. This example brings a bridge of VGI and EbA towards Disaster Risk Reduction (DRR) through water topics of securitization, insurance, smart cities and sustainable urban drainage systems (SUDS). Thus, on the other hand, we also depict how VGI support applied elements for socio-hydrology on South American urban areas, capable of policy actions for DRR through SUDS at human-impacted biomes under extremes of droughts, floods and pollution. We here recommend yardsticks of learning conditions from these real examples of using VGI's knowledge and culture biases for a more resilient socio-hydrology, in order to create opportunities for theoretical, conceptual and applied nature of EbA and DRR with viable alliances from IAHS/Panta Rhei with UN/Sendai/DRR Framework and UN/Sustainable Development Goals. From these examples, however, seem plausible co-evolutionary dynamics with stakeholders if local-scale constraints, from sociopolitical nature, institutions' policies and

  3. ALOHA Packet Broadcasting - A Retrospect

    Science.gov (United States)

    1975-01-01

    destination is available, its identification is stored in a Conation Tabu entry for the requesting user in the MEMHJNE, and the user’s address stored in a...very high compared to a typical conflict-free channel. s\\ t:J ■21- consisted only of human terminal users, it was decided that a simple error...the TOJ’s interfacing human users to a haxf duplex, line-oriented time- sharing | • system. At the time of the first TOJ design effort memory i

  4. 47 CFR 27.1203 - EBS programming requirements.

    Science.gov (United States)

    2010-10-01

    ... MISCELLANEOUS WIRELESS COMMUNICATIONS SERVICES Broadband Radio Service and Educational Broadband Service § 27... wired distribution systems or radio facilities authorized under other parts of this chapter, or to...

  5. RSS based CERN Alerter. Information broadcast to all CERN offices.

    CERN Multimedia

    Otto, R

    2007-01-01

    Nearly every large organization uses a tool to broadcast messages and information across the internal campus (messages like alerts announcing interruption in services or just information about upcoming events). These tools typically allow administrators (operators) to send "targeted" messages which are sent only to specific groups of users or computers, e/g only those located in a specified building or connected to a particular computing service. CERN has a long history of such tools: CERNVMS€™s SPM_quotMESSAGE command, Zephyr and the most recent the NICE Alerter based on the NNTP protocol. The NICE Alerter used on all Windows-based computers had to be phased out as a consequence of phasing out NNTP at CERN. The new solution to broadcast information messages on the CERN campus continues to provide the service based on cross-platform technologies, hence minimizing custom developments and relying on commercial software as much as possible. The new system, called CERN Alerter, is based on RSS (Really Simpl...

  6. 77 FR 30423 - Innovation in the Broadcast Television Bands: Allocations, Channel Sharing and Improvements to...

    Science.gov (United States)

    2012-05-23

    ... programming, political broadcasting, minimum operating hours, main studio, Emergency Alert System). Stations utilizing a shared channel will be required to retain at least enough capacity to operate one standard.... 3501 through 3520). Synopsis The Report and Order does not act on the proposals in the Notice of...

  7. Relay-aided multi-cell broadcasting with random network coding

    DEFF Research Database (Denmark)

    Lu, Lu; Sun, Fan; Xiao, Ming

    2010-01-01

    We investigate a relay-aided multi-cell broadcasting system using random network codes, where the focus is on devising efficient scheduling algorithms between relay and base stations. Two scheduling algorithms are proposed based on different feedback strategies; namely, a one-step scheduling...

  8. Print and Broadcast Mass Media Factors as Predictors of Nigerian Teachers' Political Awareness and Participation

    Science.gov (United States)

    Agbatogun, A. Olaoluwakotansibe

    2009-01-01

    This study examined the extent to which the use of print and broadcast mass media could predict the level of awareness and participation of secondary school teachers in political activities and its implications on the quality of Nigerian education system. Eight hundred and two secondary school teachers from South West states of Nigeria served as…

  9. Norwegian Radio Broadcasting : from public monopoly to competitive homogeneity?

    OpenAIRE

    Foros, Øystein; Kind, Hans Jarle; Østbye, Helge

    2006-01-01

    The present article discusses whether competition in radio broadcasting creates diversity. We start out by giving a brief overview of the development of competition within the European broadcasting markets. However, our main focus will be the market for commercial radio in Norway, partly because this represents a very interesting case from a regulatory point of view. We argue that the claimed lack of diversity in Norwegian radio broadcasting is a consequence of both the regulatory policy and ...

  10. 47 CFR 73.201 - Numerical designation of FM broadcast channels.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Numerical designation of FM broadcast channels. 73.201 Section 73.201 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES FM Broadcast Stations § 73.201 Numerical designation of FM broadcast...

  11. 47 CFR 73.23 - AM broadcast station applications affected by international agreements.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false AM broadcast station applications affected by international agreements. 73.23 Section 73.23 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES AM Broadcast Stations § 73.23 AM broadcast station...

  12. 47 CFR 73.801 - Broadcast regulations applicable to LPFM stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Broadcast regulations applicable to LPFM stations. 73.801 Section 73.801 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Low Power FM Broadcast Stations (LPFM) § 73.801 Broadcast...

  13. 47 CFR 73.4157 - Network signals which adversely affect affiliate broadcast service.

    Science.gov (United States)

    2010-10-01

    ... affiliate broadcast service. 73.4157 Section 73.4157 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Rules Applicable to All Broadcast Stations § 73.4157 Network signals which adversely affect affiliate broadcast service. See Public Notice, FCC 79-387...

  14. 47 CFR 73.4107 - FM broadcast assignments, increasing availability of.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false FM broadcast assignments, increasing...) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Rules Applicable to All Broadcast Stations § 73.4107 FM broadcast assignments, increasing availability of. (a) See, First Report and Order MM Docket 84-231, FCC 84...

  15. 47 CFR 73.1208 - Broadcast of taped, filmed, or recorded material.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Broadcast of taped, filmed, or recorded material. 73.1208 Section 73.1208 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Rules Applicable to All Broadcast Stations § 73.1208 Broadcast...

  16. 47 CFR 73.4185 - Political broadcasting and telecasting, the law of.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Political broadcasting and telecasting, the law of. 73.4185 Section 73.4185 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Rules Applicable to All Broadcast Stations § 73.4185 Political broadcasting and telecasting, the law of. (...

  17. [Scientability - a concept for the handling of homeopathic remedies by EbM].

    Science.gov (United States)

    Weymayr, Christian

    2013-01-01

    Evidence-based medicine (EbM) has proved to be very useful in healthcare; thanks to its methodology the reliability of our knowledge of the benefits and harms of interventions can be assessed. This at least applies to interventions which are based on a plausible concept for their mechanism of action and which have already achieved positive effects in experiments and simple studies. However, for interventions whose concepts contradict scientific findings EbM has proved to be unsuitable; it has not been able to prevent that they are still regarded as effective amongst wide parts of the population and medical experts. Particularly homeopathy has managed to even present itself as scientifically justified by using EbM. With the aim of highlighting the speculative character of homeopathy and other procedures and of preventing EbM from getting damaged, the concept of scientability is introduced in this article. This concept only approves of clinical studies if the intervention that is to be tested does not contradict definite scientific findings. Copyright © 2013. Published by Elsevier GmbH.

  18. 76 FR 59927 - Treatment of Aliens Whose Employment Creation Immigrant (EB-5) Petitions Were Approved After...

    Science.gov (United States)

    2011-09-28

    ... SECURITY 8 CFR Parts 216 and 245 RIN 1615-AA90 Treatment of Aliens Whose Employment Creation Immigrant (EB... applications and petitions of qualifying aliens whose employment-creation immigrant petitions were approved by...-273 Provisions C. Summary of the Adjudications Required by Public Law 107-273 III. Aliens Eligible To...

  19. 76 FR 61288 - Treatment of Aliens Whose Employment Creation Immigrant (EB-5) Petitions Were Approved After...

    Science.gov (United States)

    2011-10-04

    ... From the Federal Register Online via the Government Publishing Office ] DEPARTMENT OF HOMELAND SECURITY 8 CFR Parts 216 and 245 RIN 1615-AA90 Treatment of Aliens Whose Employment Creation Immigrant (EB... Homeland Security corrects an inadvertent error contained in the proposed rule titled Treatment of Aliens...

  20. Narvas näeb Eesti tantsuauhinna võitnud tantsulavastust / Rene Nõmmik ; intervjueerinud Tiia Linnart

    Index Scriptorium Estoniae

    Nõmmik, Rene, 1962-

    2015-01-01

    Narva kultuurimajas Rugodiv näeb Fine5 tantsuteatri lavastust "...and blue", mis võitis tänavu Eesti teatriauhinna. Etenduse koreograafideks ja lavastajateks on Tiina Ollesk ja Rene Nõmmik, keda on palutud lavastama ka Venemaale. Intervjuu Rene Nõmmikuga

  1. Energy Efficient Probabilistic Broadcasting for Mobile Ad-Hoc Network

    Science.gov (United States)

    Kumar, Sumit; Mehfuz, Shabana

    2017-06-01

    In mobile ad-hoc network (MANETs) flooding method is used for broadcasting route request (RREQ) packet from one node to another node for route discovery. This is the simplest method of broadcasting of RREQ packets but it often results in broadcast storm problem, originating collisions and congestion of packets in the network. A probabilistic broadcasting is one of the widely used broadcasting scheme for route discovery in MANETs and provides solution for broadcasting storm problem. But it does not consider limited energy of the battery of the nodes. In this paper, a new energy efficient probabilistic broadcasting (EEPB) is proposed in which probability of broadcasting RREQs is calculated with respect to remaining energy of nodes. The analysis of simulation results clearly indicate that an EEPB route discovery scheme in ad-hoc on demand distance vector (AODV) can increase the network lifetime with a decrease in the average power consumption and RREQ packet overhead. It also decreases the number of dropped packets in the network, in comparison to other EEPB schemes like energy constraint gossip (ECG), energy aware gossip (EAG), energy based gossip (EBG) and network lifetime through energy efficient broadcast gossip (NEBG).

  2. Histories of Public Service Broadcasters on the Web

    DEFF Research Database (Denmark)

    This edited volume details multiple and dynamic histories of relations between public service broadcasters and the World Wide Web. What does it mean to be a national broadcaster in a global communications environment? What are the commercial and public service pressures that were brought to bear...... when public service broadcasters implemented web services? How did “one- to-many” broadcasters adapt to the “many-to-many” medium of the internet? The thematic or- ganisation of this collection addresses such major issues, while each chapter offers a particular historical account of relations between...

  3. Automatic Dependent Surveillance - Broadcast Verification and Validation Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Automatic Dependent Surveillance ? Broadcast (ADS-B) is an emerging Communications, Navigation, and Surveillance (CNS) technology that will vastly expand the state...

  4. Minimizing Broadcast Expenses in Clustered Ad-hoc Networks

    Directory of Open Access Journals (Sweden)

    S. Zeeshan Hussain

    2018-01-01

    Full Text Available One way to minimize the broadcast expenses of routing protocols is to cluster the network. In clustered ad-hoc networks, all resources can be managed easily by resolving scalability issues. However, blind query broadcast is a major issue that leads to the broadcast storm problem in clustered ad-hoc networks. This query broadcast is done to carry out the route-search task that leads to the unnecessary propagation of route-query even after route has been found. Hence, this query propagation poses the problem of congestion in the network. In particular this motivates us to propose a query-control technique in such networks which works based on broadcast repealing. A huge amount of work has been devoted to propose the query control broadcasting techniques. However, such techniques used in traditional broadcasting mechanisms need to be properly extended for use in the cluster based routing architecture. In this paper, query-control technique is proposed for cluster based routing technique to reduce the broadcast expenses. Finally, we report some experiments which compare the proposed technique to other commonly used techniques including standard one-class AODV that follows TTL-sequence based broadcasting technique.

  5. A broadcast engineering tutorial for non-engineers

    CERN Document Server

    Pizzi, Skip

    2014-01-01

    A Broadcast Engineering Tutorial for Non-Engineers is the leading publication on the basics of broadcast technology. Whether you are new to the industry or do not have an engineering background, this book will give you a comprehensive primer of television, radio, and digital media relating to broadcast-it is your guide to understanding the technical world of radio and television broadcast engineering. It covers all the important topics such as DTV, IBOC, HD, standards, video servers, editing, electronic newsrooms, and more.

  6. Scheduling Broadcasts in a Network of Timelines

    KAUST Repository

    Manzoor, Emaad A.

    2015-05-12

    Broadcasts and timelines are the primary mechanism of information exchange in online social platforms today. Services like Facebook, Twitter and Instagram have enabled ordinary people to reach large audiences spanning cultures and countries, while their massive popularity has created increasingly competitive marketplaces of attention. Timing broadcasts to capture the attention of such geographically diverse audiences has sparked interest from many startups and social marketing gurus. However, formal study is lacking on both the timing and frequency problems. In this thesis, we introduce, motivate and solve the broadcast scheduling problem of specifying the timing and frequency of publishing content to maximise the attention received. We validate and quantify three interacting behavioural phenomena to parametrise social platform users: information overload, bursty circadian rhythms and monotony aversion, which is defined here for the first time. Our analysis of the influence of monotony refutes the common assumption that posts on social network timelines are consumed piecemeal independently. Instead, we reveal that posts are consumed in chunks, which has important consequences for any future work considering human behaviour over social network timelines. Our quantification of monotony aversion is also novel, and has applications to problems in various domains such as recommender list diversification, user satiation and variety-seeking consumer behaviour. Having studied the underlying behavioural phenomena, we link schedules, timelines, attention and behaviour by formalising a timeline information exchange process. Our formulation gives rise to a natural objective function that quantifies the expected collective attention an arrangement of posts on a timeline will receive. We apply this formulation as a case-study on real-data from Twitter, where we estimate behavioural parameters, calculate the attention potential for different scheduling strategies and, using the

  7. Eb&D: A new clustering approach for signed social networks based on both edge-betweenness centrality and density of subgraphs

    Science.gov (United States)

    Qi, Xingqin; Song, Huimin; Wu, Jianliang; Fuller, Edgar; Luo, Rong; Zhang, Cun-Quan

    2017-09-01

    Clustering algorithms for unsigned social networks which have only positive edges have been studied intensively. However, when a network has like/dislike, love/hate, respect/disrespect, or trust/distrust relationships, unsigned social networks with only positive edges are inadequate. Thus we model such kind of networks as signed networks which can have both negative and positive edges. Detecting the cluster structures of signed networks is much harder than for unsigned networks, because it not only requires that positive edges within clusters are as many as possible, but also requires that negative edges between clusters are as many as possible. Currently, we have few clustering algorithms for signed networks, and most of them requires the number of final clusters as an input while it is actually hard to predict beforehand. In this paper, we will propose a novel clustering algorithm called Eb &D for signed networks, where both the betweenness of edges and the density of subgraphs are used to detect cluster structures. A hierarchically nested system will be constructed to illustrate the inclusion relationships of clusters. To show the validity and efficiency of Eb &D, we test it on several classical social networks and also hundreds of synthetic data sets, and all obtain better results compared with other methods. The biggest advantage of Eb &D compared with other methods is that the number of clusters do not need to be known prior.

  8. 76 FR 1192 - Notice of a Change in Status of an Extended Benefit (EB) Period for Puerto Rico

    Science.gov (United States)

    2011-01-07

    ... Puerto Rico AGENCY: Employment and Training Administration, Labor. ACTION: Notice. SUMMARY: This notice announces a change in benefit period eligibility under the EB Program for Puerto Rico. The following change has occurred since the publication of the last notice regarding the State's EB status: Puerto Rico's...

  9. 76 FR 14102 - Notice of a Change in Status of an Extended Benefit (EB) Period for Alaska

    Science.gov (United States)

    2011-03-15

    ... Employment and Training Administration Notice of a Change in Status of an Extended Benefit (EB) Period for... announces a change in benefit period eligibility under the EB program for Alaska. The following changes have... total unemployment rate for Alaska met or exceeded the 8.0% threshold to enter a high unemployment...

  10. 77 FR 7603 - Notice of a Change in Status of an Extended Benefit (EB) Period for Alaska

    Science.gov (United States)

    2012-02-13

    ... Employment and Training Administration Notice of a Change in Status of an Extended Benefit (EB) Period for... announces a change in benefit period eligibility under the EB program for Alaska. The following changes have... unemployment rate (IUR) for the week ending January 7, 2012 rose to meet the 6% threshold to trigger ``on'' to...

  11. Dissecting EB1-microtubule interactions from every direction: using single-molecule visualization and static and dynamic binding measurements

    Science.gov (United States)

    Lopez, Benjamin

    2015-03-01

    EB1 is an important microtubule associating protein (MAP) that acts as a master coordinator of protein activity at the growing plus-end of the microtubule. We can recapitulate the plus-end binding behavior of EB1 along the entire length of a static microtubule using microtubules polymerized in the presence of the nonhydrolyzable GTP analogs GMPCPP and GTP γS instead of GTP. Through the use of single-molecule TIRF imaging we find that EB1 is highly dynamic (with a sub-second characteristic binding lifetime) and continuously diffusive while bound to the microtubule. We measure the diffusion coefficient, D, through linear fitting to mean-squared displacement of individually labeled proteins, and the binding lifetime, τ, by fitting a single exponential decay to the probability distribution of trajectory lifetimes. In agreement with measurements of other diffusive MAPs, we find that D increases and τ decreases with increasing ionic strength. We also find that D is sensitive to the choice of GTP analog: EB1 proteins bound to GTP γS polymerized microtubules have a D half of that found with GMPCPP polymerized microtubules. To compare these single-molecule measurements to the bulk binding behavior of EB1, we use TIRF imaging to measure the intensity of microtubules coated with EB1-GFP as a function of EB1 concentration. We find that EB1 binding is cooperative and both the quantity of EB1 bound and the dissociation constant are sensitive to GTP analog and ionic concentration. The correlation between binding affinity and D and the cooperative nature of EB1-microtubule binding leads to a decrease in D with increasing EB1 concentration. Interestingly, we also find an increase in τ at high EB1 concentrations, consistent with attractive EB1-microtubule interactions driving the cooperativity. To further understand the nature of the cooperativity we estimate the interaction energy by measuring the association and dissociation rates (kon and koff respectively) at different

  12. Incorporation of the C-GOLDSTEIN efficient climate model into the GENIE framework: "eb_go_gs" configurations of GENIE

    Directory of Open Access Journals (Sweden)

    R. Marsh

    2011-11-01

    Full Text Available A computationally efficient, intermediate complexity ocean-atmosphere-sea ice model (C-GOLDSTEIN has been incorporated into the Grid ENabled Integrated Earth system modelling (GENIE framework. This involved decoupling of the three component modules that were re-coupled in a modular way, to allow replacement with alternatives and coupling of further components within the framework. The climate model described here (referred to as "eb_go_gs" for short is the most basic version of GENIE in which atmosphere, ocean and sea ice all play an active role. Among improvements on the original C-GOLDSTEIN model, latitudinal grid resolution is generalized to allow a wider range of surface grids to be used. The ocean, atmosphere and sea-ice components of the "eb_go_gs" configuration of GENIE are individually described, along with details of their coupling. The setup and results from simulations using four different meshes are presented. The four alternative meshes comprise the widely-used 36 × 36 equal-area-partitioning of the Earth surface with 16 depth layers in the ocean, a version in which horizontal and vertical resolution are doubled, a setup matching the horizontal resolution of the dynamic atmospheric component available in the GENIE framework, and a setup with enhanced resolution in high-latitude areas. Results are presented for a spin-up experiment with a baseline parameter set and wind forcing typically used for current studies in which "eb_go_gs" is coupled with the ocean biogeochemistry module of GENIE, as well as for an experiment with a modified parameter set, revised wind forcing, and additional cross-basin transport pathways (Indonesian and Bering Strait throughflows. The latter experiment is repeated with the four mesh variants, with common parameter settings throughout, except for time-step length. Selected state variables and diagnostics are compared in two regards: (i between simulations at lowest resolution that are obtained with the

  13. Insights into the process of EB1-dependent tip-tracking of kinesin-14 Ncd. The role of the microtubule.

    Science.gov (United States)

    Szczęsna, Ewa; Kasprzak, Andrzej A

    2016-12-01

    End-binding proteins are capable of tracking the plus-ends of growing microtubules (MTs). The motor protein Ncd, a member of the kinesin-14 family, interacts with EB1 protein and becomes a non-autonomous tip-tracker. Here, we attempted to find out whether at least for Ncd, the efficient EB1-mediated tip-tracking involves the interaction of the kinesin with the MT surface. We prepared a series of Ncd tail mutants in which the MT-binding sites were altered or eliminated. Using TIRF microscopy, we characterized their behavior as tip-trackers and measured the dwell times of single molecules of EB1 and Ncd tail or its mutated forms. The mutated forms of Ncd tail exhibited tip-tracking in the presence of EB1 and the effectiveness of this process was proportional to the affinity of the mutant's tail to MT. Even though the interaction of Ncd with EB1 was weak (Kd∼9μM) the half saturating concentration of EB1 for tip-tracking was 7nM. The dwell time of Ncd tail in the presence of EB1 was ∼1s. The dwell time of EB1 alone was shorter (∼0.3s) and increased considerably in the presence of a large excess of Ncd tail. We demonstrated that tip-tracking of kinesin-14 occurs through several concurrent mechanisms: binding of kinesin only to EB1 located at the MT end, interaction of the kinesin molecules with a composite site formed by EB1 and the MT tip, and probably surface diffusion of the tail along MT. The second mechanism seems to play a crucial role in efficient tip-tracking. Copyright © 2016 Elsevier GmbH. All rights reserved.

  14. [Treatment of children with EB virus infection by Chinese medicine: a clinical study].

    Science.gov (United States)

    Zhen, Xiao-Fang; Yao, Yuan; Qin, Li-Na; Chen, Fang

    2014-02-01

    To provide evidence for Chinese medical treatment of children with EB virus infection by exploring its clinical efficacy from multiple angles. Totally 81 children patients were randomly assigned to the treatment group (46 cases) and the control group (35 cases). Patients in the treatment group took Chinese medical decoction, while those in the control received intravenous dripping of Ganciclovir and oral administration of pidotimod. The treatment period for the two groups was 2 weeks. Patients were followed-up till the 12th week. Clinical symptoms such as fever, lymphadenopathy and hepatosplenomegaly, as well as lab indices such as abnormal lymphocyte percentage, EB virus antibody, virus DNA load, T cell subsets, immunoglobulin, and so on were observed before and after treatment, at week 4 and 12 of follow-ups. (1) The total effective rate at week 2 was 95.6% in the treatment group, higher than that of the control group (94.3%), but there was no statistical difference between the two groups. (2) The time for defervescence, duration of pharyngeal hyperemia, duration of swollen tonsils was shorter in the treatment group than in the control group (P<0.05). The subsidence of lymphadenopathy, hepatomegaly, and abnormal lymphocytes was better in the treatment group than in the control group (P < 0.05). (3) The positive cases of peripheral blood hetero-lymphocyte was significantly reduced after treatment, at week 4 and 12 of follow-ups both in the treatment group and the control group (P < 0.01). The expression of IgA and IgM decreased after treatment in the two groups when compared with before treatment in the same group (P < 0.05, P < 0.01). IgG in the treatment group also obviously decreased after treatment, at week 4 and 12 of follow-ups (P < 0.05, P < 0.01), while it decreased only after treatment in the control group (P < 0.05). Activities of AST and ALT in the treatment group and the AST activity in the control group were markedly improved when compared with those

  15. Distributed successive refinement of multiview images using broadcast advantage.

    Science.gov (United States)

    Chen, Zichong; Barrenetxea, Guillermo; Vetterli, Martin

    2012-11-01

    In environmental monitoring applications, having multiple cameras focus on common scenery increases robustness of the system. To save energy based on user demand, successive refinement image coding is important, as it allows us to progressively request better image quality. By exploiting the broadcast nature and correlation between multiview images, we investigate a two-camera setup and propose a novel two-encoder successive refinement scheme which imitates a ping-pong game. For the bivariate Gaussian case, we prove that this scheme is successively refinable on the theoretical rate-distortion limit of distributed coding (Wagner surface) under arbitrary settings. For stereo-view images, we develop a practical successive refinement coding algorithm using the same idea. The simulation results show that this scheme operates close to the distributed coding bound.

  16. Discussing performance management architecture in public service broadcasting

    DEFF Research Database (Denmark)

    Tambo, Torben; Gabel, Ole Dahl

    2014-01-01

    these metrics, reflected in an architecture, raises the certainty and level of organisational consensus. Research limitations/implications: DR is unique as the largest cultural institution in the Danish language area backed by a political consensus, strong popular support, high level of funding...... and a disproportional “market share” against commercial actors. This is both interesting to research but also issues limits on the conclusions given the uniqueness. Practical implications: Ambiguity, bad connectedness, and lack of consensus of measurement of organisational performance can tentatively have a negative......Purpose: To demonstrate design of Performance Management (PM) processes in highly complex, non-profit, culture-producing organisations specifically the shift from Performance Management Systems (PMS) to Performance Management Architectures (PMA) specifically using Danish Broadcasting Corporation...

  17. Adaptive Load-Balancing Algorithms using Symmetric Broadcast Networks

    Science.gov (United States)

    Das, Sajal K.; Harvey, Daniel J.; Biswas, Rupak; Biegel, Bryan A. (Technical Monitor)

    2002-01-01

    In a distributed computing environment, it is important to ensure that the processor workloads are adequately balanced, Among numerous load-balancing algorithms, a unique approach due to Das and Prasad defines a symmetric broadcast network (SBN) that provides a robust communication pattern among the processors in a topology-independent manner. In this paper, we propose and analyze three efficient SBN-based dynamic load-balancing algorithms, and implement them on an SGI Origin2000. A thorough experimental study with Poisson distributed synthetic loads demonstrates that our algorithms are effective in balancing system load. By optimizing completion time and idle time, the proposed algorithms are shown to compare favorably with several existing approaches.

  18. 77 FR 33098 - Unlicensed Operation in the TV Broadcast Band

    Science.gov (United States)

    2012-06-05

    ... COMMISSION 47 CFR Part 15 Unlicensed Operation in the TV Broadcast Band AGENCY: Federal Communications... Memorandum Opinion and Order, in the matter of ``Unlicensed Operation in the TV Broadcast Band Approval... final regulations that are the subject of this correction relate to ``Unlicensed Operation in the TV...

  19. 77 FR 25112 - Radio Broadcasting Services; Centerville and Midway, TX

    Science.gov (United States)

    2012-04-27

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Centerville and Midway, TX AGENCY: Federal... filing procedures for comments, see 47 CFR 1.415 and 1.420. List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications Commission. Nazifa Sawez, Assistant Chief, Audio Division...

  20. 75 FR 3694 - Radio Broadcasting Services, Peach Springs, Arizona

    Science.gov (United States)

    2010-01-22

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services, Peach Springs, Arizona AGENCY: Federal Communications... procedures for comments, see 47 CFR 1.4125 and 1.420. List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. For the reasons discussed in the preamble, the Federal Communications Commission proposes to...

  1. 76 FR 69222 - Radio Broadcasting Services; Altamont, OR

    Science.gov (United States)

    2011-11-08

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Altamont, OR AGENCY: Federal Communications Commission... 47 CFR Part 73 Radio. Federal Communications Commission. Nazifa Sawez, Assistant Chief, Audio... Commission proposes to amend 47 CFR part 73 as follows: PART 73--RADIO BROADCAST SERVICES 1. The authority...

  2. 77 FR 62481 - Radio Broadcasting Services; Crownpoint, NM

    Science.gov (United States)

    2012-10-15

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Crownpoint, NM AGENCY: Federal Communications....415 and 1.420. List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications... preamble, the Federal Communications Commission proposes to amend 47 CFR Part 73 as follows: PART 73--RADIO...

  3. 78 FR 12622 - Radio Broadcasting Services; Greenup, IL

    Science.gov (United States)

    2013-02-25

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Greenup, IL AGENCY: Federal Communications Commission... 5 U.S.C. 801(a)(1)(A). List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. ] Federal... a first and/or second NCE radio service to 67.5 percent (21,149 persons) of the total population of...

  4. 77 FR 16800 - Radio Broadcasting Services; Westfield, NY

    Science.gov (United States)

    2012-03-22

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Westfield, NY AGENCY: Federal Communications... filing procedures for comments, see 47 CFR 1.415 and 1.420. List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications Commission. Nazifa Sawez, Assistant Chief, Audio Division...

  5. 75 FR 52649 - Radio Broadcasting Services; DeBeque, Colorado

    Science.gov (United States)

    2010-08-27

    ... COMMISSION 47 CFR Part 73 . Radio Broadcasting Services; DeBeque, Colorado AGENCY: Federal Communications... Congressional Review Act, see 5 U.S.C. 801(a)(1)(A). List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. 0 As stated in the preamble, the Federal Communications Commission amends 47 CFR part 73 as...

  6. 78 FR 12010 - Radio Broadcasting Services; Pearsall, Texas

    Science.gov (United States)

    2013-02-21

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Pearsall, Texas AGENCY: Federal Communications....415 and 1.420. List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications... preamble, the Federal Communications Commission proposes to amend 47 CFR part 73 as follows: PART 73--RADIO...

  7. RSBP: a reliable slotted broadcast protocol in wireless sensor networks.

    Science.gov (United States)

    Vinh, Phan Van; Oh, Hoon

    2012-10-31

    In wireless sensor networks for monitoring and control applications, a sink node needs to disseminate messages to all nodes to acquire monitoring data or to control the operation of sensor nodes. The basic flooding protocol suffers from low transmission reliability in broadcasting messages due to the hidden terminal problem. Besides, it can cause the broadcast storm problem by having many nodes rebroadcast the received message simultaneously. In order to resolve these problems while minimizing energy consumption in delivery of broadcast messages, we propose a reliable slotted broadcast protocol (RSBP) that allocates broadcast time slots to nodes based on their slot demands and then allows every node to transmit its broadcast message within the allocated slots. Then, every node can broadcast messages safely in a contention-free manner. Moreover, RSBP can be deployed easily since it does not have any specific requirements such as GPS, multi-channels and directional antennas that may not be always available in real scenarios. We show by experimental study that RSBP significantly outperforms other broadcast protocols in terms of safety-critical packet delivery and energy consumption.

  8. 47 CFR 76.66 - Satellite broadcast signal carriage.

    Science.gov (United States)

    2010-10-01

    ... digital signals of each television broadcast station that is located in a local market in Alaska or Hawaii... reasonable digital compression techniques in the carriage of local television stations. (2) Satellite... MULTICHANNEL VIDEO AND CABLE TELEVISION SERVICE Carriage of Television Broadcast Signals § 76.66 Satellite...

  9. 78 FR 42700 - Radio Broadcasting Services; Matagorda, Texas

    Science.gov (United States)

    2013-07-17

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Matagorda, Texas AGENCY: Federal Communications Commission. ACTION: Final rule. SUMMARY: The Audio Division, at the request of Tejas Broadcasting Ltd., LLP... the Congressional Review Act, see U.S.C. 801(a)(1)(A). List of Subjects in 47 CFR part 73 Radio, Radio...

  10. 78 FR 42700 - Radio Broadcasting Services; Various Locations

    Science.gov (United States)

    2013-07-17

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Various Locations AGENCY: Federal Communications...), because these allotments were previously reported. List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications Commission. Nazifa Sawez, Assistant Chief, Audio Division, Media Bureau...

  11. 77 FR 64792 - Radio Broadcasting Services; Pike Road, AL

    Science.gov (United States)

    2012-10-23

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Pike Road, AL AGENCY: Federal Communications....415 and 1.420. List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications... preamble, the Federal Communications Commission proposes to amend 47 CFR part 73 as follows: PART 73--RADIO...

  12. Radio Broadcasting for Adult Nonformal Environmental Education in Botswana.

    Science.gov (United States)

    Nyirenda, Juma E.

    1995-01-01

    Radio broadcasting is used in Botswana to inform, teach, and persuade adults about issues in agriculture, health, wildlife, conservation, and other areas. However, open broadcasting is not an effective nonformal education tool. Active and guided group listening to radio enables discussion and feedback. (SK)

  13. 76 FR 79113 - Radio Broadcasting Services; Bastrop, LA

    Science.gov (United States)

    2011-12-21

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Bastrop, LA AGENCY: Federal Communications Commission... Part 73 Radio. Federal Communications Commission. Nazifa Sawez, Assistant Chief, Audio Division, Media... amends 47 CFR part 73 as follows: PART 73--RADIO BROADCAST SERVICES 0 1. The authority citation for part...

  14. 77 FR 43216 - Radio Broadcasting Services; Randsburg, CA

    Science.gov (United States)

    2012-07-24

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Randsburg, CA AGENCY: Federal Communications....415 and 1.420. List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications... preamble, the Federal Communications Commission proposes to amend 47 CFR part 73 as follows: PART 73--RADIO...

  15. 78 FR 73793 - Radio Broadcasting Services; Evart and Ludington, Michigan

    Science.gov (United States)

    2013-12-09

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Evart and Ludington, Michigan AGENCY: Federal... filing procedures for comments, see 47 CFR 1.415 and 1.420. List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications Commission. Nazifa Sawez, Assistant Chief, Audio Division...

  16. 76 FR 13579 - Radio Broadcasting Services; Hebbronville, TX

    Science.gov (United States)

    2011-03-14

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Hebbronville, TX AGENCY: Federal Communications... filing procedures for comments, see 47 CFR 1.415 and 1.420. List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. For the reasons discussed in the preamble, the Federal Communications Commission...

  17. Depression Radio Broadcast Dramas in the Canadian History Classroom.

    Science.gov (United States)

    Chilcoat, George W.; And Others

    1990-01-01

    Provides a lesson plan on the Great Depression in which students examine the social, economic, and political events of the period through a study of radio broadcasting. Describes an activity in which students research the era and create a radio broadcast. Outlines activity guidelines, radio language, and evaluation methods. (RW)

  18. 75 FR 71044 - Radio Broadcasting Services; Onekama, MI

    Science.gov (United States)

    2010-11-22

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Onekama, MI AGENCY: Federal Communications Commission. ACTION: Final rule. SUMMARY: The Audio Division, at the request of Northern Radio of Michigan, Inc., in... CFR Part 73 Radio, Radio broadcasting. 0 For the reasons discussed in the preamble, the Federal...

  19. Canal + Spain & Live Football Broadcasts: A Whole Different Game

    NARCIS (Netherlands)

    Rodríguez Ortega, Vicente; Romero Santos, Rubén

    2017-01-01

    textabstractIn 1988 the Law for Private Television Broadcasting was approved by Spanish parliament. Three licenses were initially awarded. Soon thereafter, in 1990, three channels started broadcasting: Antena 3, Berlusconi-related Tele 5 and, against all odds, a pay channel, Canal + Spain. This

  20. Religious Broadcasting in the Middle East : Content Analysis of ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Religious Broadcasting in the Middle East : Content Analysis of Selected Channels and Programs. Over the past decade, television broadcasting has become central in shaping public attitudes in the Middle East. Against a backdrop of authoritarian governments, political instability, war and pervasive foreign military ...

  1. 75 FR 9859 - Television Broadcasting Services; Beaumont, TX

    Science.gov (United States)

    2010-03-04

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Television Broadcasting Services; Beaumont, TX AGENCY: Federal Communications... 1.420. List of Subjects in 47 CFR Part 73 Television, Television broadcasting. For the reasons...

  2. 76 FR 35831 - Television Broadcasting Services; Eau Claire, WI

    Science.gov (United States)

    2011-06-20

    ...; DA 11-1034] Television Broadcasting Services; Eau Claire, WI AGENCY: Federal Communications... Gray Television Licensee, LLC (``Gray''), the licensee of station WEAU-TV, channel 13, Eau Claire... CFR 1.415 and 1.420. List of Subjects in 47 CFR Part 73 Television, Television broadcasting. Federal...

  3. 75 FR 10692 - Television Broadcasting Services; Birmingham, AL

    Science.gov (United States)

    2010-03-09

    ... COMMISSION 47 CFR Part 73 Television Broadcasting Services; Birmingham, AL AGENCY: Federal Communications... Alabama Educational Television Commission, the licensee of noncommercial educational station WBIQ(TV... CFR Part 73 Television, Television broadcasting. 0 For the reasons discussed in the preamble, the...

  4. 75 FR 5015 - Television Broadcasting Services; Oklahoma City, OK

    Science.gov (United States)

    2010-02-01

    ... COMMISSION 47 CFR Part 73 Television Broadcasting Services; Oklahoma City, OK AGENCY: Federal Communications... procedures for comments, see 47 CFR 1.415 and 1.420. List of Subjects in 47 CFR Part 73 Television, Television broadcasting. For the reasons discussed in the preamble, the Federal Communications Commission...

  5. 76 FR 9991 - Television Broadcasting Services; Kalispell, MT

    Science.gov (United States)

    2011-02-23

    ... From the Federal Register Online via the Government Publishing Office ] FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Television Broadcasting Services; Kalispell, MT AGENCY: Federal Communications... CFR 1.415 and 1.420. List of Subjects in 47 CFR Part 73 Television, Television broadcasting. For the...

  6. 77 FR 64946 - Radio Broadcasting Services; Maysville, Georgia

    Science.gov (United States)

    2012-10-24

    ... filed by Appalachian Broadcasting Company, Inc., proposing the allotment of Channel 265A at Maysville... Broadcasting Company, Post Office Drawer E, 233 Big A Road, Toccoa, Georgia 30577. FOR FURTHER INFORMATION... released September 28, 2012. The full text of this Commission decision is available for inspection and...

  7. Team Automata for Security Analysis of Multicast/Broadcast Communication

    NARCIS (Netherlands)

    ter Beek, Maurice; Lenzini, Gabriele; Petrocchi, Marinella; Busi, N.; Gorrieri, R.; Martinelli, F.

    We show that team automata (TeA) are well suited to model secure multicast/broadcast communication with possible packet loss. This is a consequence of the natural way in which one-to-many (one-to-all) transmissions typical of multicast (broadcast) sessions can be modelled as communications between

  8. Listenership of Radio Agricultural Broadcasts in Southwestern Nigeria

    Science.gov (United States)

    Emmanuel, Adekoya Adegbenga; Olabode, Badiru Idris

    2012-01-01

    Agricultural broadcasts on radio play a major role in agricultural extension and rural development in Nigeria due to the low ratio of extension agents in relation to the farming population. The broadcasts have been on air for some time and therefore there is a need to investigate their acceptance among the rural dwellers in Southwestern Nigeria.…

  9. Public and Private Activity in Commercial TV Broadcasting

    DEFF Research Database (Denmark)

    Olai Hansen, Bodil; Keiding, Hans

    2006-01-01

    We consider a model of commercial television market, where private broadcasters coexist with a public television broadcaster. Assuming that the public TV station follows a policy of Ramsey pricing whereas the private stations are profit maximizers, we consider the equilibria in this market...

  10. Private Sponsorship of Rural Development Broadcasts on Radio in ...

    African Journals Online (AJOL)

    Increased brand awareness was the most important reason (46.7%) that propelled sponsors to support broadcasts. Most sponsors (66.7%) would be willing to support RDBs on radio. Sponsors' characteristics were not significantly related to their willingness to sponsor RDBs. Stakeholders in rural development broadcasting ...

  11. Layout and EB data reduction: comparison of OASIS based approach with format-specific reversible compressions

    Science.gov (United States)

    Pai, Ravi; Pereira, Mark; Manu, C. S.; Parchuri, Anil; Baruah, Barsha

    2007-05-01

    With rapid increase in the number of geometries in a chip and aggressive RET carried out on layout data, it has become very much imperative to address the issue of layout and EB data explosion during IC design. Currently, the most widely used GDSII format for layout data as well as the widely used data formats for EB data, are incapable of handling the huge amount of data prevalent in the UDSM regime. The new non-proprietary standardized formats of OASIS for layout data and OASIS.VSB for EB data are the way the industry is likely to go in the near future to address the issue of data explosion. But, the process of adoption of these new formats is too slow as it takes a long time for new design flows to mature. The speed of adoption is especially slow in the post-layout domain as it is very close to manufacturing and the cost of error is too high. However, the issue of layout and EB data explosion is real and immediate and hence, it should be addressed in short term without waiting for the long term solution to arrive. This paper discusses about an alternative approach of employing format-specific lossless reversible layout and EB data compression schemes to compress the layout and EB data. The performance and the advantage of this approach are compared with the currently prevalent approach of using OASIS primarily and solely for on-disk file size reduction. It is argued that the reversible compression techniques could be a better approach for on-disk data file size reduction as they would not only reduce the file sizes but could also almost seamlessly get integrated into the current tool flow without necessitating major changes in the tool flow. The possibility of using OASIS itself as a format for lossless reversible compression of GDSII and MEBES data is also discussed. It is also argued that for successful adoption of OASIS formats by the industry mere on-disk file size reduction may not be sufficient. Higher value additions such as reduction in in-core database

  12. Method and apparatus for scheduling broadcasts in social networks

    KAUST Repository

    Manzoor, Emaad Ahmed

    2016-08-25

    A method, apparatus, and computer readable medium are provided for maximizing consumption of broadcasts by a producer. An example method includes receiving selection of a total number of time slots to use for scheduling broadcasts, and receiving information regarding the producer\\'s followers. The example method further 5 includes identifying, by a processor and based on the received information, discount factors associated with the producer\\'s followers, and calculating, by the processor and based on the received information, a predicted number of competitor broadcasts during each time slot of the total number of time slots. Finally, the example method includes determining, by the processor and based on the discount factors and the predicted 10 number of competitor broadcasts during each time slot, a number of broadcasts for the producer to transmit in each time slot of the total number of time slots.

  13. Analysis of VIA and EbA in a River Bank Erosion Prone Area of Bangladesh Applying DPSIR Framework

    Directory of Open Access Journals (Sweden)

    Syed Hafizur Rahman

    2016-10-01

    Full Text Available This study aims to set up a comprehensive approach to the Vulnerability and Impact Assessment (VIA of river erosion and to suggest Ecosystem-based Adaptation (EbA practices. Based on the analysis of vulnerability using the Driver-Pressure-State-Impact-Response (DPSIR framework, this paper discusses some of the significant climatic (rainfall pattern, temperature, seasonal drift, cold wave and heat wave and non-climatic (river erosion, repetitive death of field crops and agrochemicals forces in the Kazipur Upazila (Sirajganj District—a river erosion-prone area of Bangladesh. Both primary (Key Informants Interview, Household Survey, and Focus Group Discussion and secondary (climatic, literature review data have been used in revealing the scenario of climatic stress. The analysis revealed a slightly increasing trend of mean annual temperature, and a decreasing trend of total annual rainfall from 1981 to 2015, which have been supported by people’s perception. This study found that river erosion, the increase of temperature and the late arrival of monsoon rain, excessive monsoon rainfall, high use of agrochemicals, and flow alterations are major drivers in the riverine ecosystem. These drivers are creating pressures on agricultural land, soil fertility, water availability and livelihood patterns of affected communities. Hence, floating bed cultivation, integrated pest management, use of cover crops, reforestation, the introduction of an agro-weather forecasting system, and a new variety of flood tolerant species have been suggested as potential EbA to cope with river bank erosion and to increase the capacity of the affected ecosystem.

  14. Acoustic characteristics of male commercial and public radio broadcast voices.

    Science.gov (United States)

    Warhurst, Samantha; McCabe, Patricia; Yiu, Edwin; Heard, Robert; Madill, Catherine

    2013-09-01

    Radio broadcasters need to have a voice that suits the station, which employs them. The aim of this study was to determine whether there are any acoustic measures that reflect differences between male broadcasters, who use their voices on commercial and public radio stations, and nonbroadcasting, male controls. Male commercial (n = 4) and public (n = 11) broadcasters and two groups of male, age-matched controls were recorded while reading the "Rainbow Passage" as if presenting on radio. Reading productions were analyzed for equivalent sound level (L(eq)), two measures of the long-term average spectrum and two measures of cepstral peak prominence. A two-group (ie, commercial vs public) by two-paired (broadcaster/matching control) analysis of variance was performed for each measure. An interaction effect was observed such that commercial broadcasters had a higher peak in speaker's formant (SF) region and lower alpha ratio (AR) (lower level difference between 0 and 1 k Hz and 1 and 4 kHz ranges) than public broadcasters and controls. Post hoc discriminant function analyses showed that AR could predict whether a radio performer worked on commercial or public radio network to 81% accuracy (R(2) = 0.810, P broadcasters have a more prominent peak in the SF region and smaller AR than public broadcasters and controls, similar to levels documented in actors. Given these features were not found in the public broadcasters and either control group, these results indicate that voice quality requirements for broadcasters may distinctly differ based on their station of employment. Further research with a larger sample size is required to validate this hypothesis. Copyright © 2013 The Voice Foundation. Published by Mosby, Inc. All rights reserved.

  15. End Binding 1 (EB1) overexpression in oral lesions and cancer: A biomarker of tumor progression and poor prognosis.

    Science.gov (United States)

    Kumar, Manish; Mehra, Siddharth; Thakar, Alok; Shukla, Nootan Kumar; Roychoudhary, Ajoy; Sharma, Mehar Chand; Ralhan, Ranju; Chauhan, Shyam Singh

    2016-08-01

    Oral squamous cell carcinoma (OSCC) patients are at high risk of loco-regional recurrence and despite the improvement in treatment strategy, 5-year survival rates are about 50%. Identification of patients at high risk of recurrence may enable rigorous personalized post-treatment management. In an earlier proteomics study we observed overexpression of End Binding Protein (EB1) in OSCC. In the present study we investigated the diagnostic and prognostic significance of alterations in expression of EB1 in oral cancer. In this retrospective study, the expression of EB1 protein was evaluated in 259 OSCCs, 41 dysplasia, 166 hyperplasia and 126 normal tissues using immunohistochemistry and correlated with clinical-pathological parameters and prognosis of OSCC patients over a follow-up period of up to 91months. Significantly higher expression of cytoplasmic EB1 was observed in hyperplasia [ppatients showing cytoplasmic EB1 overexpression demonstrated significantly reduced DFS (p=0.004, HR=2.1). EB1 overexpression is an early event in oral tumorigenesis and cytoplasmic EB1 accumulation is associated with poor prognosis and tumor recurrence in OSCC patients. Copyright © 2016 Elsevier B.V. All rights reserved.

  16. Important contribution of the novel locus comEB to extracellular DNA-dependent Staphylococcus lugdunensis biofilm formation.

    Science.gov (United States)

    Rajendran, Nithya Babu; Eikmeier, Julian; Becker, Karsten; Hussain, Muzaffar; Peters, Georg; Heilmann, Christine

    2015-12-01

    The coagulase-negative species Staphylococcus lugdunensis is an emerging cause of serious and potentially life-threatening infections, such as infective endocarditis. The pathogenesis of these infections is characterized by the ability of S. lugdunensis to form biofilms on either biotic or abiotic surfaces. To elucidate the genetic basis of biofilm formation in S. lugdunensis, we performed transposon (Tn917) mutagenesis. One mutant had a significantly reduced biofilm-forming capacity and carried a Tn917 insertion within the competence gene comEB. Site-directed mutagenesis and subsequent complementation with a functional copy of comEB verified the importance of comEB in biofilm formation. In several bacterial species, natural competence stimulates DNA release via lysis-dependent or -independent mechanisms. Extracellular DNA (eDNA) has been demonstrated to be an important structural component of many bacterial biofilms. Therefore, we quantified the eDNA in the biofilms and found diminished eDNA amounts in the comEB mutant biofilm. High-resolution images and three-dimensional data obtained via confocal laser scanning microscopy (CSLM) visualized the impact of the comEB mutation on biofilm integrity. The comEB mutant did not show reduced expression of autolysin genes, decreased autolytic activities, or increased cell viability, suggesting a cell lysis-independent mechanism of DNA release. Furthermore, reduced amounts of eDNA in the comEB mutant biofilms did not result from elevated levels or activity of the S. lugdunensis thermonuclease NucI. In conclusion, we defined here, for the first time, a role for the competence gene comEB in staphylococcal biofilm formation. Our findings indicate that comEB stimulates biofilm formation via a lysis-independent mechanism of DNA release. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  17. [Quantitative assessment of EB strain cell death in an aerosol and following rehydration].

    Science.gov (United States)

    Blinkova, L P; Dubinina, G P

    1978-11-01

    The authors assessed quantitatively inactivation of lyophilized cells of EB strain by the action of aerosol stress and rehydration using the method of bacterial nucleoide staining. With the advance of dust aerosol "ages" microbial sensitivity to rehydration increased and to the action of aerosol stress--decreased. The method can be used to calculate the aspiration dose in aerogenic vaccination and also to assess the efficacy of lyophilized bacteria restoration.

  18. Mainstreaming Ecosystem Services Based Climate Change Adaptation (EbA in Bangladesh: Status, Challenges and Opportunities

    Directory of Open Access Journals (Sweden)

    Nazmul Huq

    2017-06-01

    Full Text Available The paper aims to analyze the extent of Ecosystem Service (ESS based Adaptation (EbA to climate change in the policy-making process of Bangladesh. The paper is based on a three stage hybrid policy-making cycle: (i agenda setting; (ii policy formulation; and (iii policy implementation stage, where the contributions of EbA can horizontally (on the ground or vertically (strategic stage be mainstreamed and integrated. A total of nine national and sectoral development and climate change policies, and 329 climate change adaptation projects are examined belonging to different policy-making stages. The major findings include that the role of ESS is marginally considered as an adaptation component in most of the reviewed policies, especially at the top strategic level (vertical mainstreaming. However, at the policy formulation and implementation stage (horizontal mainstreaming, they are largely ignored and priority is given to structural adaptation policies and projects, e.g., large scale concrete dams and embankments. For example, ESS’s roles to adapt sectors such as urban planning, biodiversity management and disaster risk reduction are left unchecked, and the implementation stage receives overwhelming priorities and investments to undertake hard adaptation measures such that only 38 projects are related to EbA. The paper argues that: (i dominant structural adaptation ideologies; (ii the expert and bureaucracy dependent policy making process; and (iii the lack of adaptive and integration capacities at institutional level are considerably offsetting the EbA mainstreaming process that need to be adequately addressed for climate change adaptation.

  19. User innovation in public service broadcasts

    DEFF Research Database (Denmark)

    Khajeheian, Datis; Tadayoni, Reza

    2016-01-01

    This research aims to understand how public service media can encourage media entrepreneurship in the society to enrich user innovations as a source of ideas, products, contents, talent and creativity. The assumption is that media entrepreneurs turn users into sources of external creativity...... and develop user innovations into professional content. This study follows a qualitative approach with a document study of Denmark's public service broadcast and two interviews. Findings indicate that the commitment to quality and professional content prevents managers of PSBs from outsourcing...... their production to media entrepreneurs, but they trust large media companies as external producers. This research contributes to the field by proposing that public service media can foster media entrepreneurship in a society indirectly and by creating demand for external sources of creativity. Large media...

  20. Sales plan generation problem on TV broadcasting

    Directory of Open Access Journals (Sweden)

    Özlem Cosgun

    2016-07-01

    Full Text Available Major advertisers and/or advertisement agencies purchase hundreds of slots during a given broadcast period. Deterministic optimization approaches have been well developed for the problem of meeting client requests. The challenging task for the academic research currently is to address optimization problem under uncertainty. This paper is concerned with the sales plan generation problem when the audience levels of advertisement slots are random variables with known probability distributions. There are several constraints the TV networks must meet including client budget, product category and demographic information, plan weighting by week, program mix requirements, and the lengths of advertisement slots desired by the client. We formulate the problem as a chance constrained goal program and we demonstrate that it provides a robust solution with a user specified level of reliability.

  1. Strategy and Space for Broadcasting Facilities

    DEFF Research Database (Denmark)

    Jensen, Per Anker

    2006-01-01

    The paper is based on results from an ongoing research project on space strategies and building values, which in-cludes a major case study of the development of facilities for the Danish Broadcasting Corporation over time. The focus is to identify, how different space strategies have been...... implemented in different periods and how these strate-gies can be related to the general conditions of the corporation. Based on theories from Martha O’Mara’s book on Space and Strategy (Free Press, 1999) development in the strategic uncertainty of the corporation is investigated as a main determining factor...... for changes in space strategy. The paper will also explain how space strategies in different periods deals with the need for adaptability and how adaptability is interpreted differently in various periods. The conclusions include relations between value-based space strategies and the presence of visionary...

  2. Efficient broadcast on random geometric graphs

    Energy Technology Data Exchange (ETDEWEB)

    Bradonjic, Milan [Los Alamos National Laboratory; Elsasser, Robert [UNIV OF PADERBORN; Friedrich, Tobias [INTERNATIONAL COMPUTER SCI.; Sauerwald, Thomas [INTERNATIONAL COMPUTER SCI.

    2009-01-01

    A Randon Geometric Graph (RGG) is constructed by distributing n nodes uniformly at random in the unit square and connecting two nodes if their Euclidean distance is at most r, for some prescribed r. They analyze the following randomized broadcast algorithm on RGGs. At the beginning, there is only one informed node. Then in each round, each informed node chooses a neighbor uniformly at random and informs it. They prove that this algorithm informs every node in the largest component of a RGG in {Omicron}({radical}n/r) rounds with high probability. This holds for any value of r larger than the critical value for the emergence of a giant component. In particular, the result implies that the diameter of the giant component is {Theta}({radical}n/r).

  3. CAPS markers specific to Eb, Ee, and R genomes in the tribe Triticeae.

    Science.gov (United States)

    Li, X-M; Lee, B S; Mammadov, A C; Koo, B-C; Mott, I W; Wang, R R-C

    2007-04-01

    Wild Triticeae grasses serve as important gene pools for forage and cereal crops. Understanding their genome compositions is pivotal for efficient use of this vast gene pool in germplasm-enhancement programs. Several cleaved amplified polymorphic sequence (CAPS) markers were developed to distinguish the Eb, Ee, and R genomes. With the aid of disomic addition lines of wheat, it was confirmed that all 7 chromosomes of Eb, Ee, and R genomes carry these genome-specific CAPS markers. Thus, the identified CAPS markers are useful in detecting and monitoring the chromosomes of these 3 genomes. This study also provides evidence suggesting that some Purdue and Chinese germplasm lines developed for barley yellow dwarf virus (BYDV) resistance are different from those developed in Australia. Furthermore, Thinopyrum intermedium and Thinopyrum ponticum were shown to have different genome constitutions. Sequence analyses of the 1272 bp sequences, containing Ty3/gypsy retrotransposons, from the Eb, Ee, and R genomes also shed light on the evolution of these 3 genomes.

  4. Nanostructured Polyaniline Emeraldine-base form (EB-PANI): a structural investigation for different neutralization times

    Science.gov (United States)

    Sanches, Edgar A.; da Silva, Jéssica M. S.; de O. Ferreira, Joelma M.; Soares, Juliana C.; dos Santos, Amanda L.; Trovati, Graziella; Fernandes, Edson G. R.; Mascarenhas, Yvonne P.

    2014-09-01

    Polyaniline Emeraldine-base form (EB-PANI) was chemically obtained through the neutralization of Polyaniline Emeraldine-salt form (ES-PANI) using NaOH 0.5 M at 3, 24 and 48 h of neutralization. X-ray Diffraction (XRD), Le Bail Method, Small-angle X-ray Diffraction (SAXD), Small-angle X-ray Scattering (SAXS) and Scanning Electron Microscopy (SEM) were used to characterize the obtained polymers. EB-PANI crystal data obtained at 3 h of neutralization were a = 5.7230 Å, b = 17.7233 Å, c = 19.2336 Å, α = 85.2879°, β = 84.6952° and γ = 87.7014°. Crystallinity percentage was obtained using the XRD patterns and remained around 32% during the neutralization process. Le Bail Method revealed that the crystallites were very small lamellae with an oblate spherical shape and global average size around 33 Å. By SAXS it was obtained the particle Radius of Giration (Rg) around 200 Å. The maximum particle size (Dmax) of 550 Å was obtained from the Pair-distance Distribution Function (p(r)). SEM images showed very small nanofibers morphology formed by interconnected nonhomogeneous nanospheres. EB-PANI electrical conductivity was 1.32 × 10-7 S/cm along the neutralization process.

  5. Polyurethane acrylate networks including cellulose nanocrystals: a comparison between UV and EB- curing

    Science.gov (United States)

    Furtak-Wrona, K.; Kozik-Ostrówka, P.; Jadwiszczak, K.; Maigret, J. E.; Aguié-Béghin, V.; Coqueret, X.

    2018-01-01

    A water-based polyurethane (PUR) acrylate water emulsion was selected as a radiation curable matrix for preparing nanocomposites including cellulose nanocrystals (CNC) prepared by controlled hydrolysis of Ramie fibers. Cross-linking polymerization of samples prepared in the form of films or of 1 mm-thick bars was either initiated by exposure to the 395 nm light of a high intensity LED lamp or by treatment with low energy electron beam (EB). The conversion level of acrylate functions in samples submitted to increasing radiation doses was monitored by Fourier Transform Infrared Spectroscopy (FTIR). Differential Scanning Calorimetry (DSC) and Dynamic Mechanical Analysis (DMA) were used to characterize changes in the glass transition temperature of the PUR-CNC nanocomposites as a function of acrylate conversion and of CNC content. Micromechanical testing indicates the positive effect of 1 wt% CNC on Young's modulus and on the tensile strength at break (σ) of cured nanocomposites. The presence of CNC in the PUR acrylate matrix was shown to double the σ value of the nanocomposite cured to an acrylate conversion level of 85% by treatment with a 25 kGy dose under EB, whereas no increase of σ was observed in UV-cured samples exhibiting the same acrylate conversion level. The occurrence of grafting reactions inducing covalent linkages between the polysaccharide nanofiller and the PUR acrylate matrix during the EB treatment is advanced as an explanation to account for the improvement observed in samples cured under ionizing radiation.

  6. National association of broadcasters engineering handbook NAB engineering handbook

    CERN Document Server

    Jones, Graham A; Osenkowsky, Thomas G; Williams, Edmund A

    2013-01-01

    The NAB Engineering Handbook provides detailed information on virtually every aspect of the broadcast chain, from news gathering, program production and postproduction through master control and distribution links to transmission, antennas, RF propagation, cable and satellite. Hot topics covered include HD Radio, HDTV, 2 GHz broadcast auxiliary services, EAS, workflow, metadata, digital asset management, advanced video and audio compression, audio and video over IP, and Internet broadcasting. A wide range of related topics that engineers and managers need to understand are also covered, includ

  7. Direct broadcast of a sporting event as televisual cultural form

    Directory of Open Access Journals (Sweden)

    Jože Vogrinc

    2012-07-01

    Full Text Available Direct TV broadcasting of sport events is undoubtedly the focal point of interest of sport fans in sports media as well as of sponsors and investors responsible for the global mediatisation of popular sports. In this article, the centrality of direct TV broadcasts in the televisual coverage of sports, as well as in the presence of sports in new media in general is explained in the context of the impact of the mediatisation of sports upon cultural forms of TV coverage of sports. The complexity of these forms and its main features (the role of the commentator, the rules of editing, dramatisation and narrativisation in direct broadcasts are analysed.

  8. Direct broadcasting by satellite for the United Kingdom

    Science.gov (United States)

    Rainger, P.; Phillips, G. J.

    1980-09-01

    The 1977 ITU broadcast allocations provide five frequency channels on the 12 GHz microwave band to each of its European member countries. The paper discusses the economic considerations and engineering aspects of implementing Direct Broadcasting Satellite (DBS) services by 1985-1987. A 1984 Ariane-3 launch will lift a package into geosynchronous orbit for the purpose of conducting satellite broadcasting demonstrations and pre-operational testing. Two DBS program services have been proposed by the BBC - subscription television and a national program, UK1 - with the IBA and the BBC sharing regulatory authority

  9. The Two-User Gaussian Fading Broadcast Channel

    CERN Document Server

    Jafarian, Amin

    2011-01-01

    This paper presents outerbounds for the two-user Gaussian fading broadcast channel. These outerbounds are based on Costa's entropy power inequality (Costa-EPI) and are formulated mathematically as a feasibility problem. For classes of the two-user Gaussian fading broadcast channel where the outerbound is found to have a feasible solution, we find conditions under which a suitable inner and outer bound meet. For all such cases, this paper provides a partial characterization of the capacity region of the Gaussian two-user fading broadcast channel.

  10. Reliable multihop broadcast protocol with a low-overhead link quality assessment for ITS based on VANETs in highway scenarios.

    Science.gov (United States)

    Galaviz-Mosqueda, Alejandro; Villarreal-Reyes, Salvador; Galeana-Zapién, Hiram; Rubio-Loyola, Javier; Covarrubias-Rosales, David H

    2014-01-01

    Vehicular ad hoc networks (VANETs) have been identified as a key technology to enable intelligent transport systems (ITS), which are aimed to radically improve the safety, comfort, and greenness of the vehicles in the road. However, in order to fully exploit VANETs potential, several issues must be addressed. Because of the high dynamic of VANETs and the impairments in the wireless channel, one key issue arising when working with VANETs is the multihop dissemination of broadcast packets for safety and infotainment applications. In this paper a reliable low-overhead multihop broadcast (RLMB) protocol is proposed to address the well-known broadcast storm problem. The proposed RLMB takes advantage of the hello messages exchanged between the vehicles and it processes such information to intelligently select a relay set and reduce the redundant broadcast. Additionally, to reduce the hello messages rate dependency, RLMB uses a point-to-zone link evaluation approach. RLMB performance is compared with one of the leading multihop broadcast protocols existing to date. Performance metrics show that our RLMB solution outperforms the leading protocol in terms of important metrics such as packet dissemination ratio, overhead, and delay.

  11. Reliable Multihop Broadcast Protocol with a Low-Overhead Link Quality Assessment for ITS Based on VANETs in Highway Scenarios

    Directory of Open Access Journals (Sweden)

    Alejandro Galaviz-Mosqueda

    2014-01-01

    Full Text Available Vehicular ad hoc networks (VANETs have been identified as a key technology to enable intelligent transport systems (ITS, which are aimed to radically improve the safety, comfort, and greenness of the vehicles in the road. However, in order to fully exploit VANETs potential, several issues must be addressed. Because of the high dynamic of VANETs and the impairments in the wireless channel, one key issue arising when working with VANETs is the multihop dissemination of broadcast packets for safety and infotainment applications. In this paper a reliable low-overhead multihop broadcast (RLMB protocol is proposed to address the well-known broadcast storm problem. The proposed RLMB takes advantage of the hello messages exchanged between the vehicles and it processes such information to intelligently select a relay set and reduce the redundant broadcast. Additionally, to reduce the hello messages rate dependency, RLMB uses a point-to-zone link evaluation approach. RLMB performance is compared with one of the leading multihop broadcast protocols existing to date. Performance metrics show that our RLMB solution outperforms the leading protocol in terms of important metrics such as packet dissemination ratio, overhead, and delay.

  12. Experimental Research of HF Passive Radar Based on DRM Digital AM Broadcasting

    Directory of Open Access Journals (Sweden)

    Wan Xian-rong

    2012-03-01

    Full Text Available This paper gives the experimental research of HF Passive Bistatic Radar (HFPBR based on Digital Radio Mondiale (DRM digital AM broadcasting that have been first carried out in China, using the newly-developed all-digital active/passive integrated HF surface wave radar system. The principle, key techniques, experimental equipment, and preliminary results are introduced about this new radar system. Based on analysis of the measurement data, experimental results under different scenarios including surface-wave, sky-wave, and hybrid sky-surface propagation modes are presented, which have proved, for the first time worldwide, the technical feasibility of using DRM broadcasting signal for over-the-horizon detection by field experiment and formed the theoretical and experimental basis for the further development of HFPBR.

  13. Analysis of economics of a TV broadcasting satellite for additional nationwide TV programs

    Science.gov (United States)

    Becker, D.; Mertens, G.; Rappold, A.; Seith, W.

    1977-01-01

    The influence of a TV broadcasting satellite, transmitting four additional TV networks was analyzed. It is assumed that the cost of the satellite systems will be financed by the cable TV system operators. The additional TV programs increase income by attracting additional subscribers. Two economic models were established: (1) each local network is regarded as an independent economic unit with individual fees (cost price model) and (2) all networks are part of one public cable TV company with uniform fees (uniform price model). Assumptions are made for penetration as a function of subscription rates. Main results of the study are: the installation of a TV broadcasting satellite improves the economics of CTV-networks in both models; the overall coverage achievable by the uniform price model is significantly higher than that achievable by the cost price model.

  14. 47 CFR 73.4163 - Noncommercial nature of educational broadcast stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Noncommercial nature of educational broadcast stations. 73.4163 Section 73.4163 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Rules Applicable to All Broadcast Stations § 73.4163...

  15. 47 CFR 73.2090 - Ban on discrimination in broadcast transactions.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Ban on discrimination in broadcast transactions. 73.2090 Section 73.2090 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Rules Applicable to All Broadcast Stations § 73.2090 Ban on...

  16. 47 CFR 74.780 - Broadcast regulations applicable to translators, low power, and booster stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Broadcast regulations applicable to translators... COMMISSION (CONTINUED) BROADCAST RADIO SERVICES EXPERIMENTAL RADIO, AUXILIARY, SPECIAL BROADCAST AND OTHER PROGRAM DISTRIBUTIONAL SERVICES Low Power TV, TV Translator, and TV Booster Stations § 74.780 Broadcast...

  17. 47 CFR 74.6 - Licensing of broadcast auxiliary and low power auxiliary stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Licensing of broadcast auxiliary and low power...) BROADCAST RADIO SERVICES EXPERIMENTAL RADIO, AUXILIARY, SPECIAL BROADCAST AND OTHER PROGRAM DISTRIBUTIONAL SERVICES General; Rules Applicable to All Services in Part 74 § 74.6 Licensing of broadcast auxiliary and...

  18. 78 FR 67025 - Domestic Requests for Broadcasting Board of Governors Program Materials

    Science.gov (United States)

    2013-11-08

    ...; and (b) The TV Marti Division of the Office of Cuba Broadcasting for broadcast-quality copies of TV or... for media and organization one-time requests for broadcast-quality agency program materials, and... as follows: Sec. 502.4 Media or organization one-time requests for broadcast quality agency program...

  19. 47 CFR 73.6026 - Broadcast regulations applicable to Class A television stations.

    Science.gov (United States)

    2010-10-01

    ... television stations. 73.6026 Section 73.6026 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Class A Television Broadcast Stations § 73.6026 Broadcast regulations applicable to Class A television stations. The following rules are applicable to Class A...

  20. 47 CFR 73.9001 - Redistribution control of digital television broadcasts.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Redistribution control of digital television... RADIO SERVICES RADIO BROADCAST SERVICES Digital Broadcast Television Redistribution Control § 73.9001 Redistribution control of digital television broadcasts. Licensees of TV broadcast stations may utilize the...

  1. EB1 regulates attachment of Ska1 with microtubules by forming extended structures on the microtubule lattice.

    Science.gov (United States)

    Thomas, Geethu E; Bandopadhyay, K; Sutradhar, Sabyasachi; Renjith, M R; Singh, Puja; Gireesh, K K; Simon, Steny; Badarudeen, Binshad; Gupta, Hindol; Banerjee, Manidipa; Paul, Raja; Mitra, J; Manna, Tapas K

    2016-05-26

    Kinetochore couples chromosome movement to dynamic microtubules, a process that is fundamental to mitosis in all eukaryotes but poorly understood. In vertebrates, spindle-kinetochore-associated (Ska1-3) protein complex plays an important role in this process. However, the proteins that stabilize Ska-mediated kinetochore-microtubule attachment remain unknown. Here we show that microtubule plus-end tracking protein EB1 facilitates Ska localization on microtubules in vertebrate cells. EB1 depletion results in a significant reduction of Ska1 recruitment onto microtubules and defects in mitotic chromosome alignment, which is also reflected in computational modelling. Biochemical experiments reveal that EB1 interacts with Ska1, facilitates Ska1-microtubule attachment and together stabilizes microtubules. Structural studies reveal that EB1 either with Ska1 or Ska complex forms extended structures on microtubule lattice. Results indicate that EB1 promotes Ska association with K-fibres and facilitates kinetochore-microtubule attachment. They also implicate that in vertebrates, chromosome coupling to dynamic microtubules could be mediated through EB1-Ska extended structures.

  2. Protective effects of ebselen (Ebs) and para-aminosalicylic acid (PAS) against manganese (Mn)-induced neurotoxicity

    Energy Technology Data Exchange (ETDEWEB)

    Marreilha dos Santos, A.P., E-mail: apsantos@ff.ul.pt [I-Med.UL, Department of Toxicology and Food Sciences, Faculty of Pharmacy, University of Lisbon, Lisbon (Portugal); Lucas, Rui L.; Andrade, Vanda; Mateus, M. Luísa [I-Med.UL, Department of Toxicology and Food Sciences, Faculty of Pharmacy, University of Lisbon, Lisbon (Portugal); Milatovic, Dejan; Aschner, Michael [Department of Pediatrics, Vanderbilt University Medical Center, Nashville, TN 37232 (United States); Batoreu, M. Camila [I-Med.UL, Department of Toxicology and Food Sciences, Faculty of Pharmacy, University of Lisbon, Lisbon (Portugal)

    2012-02-01

    Chronic, excessive exposure to manganese (Mn) may induce neurotoxicity and cause an irreversible brain disease, referred to as manganism. Efficacious therapies for the treatment of Mn are lacking, mandating the development of new interventions. The purpose of the present study was to investigate the efficacy of ebselen (Ebs) and para-aminosalicylic acid (PAS) in attenuating the neurotoxic effects of Mn in an in vivo rat model. Exposure biomarkers, inflammatory and oxidative stress biomarkers, as well as behavioral parameters were evaluated. Co-treatment with Mn plus Ebs or Mn plus PAS caused a significant decrease in blood and brain Mn concentrations (compared to rats treated with Mn alone), concomitant with reduced brain E{sub 2} prostaglandin (PGE{sub 2}) and enhanced brain glutathione (GSH) levels, decreased serum prolactin (PRL) levels, and increased ambulation and rearing activities. Taken together, these results establish that both PAS and Ebs are efficacious in reducing Mn body burden, neuroinflammation, oxidative stress and locomotor activity impairments in a rat model of Mn-induced toxicity. -- Highlights: ► The manuscript is unique in its approach to the neurotoxicity of Mn. ► The manuscript incorporates molecular, cellular and functional (behavioral) analyses. ► Both PAS and Ebs are effective in restoring Mn behavioral function. ► Both PAS and Ebs are effective in reducing Mn-induced oxidative stress. ► Both PAS and Ebs led to a decrease in Mn-induced neuro-inflammation.

  3. MODEL OF LEARNING ORGANIZATION IN BROADCASTING ORGANIZATION OF ISLAMIC REPUBLIC OF IRAN

    OpenAIRE

    Reza Najafbagy

    2010-01-01

    This article tries to present a model of learning organization for Iran Broadcasting Organization which is under the management of the spiritual leader of Iran. The study is based on characteristics of Peter Senge’s original learning organization namely, personal stery, mental models, shared vision, team learning and systems thinking. The methodology was a survey research employed questionnaire among sample employees and managers of the Organization.Findings showed that the Organization is fa...

  4. Electric bus systems.

    Science.gov (United States)

    2017-04-01

    Pure electric buses (EBs) offer an alternative fuel for the nations transit bus systems. To : evaluate EBs in a transit setting, this project investigated the five electric bus fleet of the : StarMetro transit system of the city of Tallahassee, FL...

  5. Broadcast spawning by Pocillopora species on the Great Barrier Reef.

    Science.gov (United States)

    Schmidt-Roach, Sebastian; Miller, Karen J; Woolsey, Erika; Gerlach, Gabriele; Baird, Andrew H

    2012-01-01

    The coral genus Pocillopora is one of the few to include some species that broadcast spawn gametes and some species that brood larvae, although reports of reproductive mode and timing vary within and among species across their range. Notably, the ubiquitous Pocillopora damicornis has been described as both a brooder and spawner, although evidence of broadcast spawning is rare. Here, we report observations of broadcast-spawning in four species of Pocillopora on the Great Barrier Reef (GBR), including P. damicornis. All species spawned predictably during the early morning, two days following the full moon, and spawning was observed in multiple months over the summer period (November to February). Eggs and sperm were free-spawned concurrently. Eggs were negatively buoyant and contained Symbiodinium. This newfound knowledge on the mode, timing and regularity of broadcast spawning in Pocillopora spp. on the GBR brings us one step closer to elucidating the complex reproductive ecology of these species.

  6. 78 FR 12967 - Broadcast Services; Children's Television; Cable Operators

    Science.gov (United States)

    2013-02-26

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Broadcast Services; Children's Television; Cable Operators AGENCY: Federal Communications Commission. ACTION: Final rule; announcement of effective date. SUMMARY: This document announces...

  7. 76 FR 43933 - Radio Broadcasting Services; Markham, TX

    Science.gov (United States)

    2011-07-22

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Markham, TX AGENCY: Federal Communications Commission... petition for reconsideration of Victoria Radio Works, LLC (``VRW''), seeking reconsideration of the Audio...

  8. Low Cost Antennas for Direct Broadcast Satellite Radio

    Science.gov (United States)

    Wu, T. K.; Huang, J.

    1994-01-01

    Two omni-directional and circularly polarized low gain antennas (the crossed drooping dipole and the TM(sub 21) mode circular patch antenna)are developed for direct broadcast satellite radio (DBSR) outdoor mobile terminal applications.

  9. 77 FR 38761 - Radio Broadcasting Services; Pike Road, AL

    Science.gov (United States)

    2012-06-29

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Pike Road, AL AGENCY: Federal Communications Commission. ACTION: Proposal rule; dismissal. SUMMARY: The Audio Division dismisses the petition for...

  10. 78 FR 11987 - Radio Broadcasting Services; Avalon, California

    Science.gov (United States)

    2013-02-21

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Avalon, California AGENCY: Federal Communications Commission. ACTION: Final rule; announcement of effective date. SUMMARY: This document announces the...

  11. 75 FR 81190 - Television Broadcasting Services; Yuma, AZ

    Science.gov (United States)

    2010-12-27

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Television Broadcasting Services; Yuma, AZ AGENCY: Federal Communications Commission. ACTION: Dismissal. SUMMARY: The Commission dismisses the petition for rulemaking filed by Arizona...

  12. 76 FR 18497 - Television Broadcasting Services; Augusta, GA

    Science.gov (United States)

    2011-04-04

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Television Broadcasting Services; Augusta, GA AGENCY: Federal Communications... 73 Television. Federal Communications Commission. Barbara A. Kreisman, Chief, Video Division, Media...

  13. Surveying woodland raptors by broadcast of conspecific vocalizations

    Science.gov (United States)

    Mosher, J.A.; Fuller, M.R.; Kopeny, M.

    1990-01-01

    We surveyed for raptors in forests on study areas in five of the eastern United States. For Cooper's Hawks (Accipiter cooperi), Red-shouldered Hawks (Buteo lineatus), and Barred Owls (Strix varia) the contact rates obtained by broadcasting taped vocalizations of conspecifics along roads were significantly greater than contact rates obtained by only looking and listening from the roadside. Broad-winged Hawks (B. platypterus) were detected only after their calls were broadcast. Most raptors were detected within 10 min of the beginning of the broadcasts. Red-tailed Hawks (B. jamaicensis) and Goshawks (A. gentilis) nested infrequently on our study areas, and we were unable to increase detections of these species. Generally, point count transects along woodland roads, from which conspecific vocalizations were broadcast, resulted in higher species specific detection rates than when walking, driving continuously, or only looking and listening for raptors at roadside stops.

  14. Print, Broadcast Students Share VDTs at West Fla.

    Science.gov (United States)

    Roberts, Churchill L.; Dickson, Sandra H.

    1985-01-01

    Describes the use of video display terminals in the journalism lab of a Florida university. Discusses the different purposes for which broadcast and print journalism students use such equipment. (HTH)

  15. How we use online broadcasting - Web TV - for community engagement

    Science.gov (United States)

    Allison, M. L.; Conway, F. M.; Matti, J.; Palmer, R.

    2013-12-01

    The Arizona Geological Survey uses online broadcasting (Webcast or 'Web TV') to help fulfill our statutory mission to 'Inform, advise and assist the public in matters concerning the geological processes, materials and landscapes and the development and use of the mineral resources of this state.' We launched a monthly online broadcast called 'Arizona Mining Review' via Livestream, a low-cost or free video streaming service. The show provides news, interviews, and discussions about mining and mineral resources topics of interest in Arizona, the nation's second largest non-fuel mining state. The costs to set up and broadcast are minor. Interviews with local guests are held in a corner of the AZGS conference room with easy chairs and a couch; long-distance interviews are held via Skype. The broadcast originates from a desktop computer with a webcam, a $60 microphone, three sets of earbud headphones and a powered amplifier. During broadcasts, we supplement interview footage with slides, photos, or video clips that we have or are provided by guests. Initial broadcasts were live; recordings of these were later uploaded to our YouTube channel. Because scheduling and executing a live Internet broadcast is stressful and demanding for both the production team and guests, we recently elected to record and produce episodes prior to broadcasting them. This allows us more control over supplementary materials used during the broadcast; it also permits us to record the broadcast using a high-definition digital video camera that cannot be used for streaming video. In addition to the Arizona Mining Review, we record conferences and workshops and special presentations on topical issues. A video on the recently discovered Little Chino fault has drawn over 3,000 views. Our latest presentations are short 1-2 minute 'video abstracts' delivered by authors of new publications released by the Survey. These include maps and graphics from the reports to help illustrate the topics and their

  16. An Overview on Development of Passive Radar Based on the Low Frequency Band Digital Broadcasting and TV Signals

    Directory of Open Access Journals (Sweden)

    Wan Xian-rong

    2012-06-01

    Full Text Available Starting from the detection principle and characteristics of passive radar, this paper describes the development of passive radar based on the low frequency band (HF/VHF/UHF digital broadcasting and TV signal. Based on the radio coverage ratio and technical features of digital broadcasting and TV signals, the research status in abroad, especially in Europe, is introduced at first, on experimental systems, technical parameters, and comparative experiments. Then the latest development of passive radars, in different frequency bands in China, both theory and experimental study are presented. Followed is the commentary on the key techniques and problems of Digital Broadcasting-based Passive Radar (DBPR, including the waveform’s properties and its modification, reference signal extraction, multipath clutter rejection, target detection, tracking, and fusion as well as real-time signal processing. Finally, the prospects of development and application of this kind of passive radar are discussed.

  17. Broadcast Abstraction in a Stochastic Calculus for Mobile Networks

    DEFF Research Database (Denmark)

    Song, Lei; Godskesen, Jens Christian

    2012-01-01

    topology constraint. We allow continuous time stochastic behavior of processes running at network nodes, e.g. in order to be able to model randomized protocols. The introduction of group broadcast and an operator to help avoid flooding allows us to define a novel notion of broadcast abstraction. Finally......, we define a weak bisimulation congruence and apply our theory on an example of a leader election protocol....

  18. At the Digital Watershed: Terrestrial Television Broadcasting in Japan

    OpenAIRE

    Koga-Browes, Scott

    2012-01-01

    The switch to digital terrestrial broadcasting on 24 July 2011 marked a watershed for the broadcasting industry in Japan. Digitalisation is the single largest industry-wide event since the advent of alternative distribution technologies, satellite and cable, in the 1980s. Preparation for the switch to digital, known as chideji-ka, has put existing business arrangements under pressure and has led to a renewed focus on the future shape of the industry. There is increasing acknowledgement that c...

  19. Beyond Broadcast Yourself ™: The Future of YouTube

    OpenAIRE

    Jarrett, Kylie

    2008-01-01

    Since its launch in early 2005, video sharing website YouTube has emerged as a culturally, politically and economically significant medium and as one of the inheritors of the social role played by broadcast television. However its continued growth and journey to profitability is not guaranteed. This paper queries the future of YouTube by exploring the tension inherent in the site’s 3 key characteristics embodied within its slogan Broadcast Yourself ™. The site is based within r...

  20. French Musical Broadcasting from 1955 to 1964: New Paths for the Broadcasting of Music

    OpenAIRE

    Bennet, Christophe

    2015-01-01

    During the 55-64 decade, French radio knows very serious modifications. Beside the birth of the private station Europe #1 (which doesn't concern our topic, since it hardly broadcasts any classical music), which is going to overshadow the national radio, it is going to be transformed, parallel to the replacement of its successive managers. The eleven years with Wladimir Porché at the helm were essential. Parallel to the development of the radio (the multiplication of the stations, programs, tr...

  1. A mutation of the fission yeast EB1 overcomes negative regulation by phosphorylation and stabilizes microtubules

    Energy Technology Data Exchange (ETDEWEB)

    Iimori, Makoto; Ozaki, Kanako [Graduate School of Biostudies, Kyoto University, Kitashirakawa-Oiwake cho, Sakyo ku, Kyoto, 606-8502 (Japan); Chikashige, Yuji [Kobe Advanced ICT Research Center, National Institute of Information and Communications Technology, Kobe, 651-2492 (Japan); Habu, Toshiyuki [Graduate School of Biostudies, Kyoto University, Kitashirakawa-Oiwake cho, Sakyo ku, Kyoto, 606-8502 (Japan); Radiation Biology Center, Kyoto University, Yoshida-Konoe cho, Sakyo ku, Kyoto, 606-8501 (Japan); Hiraoka, Yasushi [Kobe Advanced ICT Research Center, National Institute of Information and Communications Technology, Kobe, 651-2492 (Japan); Graduate School of Frontier Biosciences, Osaka University, 1-3 Yamadaoka, Suita, 565-0871 (Japan); Maki, Takahisa; Hayashi, Ikuko [Graduate School of Nanobioscience, Yokohama City University, Tsurumi, Yokohama, 230-0045 (Japan); Obuse, Chikashi [Graduate School of Life Science, Hokkaido University, Sapporo 001-0021 (Japan); Matsumoto, Tomohiro, E-mail: tmatsumo@house.rbc.kyoto-u.ac.jp [Graduate School of Biostudies, Kyoto University, Kitashirakawa-Oiwake cho, Sakyo ku, Kyoto, 606-8502 (Japan); Radiation Biology Center, Kyoto University, Yoshida-Konoe cho, Sakyo ku, Kyoto, 606-8501 (Japan)

    2012-02-01

    Mal3 is a fission yeast homolog of EB1, a plus-end tracking protein (+ TIP). We have generated a mutation (89R) replacing glutamine with arginine in the calponin homology (CH) domain of Mal3. Analysis of the 89R mutant in vitro has revealed that the mutation confers a higher affinity to microtubules and enhances the intrinsic activity to promote the microtubule-assembly. The mutant Mal3 is no longer a + TIP, but binds strongly the microtubule lattice. Live cell imaging has revealed that while the wild type Mal3 proteins dissociate from the tip of the growing microtubules before the onset of shrinkage, the mutant Mal3 proteins persist on microtubules and reduces a rate of shrinkage after a longer pausing period. Consequently, the mutant Mal3 proteins cause abnormal elongation of microtubules composing the spindle and aster. Mal3 is phosphorylated at a cluster of serine/threonine residues in the linker connecting the CH and EB1-like C-terminal motif domains. The phosphorylation occurs in a microtubule-dependent manner and reduces the affinity of Mal3 to microtubules. We propose that because the 89R mutation is resistant to the effect of phosphorylation, it can associate persistently with microtubules and confers a stronger stability of microtubules likely by reinforcing the cylindrical structure. -- Highlights: Black-Right-Pointing-Pointer We characterize a mutation (mal3-89R) in fission yeast homolog of EB1. Black-Right-Pointing-Pointer The mutation enhances the activity to assemble microtubules. Black-Right-Pointing-Pointer Mal3 is phosphorylated in a microtubule-dependent manner. Black-Right-Pointing-Pointer The phosphorylation negatively regulates the Mal3 activity.

  2. Optimizing Energy and Modulation Selection in Multi-Resolution Modulation For Wireless Video Broadcast/Multicast

    KAUST Repository

    She, James

    2009-11-01

    Emerging technologies in Broadband Wireless Access (BWA) networks and video coding have enabled high-quality wireless video broadcast/multicast services in metropolitan areas. Joint source-channel coded wireless transmission, especially using hierarchical/superposition coded modulation at the channel, is recognized as an effective and scalable approach to increase the system scalability while tackling the multi-user channel diversity problem. The power allocation and modulation selection problem, however, is subject to a high computational complexity due to the nonlinear formulation and huge solution space. This paper introduces a dynamic programming framework with conditioned parsing, which significantly reduces the search space. The optimized result is further verified with experiments using real video content. The proposed approach effectively serves as a generalized and practical optimization framework that can gauge and optimize a scalable wireless video broadcast/multicast based on multi-resolution modulation in any BWA network.

  3. Performance Evaluation and Parameter Optimization of SoftCast Wireless Video Broadcast

    Directory of Open Access Journals (Sweden)

    Dongxue Yang

    2015-08-01

    Full Text Available Wireless video broadcast plays an imp ortant role in multimedia communication with the emergence of mobile video applications. However, conventional video broadcast designs suffer from a cliff effect due to separated source and channel encoding. The newly prop osed SoftCast scheme employs a cross-layer design, whose reconstructed video quality is prop ortional to the channel condition. In this pap er, we provide the p erformance evaluation and the parameter optimization of the SoftCast system. Optimization principles on parameter selection are suggested to obtain a b etter video quality, o ccupy less bandwidth and/or utilize lower complexity. In addition, we compare SoftCast with H.264 in the LTE EPA scenario. The simulation results show that SoftCast provides a b etter p erformance in the scalability to channel conditions and the robustness to packet losses.

  4. Unconstrained Capacities of Quantum Key Distribution and Entanglement Distillation for Pure-Loss Bosonic Broadcast Channels

    Science.gov (United States)

    Takeoka, Masahiro; Seshadreesan, Kaushik P.; Wilde, Mark M.

    2017-10-01

    We consider quantum key distribution (QKD) and entanglement distribution using a single-sender multiple-receiver pure-loss bosonic broadcast channel. We determine the unconstrained capacity region for the distillation of bipartite entanglement and secret key between the sender and each receiver, whenever they are allowed arbitrary public classical communication. A practical implication of our result is that the capacity region demonstrated drastically improves upon rates achievable using a naive time-sharing strategy, which has been employed in previously demonstrated network QKD systems. We show a simple example of a broadcast QKD protocol overcoming the limit of the point-to-point strategy. Our result is thus an important step toward opening a new framework of network channel-based quantum communication technology.

  5. Unconstrained Capacities of Quantum Key Distribution and Entanglement Distillation for Pure-Loss Bosonic Broadcast Channels.

    Science.gov (United States)

    Takeoka, Masahiro; Seshadreesan, Kaushik P; Wilde, Mark M

    2017-10-13

    We consider quantum key distribution (QKD) and entanglement distribution using a single-sender multiple-receiver pure-loss bosonic broadcast channel. We determine the unconstrained capacity region for the distillation of bipartite entanglement and secret key between the sender and each receiver, whenever they are allowed arbitrary public classical communication. A practical implication of our result is that the capacity region demonstrated drastically improves upon rates achievable using a naive time-sharing strategy, which has been employed in previously demonstrated network QKD systems. We show a simple example of a broadcast QKD protocol overcoming the limit of the point-to-point strategy. Our result is thus an important step toward opening a new framework of network channel-based quantum communication technology.

  6. Satellite single-axis attitude determination based on Automatic Dependent Surveillance - Broadcast signals

    Science.gov (United States)

    Zhou, Kaixing; Sun, Xiucong; Huang, Hai; Wang, Xinsheng; Ren, Guangwei

    2017-10-01

    The space-based Automatic Dependent Surveillance - Broadcast (ADS-B) is a new technology for air traffic management. The satellite equipped with spaceborne ADS-B system receives the broadcast signals from aircraft and transfers the message to ground stations, so as to extend the coverage area of terrestrial-based ADS-B. In this work, a novel satellite single-axis attitude determination solution based on the ADS-B receiving system is proposed. This solution utilizes the signal-to-noise ratio (SNR) measurement of the broadcast signals from aircraft to determine the boresight orientation of the ADS-B receiving antenna fixed on the satellite. The basic principle of this solution is described. The feasibility study of this new attitude determination solution is implemented, including the link budget and the access analysis. On this basis, the nonlinear least squares estimation based on the Levenberg-Marquardt method is applied to estimate the single-axis orientation. A full digital simulation has been carried out to verify the effectiveness and performance of this solution. Finally, the corresponding results are processed and presented minutely.

  7. Court Reconstruction for Camera Calibration in Broadcast Basketball Videos.

    Science.gov (United States)

    Wen, Pei-Chih; Cheng, Wei-Chih; Wang, Yu-Shuen; Chu, Hung-Kuo; Tang, Nick C; Liao, Hong-Yuan Mark

    2016-05-01

    We introduce a technique of calibrating camera motions in basketball videos. Our method particularly transforms player positions to standard basketball court coordinates and enables applications such as tactical analysis and semantic basketball video retrieval. To achieve a robust calibration, we reconstruct the panoramic basketball court from a video, followed by warping the panoramic court to a standard one. As opposed to previous approaches, which individually detect the court lines and corners of each video frame, our technique considers all video frames simultaneously to achieve calibration; hence, it is robust to illumination changes and player occlusions. To demonstrate the feasibility of our technique, we present a stroke-based system that allows users to retrieve basketball videos. Our system tracks player trajectories from broadcast basketball videos. It then rectifies the trajectories to a standard basketball court by using our camera calibration method. Consequently, users can apply stroke queries to indicate how the players move in gameplay during retrieval. The main advantage of this interface is an explicit query of basketball videos so that unwanted outcomes can be prevented. We show the results in Figs. 1, 7, 9, 10 and our accompanying video to exhibit the feasibility of our technique.

  8. Wireless Multichannel Multipoint Broadcast Service for Mobile Stations

    Directory of Open Access Journals (Sweden)

    B. Homer Benny

    2013-01-01

    Full Text Available In wireless Multicast Broadcast Service (MBS, the common channel is used to multicast the MBS content to the Mobile Stations (MSs on the MBS calls within the coverage area of a Base Station (BS, which causes interference to the dedicated channels serving the traditional calls, and degrades the system capacity. The MBS zone technology is proposed in Mobile Communications Network (MCN standards to improve system capacity and reduce the handoff delay for the wireless MBS calls. In the MBS zone technology, a group of BSs form an MBS zone, where the macro diversity is applied in the MS, the BSs synchronize to transmit the MBS content on the same common channel, interference caused by the common channel is reduced, and the MBS MSs need not perform handoff while moving between the BSs in the same MBS zone. However, when there is no MBS MS in a BS with the MBS zone technology, the transmission on the common channel wastes the bandwidth of the BS. It is an important issue to determine the condition for the MBS Controller (MBSC to enable the MBS zone technology by considering the Quality of Services (QoS for traditional calls and MBS calls are used to reduce the dependency over the common channel and also it is going to reduce the delay over the network. By enabling Dynamic Channel Allocation (DCA and Enhance Dynamic Channel Allocation (EDCA we are going to overcome these problems.

  9. Integrating Communication and Navigation: Next Generation Broadcast Service (NGBS)

    Science.gov (United States)

    Donaldson, Jennifer

    2017-01-01

    NASA Goddard has been investing in technology demonstrations of a beacon service, now called Next Generation Broadcast Services (NGBS). NGBS is a global, space-based, communications and navigation service for users of Global Navigation Satellite Systems (GNSS) and the Tracking and Data Relay Satellite System (TDRSS). NGBS will provide an S-band beacon messaging source and radio navigation available to users at orbital altitudes 1400 km and below, increasing the autonomy and resiliency of onboard communication and navigation. NGBS will deliver both one-way radiometric (Doppler and pseudorange) and fast forward data transport services to users. Portions of the overall forward data volume will be allocated for fixed message types while the remaining data volume will be left for user forward command data. The NGBS signal will reside within the 2106.43 MHz spectrum currently allocated for the Space Networks multiple access forward (MAF) service and a live service demonstration is currently being planned via the 2nd and 3rd generation TDRS satellites.

  10. Mechanical properties of EB-PVD ZrO{sub 2} thermal barrier coatings; Mechanische Eigenschaften von EB-PVD ZrO{sub 2} Waermedaemmschichten

    Energy Technology Data Exchange (ETDEWEB)

    Held, Carolin

    2014-08-29

    In this work, the elastic properties of thermal barrier coatings which were produced by electron-beam enhanced physical vapour deposition were investigated, as well as the dependency of the properties on the sample microstructure, the thermal treatment and the test method. For this purpose, not only commercial coatings were characterized, but also special sample material was used which consists of a 1 mm thick layer of EB-PVD TBC. This material was isothermally heat treated for different times at 950 C, 1100 C and 1200 C and then tested in a specially developed miniaturized bend test and by dynamic mechanical analysis. The sample material was tested by nanoindentation in order to measure the Young's modulus on a local scale, and the porosity of the samples was determined by microstructure analysis and porosimetry. The decrease of porosity could be connected with sintering and subsequent stiffening of the material. The test results are dependent on the tested volume. A small test volume leads to larger measured Young's moduli, while a large test volume yields lower values. The test volume also has an influence on the increase of stiffness during thermal exposure. With a small tested volume, a quicker increase of the Young's modulus was registered, which could be associated to the sintering of local structures.

  11. Anti-migratory effect of vinflunine in endothelial and glioblastoma cells is associated with changes in EB1 C-terminal detyrosinated/tyrosinated status.

    Directory of Open Access Journals (Sweden)

    Amandine Rovini

    Full Text Available We previously showed that vinflunine, a microtubule-targeting drug of the Vinca-alkaloid family exerted its anti-angiogenic/anti-migratory activities through an increase in microtubule dynamics and an inhibition of microtubule targeting to adhesion sites. Such effect was associated with a reduction of EB1 comet length at microtubule (+ ends. In this work we first showed that the pro-angiogenic vascular endothelial growth factor VEGF suppressed microtubule dynamics in living Human Umbilical Vein Endothelial Cells (HUVECs, increased EB1 comet length by 40%, and induced EB1 to bind all along the microtubules, without modifying its expression level. Such microtubule (+ end stabilization occurred close to the plasma membrane in the vicinity of focal adhesion as shown by TIRF microscopy experiments. Vinflunine completely abolished the effect of VEGF on EB1 comets. Interestingly, we found a correlation between the reduction of EB1 comet length by vinflunine and the inhibition of cell migration. By using 2D gel electrophoresis we demonstrated for the first time that EB1 underwent several post-translational modifications in endothelial and tumor cells. Particularly, the C-terminal EEY sequence was poorly detectable in control and VEGF-treated HUVECs suggesting the existence of a non-tyrosinated form of EB1. By using specific antibodies that specifically recognized and discriminated the native tyrosinated form of EB1 and a putative C-terminal detyrosinated form, we showed that a detyrosinated form of EB1 exists in HUVECs and tumor cells. Interestingly, vinflunine decreased the level of the detyrosinated form and increased the native tyrosinated form of EB1. Using 3-L-Nitrotyrosine incorporation experiments, we concluded that the EB1 C-terminal modifications result from a detyrosination/retyrosination cycle as described for tubulin. Altogether, our results show that vinflunine inhibits endothelial cell migration through an alteration of EB1 comet length

  12. 47 CFR 73.6023 - Distributed transmission systems.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Distributed transmission systems. 73.6023... distributed transmission system. ... RADIO BROADCAST SERVICES Class A Television Broadcast Stations § 73.6023 Distributed transmission...

  13. SURVEI PENANGANAN BROADCAST STORM PROBLEM PADA PROTOKOL ROUTING AODV DI MANET

    Directory of Open Access Journals (Sweden)

    Indera Zainul Muttaqien

    2015-07-01

    Full Text Available Komunikasi multi-hop pada lingkungan MANET dapat melibatkan broadcast paket dalam proses route discovery. Protokol routing pada MANET akan melakukan broadcast paket RREQ dan menjalarkannya ke node tujuan secepat dan seefisien mungkin, dimana paket RREQ dari rute yang optimal adalah paket RREQ yang terlebih dahulu sampai ke tujuan. Aktifitas broadcast yang tidak terkontrol dapat menyebabkan suatu kondisi yang disebut broadcast storm problem. Broadcast storm problem dapat berdampak pada terganggunya kinerja dari protokol routing akibat adanya packet redundancy, contention, dan collision. Broadcast storm problem dapat ditangani dengan membatasi jumlah node yang dapat melakukan broadcast. Tujuan utama dari pembuatan makalah ini adalah merangkum beberapa mekanisme terbaru yang telah diakukan oleh para peneliti untuk menangani broadcast storm problem. Kami juga menyajikan perbandingan dari mekanisme tersebut berdasarkan karakteristik dari mekanisme ditinjau dari kesesuaian dengan beberapa skema penanganan broadcast storm problem yang diajukan oleh peneliti sebelumnya, kebutuhan informasi tertentu antar node, lingkungan uji coba dan apakah mekanisme ini dapat diterapkan pada protokol routing lainnya.

  14. Willingness to Pay for Elderly Telecare Service Using the Internet and Digital Terrestrial Broadcasting.

    Science.gov (United States)

    Kaga, Satoshi; Suzuki, Teppei; Ogasawara, Katsuhiko

    2017-10-24

    In Japan over the past few years, more attention has been focused on unnoticed solitary death in the context of an aging society and the trend toward nuclear family. A number of institutions and companies have implemented a prevention measure with digital terrestrial broadcasting telecare services for the elderly: Hokkaido University; TV-Asahi Corporation; Hitachi, Ltd; Iwamizawa City; Hokkaido Television Broadcasting Co, Ltd; and Hamanasu Information Co, Ltd. Although this system is provided free of charge as a demonstration test, determining the appropriate price for the service is required for its sustainable operation. The aim of this study was to quantify individual willingness to pay (WTP) so as to test the tenability of digital terrestrial broadcasting service for elderly telecare. We used the contingent valuation method (CVM) to estimate the WTP for this service among 305 citizens (valid response rate 76.0%) living in Japan. A questionnaire survey was conducted for people aged 18 to 100 years according to Japanese age distribution from September 2016. To elicit WTP, we adopted a double-bound dichotomous choice method to ask the respondents whether they agree or disagree with the price we offered. The median WTP for this service's monthly fee is estimated to be 431 JPY (approximately US $3.7). The finding suggests that gender (0.66, P=.01), health consciousness (1.08, P=.01), willingness to use (2.38, Pdigital terrestrial broadcasting service for elderly telecare was 431 JPY (approximately US $3.7). In the analysis of factors that affect WTP, constant factors, log-bid, health consciousness, gender, see others less than one time for week, and willingness to use made positive effect to probability of acceptance. In comparison of WTP in different groups, age groups showed that WTP of the elderly group was higher than WTP of the middle age group and younger age group. However, WTP surveys need to be carefully conducted to minimize the sampling bias and allocate

  15. Performance of the Galileo broadcast NeQuick model: Comparison with GPS and JASON TEC

    Science.gov (United States)

    Wang, Ningbo; Yuan, Yunbin; Li, Zishen

    2016-04-01

    Performances of Galileo NeQuick model are analyzed over the continental and oceanic regions for the whole year of 2013. The three broadcast coefficients of NeQuick are computed from 23 globally distributed tracking stations of the International GNSS Services (IGS), by ingesting the Global Positioning System (GPS) derived ionospheric total electron content (TEC) into the original NeQuick 2 model. In continental regions, the ionospheric TEC derived from 34 IGS stations are used as references for the comparison. In oceanic regions, where the IGS stations are sparse,high-quality vertical TEC sources provided by JASON 1 and 2 altimeters are used as references. GPS broadcast Klobuchar, the original and broadcast NeQuick can mitigate the ionospheric delay by 56.8%, 63.3% and 72.4%, respectively, when compared to GPS TEC. The three models can correct 51.1%, 61.2 % and 68.6% of the ionospheric delay when compared to JASON TEC. Galileo NeQuick model outperforms Klobuchar by 15.6% and 17.5% over the continental and oceanic regions, respectively, for the test period.

  16. BROSMAP: A Novel Broadcast Based Secure Mobile Agent Protocol for Distributed Service Applications

    Directory of Open Access Journals (Sweden)

    Dina Shehada

    2017-01-01

    Full Text Available Mobile agents are smart programs that migrate from one platform to another to perform the user task. Mobile agents offer flexibility and performance enhancements to systems and service real-time applications. However, security in mobile agent systems is a great concern. In this paper, we propose a novel Broadcast based Secure Mobile Agent Protocol (BROSMAP for distributed service applications that provides mutual authentication, authorization, accountability, nonrepudiation, integrity, and confidentiality. The proposed system also provides protection from man in the middle, replay, repudiation, and modification attacks. We proved the efficiency of the proposed protocol through formal verification with Scyther verification tool.

  17. Obstacles to broadcasting for national integration in Nigeria.

    Science.gov (United States)

    Amienyi, O P

    1989-01-01

    In Nigeria, the media is the major government vehicle to achieve national integration. The problems arise from the approximately 250 ethnic groups speaking many languages. Television and radio have caused disintegration by emphasizing alienation and polarization rather than unity. With more than 178 languages there are major problems for radio and television. The government leaders have promoted a strong interest in creating a unified society through broadcasting, but at the same time have allowed media managers to operate towards goals of ethnic protection. Religion is also a factor that hinders broadcasting for national unity, since there are Hausa and Muslim in the north, Catholic in the south-east, and in the south-west there are many African ethnic religions. More than 60% of the local programming on television is keyed to local religious subjects. Illiteracy is also a problem in the use of broadcasting in the goal of national integration. Only through education of a socially conscious people can the religious fanaticism, ethnocentrism, and tribalism be overcome to form a united nation. Broadcasting can play an important role consistent with the needs of society as a whole. Managers in broadcasting must be well educated, well trained and understand the needs and ambitions of society. They need to support these needs and ambitions, and be constructively critical when necessary for the betterment of society.

  18. 75 FR 17874 - Digital Audio Broadcasting Systems and Their Impact on the Terrestrial Radio Broadcast Service

    Science.gov (United States)

    2010-04-08

    ... document is available in alternative formats (computer diskette, large print, audio record and Braille... facilities with operating power up to -14 dBc upon notice to the Commission (licensees of a super-powered FM... licensee of the affected analog FM station may file an interference complaint with the Bureau. \\4\\ Super...

  19. Seamless Mobile Multimedia Broadcasting Using Adaptive Error Recovery

    Directory of Open Access Journals (Sweden)

    Carlos M. Lentisco

    2017-01-01

    Full Text Available Multimedia services over mobile networks present several challenges, such as ensuring a reliable delivery of multimedia content, avoiding undesired service disruptions, or reducing service latency. HTTP adaptive streaming addresses these problems for multimedia unicast services, but it is not efficient from the point of view of radio resource consumption. In Long-Term Evolution (LTE networks, multimedia broadcast services are provided over a common radio channel using a combination of forward error correction and unicast error recovery techniques at the application level. This paper discusses how to avoid service disruptions and reduce service latency for LTE multimedia broadcast services by adding dynamic adaptation capabilities to the unicast error recovery process. The proposed solution provides a seamless mobile multimedia broadcasting without compromising the quality of the service perceived by the users.

  20. A proteomic study of mitotic phase-specific interactors of EB1 reveals a role for SXIP-mediated protein interactions in anaphase onset

    Directory of Open Access Journals (Sweden)

    Naoka Tamura

    2015-01-01

    Full Text Available Microtubules execute diverse mitotic events that are spatially and temporally separated; the underlying regulation is poorly understood. By combining drug treatments, large-scale immunoprecipitation and mass spectrometry, we report the first comprehensive map of mitotic phase-specific protein interactions of the microtubule-end binding protein, EB1. EB1 interacts with some, but not all, of its partners throughout mitosis. We show that the interaction of EB1 with Astrin-SKAP complex, a key regulator of chromosome segregation, is enhanced during prometaphase, compared to anaphase. We find that EB1 and EB3, another EB family member, can interact directly with SKAP, in an SXIP-motif dependent manner. Using an SXIP defective mutant that cannot interact with EB, we uncover two distinct pools of SKAP at spindle microtubules and kinetochores. We demonstrate the importance of SKAP's SXIP-motif in controlling microtubule growth rates and anaphase onset, without grossly disrupting spindle function. Thus, we provide the first comprehensive map of temporal changes in EB1 interactors during mitosis and highlight the importance of EB protein interactions in ensuring normal mitosis.

  1. 47 CFR 1.525 - Agreements between parties for amendment or dismissal of, or failure to prosecute, broadcast...

    Science.gov (United States)

    2010-10-01

    ... dismissal of, or failure to prosecute, broadcast applications. 1.525 Section 1.525 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL PRACTICE AND PROCEDURE Broadcast Applications and Proceedings General Filing..., broadcast applications. See § 73.3525. ...

  2. Návrhy na zlepšení služeb hotelu Slunce

    OpenAIRE

    Burdová, Martina

    2011-01-01

    Tato diplomová práce je zpracována pro společnost Hotel & Restaurant Slunce, s.r.o., která je provozovatelem čtyřhvězdičkového hotelu Slunce. Zkoumá a hodnotí hotelové služby a oblasti, které s jejich zajištěním souvisí. Obsahuje návrhy na personální zajištění provozu, technického zázemí a zlepšení nabídky služeb, které vedou ke zvýšení obsazenosti hotelu a restaurace. Abstract The diploma thesis was elaborated for the company Hotel & Restaurant Slunce, s.r.o., which operates the fourstar ...

  3. Evaluation of Factors Affecting Polyhydroxyalkanoates Production by Comamonas sp. EB172 Using Central Composite Design

    Directory of Open Access Journals (Sweden)

    Noor Azman Mohd Johar

    2012-09-01

    Full Text Available Aims: Statistical approach, central composite design (CCD was used to investigate the complex interaction among temperature (25-37 °C, initial medium pH (5-9, inoculum size (4-10 % (v/v, concentration of (NH42SO4 (0-1 g/L and concentration of mixed organic acids (5-10 g/L in the production of polyhydroxyalkanoates by Comamonas sp. EB172.Methodology and Results: Mixed organic acids derived from anaerobically treated palm oil mill effluent (POME containing acetic:propionic:butyric (ratio of 3:1:1 were used as carbon source in the batch culture of Comamonas sp. EB172 to produce polyhydoxyalkanoates (PHAs. The analysis of variance (ANOVA showed that all five factors were significantly important in the batch fermentation by shake flask with a P value of less than 0.001. The optimal temperature, initial medium pH, inoculum size, concentration of (NH42SO4 and concentration of mixed organic acids were 30 °C, 7.04, 4.0 % (v/v, 0.01 g/L and 5.05 g/L respectively.Conclusion, significance and impact of study: Optimization of the production medium containing mixed organic acids has improved the PHA production for more than 2 folds. Under optimal condition in the shake flask fermentation, the predicted growth is 2.98 g/L of dry cell weight (DCW with 47.07 wt % of PHA content. The highest yield of PHA was 0.28 g of PHA per g mixed organic acids.

  4. Ultrasonic Sensor-Based Personalized Multichannel Audio Rendering for Multiview Broadcasting Services

    OpenAIRE

    Yong Guk Kim; Sang-Taeck Moon; Seung Ho Choi; Hong Kook Kim

    2013-01-01

    An ultrasonic sensor-based personalized multichannel audio rendering method is proposed for multiview broadcasting services. Multiview broadcasting, a representative next-generation broadcasting technique, renders video image sequences captured by several stereoscopic cameras from different viewpoints. To achieve realistic multiview broadcasting, multichannel audio that is synchronized with a user’s viewpoint should be rendered in real time. For this reason, both a real-time person-tracking t...

  5. A Distributed Air Index Based on Maximum Boundary Rectangle over Grid-Cells for Wireless Non-Flat Spatial Data Broadcast

    Directory of Open Access Journals (Sweden)

    Seokjin Im

    2014-06-01

    Full Text Available In the pervasive computing environment using smart devices equipped with various sensors, a wireless data broadcasting system for spatial data items is a natural way to efficiently provide a location dependent information service, regardless of the number of clients. A non-flat wireless broadcast system can support the clients in accessing quickly their preferred data items by disseminating the preferred data items more frequently than regular data on the wireless channel. To efficiently support the processing of spatial window queries in a non-flat wireless data broadcasting system, we propose a distributed air index based on a maximum boundary rectangle (MaxBR over grid-cells (abbreviated DAIM, which uses MaxBRs for filtering out hot data items on the wireless channel. Unlike the existing index that repeats regular data items in close proximity to hot items at same frequency as hot data items in a broadcast cycle, DAIM makes it possible to repeat only hot data items in a cycle and reduces the length of the broadcast cycle. Consequently, DAIM helps the clients access the desired items quickly, improves the access time, and reduces energy consumption. In addition, a MaxBR helps the clients decide whether they have to access regular data items or not. Simulation studies show the proposed DAIM outperforms existing schemes with respect to the access time and energy consumption.

  6. A distributed air index based on maximum boundary rectangle over grid-cells for wireless non-flat spatial data broadcast.

    Science.gov (United States)

    Im, Seokjin; Choi, JinTak

    2014-06-17

    In the pervasive computing environment using smart devices equipped with various sensors, a wireless data broadcasting system for spatial data items is a natural way to efficiently provide a location dependent information service, regardless of the number of clients. A non-flat wireless broadcast system can support the clients in accessing quickly their preferred data items by disseminating the preferred data items more frequently than regular data on the wireless channel. To efficiently support the processing of spatial window queries in a non-flat wireless data broadcasting system, we propose a distributed air index based on a maximum boundary rectangle (MaxBR) over grid-cells (abbreviated DAIM), which uses MaxBRs for filtering out hot data items on the wireless channel. Unlike the existing index that repeats regular data items in close proximity to hot items at same frequency as hot data items in a broadcast cycle, DAIM makes it possible to repeat only hot data items in a cycle and reduces the length of the broadcast cycle. Consequently, DAIM helps the clients access the desired items quickly, improves the access time, and reduces energy consumption. In addition, a MaxBR helps the clients decide whether they have to access regular data items or not. Simulation studies show the proposed DAIM outperforms existing schemes with respect to the access time and energy consumption.

  7. 47 CFR 1.572 - Processing TV broadcast and translator station applications.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Processing TV broadcast and translator station applications. 1.572 Section 1.572 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL PRACTICE AND PROCEDURE Broadcast Applications and Proceedings General Filing Requirements § 1.572 Processing TV broadcast...

  8. 47 CFR 74.601 - Classes of TV broadcast auxiliary stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Classes of TV broadcast auxiliary stations. 74... Television Broadcast Auxiliary Stations § 74.601 Classes of TV broadcast auxiliary stations. (a) TV pickup stations. A land mobile station used for the transmission of TV program material and related communications...

  9. 47 CFR 74.1205 - Protection of channel 6 TV broadcast stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Protection of channel 6 TV broadcast stations... 6 TV broadcast stations. The provisions of this section apply to all applications for construction... applicant and each affected TV Channel 6 broadcast station licensee or permittee concurring with the...

  10. 75 FR 76731 - Request for Comment for Report on In-State Broadcast Programming

    Science.gov (United States)

    2010-12-09

    ... COMMISSION Request for Comment for Report on In-State Broadcast Programming AGENCY: Federal Communications...) requires the Commission to submit a report on in- state broadcast programming to the appropriate... STELA states: SEC. 304. REPORT ON IN-STATE BROADCAST PROGRAMMING. Not later than 18 months after the...

  11. 76 FR 65192 - Radio Broadcasting Services; AM or FM Proposals To Change the Community of License

    Science.gov (United States)

    2011-10-20

    ... COMMISSION Radio Broadcasting Services; AM or FM Proposals To Change the Community of License AGENCY: Federal... the community of license: Eastern Sierra Broadcasting, Station KCWK, Facility ID 160324, BMP..., BNPH-20110929AGK, from Rotan, TX, to Roscoe, TX; Everglades City Broadcasting Company, Inc., Station...

  12. 78 FR 23565 - Radio Broadcasting Services; AM or FM Proposals To Change the Community of License.

    Science.gov (United States)

    2013-04-19

    ... COMMISSION Radio Broadcasting Services; AM or FM Proposals To Change the Community of License. AGENCY... BROADCASTING, INC., Station KAKS, Facility ID 69858, BPH- 20130318AGJ, From HUNTSVILLE, AR, To GOSHEN, AR; CARROLL COUNTY BROADCASTING, INC., Station KTHS, Facility ID 35668, BP-20130318AGK, From BERRYVILLE, AR...

  13. 76 FR 49364 - Radio Broadcasting Services; Gearhart, Madras, and Manzanita, OR

    Science.gov (United States)

    2011-08-10

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Gearhart, Madras, and Manzanita, OR AGENCY: Federal... CFR Part 73 Radio, Radio broadcasting. Federal Communications Commission. James D. Bradshaw, Deputy... Broadcasting, L.C., as modified pursuant to the counterproposal of Cumulus Licensing LLC (``Cumulus''), allots...

  14. 75 FR 51812 - Radio Broadcasting Services; AM or FM Proposals To Change the Community of License

    Science.gov (United States)

    2010-08-23

    ...] [FR Doc No: 2010-20912] FEDERAL COMMUNICATIONS COMMISSION Radio Broadcasting Services; AM or FM... BROADCASTING CORPORATION, Station KWBC, Facility ID 40912, BP-20100712ABU, From NAVASOTA, TX, To COLLEGE..., OR, To ALOHA, OR; IORIO BROADCASTING, INC., Station WNAE-FM, Facility ID 164188, BPH-20100728ABK...

  15. 76 FR 81932 - Auction of FM Broadcast Construction Permits; Revised Construction Permit Number in Auction 93

    Science.gov (United States)

    2011-12-29

    ... COMMISSION Auction of FM Broadcast Construction Permits; Revised Construction Permit Number in Auction 93... the construction permit number for one of the FM broadcast construction permits for Auction 93. FOR... of the FM broadcast construction permits being offered in Auction 93. The number assigned to the...

  16. 47 CFR 76.1601 - Deletion or repositioning of broadcast signals.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Deletion or repositioning of broadcast signals. 76.1601 Section 76.1601 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST... repositioning of broadcast signals. Effective April 2, 1993, a cable operator shall provide written notice to...

  17. 47 CFR 1.570 - AM broadcast station applications involving other North American countries.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false AM broadcast station applications involving... GENERAL PRACTICE AND PROCEDURE Broadcast Applications and Proceedings General Filing Requirements § 1.570 AM broadcast station applications involving other North American countries. See § 73.3570. ...

  18. 47 CFR 25.215 - Technical requirements for space stations in the Direct Broadcast Satellite Service.

    Science.gov (United States)

    2010-10-01

    ... the Direct Broadcast Satellite Service. 25.215 Section 25.215 Telecommunication FEDERAL COMMUNICATIONS... Technical requirements for space stations in the Direct Broadcast Satellite Service. In addition to § 25.148(f), space station antennas operating in the Direct Broadcast Satellite Service must be designed to...

  19. 47 CFR 1.580 - Local public notice of filing of broadcast applications.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Local public notice of filing of broadcast... PROCEDURE Broadcast Applications and Proceedings General Filing Requirements § 1.580 Local public notice of filing of broadcast applications. See § 73.3580. ...

  20. 47 CFR 73.674 - Digital television transition notices by broadcasters.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Digital television transition notices by... RADIO SERVICES RADIO BROADCAST SERVICES Television Broadcast Stations § 73.674 Digital television... broadcasting to digital television (DTV). For each such commercial station, a licensee or permittee must elect...