WorldWideScience

Sample records for bremzes berzes pra

  1. Remarks on the differential algebraic approach to particle beam optics by M. Berz

    International Nuclear Information System (INIS)

    Garczynski, V.

    1992-01-01

    The underlying mathematical structure of the differential algebraic approach of M. Berz to particle beam optics is isomorphic to the familiar truncated polynomial algebra. Concrete examples of derivations in this algebra, consistent with the truncation operation, are given

  2. Discharge and Nitrogen Transfer Modelling in the Berze River: A HYPE Setup and Calibration

    Directory of Open Access Journals (Sweden)

    Veinbergs Arturs

    2017-05-01

    Full Text Available This study is focused on water quality and quantity modelling in the Berze River basin located in the Zemgale region of Latvia. The contributing basin area of 872 km2 is furthermore divided into 15 sub-basins designated according to the characteristics of hydrological network and water sampling programme. The river basin of interest is a spatially complex system with agricultural land and forests as two predominant land use types. Complexity of the system reflects in the discharge intensity and diffuse pollution of nitrogen compounds into the water bodies of the river basin. The presence of urban area has an impact as the load from the existing wastewater treatment plants consist up to 76 % of the total nitrogen load in the Berze River basin. Representative data sets of land cover, agricultural field data base for crop distribution analysis, estimation of crop management, soil type map, digital elevation model, drainage conditions, network of water bodies and point sources were used for the modelling procedures. The semi-distributed hydro chemical model HYPE has a setup to simulate discharge and nitrogen transfer. In order to make the model more robust and appropriate for the current study the data sets previously stated were classified by unifying similar spatially located polygons. The data layers were overlaid and 53 hydrological response units (SLCs were created. Agricultural land consists of 48 SLCs with the details of soils, drainage conditions, crop types, and land management practices. Manual calibration procedure was applied to improve the performance of discharge simulation. Simulated discharge values showed good agreement with the observed values with the Nash-Sutcliffe efficiency of 0.82 and bias of −6.6 %. Manual calibration of parameters related to nitrogen leakage simulation was applied to test the most sensitive parameters.

  3. Discharge and Nitrogen Transfer Modelling in the Berze River: A HYPE Setup and Calibration

    Science.gov (United States)

    Veinbergs, Arturs; Lagzdins, Ainis; Jansons, Viesturs; Abramenko, Kaspars; Sudars, Ritvars

    2017-05-01

    This study is focused on water quality and quantity modelling in the Berze River basin located in the Zemgale region of Latvia. The contributing basin area of 872 km2 is furthermore divided into 15 sub-basins designated according to the characteristics of hydrological network and water sampling programme. The river basin of interest is a spatially complex system with agricultural land and forests as two predominant land use types. Complexity of the system reflects in the discharge intensity and diffuse pollution of nitrogen compounds into the water bodies of the river basin. The presence of urban area has an impact as the load from the existing wastewater treatment plants consist up to 76 % of the total nitrogen load in the Berze River basin. Representative data sets of land cover, agricultural field data base for crop distribution analysis, estimation of crop management, soil type map, digital elevation model, drainage conditions, network of water bodies and point sources were used for the modelling procedures. The semi-distributed hydro chemical model HYPE has a setup to simulate discharge and nitrogen transfer. In order to make the model more robust and appropriate for the current study the data sets previously stated were classified by unifying similar spatially located polygons. The data layers were overlaid and 53 hydrological response units (SLCs) were created. Agricultural land consists of 48 SLCs with the details of soils, drainage conditions, crop types, and land management practices. Manual calibration procedure was applied to improve the performance of discharge simulation. Simulated discharge values showed good agreement with the observed values with the Nash-Sutcliffe efficiency of 0.82 and bias of -6.6 %. Manual calibration of parameters related to nitrogen leakage simulation was applied to test the most sensitive parameters.

  4. A desktop PRA

    International Nuclear Information System (INIS)

    Dolan, B.J.; Weber, B.J.

    1989-01-01

    This paper reports that Duke Power Company has completed full-scope PRAs for each of its nuclear stations - Oconee, McGuire and Catawba. These living PRAs are being maintained using desktop personal computers. Duke's PRA group now has powerful personal computer-based tools that have both decreased direct costs (computer analysis expenses) and increased group efficiency (less time to perform analyses). The shorter turnaround time has already resulted in direct savings through analyses provided in support of justification for continued station operation. Such savings are expected to continue with similar future support

  5. PRA quality and use

    International Nuclear Information System (INIS)

    Okrent, D.; Apostolakis, G.; Whitley, R.; Garrick, B.J.

    1982-10-01

    This report deals with several inter-related aspects of probabilistic risk assessment. Some prior opinion regarding quality assurance, methodology and questions of peer review are reviewed, followed by comments by the authors on these and related subjects. Problems arising in decision-making by different groups concerning the meaning and validity of a PRA are examined, and the role of performance criteria in helping to achieve consensus is treated. Finally, a general approach to the development of performance criteria for systems and functions by the retrospective comparison of existing PRAs is proposed and examined in a preliminary fashion

  6. PRA and Conceptual Design

    Science.gov (United States)

    DeMott, Diana; Fuqua, Bryan; Wilson, Paul

    2013-01-01

    Once a project obtains approval, decision makers have to consider a variety of alternative paths for completing the project and meeting the project objectives. How decisions are made involves a variety of elements including: cost, experience, current technology, ideologies, politics, future needs and desires, capabilities, manpower, timing, available information, and for many ventures management needs to assess the elements of risk versus reward. The use of high level Probabilistic Risk Assessment (PRA) Models during conceptual design phases provides management with additional information during the decision making process regarding the risk potential for proposed operations and design prototypes. The methodology can be used as a tool to: 1) allow trade studies to compare alternatives based on risk, 2) determine which elements (equipment, process or operational parameters) drives the risk, and 3) provide information to mitigate or eliminate risks early in the conceptual design to lower costs. Creating system models using conceptual design proposals and generic key systems based on what is known today can provide an understanding of the magnitudes of proposed systems and operational risks and facilitates trade study comparisons early in the decision making process. Identifying the "best" way to achieve the desired results is difficult, and generally occurs based on limited information. PRA provides a tool for decision makers to explore how some decisions will affect risk before the project is committed to that path, which can ultimately save time and money.

  7. Hiperurisemia pada Pra Diabetes

    Directory of Open Access Journals (Sweden)

    Ellyza Nasrul

    2012-09-01

    Full Text Available AbstrakAsam urat (AU merupakan produk akhir dari katabolisme adenin dan guanin yang berasal dari pemecahannukleotida purin. Urat dihasilkan oleh sel yang mengandung xanthine oxidase, terutama hepar dan usus kecil.Hiperurisemia adalah keadaan kadar asam urat dalam darah lebih dari 7,0 mg/dL.Pra diabetes adalah subjek yangmempunyai kadar glukosa plasma meningkat akan tetapi peningkatannya masih belum mencapai nilai minimaluntuk kriteria diagnosis diabetes melitus (DM. Glukosa darah puasa terganggu merupakan keadaan dimanapeningkatan kadar FPG≥100 mg/dL dan <126 mg/dL. Toleransi glukosa terganggu merupakan peningkatanglukosa plasma 2 jam setelah pembebanan 75 gram glukosa oral (≥140 mg/dL dan <200mg/dL dengan FPG<126 mg/dL.Insulin juga berperan dalam meningkatkan reabsorpsi asam urat di tubuli proksimal ginjal. Sehinggapada keadaan hiperinsulinemia pada pra diabetes terjadi peningkatan reabsorpsi yang akan menyebabkanhiperurisemia. Transporter urat yang berada di membran apikal tubuli renal dikenal sebagai URAT-1 berperandalam reabsorpsi urat.Kata kunci: Hiperurisemia, Pra DiabetesAbstractUric acid (AU is the end product of the catabolism of adenine and guanine nucleotides derived from thebreakdown of purines. Veins produced by cells containing xanthine oxidase, especially the liver and small intestine.Hyperuricemia is a state in the blood uric acid levels over 7.0 mg / dL.Pre-diabetes is a subject which has a plasmaglucose level will rise but the increase is still not reached the minimum value for the diagnostic criteria for diabetesmellitus (DM. Impaired fasting blood glucose is a condition in which increased levels of FPG ≥ 100 mg / dL and<126 mg / dL. Impaired glucose tolerance is an increase in plasma glucose 2 hours after 75 gram oral glucose load(≥ 140 mg / dL and <200mg/dl with FPG <126 mg / dL.Insulin also plays a role in increasing the reabsorption ofuric acid in renal proximal tubule. So that the hyperinsulinemia in the pre

  8. Insights into PRA methodologies

    International Nuclear Information System (INIS)

    Gallagher, D.; Lofgren, E.; Atefi, B.; Liner, R.; Blond, R.; Amico, P.

    1984-08-01

    Probabilistic Risk Assessments (PRAs) for six nuclear power plants were examined to gain insight into how the choice of analytical methods can affect the results of PRAs. The PRA sreflectope considered was limited to internally initiated accidents sequences through core melt. For twenty methodological topic areas, a baseline or minimal methodology was specified. The choice of methods for each topic in the six PRAs was characterized in terms of the incremental level of effort above the baseline. A higher level of effort generally reflects a higher level of detail or a higher degree of sophistication in the analytical approach to a particular topic area. The impact on results was measured in terms of how additional effort beyond the baseline level changed the relative importance and ordering of dominant accident sequences compared to what would have been observed had methods corresponding to the baseline level of effort been employed. This measure of impact is a more useful indicator of how methods affect perceptions of plant vulnerabilities than changes in core melt frequency would be. However, the change in core melt frequency was used as a secondary measure of impact for nine topics where availability of information permitted. Results are presented primarily in the form of effort-impact matrices for each of the twenty topic areas. A suggested effort-impact profile for future PRAs is presented

  9. PRA and Risk Informed Analysis

    International Nuclear Information System (INIS)

    Bernsen, Sidney A.; Simonen, Fredric A.; Balkey, Kenneth R.

    2006-01-01

    The Boiler and Pressure Vessel Code (BPVC) of the American Society of Mechanical Engineers (ASME) has introduced a risk based approach into Section XI that covers Rules for Inservice Inspection of Nuclear Power Plant Components. The risk based approach requires application of the probabilistic risk assessments (PRA). Because no industry consensus standard existed for PRAs, ASME has developed a standard to evaluate the quality level of an available PRA needed to support a given risk based application. The paper describes the PRA standard, Section XI application of PRAs, and plans for broader applications of PRAs to other ASME nuclear codes and standards. The paper addresses several specific topics of interest to Section XI. Important consideration are special methods (surrogate components) used to overcome the lack of PRA treatments of passive components in PRAs. The approach allows calculations of conditional core damage probabilities both for component failures that cause initiating events and failures in standby systems that decrease the availability of these systems. The paper relates the explicit risk based methods of the new Section XI code cases to the implicit consideration of risk used in the development of Section XI. Other topics include the needed interactions of ISI engineers, plant operating staff, PRA specialists, and members of expert panels that review the risk based programs

  10. Review of PRA methodology for LMFBR

    International Nuclear Information System (INIS)

    Yang, J. E.

    1999-02-01

    Probabilistic Risk Assessment (PRA) has been widely used as a tool to evaluate the safety of NPPs (Nuclear Power Plants), which are in the design stage as well as in operation. Recently, PRA becomes one of the licensing requirements for many existing and new NPPs. KALIMER is a Liquid Metal Fast Breeder Reactor (LMFBR) being developed by KAERI. Since the design concept of KALIMER is similar to that of the PRISM plant developed by GE, it would be appropriate to review the PRA methodology of PRISM as the first step of KALIMER PRA. Hence, in this report summarizes the PRA methodology of PRISM plant, and the required works for the PSA of KALIMER based on the reviewed results. The PRA technology of PRISM plant consists of following five major tasks: (1) development of initiating event list, (2) development of system event tree, (3) development of core response event tree, (4) development of containment response event tree, and (5) consequences and risk estimation. The estimated individual and societal risk measures show that the risk from a PRISM module is substantially less than the NRC goal. Each task is compared to the PRA methodology of Light Water Reactor (LWR)/Pressurized Heavy Water Reactor (PHWR). In the report, each task of PRISM PRA methodology is reviewed and compared to the corresponding part of LWR/PHWR PSA performed in Korea. The parts that are not modeled appropriately in PRISM PRA are identified, and the recommendations for KALIMER PRA are stated. (author). 14 refs., 9 tabs., 4 figs

  11. Linkage of PRA models. Phase 1, Results

    Energy Technology Data Exchange (ETDEWEB)

    Smith, C.L.; Knudsen, J.K.; Kelly, D.L.

    1995-12-01

    The goal of the Phase I work of the ``Linkage of PRA Models`` project was to postulate methods of providing guidance for US Nuclear Regulator Commission (NRC) personnel on the selection and usage of probabilistic risk assessment (PRA) models that are best suited to the analysis they are performing. In particular, methods and associated features are provided for (a) the selection of an appropriate PRA model for a particular analysis, (b) complementary evaluation tools for the analysis, and (c) a PRA model cross-referencing method. As part of this work, three areas adjoining ``linking`` analyses to PRA models were investigated: (a) the PRA models that are currently available, (b) the various types of analyses that are performed within the NRC, and (c) the difficulty in trying to provide a ``generic`` classification scheme to groups plants based upon a particular plant attribute.

  12. Linkage of PRA models. Phase 1, Results

    International Nuclear Information System (INIS)

    Smith, C.L.; Knudsen, J.K.; Kelly, D.L.

    1995-12-01

    The goal of the Phase I work of the ''Linkage of PRA Models'' project was to postulate methods of providing guidance for US Nuclear Regulator Commission (NRC) personnel on the selection and usage of probabilistic risk assessment (PRA) models that are best suited to the analysis they are performing. In particular, methods and associated features are provided for (a) the selection of an appropriate PRA model for a particular analysis, (b) complementary evaluation tools for the analysis, and (c) a PRA model cross-referencing method. As part of this work, three areas adjoining ''linking'' analyses to PRA models were investigated: (a) the PRA models that are currently available, (b) the various types of analyses that are performed within the NRC, and (c) the difficulty in trying to provide a ''generic'' classification scheme to groups plants based upon a particular plant attribute

  13. Standardized procedure for tsunami PRA by AESJ

    International Nuclear Information System (INIS)

    Kirimoto, Yukihiro; Yamaguchi, Akira; Ebisawa, Katsumi

    2013-01-01

    After Fukushima Accident (March 11, 2011), the Atomic Energy Society of Japan (AESJ) started to develop the standard of Tsunami Probabilistic Risk Assessment (PRA) for nuclear power plants in May 2011. As Japan is one of the countries with frequent earthquakes, a great deal of efforts has been made in the field of seismic research since the early stage. To our regret, the PRA procedures guide for tsunami has not yet been developed although the importance is held in mind of the PRA community. Accordingly, AESJ established a standard to specify the standardized procedure for tsunami PRA considering the results of investigation into the concept, the requirements that should have and the concrete methods regarding tsunami PRA referring the opinions of experts in the associated fields in December 2011 (AESJ-SC-RK004:2011). (author)

  14. Practical PRA applications at Consumers Power Company

    International Nuclear Information System (INIS)

    Blanchard, D.P.

    1985-01-01

    Consumers Power Company has completed two probabilistic risk assessments (PRAs), one each at its Big Rock Point and Midland plants and is in the process of performing a third study at its Palisades Plant. Each PRA is summarized briefly in this paper. Each PRA has been used to evaluate specific plant design features and make operating and design recommendations to plant and Company management as well as to the regulator. This paper is a sumary of those issues on which Consumers Power Company has applied PRAs to date. The technique used in applying PRA to these issues has varied as more was learned about the plants from the PRA and about PRA itself. Some issue resolutions involved deriving technical arguments from small parts of the PRA only, such as the logic models or consequence analysis. Still others required use of the entire PRA including sequence quantification, plant and containment response, consequence analysis and eventually cost-benefit evaluation of proposed resolutions. The benefits derived from these analyses have also varied and include not only a perceived reduction in the risks associated with plant operation but also economic benefit to the Company in that cost-effective alternatives to resolving safety issues have been permitted

  15. IRIS PRA preliminary results and future direction

    International Nuclear Information System (INIS)

    Finnicum, D.J.; Kling, C.L.; Carelli, M.D.

    2004-01-01

    Westinghouse is currently conducting the pre-application licensing of the International Reactor Innovative and Secure (IRIS) on behalf of the IRIS Consortium. One of the key aspects of the IRIS design is the concept of safety-by-design. The PRA (Probabilistic Risk Analysis) is being used as an integral part of the design process. As part of this effort, a PRA of the initial design was generated to address 2 key areas. First, the IRIS PRA supported the evaluation of IRIS design issues by providing a solid risk basis for design and analyses required for the pre-licensing evaluation of the IRIS design. The PRA provides the tool for quantifying the benefit of the safety-by-design approach. Second, the current PRA task is beginning the preparation of the more complete PRA analyses and documentation eventually required for Design Certification. One of the key risk-related goals for IRIS is to reduce the EPZ (Emergency Protection Zone) to within the exclusion area by demonstrating that the off-site doses are consistent with the US Protective Action Guidelines (PAGs) for initiation of emergency response so that the required protective actions would be limited to the exclusion area. The results of the preliminary PRA indicated a core damage frequency of 1.2 E-08 for internal initiators. This is a very good result but much work is needed to meet the ambitious goal of no emergency response. The next phase of the PRA analyses will involve a two-fold expansion of the PRA. First, as the design and analyses approach a greater level of detail, the assumptions used for the initial PRA will be reviewed and the models will be revised as needed to reflect the improved knowledge of the system design and performance. Furthermore, as the full plant design advances, the PRA will be expanded to incorporate risk associated with external challenges such as seismic and fire, and to address low power and shutdowns modes of operation. As with the initial work, the PRA will serve as a tool to

  16. Observations on PRA and its applications

    International Nuclear Information System (INIS)

    Yeh, Y.-C.; Shieh, S.-L.

    2004-01-01

    An overview on the experience of PRA and its prospective application in Taiwan's three nuclear power plants is presented. Through the PRA, plant design improvements are performed and several engineering findings are illuminated. The sensitivity study including the internal, seismic, and typhoon events are conducted to justify items that can significantly reduce core meltdown risk. Its resulted plant betterment plans are thus highlighted accordingly. For PRA application, a risk-based inspection program for allocating inspection human resources has been resulted following the importance ranking of each component. The developing risk-based regulation to rationalize technical specification and maintenance program will also be entailed. To enhance the accuracy of the PRA model and its reproducibility, several issues are considered to have high priority for improvement such as external event data and analyses, uncertainty, common mode failure, human reliability, and the relative component importance. Highlight of their significance along with some typical sensitivity analyses are discussed for further investigation. (author)

  17. PRA studies: results, insights and applications

    International Nuclear Information System (INIS)

    Levine, S.; Stetson, F.T.

    1983-01-01

    This paper deals with Probalistic Risk Assessment (PRA) studies and their results. The PRA is a combination of logic structures and analytical techniques that can be used to estimate the likelihood and consequences of events that have not been observed because of their low frequency occurrence. At first attitudes concerning PRA reports were controversial principally because of their new techniques and complex multidisciplinary nature. However these attitudes changed following the accident at Three Mile Island in 1979. Many people after this event came to appreciate the risks associated with the operation of nuclear power plants, and since the TMI accident there has been a rapid expansion, in the use of PRA in the US and other countries. (NEA) [fr

  18. Management and Organization Influences in PRA

    International Nuclear Information System (INIS)

    Gertman, D.I.; Hallbert, B. P.; Blackman, H. S.

    1998-01-01

    The authors present a research program which aimed at increasing the quality of comprehensiveness of contemporary PRA (Probability Risk Assessment) by providing a tool that allows for incorporating M and O in PRA, at improving the quality of NRC assessments, at conducting research to support the risk informed regulation process, at identifying impact of management and organization, safety culture, workplace environment, down-sizing and deregulation on human performance and reliability

  19. Uses of PRA in nuclear reactor regulation

    International Nuclear Information System (INIS)

    Congel, F.

    1987-01-01

    For the past five years, more than ten probabilistic risk assessment (PRA) studies were conducted by the owners of nuclear utilities and were submitted for the review of US Nuclear Regulatory Commission staff. These PRA studies were reviewed under various types of regulatory activities depending on the nature of plant licensing stage. The reviews of these PRAs provided very valuable uses to both the staff and the licensees on safety matters of the plant operation. The licensees developed perspectives using PRA models on the safety profiles of their plants. These PRA perspectives influenced licensees' major decisions to implement improvements to plant design and operating and emergency procedures to reduce and/or eliminate the plant's vulnerability to core damage accidents. The staff's review of these PRAs particularly emphasized the dominant accident sequences. The resulting findings led to the identification of dominant risk contributors, critical areas of plant locations, mechanisms leading to potential early containment failures, and instances of noncompliances of staff's deterministic criteria. Specific examples include single failure criterion and separation requirements to assess the need for any additional measures to further improve the safety of the plant. Some of these PRAs were reviewed under regulatory activities other than safety review such as environmental review, final design review, and licensing hearings. Most importantly, the risk profiles of generic PRAs will continue to be used in reviewing and evaluating unresolved safety issues and other generic issues. The major regulatory uses of PRAs, a summary of full scope PRA review, a summary of plant improvements as a result of PRA reviews, and the future role of PRA reviews are presented

  20. PRA (Probabilistic Risk Assessments) Participation versus Validation

    Science.gov (United States)

    DeMott, Diana; Banke, Richard

    2013-01-01

    Probabilistic Risk Assessments (PRAs) are performed for projects or programs where the consequences of failure are highly undesirable. PRAs primarily address the level of risk those projects or programs posed during operations. PRAs are often developed after the design has been completed. Design and operational details used to develop models include approved and accepted design information regarding equipment, components, systems and failure data. This methodology basically validates the risk parameters of the project or system design. For high risk or high dollar projects, using PRA methodologies during the design process provides new opportunities to influence the design early in the project life cycle to identify, eliminate or mitigate potential risks. Identifying risk drivers before the design has been set allows the design engineers to understand the inherent risk of their current design and consider potential risk mitigation changes. This can become an iterative process where the PRA model can be used to determine if the mitigation technique is effective in reducing risk. This can result in more efficient and cost effective design changes. PRA methodology can be used to assess the risk of design alternatives and can demonstrate how major design changes or program modifications impact the overall program or project risk. PRA has been used for the last two decades to validate risk predictions and acceptability. Providing risk information which can positively influence final system and equipment design the PRA tool can also participate in design development, providing a safe and cost effective product.

  1. Individual plant examination and future PRA applications

    International Nuclear Information System (INIS)

    Monty, B.S.; Sursock, J.P.; Thierry, R.J.

    1992-01-01

    PRA is being used in many areas of plant operation as has been demonstrated in previous studies. With the U.S. NRC's emphasis on the use of risk to identify plant vulnerabilities and the development of plant specific PRA models for all plants, it is expected that the use of PRA will be expanded. Key areas where this is expected to occur include the development of risk-based Technical Specifications, risk management, and risk-centered maintenance programs. This paper focuses on the Individual Plant Examination requirement and the possible uses of risk-based methods in controlling plant operation to enhance plant safety and availability, and how the IPE requirement will potentially further this area of development. (orig./DG)

  2. Level 2 PRA for a German BWR

    International Nuclear Information System (INIS)

    Sassen, F.; Rapp, W.; Tietsch, W.; Roess, P.

    2007-01-01

    A concept for a Level 2 Probabilistic Risk Assessment (L2 PRA) for a German Boiling Water Reactor (BWR) has been developed taking into account the role of L2 PRA within the German regulatory landscape. According to this concept, a plant specific evaluation of the severe accident phenomenology as well as analyses of the accident progression for the severe accident scenarios has been performed. Furthermore a plant specific MELCOR 1.8.6 model has been developed and special MELCOR source term calculations have been performed for the different release paths. This paper will present examples from the different areas described above. (author)

  3. Probabilistic risk assessment course documentation. Volume 1: PRA fundamentals

    International Nuclear Information System (INIS)

    Breeding, R.J.; Leahy, T.J.; Young, J.

    1985-08-01

    The full range of PRA topics is presented, with a special emphasis on systems analysis and PRA applications. Systems analysis topics include system modeling such as fault tree and event tree construction, failure rate data, and human Reliability. The discussion of PRA applications is centered on past and present PRA based programs, such as WASH-1400 and the Interim Reliability Evaluation Program, as well as on some of the potential future applications of PRA. The relationship of PRA to generic safety issues such as station blackout and Anticipated Transient Without Scram (ATWS) is also discussed. In addition to system modeling, the major PRA tasks of accident process analysis, and consequence analysis are presented. An explanation of the results of these activities, and the techniques by which these results are derived, forms the basis for a discussion of these topics. An additional topic which is presented in this course is the topic of PRA management, organization, and evaluation. 84 figs., 41 tabs

  4. The Angra 1 fire PRA project

    International Nuclear Information System (INIS)

    Silva, Luiz E. Massiere de C.; Kassawara, Robert

    2009-01-01

    The Angra 1 Fire PRA (Probabilistic Risk Assessment) is under development by ELETRONUCLEAR jointly with EPRI (Electric Power Research Institute). The project was started January of 2007 and it is foreseen to be finished in the middle of the next year. The study is being conducted according to the newest methodology developed by EPRI and NRC/RES (U.S. Nuclear Regulatory Commission - Office of Regulatory Research) published in 2005 as Fire PRA Methodology for Nuclear Power Facilities (NUREG/CR-6850 or EPRI TR-1011989) [1]. Starting from the Internal Events Angra 1 PRA model Level 1 the project aims to be a comprehensive plant-specific fire analysis to identify the possible consequences of a fire in the plant vital areas which threaten the integrity of systems relevant to the safety, challenging the safety functions and representing a risk of accident that can lead to a core damage. The main tasks include the plant boundary and partitioning, the fire PRA component selection and the identification of the possible fire scenarios (ignition, propagation, detection, extinction and hazards) considering human failure events to establish the fire-induced risk model for quantification of the risk for nuclear core damage taking into account the plant design and its fire protection resources. This work presents a general discussion on the methodology applied to the completed steps of the project. (author)

  5. PRA: a powerful engineering decision tool

    International Nuclear Information System (INIS)

    Carvalho, H.G. de.

    1988-03-01

    The probabilistic risk analysis (PRA) is studied and its historical development is briefly presented. Human factors, sofware and guides, improvement of utility management of nuclear power operations are discussed. The development of a standardized LWR design, optimized for safety, reliability and economy is studied. The impact of risk assessments in public acceptance of nuclear power is discussed. (M.A.C.) [pt

  6. Probabilistic risk assessment (PRA) reference document. Final report

    International Nuclear Information System (INIS)

    Murphy, J.A.

    1984-09-01

    This document describes the current status of probabilistic risk assessment (PRA) as practiced in the nuclear reactor regulatory process. The PRA studies that have been completed or are under way are reviewed. The levels of maturity of the methodologies used in a PRA are discussed. Insights derived from PRAs are listed. The potential uses of PRA results for regulatory purposes are discussed. This document was issued for comment in February 1984 entitled Probabilistic Risk Assessment (PRA): Status Report and Guidance for Regulatory Application. The comments received on the draft have been considered for this final version of the report

  7. Role of PRA in new NPP projects

    International Nuclear Information System (INIS)

    Julin, A.; Sandberg, J.; Virolainen, R.

    2012-01-01

    In Finland, a plant specific, Level 1 and 2 Probabilistic Risk Analysis (PRA) is required as a prerequisite for issuing the construction license and operating license. The use of PRA in various applications and the main insights are presented. These applications include e.g. PRA support to the design of SSCs (Systems, Structures and Components), definition of pre-service and in-service inspection programs, evaluation of the safety classification of SSCs, development of procedures, training and in definition of risk informed technical specifications, periodic testing and on-line preventive maintenance programs. In addition, PRA shall be used to assess the adequacy and coverage of the phase and system commissioning programs. Also the potential risks related to commissioning tests during nuclear test phase, shall be assessed with the help of PRA. In OL3 project, risk informed approach has been applied on a large scale for the first time in the design, construction and commissioning of a new NPP unit. Pre-nuclear commissioning tests have started at OL3 site and the plant is foreseen to begin commercial operation in 2013. Decisions have been made to launch new NPP projects. Teollisuuden Voima Oyj (TVO) is planning to build a new unit (OL4) at Olkiluoto site and a new utility, Fennovoima, is planning to build one unit at one of two alternative green field sites in Northern parts of Finland. Insights from PRAs of operating NPPs have been used in the evaluation of possible new sites to ensure that the site specific concerns and environmental conditions are adequately taken into account in the design of SSCs. Although the seismic activity at the Olkiluoto site is low, a comprehensive seismic risk analysis is being conducted. Its results support the review of the deterministic seismic design. For new sites, a probabilistic seismic hazard analysis has been carried out for the determination of the design earthquake. Experiences from OL3 licensing have been utilized in the

  8. Summary of PRA assessment of transient accident risks, human factors considerations, and PRA methods and applications

    International Nuclear Information System (INIS)

    Carnino, A.

    1984-01-01

    This chapter reviews the progress made in the probabilistic risk assessment (PRA) area to help in solving operational transient problems and to integrate human factors considerations, as discussed at the American Nuclear Society Topical Meeting on Anticipated and Abnormal Plant Transients in Light Water Reactors. Topics considered include core-melt frequency, external events (e.g., fires, floods), diagnostic errors, and operator aids. It is concluded that confidence in PRA results, predictions and uses for decisions in both the safety of the plants and their availability will improve

  9. Insights on PRA Review Practices: Necessity for Model Shaking

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Inn Seock; Jang, Mi suk; Kim, Seoung Rae [NESS, Daejeon (Korea, Republic of)

    2016-05-15

    Probabilistic risk assessment (PRA) is increasingly used as a technique to help ensure design and operational safety of nuclear power plants (NPPs) in the nuclear industry. Hence, there is considerable interest in the PRA quality, and as a result, a peer review of the PRA model is typically performed to ensure its technical adequacy as part of the PRA development process or for any other reason (e.g., regulatory requirement). For the PRA model to be used as a valuable vehicle for risk-informed applications, it is essential that the PRA model must yield correct and physically meaningful accident sequences and minimal cutsets for specific plant configurations or conditions relating to the applications. Hence, the existing peer review guidelines need to be updated to reflect these insights so that risk-informed applications could be more actively pursued with confidence.

  10. PRA: A PERSPECTIVE ON STRENGTHS, CURRENT LIMITATIONS, AND POSSIBLE IMPROVEMENTS

    Directory of Open Access Journals (Sweden)

    ALI MOSLEH

    2014-02-01

    Full Text Available Probabilistic risk assessment (PRA has been used in various technological fields to assist regulatory agencies, managerial decision makers, and systems designers in assessing and mitigating the risks inherent in these complex arrangements. Has PRA delivered on its promise? How do we gage PRA performance? Are our expectations about value of PRA realistic? Are there disparities between what we get and what we think we are getting form PRA and its various derivatives? Do current PRAs reflect the knowledge gained from actual events? How do we address potential gaps? These are some of the questions that have been raised over the years since the inception of the field more than forty years ago. This paper offers a brief assessment of PRA as a technical discipline in theory and practice, its key strengths and weaknesses, and suggestions on ways to address real and perceived shortcomings.

  11. PRA: A Perspective on Strengths, Current Limitations, And Possible Improvements

    International Nuclear Information System (INIS)

    Mosleh, Ail

    2014-01-01

    Probabilistic risk assessment (PRA) has been used in various technological fields to assist regulatory agencies, managerial decision makers, and systems designers in assessing and mitigating the risks inherent in these complex arrangements. Has PRA delivered on its promise? How do we gage PRA performance? Are our expectations about value of PRA realistic? Are there disparities between what we get and what we think we are getting form PRA and its various derivatives? Do current PRAs reflect the knowledge gained from actual events? How do we address potential gaps? These are some of the questions that have been raised over the years since the inception of the field more than forty years ago. This paper offers a brief assessment of PRA as a technical discipline in theory and practice, its key strengths and weaknesses, and suggestions on ways to address real and perceived shortcomings

  12. PRISIM: a computer program that makes PRA useful

    International Nuclear Information System (INIS)

    Fussell, J.B.; Campbell, D.J.; Glynn, J.C.; Burdick, G.R.

    1986-01-01

    PRISIM is an IBM personal computer program that translates probabilistic risk assessment (PRA) information and calculates additional PRA type information for use by those who are not PRA experts. Specifically, PRISIM was developed for the US Nuclear Regulatory Commission for use by their resident inspectors at nuclear power plants. Inspector activities are either scheduled or are in response to a particular status of a plant. PRISIM is useful for either activity

  13. Seismic PRA of a BWR plant

    International Nuclear Information System (INIS)

    Nishio, Masahide; Fujimoto, Haruo

    2014-01-01

    Since the occurrence of nuclear power plant accidents in the Fukushima Daichi nuclear power station, the regulatory framework on severe accident (SA) has been discussed in Japan. The basic concept is to typify and identify the accident sequences leading to core/primary containment vessel (PCV) damage and to implement SA measures covering internal and external events extensively. As Japan is an earthquake-prone country and earthquakes and tsunami are important natural external events for nuclear safety of nuclear power plants, JNES performed the seismic probabilistic risk assessment (PRA) on a typical nuclear power plant and evaluated the dominant accident sequences leading to core/PCV damage to discuss dominant scenarios of severe accident (SA). The analytical models and the results of level-1 seismic PRA on a 1,100 MWe BWR-5 plant are shown here. Seismic PRA was performed for a typical BWR5 plant. Initiating events with large contribution to core damage frequency are the loss of all AC powers (station blackout) and the large LOCA. The top of dominant accident sequences is the simultaneous occurrence of station blackout and large LOCA. Important components to core damage frequency are electric power supply equipment. It needs to keep in mind that the results are influenced on site geologic characteristic to a greater or lesser. In the process of analysis, issues such as conservative assumptions related to damages of building or structure and success criteria for excessive LOCA are left to be resolved. These issues will be further studied including thermal hydric analysis in the future. (authors)

  14. Certification plan for safety and PRA codes

    International Nuclear Information System (INIS)

    Toffer, H.; Crowe, R.D.; Ades, M.J.

    1990-05-01

    A certification plan for computer codes used in Safety Analyses and Probabilistic Risk Assessment (PRA) for the operation of the Savannah River Site (SRS) reactors has been prepared. An action matrix, checklists, and a time schedule have been included in the plan. These items identify what is required to achieve certification of the codes. A list of Safety Analysis and Probabilistic Risk Assessment (SA ampersand PRA) computer codes covered by the certification plan has been assembled. A description of each of the codes was provided in Reference 4. The action matrix for the configuration control plan identifies code specific requirements that need to be met to achieve the certification plan's objectives. The checklist covers the specific procedures that are required to support the configuration control effort and supplement the software life cycle procedures based on QAP 20-1 (Reference 7). A qualification checklist for users establishes the minimum prerequisites and training for achieving levels of proficiency in using configuration controlled codes for critical parameter calculations

  15. Fire PRA requantification studies. Final report

    International Nuclear Information System (INIS)

    Parkinson, W.

    1993-03-01

    This report describes the requantification of two existing fire probabilistic risk assessments (PRAs) using a fire PRA method and data that are being developed by the Electric Power Research Institute (EPRI). The two existing studies are the Seabrook Station Probabilistic Safety Assessment that was made in 1983 and the 1989 NUREG-1150 analysis of the Peach Bottom Plant. Except for the fire methods and data, the original assumptions were used. The results from the requantification show that there were excessive conservatisms in the original studies. The principal reason for a hundredfold reduction in the Peach Bottom core- damage frequency is the determination that no electrical cabinet fire in a switchgear room would damage both offsite power feeds. Past studies often overestimated the heat release from electrical cabinet fires. EPRI's electrical cabinet heat release rates are based on tests that were conducted for Sandia's fire research program. The rates are supported by the experience in the EPRI Fire Events Database for U.S. nuclear plants. Test data and fire event experience also removed excessive conservatisms in the Peach Bottom control and cable spreading rooms, and the Seabrook primary component cooling pump, turbine building relay and cable spreading rooms. The EPRI fire PRA method and data will show that there are excessive conservatisms in studies that were made for many plants and can benefit them accordingly

  16. Preliminary ATWS analysis for the IRIS PRA

    International Nuclear Information System (INIS)

    Maddalena Barra; Marco S Ghisu; David J Finnicum; Luca Oriani

    2005-01-01

    Full text of publication follows: The pressurized light water cooled, medium power (1000 MWt) IRIS (International Reactor Innovative and Secure) has been under development for four years by an international consortium of over 21 organizations from ten countries. The plant conceptual design was completed in 2001 and the preliminary design is nearing completion. The pre-application licensing process with NRC started in October, 2002. IRIS has been primarily focused on establishing a design with innovative safety characteristics. The first line of defense in IRIS is to eliminate event initiators that could potentially lead to core damage. In IRIS, this concept is implemented through the 'safety by design' approach, which allows to minimize the number and complexity of the safety systems and required operator actions. The end result is a design with significantly reduced complexity and improved operability, and extensive plant simplifications to enhance construction. To support the optimization of the plant design and confirm the effectiveness of the safety by design approach in mitigating or eliminating events and thus providing a significant reduction in the probability of severe accidents, the PRA is being used as an integral part of the design process. A preliminary but extensive Level 1 PRA model has been developed to support the pre-application licensing of the IRIS design. As a result of the Preliminary IRIS PRA, an optimization of the design from a reliability point of view was completed, and an extremely low (about 1.2 E -8 ) core damage frequency (CDF) was assessed to confirm the impact of the safety by design approach. This first assessment is a result of a PRA model including internal initiating events. During this assessment, several assumptions were necessary to complete the CDF evaluation. In particular Anticipated Transients Without Scram (ATWS) were not included in this initial assessment, because their contribution to core damage frequency was assumed

  17. Development of insights from PRAs for non-PRA people

    International Nuclear Information System (INIS)

    Reilly, H.J.; Meale, B.M.

    1992-01-01

    A probabilistic risk assessment (PRA) of the Savannah River K-Reactor was completed in 1990. The PRA estimated the frequency of core damage accidents caused by operational occurrences during power operation of the reactor. The US Department of Energy (DOE) requested Idaho National Engineering Laboratory (INEL) to prepare guidance based on the PRA for use by DOE personnel at the Savannah River Site (SRS). The document had the purpose of informing the DOE system engineers and site representatives about how the information in the PRA might be used to help guide their activities. Opportunities existed to develop a document somewhat different than those developed previously by other programs. The opportunities existed because the audience is different: the principal audience for the document consists of DOE engineers who have continuing oversight responsibility for activities performed by the operating contractor at the K-Reactor, but who may not be knowledgeable about PRA

  18. Use of PRA in Shuttle Decision Making Process

    Science.gov (United States)

    Boyer, Roger L.; Hamlin, Teri L.

    2010-01-01

    How do you use PRA to support an operating program? This presentation will explore how the Shuttle Program Management has used the Shuttle PRA in its decision making process. It will reveal how the PRA has evolved from a tool used to evaluate Shuttle upgrades like Electric Auxiliary Power Unit (EAPU) to a tool that supports Flight Readiness Reviews (FRR) and real-time flight decisions. Specific examples of Shuttle Program decisions that have used the Shuttle PRA as input will be provided including how it was used in the Hubble Space Telescope (HST) manifest decision. It will discuss the importance of providing management with a clear presentation of the analysis, applicable assumptions and limitations, along with estimates of the uncertainty. This presentation will show how the use of PRA by the Shuttle Program has evolved overtime and how it has been used in the decision making process providing specific examples.

  19. The tsunami probabilistic risk assessment (PRA). Example of accident sequence analysis of tsunami PRA according to the standard for procedure of tsunami PRA for nuclear power plants

    International Nuclear Information System (INIS)

    Ohara, Norihiro; Hasegawa, Keiko; Kuroiwa, Katsuya

    2013-01-01

    After the Fukushima Daiichi nuclear power plant (NPP) accident, standard for procedure of tsunami PRA for NPP had been established by the Standardization Committee of AESJ. Industry group had been conducting analysis of Tsunami PRA for PWR based on the standard under the cooperation with electric utilities. This article introduced overview of the standard and examples of accident sequence analysis of Tsunami PRA studied by the industry group according to the standard. The standard consisted of (1) investigation of NPP's composition, characteristics and site information, (2) selection of relevant components for Tsunami PRA and initiating events and identification of accident sequence, (3) evaluation of Tsunami hazards, (4) fragility evaluation of building and components and (5) evaluation of accident sequence. Based on the evaluation, countermeasures for further improvement of safety against Tsunami could be identified by the sensitivity analysis. (T. Tanaka)

  20. Seabrook Station Level 2 PRA Update to Include Accident Management

    International Nuclear Information System (INIS)

    Lutz, Robert; Lucci, Melissa; Kiper, Kenneth; Henry, Robert

    2006-01-01

    A ground-breaking study was recently completed as part of the Seabrook Level 2 PRA update. This study updates the post-core damage phenomena to be consistent with the most recent information and includes accident management activities that should be modeled in the Level 2 PRA. Overall, the result is a Level 2 PRA that fully meets the requirements of the ASME PRA Standard with respect to modeling accident management in the LERF assessment and NRC requirements in Regulatory Guide 1.174 for considering late containment failures. This technical paper deals only with the incorporation of operator actions into the Level 2 PRA based on a comprehensive study of the Seabrook Station accident response procedures and guidance. The paper describes the process used to identify the key operator actions that can influence the Level 2 PRA results and the development of success criteria for these key operator actions. This addresses a key requirement of the ASME PRA Standard for considering SAMG. An important benefit of this assessment was the identification of Seabrook specific accident management insights that can be fed back into the Seabrook Station accident management procedures and guidance or the training provided to plant personnel for these procedures and guidance. (authors)

  1. How the chemical industry can benefit from PRA

    International Nuclear Information System (INIS)

    Guymer, P.; Kaiser, G.D.; Mc Kelvey, T.W.; Hannaman, G.W.

    1986-01-01

    Probabilistic Risk Assessment (PRA) is a method of quantifying the frequency of occurrence and the magnitude of the consequences of accidents in systems that contain hazardous materials such as radioactive fission products, and toxic, flammable or explosive chemicals. The frequency and the magnitude of the consequences are the basic elements of any definition or risk, which is often simply expressed as the product of frequency and magnitude, summed over all accident sequences. PRA is now a mature technique that has been used to estimate risk for a number of industrial facilities. In this paper the author gives examples of beneficial uses of PRA

  2. PRA-Code Upgrade to Handle a Generic Problem

    International Nuclear Information System (INIS)

    Wilson, J. R.

    1999-01-01

    During the probabilistic risk assessment (PRA) for the proposed Yucca Mountain nuclear waste repository, a problem came up that could not be handled by most PRA computer codes. This problem deals with dependencies between sequential events in time. Two similar scenarios that illustrate this problem are LOOP nonrecovery and sequential wearout failures with units of time. The purpose of this paper is twofold: To explain the problem generically, and to show how the PRA code at the INEEL, SAPHIRE, has been modified to solve this problem correctly

  3. The radioprotective effect of a new aminothiol (20-PRA)

    International Nuclear Information System (INIS)

    Dolabela, M.F.; Lopes, M.T.P.; Pereira, M.T.; Steffani, G.M.; Pilo-Veloso, D.; Salas, C.E.; Nelson, D.L.

    1998-01-01

    We examined the radioprotective effect of aminothiol 2-N-propylamine-cyclohexane thiol (20-PRA) on a human leukemic cell line (K562) following various radiation doses (5,7.5 and 20 Gy) using a source of 60 Co γ-rays. At 5 Gy and 1nM 20-PRA, a substantial protective effect (58%) was seen 24 h after irradiation, followed by a decrease at 48 h (11%). At the high radiation dose (20 Gy) a low protective effect was also seen (35%). In addition, the anti tumorigenic potential of 10 nM 20-PRA was shown by the inhibition of crown gall formation induced by Agrobacterium tumefaciens. The radioprotective potency of 20-PRA is 10 5- 10 6 times higher than that of the aminothiol WR-1065 (N(2-mercaptoethyl)-1,3-diamino propane) whose protective effect is in the 0.1 to 1.0 nM range. (author)

  4. The radioprotective effect of a new aminothiol (20-PRA

    Directory of Open Access Journals (Sweden)

    M.F. Dolabela

    1998-08-01

    Full Text Available We examined the radioprotective effect of aminothiol 2-N-propylamine-cyclo-hexanethiol (20-PRA on a human leukemic cell line (K562 following various radiation doses (5, 7.5 and 20 Gy using a source of 60Co g-rays. At 5 Gy and 1 nM 20-PRA, a substantial protective effect (58% was seen 24 h after irradiation, followed by a decrease at 48 h (11%. At the high radiation dose (20 Gy a low protective effect was also seen (35%. In addition, the antitumorigenic potential of 10 nM 20-PRA was shown by the inhibition of crown gall formation induced by Agrobacterium tumefaciens. The radioprotective potency of 20-PRA is 105-106 times higher than that of the aminothiol WR-1065 (N-(2-mercaptoethyl-1,3-diaminopropane whose protective effect is in the 0.1 to 1.0 mM range.

  5. Applications of PRA in nuclear criticality safety

    International Nuclear Information System (INIS)

    McLaughlin, T.P.

    1992-01-01

    Traditionally, criticality accident prevention at Los Alamos has been based on a thorough review and understanding of proposed operations of changes to operations, involving both process supervision and criticality safety staff. The outcome of this communication was usually an agreement, based on professional judgement, that certain accident sequences were credible and had to be reduced in likelihood either by administrative controls or by equipment design and others were not credible, and thus did not warrant expenditures to further reduce their likelihood. The extent of analysis and documentation was generally in proportion to the complexity of the operation but did not include quantified risk assessments. During the last three years nuclear criticality safety related Probabilistic Risk Assessments (PRAs) have been preformed on operations in two Los Alamos facilities. Both of these were conducted in order to better understand the cost/benefit aspects of PRA's as they apply to largely ''hands-on'' operations with fissile material for which human errors or equipment failures significant to criticality safety are both rare and unique. Based on these two applications and an appreciation of the historical criticality accident record (frequency and consequences) it is apparent that quantified risk assessments should be performed very selectively

  6. Two decades of PRA: What next?

    International Nuclear Information System (INIS)

    Rasmussen, N.C.

    1992-01-01

    Two decades ago, in the spring of 1972, the Reactor Safety Study was undertaken for the US Atomic Energy Commission (AEC). The goal of this study was to assess the risk to the public posed by the nuclear power plants operating in the US. Some three and one-half years later in October 1975, the study group issued its final report titled The Reactor Safety Study, also commonly known by its document number WASH 1400. Because it was issued at a time of heated public debate about nuclear safety, WASH 1400 received considerable critical review. By the late 1970s, as a result of the Lewis Report and the accident at Three Mile Island, the value of the WASH 1400 methodology was gradually recognized. A number of utilities undertook such studies of their own plants. The field of probabilistic risk assessment (PRA) developed from these efforts. Challenges remain. Among these are how to effectively communicate the results of the analysis. Just what does a probability of one in a million mean? Is there a de minimis probability - one so small that it can be ignored? How should society make decisions under substantial uncertainty? A number of these questions pose real challenges for the future

  7. Chinshan living PRA model using NUPRA software package

    International Nuclear Information System (INIS)

    Cheng, S.-K.; Lin, T.-J.

    2004-01-01

    A living probabilistic risk assessment (PRA) model has been established for Chinshan Nuclear Power Station (BWR-4, MARK-I) using NUPRA software package. The core damage frequency due to internal events, seismic events and typhoons are evaluated in this model. The methodology and results considering the recent implementation of the 5th emergency diesel generator and automatic boron injection function are presented. The dominant sequences of this PRA model are discussed, and some possible applications of this living model are proposed. (author)

  8. 'Living PRA' concept for plant risk: Reliability and availability tracking

    International Nuclear Information System (INIS)

    Sancaktar, S.; Sharp, D.R.

    1985-01-01

    The 'Living PRA' (Probabilistic Risk Assessment) is based on placing a PRA plant model on an interactive computer. This model consists of fault tree analyses for plant systems, event tree analyses for abnormal events and site specific consequence analysis for public and/or financial risks, for a nuclear power plant. A living PRA allows updates and sensitivity analyses by the plant owner throughout the lifetime of a plant. Recently, event and fault trees from two major PRAs were placed in a computerized format. The BYRON PRA study and the Living PRA and Economic Risk examples for Indian Point Unit-3 enabled analysts to gain experience and insight into the problems of plant operation. The above concept is well established for the Nuclear Power Plant evaluation. It has been also used for evaluation of processing facilities. In these studies, systems modeling was carried out by using the GRAFTER system for automated fault tree construction. Presently both the tools and the experience exists to set up useful and viable living PRA models for nuclear and chemical processing plants to enhance risk management by the plant owners through in-house use of micro computer based models

  9. PRA and the implementation of quantitative safety goals

    International Nuclear Information System (INIS)

    Okrent, D.

    1983-01-01

    With the adoption by the U.S. Nuclear Regulatory Commission (NRC) in January, 1983, of a Policy Statement on Safety Goals for the Operation of Nuclear Power Plants, probabilitstic risk assessment (PRA) has taken on increased importance in nuclear reactor safety. Although the Reactor Safety Study, WASH-1400, was a major pioneering effort that revolutionized thinking about reactor safety, PRA was used only on occasion by the NRC regulatory staff prior to the accident at Three Mile Island. Since then, PRA has been used more and more as an important factor in decision making, usually for specific issues. The nuclear industry has also employed PRA, sometimes to make its case on specific issues, sometimes to present a position on overall risk. The advent of the Zion and Indian Point PRAs, with their treatment of risks from fire, wind, and earthquakes, and their examination of the course of core melt accidents, has added a new dimension to the overall picture. Although the NRC has stated that during the next two year evolution period, its quantitative design objectives and PRA are not to enter directly into the licensing process, many important issues will be influenced significantly by the results of risk and reliability studies. In fact, PRA may be coming into a position of great importance before the methodology, data, and process are sufficiently mature for the task. Large gaps still exist in our understanding of phenomena and in input information; and much of the final result depends on subjective input; large differences of opinion can and should be expected to persist. Accepted standards for quality assurance, and adequacy and depth of independent, peer review remain to be formulated and achieved. This paper will summarize the recently adopted NRC safety policy and the two-year evaluation plan, and will provide, by example, some words of caution concerning a few of the difficulties which may arise. (orig.)

  10. Probabilistic Risk Assessment (PRA): A Practical and Cost Effective Approach

    Science.gov (United States)

    Lee, Lydia L.; Ingegneri, Antonino J.; Djam, Melody

    2006-01-01

    The Lunar Reconnaissance Orbiter (LRO) is the first mission of the Robotic Lunar Exploration Program (RLEP), a space exploration venture to the Moon, Mars and beyond. The LRO mission includes spacecraft developed by NASA Goddard Space Flight Center (GSFC) and seven instruments built by GSFC, Russia, and contractors across the nation. LRO is defined as a measurement mission, not a science mission. It emphasizes the overall objectives of obtaining data to facilitate returning mankind safely to the Moon in preparation for an eventual manned mission to Mars. As the first mission in response to the President's commitment of the journey of exploring the solar system and beyond: returning to the Moon in the next decade, then venturing further into the solar system, ultimately sending humans to Mars and beyond, LRO has high-visibility to the public but limited resources and a tight schedule. This paper demonstrates how NASA's Lunar Reconnaissance Orbiter Mission project office incorporated reliability analyses in assessing risks and performing design tradeoffs to ensure mission success. Risk assessment is performed using NASA Procedural Requirements (NPR) 8705.5 - Probabilistic Risk Assessment (PRA) Procedures for NASA Programs and Projects to formulate probabilistic risk assessment (PRA). As required, a limited scope PRA is being performed for the LRO project. The PRA is used to optimize the mission design within mandated budget, manpower, and schedule constraints. The technique that LRO project office uses to perform PRA relies on the application of a component failure database to quantify the potential mission success risks. To ensure mission success in an efficient manner, low cost and tight schedule, the traditional reliability analyses, such as reliability predictions, Failure Modes and Effects Analysis (FMEA), and Fault Tree Analysis (FTA), are used to perform PRA for the large system of LRO with more than 14,000 piece parts and over 120 purchased or contractor

  11. Probabilistic risk assessment (PRA): status report and guidance for regulatory application. Draft report for comment

    International Nuclear Information System (INIS)

    1984-02-01

    This document describes the current status of the methodologies used in probabilistic risk assessment (PRA) and provides guidance for the application of the results of PRAs to the nuclear reactor regulatory process. The PRA studies that have been completed or are underway are reviewed. The levels of maturity of the methodologies used in a PRA are discussed. Insights derived from PRAs are listed. The potential uses of PRA results for regulatory purposes are discussed

  12. A model for assessing human cognitive reliability in PRA studies

    International Nuclear Information System (INIS)

    Hannaman, G.W.; Spurgin, A.J.; Lukic, Y.

    1985-01-01

    This paper summarizes the status of a research project sponsored by EPRI as part of the Probabilistic Risk Assessment (PRA) technology improvement program and conducted by NUS Corporation to develop a model of Human Cognitive Reliability (HCR). The model was synthesized from features identified in a review of existing models. The model development was based on the hypothesis that the key factors affecting crew response times are separable. The inputs to the model consist of key parameters the values of which can be determined by PRA analysts for each accident situation being assessed. The output is a set of curves which represent the probability of control room crew non-response as a function of time for different conditions affecting their performance. The non-response probability is then a contributor to the overall non-success of operating crews to achieve a functional objective identified in the PRA study. Simulator data and some small scale tests were utilized to illustrate the calibration of interim HCR model coefficients for different types of cognitive processing since the data were sparse. The model can potentially help PRA analysts make human reliability assessments more explicit. The model incorporates concepts from psychological models of human cognitive behavior, information from current collections of human reliability data sources and crew response time data from simulator training exercises

  13. 77 FR 10576 - Methodology for Low Power/Shutdown Fire PRA

    Science.gov (United States)

    2012-02-22

    ... NUCLEAR REGULATORY COMMISSION [NRC-2011-0295] Methodology for Low Power/Shutdown Fire PRA AGENCY.../Shutdown Fire PRA.'' In response to request from members of the public, the NRC is extending the public... risk assessment (PRA) method for quantitatively analyzing fire risk in commercial nuclear power plants...

  14. 76 FR 81998 - Methodology for Low Power/Shutdown Fire PRA

    Science.gov (United States)

    2011-12-29

    ... NUCLEAR REGULATORY COMMISSION [NRC-2011-0295] Methodology for Low Power/Shutdown Fire PRA AGENCY..., ``Methodology for Low Power/Shutdown Fire PRA--Draft Report for Comment.'' DATES: Submit comments by March 01... risk assessment (PRA) method for quantitatively analyzing fire risk in commercial nuclear power plants...

  15. Load out and offshore lifting of the PRA-1 platform modules; Embarque e icamento offshore dos modulos de PRA-1

    Energy Technology Data Exchange (ETDEWEB)

    Barbosa, Fernando; Raigorodsky, Jacques; Mitidieri, Jorge L.U.; Ricardi, Paulo S. [Construtora Norberto Odebrecht S.A., Rio de Janeiro, RJ (Brazil)

    2008-07-01

    The technology innovations are characteristics of offshore Engineering around the world. These technologies just make sense when they aim the productivity, security and costs gains compared to ordinary methods. It is in this context that the proposal of the Consorcio PRA-1 (Odebrecht e UTC) team makes sense, in the definition of basic methodology for the PRA-1 platform construction and installation. Through the innovative concept, It was defined (still in the proposal phase) the basic premise that the modules construction and assembly were onshore ending up that just few hours after the offshore installation the modules should be operational in minimal habitability conditions. This innovative method allowed the lack of Flotel, that is a platform which provide support to the offshore construction and assembly (Flotel represents a high costs to the project) and, as consequence, the contract signature by CONSORCIO PRA-1. This work aims to describe the method used for the LOUD-OUT of the PRA-1 modules and the installation of them on the jacket through a vessel provide with cranes the has performed the lifting. Theses operations became unique in Brazil due its challengers characteristics: Module 12 weight = 7203 tf and Module 35 = 5725 tf. For the accomplishment of the Load-out and offshore lifting, was performed a detailed planning and a high level of subcontract interface management. The operations mentioned above were filmed/photographed and published in the specialized media. (author)

  16. PRA: an evaluation of state-of-the-art

    International Nuclear Information System (INIS)

    Joksimovich, V.

    1985-01-01

    Some elements of the probabilistic risk assessment (PRA) methodology can be characterized as mature and are even ready for some kind of a standardization effort. Other elements are still, however, in a rapid state of evolution. Questions are continuously being asked regarding maturity of PRA techniques vis-a-vis a regulatory decision-making process. Establishing a framework for evaluating state-of-the-art in any technological field is a challenging task. An implementation of a selected framework to a satisfactory conclusion is a monumental task. Of course, these types of issues can be discussed meaningfully only if they are tied to a particular application. The author's participation in the NSF-sponsored risk assessment project is discussed in the paper. The evaluation employed here makes use of the following five evaluation criteria: logical soundness, completeness, accuracy, acceptability, and practicality

  17. Organizational extension of PRA models and NASA application

    International Nuclear Information System (INIS)

    Pate-Cornell, E.

    1989-01-01

    This paper describes a probabilistic method which extends classical PRA to include some characteristics of the organization that processes or manages an engineering system. Ataxonomy of errors is presented and their organizational roots are examined. An assembly model is proposed for the analysis of the resulting spectrum of capacities of the system. The management of the Thermal Protection system of the Space Shuttle is used as an illustration. The model allows assessment of the benefits of organizational improvements of the orbiter's processing

  18. Task analysis: How far are we from usable PRA input

    International Nuclear Information System (INIS)

    Gertman, D.I.; Blackman, H.S.; Hinton, M.F.

    1984-01-01

    This chapter reviews data collected at the Idaho National Engineering Laboratory for three DOE-owned reactors (the Advanced Test Reactor, the Power Burst Facility, and the Loss of Fluids Test Reactor) in order to identify usable Probabilistic Risk Assessment (PRA) input. Task analytic procedures involve the determination of manning and skill levels as a means of determining communication requirements, in assessing job performance aids, and in assessing the accuracy and completeness of emergency and maintenance procedures. The least understood aspect in PRA and plant reliability models is the human factor. A number of examples from the data base are discussed and offered as a means of providing more meaningful data than has been available to PRA analysts in the past. It is concluded that the plant hardware-procedures-personnel interfaces are essential to safe and efficient plant operations and that task analysis is a reasonably sound way of achieving a qualitative method for identifying those tasks most strongly associated with task difficulty, severity of consequence, and error probability

  19. An evaluation of the reliability and usefulness of external-initiator PRA [probabilistic risk analysis] methodologies

    International Nuclear Information System (INIS)

    Budnitz, R.J.; Lambert, H.E.

    1990-01-01

    The discipline of probabilistic risk analysis (PRA) has become so mature in recent years that it is now being used routinely to assist decision-making throughout the nuclear industry. This includes decision-making that affects design, construction, operation, maintenance, and regulation. Unfortunately, not all sub-areas within the larger discipline of PRA are equally ''mature,'' and therefore the many different types of engineering insights from PRA are not all equally reliable. 93 refs., 4 figs., 1 tab

  20. An evaluation of the reliability and usefulness of external-initiator PRA (probabilistic risk analysis) methodologies

    Energy Technology Data Exchange (ETDEWEB)

    Budnitz, R.J.; Lambert, H.E. (Future Resources Associates, Inc., Berkeley, CA (USA))

    1990-01-01

    The discipline of probabilistic risk analysis (PRA) has become so mature in recent years that it is now being used routinely to assist decision-making throughout the nuclear industry. This includes decision-making that affects design, construction, operation, maintenance, and regulation. Unfortunately, not all sub-areas within the larger discipline of PRA are equally mature,'' and therefore the many different types of engineering insights from PRA are not all equally reliable. 93 refs., 4 figs., 1 tab.

  1. Pemikiran Suksesi Dalam Politik Islam Masa Pra Modern

    Directory of Open Access Journals (Sweden)

    Mazro'atus Sa'adah

    2016-12-01

    Abstrak: Pemikiran politik Islam muncul setelah Islam melalui Nabi Muhammad SAW berhasil membentuk sebuah ummat baru, dari peralihan kekuasaan kerajaan/kesukuan kepada Nabi yang kemudian kepada umat. Nabi Muhammad dinilai berhasil dalam mengatur komunitas barunya yang dikendalikan oleh ajarannya dalam seluruh lini kehidupan. Persoalan muncul kemudian setelah beliau wafat, yang akhirnya memunculkan pemikiran tentang suksesi. Artikel ini akan membahas tentang mengapa terjadi suksesi setelah Nabi Muhammad SAW wafat, bagaimana pemikiran para tokoh politik Islam masa pra modern terkait dengan suksesi, dan apa kontribusi pemikiran suksesi ini terhadap politik Islam di Indonesia. Dengan menggunakan pendekatan sejarah, ditemukan bahwa Nabi Muhammad tidak menetapkan siapa yang akan menggantikannya, dan ketika beliau wafat (632 M, para sahabat memilih seorang pemimpin (imam/khalifah. Masa pemerintahan Abu Bakar, Umar dan Usman banyak terjadi perselisihan yang awalnya terkait kepentingan agama namun berkembang menjadi kepentingan politik. Ketika Ali bin Abi Talib diangkat sebagai khalifah, konflik politik berkepanjangan berkaitan dengan pembunuhan Usman, menjadikan timbulnya perang jamal antara Aisyah dan Ali. Pada masa ini perbedaan kepentingan aqidah dipolitisir lebih jauh menjadi sebuah kepentingan politik. Dinamika politik ini kemudian melahirkan mazhab politik Islam klasik yang terbagi dalam tiga mazhab besar yaitu Sunni, Syi'ah dan Khawarij, yang darinya muncul istilah-istilah khilafah, imamah, ahlul halli wal aqdi, bay’ah, walayah dan lain-lain. Dari ketiga mazhab politik ini, kemudian muncul ide pemikiran politik Islam yang sangat kompleks dan berkepanjangan dari para tokoh politik Islam pra modern yang banyak dipengaruhi oleh filosof Yunani. Di Indonesia, pemikiran suksesi dalam politik Islam masa pra modern ini pernah diwacanakan. Namun untuk pemilihan kepala Negara belum terealisasi mengingat Indonesia bukan Negara Islam.

  2. SHARP - a framework for incorporating human interactions into PRA studies

    International Nuclear Information System (INIS)

    Hannaman, G.W.; Joksimovich, V.; Spurgin, A.J.; Worledge, D.H.

    1985-01-01

    Recently, increased attention has been given to understanding the role of humans in the safe operation of nuclear power plants. By virtue of the ability to combine equipment reliability with human reliability probabilistic risk assessment (PRA) technology was deemed capable of providing significant insights about the contributions of human interations in accident scenarios. EPRI recognized the need to strengthen the methodology for incorporating human interactions into PRAs as one element of their broad research program to improve the credibility of PRAs. This research project lead to the development and detailed description of SHARP (Systematic Human Application Reliability Procedure) in EPRI NP-3583. The objective of this paper is to illustrate the SHARP framework. This should help PRA analysts state more clearly their assumptions and approach no matter which human reliability assessment technique is used. SHARP includes a structure of seven analysis steps which can be formally or informally performed during PRAs. The seven steps are termed definition, screening, breakdown, representation, impact assessment, quantification, and documentation

  3. Evaluation of allowed outage time using PRA results

    International Nuclear Information System (INIS)

    Johanson, G.

    1985-01-01

    In a probabilistic risk assessment (PRA) different measures of risk importance can be established. These measures can be used as a basis for further evaluation and determination of allowed outage time for specific components, within safety systems of a nuclear power plant. In order to optimize the allowed outage time (AOT) stipulated in the plant's Technical Specification it is necessary to create a methodology which could incorporate existing PRA data into a quantitative extrapolation. In order to evaluate the plant risk status due to AOT in a quantitative manner, the risk achievement worth is utilized. Risk achievement worth is defined as follows: to measure the worth of a feature, in achieving the present risk, one approach is to remove the feature and then determine how much the risk has increased. Thus, the risk achievement worth is formally defined to be the increase in risk if the feature were assumed not be there or to be failed. Another parameter of interest for this analysis is the shutdown risk increase. The shutdown risk achievement worth must be incorporated into the accident sequence risk achievement worth to arrive at an optimal set of plant specific AOTs

  4. Spatially Informed Plant PRA Models for Security Assessment

    International Nuclear Information System (INIS)

    Wheeler, Timothy A.; Thomas, Willard; Thornsbury, Eric

    2006-01-01

    Traditional risk models can be adapted to evaluate plant response for situations where plant systems and structures are intentionally damaged, such as from sabotage or terrorism. This paper describes a process by which traditional risk models can be spatially informed to analyze the effects of compound and widespread harsh environments through the use of 'damage footprints'. A 'damage footprint' is a spatial map of regions of the plant (zones) where equipment could be physically destroyed or disabled as a direct consequence of an intentional act. The use of 'damage footprints' requires that the basic events from the traditional probabilistic risk assessment (PRA) be spatially transformed so that the failure of individual components can be linked to the destruction of or damage to specific spatial zones within the plant. Given the nature of intentional acts, extensive modifications must be made to the risk models to account for the special nature of the 'initiating events' associated with deliberate adversary actions. Intentional acts might produce harsh environments that in turn could subject components and structures to one or more insults, such as structural, fire, flood, and/or vibration and shock damage. Furthermore, the potential for widespread damage from some of these insults requires an approach that addresses the impacts of these potentially severe insults even when they occur in locations distant from the actual physical location of a component or structure modeled in the traditional PRA. (authors)

  5. Top event prevention analysis: A deterministic use of PRA

    International Nuclear Information System (INIS)

    Worrell, R.B.; Blanchard, D.P.

    1996-01-01

    This paper describes the application of Top Event Prevention Analysis. The analysis finds prevention sets which are combinations of basic events that can prevent the occurrence of a fault tree top event such as core damage. The problem analyzed in this application is that of choosing a subset of Motor-Operated Valves (MOVs) for testing under the Generic Letter 89-10 program such that the desired level of safety is achieved while providing economic relief from the burden of testing all safety-related valves. A brief summary of the method is given, and the process used to produce a core damage expression from Level 1 PRA models for a PWR is described. The analysis provides an alternative to the use of importance measures for finding the important combination of events in a core damage expression. This application of Top Event Prevention Analysis to the MOV problem was achieve with currently available software

  6. 40 CFR 180.1200 - Pseudomonas fluorescens strain PRA-25; temporary exemption from the requirement of a tolerance.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Pseudomonas fluorescens strain PRA-25... RESIDUES IN FOOD Exemptions From Tolerances § 180.1200 Pseudomonas fluorescens strain PRA-25; temporary... established for residues of the microbial pesticide, pseudomonas fluorescens strain PRA-25 when used on peas...

  7. Studi Awal Pra Desain Pabrik Bioetanol dari Nira Siwalan

    Directory of Open Access Journals (Sweden)

    Novarian Budisetyowati

    2017-01-01

    Full Text Available Bioetanol kini banyak dikembangkan sebagai bahan bakar alternatif pengganti bahan bakar fosil. Bioetanol untuk campuran bensin harus memiliki kemurnian sebesar 99,5-100%. Bioetanol dapat diperoleh dengan proses fermentasi yang melibatkan mikroorganisme. Pra desain pabrik bioetanol dari nira siwalan ini menggunakan proses fermentasi. Bahan baku berupa nira siwalan diasamkan dengan menggunakan H2SO4, kemudian disterilisasi sebelum difermentasi di fermentor selama 36 jam. Adapun mikroorganisme yang digunakan adalah Saccharomyces cereviceae. Bakteri ini mampu mengurai gula tanpa kehadiran oksigen dan menghasilkan etanol dan karbondioksida. Bioetanol dapat diperoleh dengan proses fermentasi yang melibatkan mikroorganisme. Pra desain pabrik bioetanol dari nira siwalan ini menggunakan proses fermentasi. Bahan baku berupa nira siwalan diasamkan dengan menggunakan H2SO4, kemudian disterilisasi sebelum difermentasi di fermentor selama 36 jam. Adapun mikroorganisme yang digunakan adalah Saccharomyces cereviceae. Setelah dari fermentor nira yang sudah difermentasi dinetralkan pH nya menggunakan NH4OH di tangki netralisasi. Dari tangki netralisasi nira dipompakan melewati preheater sebelum masuk ke kolom distilasi. Pemurnian dilakukan dengan menggunakan kolom distilasi sebanyak 2 buah. Pada distilasi yang pertama diperoleh kadar etanol sebesar 60% dan pada distilasi yang kedua diperoleh kadar 96%. Dari kolom distilasi 2 larutan didinginkan menggunakan cooler untuk didapatkan suhu 32oC agar sesuai dengan suhu proses dehidrasi dengan menggunakan Molecular Sieve yang diinginkan. Proses dehidrasi dilakukan untuk mendapat kadar etanol 99,5%. Etanol 99,5% yang dihasilkan kemudian disimpan dalam tangki penampung. Kebutuhan bioetanol dalam negeri pada tahun 2018 diperkirakan 3.166.015,13 kL/tahun. Berdasarkan analisa ekonomi yang dilakukan, diperoleh hasil sebagai berikut internal rate of return 26,53 % per tahun, pay out time 4,73 tahun, dan BEP 34,62 % Ditinjau

  8. Clinical significance of determination of SAC/PRA value in patients with primary aldosteronism

    International Nuclear Information System (INIS)

    Li Liren; Dai Yaozong; Liu Jiumin

    2003-01-01

    Objective: To investigate the diagnostic significance of determining SAC/PRA valve in hyperaldosteronism. Methods: Plasma renin activity (PRA) and angiotensin (AT-II) as well as serum aldosterone contents were measured with RIA in 48 patients with primary aldosteronism and 30 controls. The SAC/PRA value was calculated. Results: Contents of PRA, AT-II and Aldo in blood of patients with primary aldosteronism were very significantly different from those in controls (p < 0.001) (PRA 0.14 ± 0.08 ng/ml/h vs 0.57 ± 0.08 ng/ml/h; AT-II 21.21 ± 7.55 ng/L vs 36.03 ± 6.11 ng/L; Aldo 1.07 ± 0.34 nmol/L vs 0.33 ± 0.04 nmol/L). Calculated SAC/PRA value was 913 ± 409 (normal upper limit 400). Conclusion: SAC/PRA value is an useful accessory diagnostic criterion for primary aldosteronism

  9. PRA -- Now that operators have it, what do they do with it?

    International Nuclear Information System (INIS)

    Rasmussen, M.A.; Kolo, R.J.

    1996-01-01

    Many utilities have had Probabilistic Risk Assessment (PRA) projects underway for several years in order to satisfy the NRC Generic Letter 88-20 requirement for an Individual Plant Examination, or IPE. Typically the studies have reached the conclusion that there are significant differences in the contribution of different plant components to preventing core damage should a major plant transient occur. How nuclear plant operators can use this knowledge to DECREASE the overall risk of performing the routine tasks of testing and maintenance is not an easy task. 10CFR50.65; ''The Maintenance Rule,'' requires that any plant maintenance performed with the unit on line be evaluated for risk. Byron Station will satisfy the 10CFR50.65 requirement by using PRA methodology to evaluate testing and maintenance activities performed with the unit at power. The challenge is to effectively use the results of PRA studies to aid in plant operations without having to make on shift plant operations personnel experts in PRA. At Byron, PRA is used to help build the weekly work schedules. Operations personnel tasked with reviewing the work schedule are the departmental experts on the use of the PRA results. The on shift SRO's role in implementing the program is to accurately execute and monitor the work week schedule as written, and to react to unforeseen equipment failures with an appropriate level of response. The response to such emergent work items is also predefined. Handling emergent work in a prescribed manner minimizes the overall risk to the unit and also eliminates the need to have PRA expertise available to make emergent work risk evaluations. Thus the on shift operators' required knowledge of PRA methods and intricacies is minimized. PRA is just another of the many tools used by the shift operator to run the plant in a safe, conservative manner

  10. Issues and insights of PRA methodology in nuclear and space applications

    International Nuclear Information System (INIS)

    Hsu, F.

    2005-01-01

    This paper presents some important issues and technical insights on the scope, conceptual framework, and essential elements of nuclear power plant Probabilistic Risk Assessments (PRAs) and that of the PRAs in general applications of the aerospace industry, such as the Space Shuttle PRA being conducted by NASA. Discussions are focused on various lessons learned in nuclear power plant PRA applications and their potential applicability to the PRAs in the aerospace and launch vehicle systems. Based on insights gained from PRA projects for nuclear power plants and from the current Space Shuttle PRA effort, the paper explores the commonalities and the differences between the conduct of the different PRAs and the key issues and risk insights derived from extensive modeling practices in both industries of nuclear and space. (author)

  11. How Can You Support RIDM/CRM/RM Through the Use of PRA

    Science.gov (United States)

    DoVemto. Tpmu

    2011-01-01

    Probabilistic Risk Assessment (PRA) is one of key Risk Informed Decision Making (RIDM) tools. It is a scenario-based methodology aimed at identifying and assessing Safety and Technical Performance risks in complex technological systems.

  12. Current and future applications of PRA in regulatory activities

    Energy Technology Data Exchange (ETDEWEB)

    Speis, T.P.; Murphy, J.A.; Cunningham, M.A. [Nuclear Regulatory Commission, Washington, DC (United States)] [and others

    1995-04-01

    Probabilistic Risk Assessments (PRAs) have proven valuable in providing the regulators, the nuclear plant operators, and the reactor designers insights into plant safety, reliability, design and operation. Both the NRC Commissioners and the staff have grown to appreciate the valuable contributions PRAs can have in the regulatory arena, though I will admit the existence of some tendencies for strict adherence to the deterministic approach within the agency and the public at large. Any call for change, particularly one involving a major adjustment in approach to the regulation of nuclear power, will meet with a certain degree of resistance and retrenchment. Change can appear threatening and can cause some to question whether the safety mission is being fulfilled. This skepticism is completely appropriate and is, in fact, essential to a proper transition towards risk and performance-based approaches. Our task in the Office of Nuclear Regulatory Research is to increase the PRA knowledge base within the agency and develop appropriate guidance and methods needed to support the transitioning process.

  13. Overview of seismic margin insights gained from seismic PRA results

    International Nuclear Information System (INIS)

    Kennedy, R.P.; Sues, R.H.; Campbell, R.D.

    1986-01-01

    This paper presents the findings of a study conducted under NRC and EPRI sponsorship in which published seismic PRAs were reviewed in order to gain insight to the seismic margins inherent in existing nuclear plants. The approach taken was to examine the fragilities of those components which have been found to be dominant contributors to seismic risk at plants in low-to-moderate seismic regions (SSE levels between 0.12g and 0.25g). It is concluded that there is significant margin inherent in the capacity of most critical components above the plant design basis. For ground motions less than about 0.3g, the predominant sources of seismic risk are loss of offsite power coupled with random failure of the emergency diesels, non-recoverable circuit breaker trip due to relay chatter, unanchored equipment, unreinforced non-load bearing block walls, vertical water storage tanks, systems interactions and possibly soil liquefaction. Recommendations as to which components should be reviewed in seismic margin studies for margin earthquakes less than 0.3g, between 0.3g and 0.5g, and greater than 0.5g, developed by the NRC expert panel on the quantification of seismic margins (based on the review of past PRA data, earthquake experience data, and their own personal experience) are presented

  14. Reliability design of a critical facility: An application of PRA methods

    International Nuclear Information System (INIS)

    Souza Vieira Neto, A.; Souza Borges, W. de

    1987-01-01

    Although a general agreement concerning the enforcement of reliability (probabilistic) design criteria for nuclear utilities is yet to be achieved. PRA methodology can still be used successfully as a project design and review tool, aimed at improving system's prospective performance or minimizing expected accident consequences. In this paper, the potential of such an application of PRA methods is examined in the special case of a critical design project currently being developed in Brazil. (orig.)

  15. ASSESSMENT OF DYNAMIC PRA TECHNIQUES WITH INDUSTRY AVERAGE COMPONENT PERFORMANCE DATA

    Energy Technology Data Exchange (ETDEWEB)

    Yadav, Vaibhav; Agarwal, Vivek; Gribok, Andrei V.; Smith, Curtis L.

    2017-06-01

    In the nuclear industry, risk monitors are intended to provide a point-in-time estimate of the system risk given the current plant configuration. Current risk monitors are limited in that they do not properly take into account the deteriorating states of plant equipment, which are unit-specific. Current approaches to computing risk monitors use probabilistic risk assessment (PRA) techniques, but the assessment is typically a snapshot in time. Living PRA models attempt to address limitations of traditional PRA models in a limited sense by including temporary changes in plant and system configurations. However, information on plant component health are not considered. This often leaves risk monitors using living PRA models incapable of conducting evaluations with dynamic degradation scenarios evolving over time. There is a need to develop enabling approaches to solidify risk monitors to provide time and condition-dependent risk by integrating traditional PRA models with condition monitoring and prognostic techniques. This paper presents estimation of system risk evolution over time by integrating plant risk monitoring data with dynamic PRA methods incorporating aging and degradation. Several online, non-destructive approaches have been developed for diagnosing plant component conditions in nuclear industry, i.e., condition indication index, using vibration analysis, current signatures, and operational history [1]. In this work the component performance measures at U.S. commercial nuclear power plants (NPP) [2] are incorporated within the various dynamic PRA methodologies [3] to provide better estimates of probability of failures. Aging and degradation is modeled within the Level-1 PRA framework and is applied to several failure modes of pumps and can be extended to a range of components, viz. valves, generators, batteries, and pipes.

  16. Dynamic Positioning System (DPS) Risk Analysis Using Probabilistic Risk Assessment (PRA)

    Science.gov (United States)

    Thigpen, Eric B.; Boyer, Roger L.; Stewart, Michael A.; Fougere, Pete

    2017-01-01

    The National Aeronautics and Space Administration (NASA) Safety & Mission Assurance (S&MA) directorate at the Johnson Space Center (JSC) has applied its knowledge and experience with Probabilistic Risk Assessment (PRA) to projects in industries ranging from spacecraft to nuclear power plants. PRA is a comprehensive and structured process for analyzing risk in complex engineered systems and/or processes. The PRA process enables the user to identify potential risk contributors such as, hardware and software failure, human error, and external events. Recent developments in the oil and gas industry have presented opportunities for NASA to lend their PRA expertise to both ongoing and developmental projects within the industry. This paper provides an overview of the PRA process and demonstrates how this process was applied in estimating the probability that a Mobile Offshore Drilling Unit (MODU) operating in the Gulf of Mexico and equipped with a generically configured Dynamic Positioning System (DPS) loses location and needs to initiate an emergency disconnect. The PRA described in this paper is intended to be generic such that the vessel meets the general requirements of an International Maritime Organization (IMO) Maritime Safety Committee (MSC)/Circ. 645 Class 3 dynamically positioned vessel. The results of this analysis are not intended to be applied to any specific drilling vessel, although provisions were made to allow the analysis to be configured to a specific vessel if required.

  17. Advances in Probabilistic Risk Assessment (PRA): a look into practitioners toolbox

    International Nuclear Information System (INIS)

    Mok, J.; Kaasalainen, S.; Donnelly, K.

    2007-01-01

    The ever-increasing emphasis on the use of Probabilistic Risk Assessment (PRA) in risk-informed decision making translates into increased expectations relating to PRA applications for the groups tasked with developing and maintaining the facility PRAs. In order to succeed in meeting the demand for PRA work, it is essential to develop methodologies and tools (or utilities) that improve the efficiency with which the PRAs are processed and manipulated to obtain a solution. Examples from the Nuclear Safety Solutions (NSS) PRA Practitioners tool box include utilities for cutting logical loops, optimizing fault trees (to decrease run-times), modularizing fault trees, and converting event trees into high level fault tree logic (an important element if the PRA study is to be used to support a risk monitor such as an Equipment Out-of-Service (EOOS) Monitor). The objective of this paper is be to briefly describe the main features of these utilities, and to illustrate the value they have in terms of improving the efficiency and effectiveness of PRA development and maintenance at NSS. (author)

  18. PRA-1 offshore platform start-up within seven days; Operacionalizacao da plataforma offshore PRA-1 em sete dias

    Energy Technology Data Exchange (ETDEWEB)

    Barbosa, Fernando; Mitidieri, Jorge; Faria, Jose Luis Coutinho de; Ribeiro, Juan Carlos; Moura, Mario Arthur [Construtora Norberto Oderbrecht S.A., Rio de Janeiro, RJ (Brazil)

    2008-07-01

    The technologic innovations are very hard features with regards to Offshore Engineering and Construction over the worldwide. The innovations only make sense since they are focus on the high productivity, safe job and cost reduction compared with the current technologies. Inside the scenario mentioned above is Construtora Norberto Odebrecht S.A. concept for the PRA-1 platform Engineering and Construction. Through a very advanced and innovation concept, it was defined as the Main Strategic Planning of the undertaking not use a temporary platform support (named in Brazil as 'Flotel') during the 'Hook-up', commissioning and star-up offshore phase. The success of the strategic made possible through the implementation of new engineering tools, and, besides this, through a very careful offshore planning focused on minimizing and make easier as much as possible the offshore activities. The planning can be basically spitted on the following parts: A- Onshore preparations (Assembly, Integration and Commissioning of the Utilities and Accommodation Modules) B- Offshore detailed planning of the critical activities concerning the start-up of the systems responsible for leaving the platform ready for 'live'. This operation was defined as 'seven days of platform live support' (main target of this paper). (author)

  19. ANALISIS INFLASI PRA DAN PASCA KRISIS MONETER DALAM PEREKONOMIAN INDONESIA

    Directory of Open Access Journals (Sweden)

    Deni Sri Haryati

    2014-10-01

    Full Text Available Abstrak ___________________________________________________________________ Penelitian ini menganalisis fluktuasi inflasi yang terjadi pada masa pra, saat, dan pasca krisis moneter. Terdapat 5 variabel yang berkorelasi dengan inflasi di Indonesia. Variabel-variabel tersebut adalah jumlah uang beredar (JUB, nilai tukar nominal (NTN, pertumbuhan ekonomi, pengeluaran pemerintah (PeP,dan  bahan bakar minyak (BBM. Sebenarnya variabel tersebut memiliki hubungan dengan inflasi pada seluruh era. Namun, variabel tesebut memiliki dominasi yang berbeda pada masing-masing eranya. Era prakrisis didominasi oleh 3 variabel, yakni; pertumbuhan ekonomi, NTN, dan JUB, era krisis didominasi oleh seluruh variabel yang ada, dan era pasca krisis didominasi oleh 3 variabel, yakni; PeP, NTN, dan JUB. Variabel-variabel ini akan dijelaskan pengaruhnya terhadap inflasi pada era yang didominasi dimana apakah memiliki hubungan sebanding atau berbanding terbalik. Abstract ___________________________________________________________________ This study analyzes the fluctuations in inflation that occurred in the pre, during and post the financial crisis. There are 5 variables that correlated with inflation in Indonesia. These variables are the money supply (MS, the nominal exchange rate (NER, economic growth, government expenditure (GE, and fuel oil (BBM. Actually, these variables have a relationship with inflation on the whole era. However, the variable has a predominance of different proficiency level in each era. Pre-crisis era dominated by three variables, namely; economic growth, NER, and MS, crisis era dominated by all the variables that exist, and the post-crisis era dominated by three variables, namely; GE, NER, and MS. These variables will be explained influence on inflation in an era dominated where or whether proportional or inversely proportional relationship. © 2014 Universitas Negeri Semarang

  20. Use of PRA in the nuclear regulatory field in South Africa

    International Nuclear Information System (INIS)

    Hill, T.F.

    1994-01-01

    The nuclear regulatory authority in South Africa (since 1988 the Council for Nuclear Safety (CNS)), established in 1973 nuclear safety criteria against which to assess the level of safety of any facility using radioactive material. It is a regulatory requirement in South Africa to develop and maintain a living PRA for each facility and thereby to provide the necessary information to demonstrate compliance against these criteria. All safety submissions to the CNS must include at least a risk statement based on an accepted PRA study. The function of the CNS is to regulate all activities in South Africa involving the use of radioactive material and posing a significant risk to the public or plant personnel. This includes most aspects of the nuclear fuel cycle and the Koeberg NPS (two 2775 MW(th) PWRs). A PRA study including source terms for the two Koeberg units was presented by the contractor in 1979. This included the risk due to power and shutdown states and non reactor related accidents involving spent fuel storage, fuel handling and waste treatment related activities. At least 20 PRA studies have been performed for other nuclear facilities in the country. The CNS maintains an in-house PRA capability to perform independent assessments of licensee submission, to participate in developments of PRA methodology in the regulatory field, to perform pro-active safety work and to assist in regulatory decision making. Present ongoing work includes the development of a risk monitor, a risk management system, improvement in PRA codes, models, data collection and analysis, off-site risk assessment methodology and associated regulatory policy. (author). 1 fig

  1. Practical Application of PRA as an Integrated Design Tool for Space Systems

    Science.gov (United States)

    Kalia, Prince; Shi, Ying; Pair, Robin; Quaney, Virginia; Uhlenbrock, John

    2013-01-01

    This paper presents the application of the first comprehensive Probabilistic Risk Assessment (PRA) during the design phase of a joint NASA/NOAA weather satellite program, Geostationary Operational Environmental Satellite Series R (GOES-R). GOES-R is the next generation weather satellite primarily to help understand the weather and help save human lives. PRA has been used at NASA for Human Space Flight for many years. PRA was initially adopted and implemented in the operational phase of manned space flight programs and more recently for the next generation human space systems. Since its first use at NASA, PRA has become recognized throughout the Agency as a method of assessing complex mission risks as part of an overall approach to assuring safety and mission success throughout project lifecycles. PRA is now included as a requirement during the design phase of both NASA next generation manned space vehicles as well as for high priority robotic missions. The influence of PRA on GOES-R design and operation concepts are discussed in detail. The GOES-R PRA is unique at NASA for its early implementation. It also represents a pioneering effort to integrate risks from both Spacecraft (SC) and Ground Segment (GS) to fully assess the probability of achieving mission objectives. PRA analysts were actively involved in system engineering and design engineering to ensure that a comprehensive set of technical risks were correctly identified and properly understood from a design and operations perspective. The analysis included an assessment of SC hardware and software, SC fault management system, GS hardware and software, common cause failures, human error, natural hazards, solar weather and infrastructure (such as network and telecommunications failures, fire). PRA findings directly resulted in design changes to reduce SC risk from micro-meteoroids. PRA results also led to design changes in several SC subsystems, e.g. propulsion, guidance, navigation and control (GNC

  2. MAAP4.0.7 analysis and justification for PRA level 1 mission success criteria

    International Nuclear Information System (INIS)

    Butler, J.S.; Kapitz, D.; Martin, R.P.; Seifaee, F.; Sundaram, R.K.

    2008-01-01

    The U.S. EPR is a 4590 MWth evolutionary pressurized water reactor that incorporates proven technology with innovative system architecture to provide an unprecedented level of safety. One of the measures of safety is provided by Probability Risk Assessment (PRA). PRA Level 1 concerns the evaluation of core damage frequency based on various initiating events and the success or failure of various plant event mitigation features. Determination of this measure requires mission success criteria, which are used to build the logic that makes up the fault trees and event trees of the Level 1 PRA. Developing mission success criteria for the wide variety of accident sequences modeled in the PRA Level 1 model requires a large number of thermal hydraulic calculations. The MAAP4 code, developed by Fauske and Associates, Inc. and distributed by EPRI, was chosen to perform these calculations because of its fast computation times relative to more sophisticated thermal-hydraulics codes This is a unique application of MAAP4, which was developed specifically for severe accident and PRA Level 2 analysis. As such, a study was performed to assess MAAP4 's thermal-hydraulic response capabilities against AREVA 's S-RELAP5 best-estimate integral systems thermal-hydraulic analysis code. (authors)

  3. Using level-I PRA for enhanced safety of the advanced neutron source reactor

    International Nuclear Information System (INIS)

    Ramsey, C.T.; Linn, M.A.

    1995-01-01

    The phase-1, level-I probabilistic risk assessment (PRA) of the Advanced Neutron Source (ANS) reactor has been completed as part of the conceptual design phase of this proposed research facility. Since project inception, PRA and reliability concepts have been an integral part of the design evolutions contributing to many of the safety features in the current design. The level-I PRA has been used to evaluate the internal events core damage frequency against project goals and to identify systems important to safety and availability, and it will continue to guide and provide support to accident analysis, both severe and nonsevere. The results also reflect the risk value of defense-in-depth safety features in reducing the likelihood of core damage

  4. System 80+TM PRA insights on severe accident prevention and mitigation

    International Nuclear Information System (INIS)

    Finnicum, D.J.; Jacob, M.C.; Schneider, R.E.; Weston, R.A.

    2004-01-01

    The System 80 + design is ABB-CE's standardized evolutionary Advanced Light Water Reactor (ALWR) design. It incorporates design enhancements based on Probabilistic Risk Assessment (PRA) insights, guidance from the ALWR Utility Requirements Document (URD), and US NRC's Severe Accident Policy. Major severe accident prevention and mitigation design features of the System 80 + design are described. The results of the System 80 + PRA are presented and the insights gained from the PRA sensitivity analyses are discussed. ABB-CE considered defense-in-depth for accident prevention and mitigation early in the design process and used robust design features to ensure that the System 80 + design achieved a low core damage frequency, low containment conditional failure probability, and excellent deterministic containment performance under severe accident conditions and to ensure that the risk was properly allocated among design features and between prevention and mitigation. (author)

  5. Urgensi Pemeriksaan Psikis Pra-Nikah (Studi Pandangan Kepala KUA dan Psikolog Kota Malang

    Directory of Open Access Journals (Sweden)

    Ika Kurnia Fitriani

    2015-06-01

    Full Text Available Beberapa negara muslim memberikan perhatian terhadap pemeriksaan psikis pra-nikah bagi calon mempelai, sebagai upaya menanggulangi masalah rumah tangga akibat gangguan kejiwaan di masa yang akan datang. Penelitian ini bertujuan menggali informasi dari Kepala KUA dan Psikolog di Kota Malang tentang pemeriksaan psikis pra-nikah dan urgensinya bagi calon mempelai. Penelitian ini termasuk dalam penelitian lapangan (field reasearch, dengan menggunakan pendekatan kualitatif.  Alanisis data dilakukan melalui tiga tahapan yaitu reduksi data, penyajian data, dan menarik kesimpulan. Pengecekan keabsahan data menggunakan triangulasi sumber yang membandingkan hasil wawancara dengan data sekunder, dan triangulasi teori. Hasil dari penelitian ini menunjukkan bahwa Kepala KUA dan Psikolog di kota Malang menyetujui diadakan pemeriksaan psikis pranikah akan tetapi harus ada aturan hukumnya dan dilakukan sosialisasi agar program menjadi efektif. Selain itu, pemeriksaan psikis pra-nikah tidak bertentangan dengan konsep maqashid al-syari’ah dan konsep sadz al-dzari’ah dalam hukum Islam.

  6. Applicability of PRA methods and data to the financial risk assessment of nuclear power plants

    International Nuclear Information System (INIS)

    El-Sheik, K.A.

    1985-01-01

    Financial risk assessment, where the probability and severity of financial consequences are estimated, offers a logical framework for organizing and evaluating data pertinent to nuclear power plant accidents. Under the sponsorship of the Electric Power Research Institute, General Electric investigated the feasibility of financial risk assessment of nuclear power plants and of applying PRA methods and data in such an assessment. This paper summarizes the main findings of this investigation. Specifically, the paper discussed the following topics: definition of financial consequences and financial risk; overall approach for financial risk assessment and how it compares with the approach for PRA used in the Reactor Safety Study; and specific financial risk assessment procedures for defining initiating events, plant response sequences, institutional scenarios, and financial consequences and how they compare to analogous procedures for PRA

  7. Mutation of praR in Rhizobium leguminosarum enhances root biofilms, improving nodulation competitiveness by increased expression of attachment proteins.

    Science.gov (United States)

    Frederix, Marijke; Edwards, Anne; Swiderska, Anna; Stanger, Andrew; Karunakaran, Ramakrishnan; Williams, Alan; Abbruscato, Pamela; Sanchez-Contreras, Maria; Poole, Philip S; Downie, J Allan

    2014-08-01

    In Rhizobium leguminosarum bv. viciae, quorum-sensing is regulated by CinR, which induces the cinIS operon. CinI synthesizes an AHL, whereas CinS inactivates PraR, a repressor. Mutation of praR enhanced biofilms in vitro. We developed a light (lux)-dependent assay of rhizobial attachment to roots and demonstrated that mutation of praR increased biofilms on pea roots. The praR mutant out-competed wild-type for infection of pea nodules in mixed inoculations. Analysis of gene expression by microarrays and promoter fusions revealed that PraR represses its own transcription and mutation of praR increased expression of several genes including those encoding secreted proteins (the adhesins RapA2, RapB and RapC, two cadherins and the glycanase PlyB), the polysaccharide regulator RosR, and another protein similar to PraR. PraR bound to the promoters of several of these genes indicating direct repression. Mutations in rapA2, rapB, rapC, plyB, the cadherins or rosR did not affect the enhanced root attachment or nodule competitiveness of the praR mutant. However combinations of mutations in rapA, rapB and rapC abolished the enhanced attachment and nodule competitiveness. We conclude that relief of PraR-mediated repression determines a lifestyle switch allowing the expression of genes that are important for biofilm formation on roots and the subsequent initiation of infection of legume roots. © 2014 The Authors. Molecular Microbiology published by John Wiley & Sons Ltd.

  8. Constellation Probabilistic Risk Assessment (PRA): Design Consideration for the Crew Exploration Vehicle

    Science.gov (United States)

    Prassinos, Peter G.; Stamatelatos, Michael G.; Young, Jonathan; Smith, Curtis

    2010-01-01

    Managed by NASA's Office of Safety and Mission Assurance, a pilot probabilistic risk analysis (PRA) of the NASA Crew Exploration Vehicle (CEV) was performed in early 2006. The PRA methods used follow the general guidance provided in the NASA PRA Procedures Guide for NASA Managers and Practitioners'. Phased-mission based event trees and fault trees are used to model a lunar sortie mission of the CEV - involving the following phases: launch of a cargo vessel and a crew vessel; rendezvous of these two vessels in low Earth orbit; transit to th$: moon; lunar surface activities; ascension &om the lunar surface; and return to Earth. The analysis is based upon assumptions, preliminary system diagrams, and failure data that may involve large uncertainties or may lack formal validation. Furthermore, some of the data used were based upon expert judgment or extrapolated from similar componentssystemsT. his paper includes a discussion of the system-level models and provides an overview of the analysis results used to identify insights into CEV risk drivers, and trade and sensitivity studies. Lastly, the PRA model was used to determine changes in risk as the system configurations or key parameters are modified.

  9. Selecting the seismic HRA approach for Savannah River Plant PRA revision 1

    International Nuclear Information System (INIS)

    Papouchado, K.; Salaymeh, J.

    1993-10-01

    The Westinghouse Savannah River Company (WSRC) has prepared a level I probabilistic risk assessment (PRA), Rev. 0 of reactor operations for externally-initiated events including seismic events. The SRS PRA, Rev. 0 Seismic HRA received a critical review that expressed skepticism with the approach used for human reliability analysis because it had not been previously used and accepted in other published PRAs. This report provides a review of published probabilistic risk assessments (PRAs), the associated methodology guidance documents, and the psychological literature to identify parameters important to seismic human reliability analysis (HRA). It also describes a recommended approach for use in the Savannah River Site (SRS) PRA. The SRS seismic event PRA performs HRA to account for the contribution of human errors in the accident sequences. The HRA of human actions during and after a seismic event is an area subject to many uncertainties and involves significant analyst judgment. The approach recommended by this report is based on seismic HRA methods and associated issues and concerns identified from the review of these referenced documents that represent the current state-of-the- art knowledge and acceptance in the seismic HRA field

  10. Probabilistic risk assessment course documentation. Volume 2. Probability and statistics for PRA applications

    International Nuclear Information System (INIS)

    Iman, R.L.; Prairie, R.R.; Cramond, W.R.

    1985-08-01

    This course is intended to provide the necessary probabilistic and statistical skills to perform a PRA. Fundamental background information is reviewed, but the principal purpose is to address specific techniques used in PRAs and to illustrate them with applications. Specific examples and problems are presented for most of the topics

  11. MATILDA: A Military Laser Range Safety Tool Based on Probabilistic Risk Assessment (PRA) Techniques

    Science.gov (United States)

    2014-08-01

    3 2.1 UK Need for a PRA-Based Approach ............................................................... 3 2.2 A Risk-Based Approach to...Figure 6: MATILDA Coordinate Transformations ....................................................... 22  Figure 7: Geocentric and MICS Coordinates...Star-Shaped Condition ................................................................................. 27  Figure 11: Points of Closest Approach

  12. An integrated PRA module for fast determination of risk significance and improvement effectiveness

    International Nuclear Information System (INIS)

    Chao, Chun-Chang; Lin, Jyh-Der

    2004-01-01

    With the widely use of PRA technology in risk-informed applications, to predict the changes of CDF and LERF becomes a standard process for risk-informed applications. This paper describes an integrated PRA module prepared for risk-informed applications. The module contains a super risk engine, a super fault tree engine, an advanced PRA model and a tool for data base maintenance. The individual element of the module also works well for purpose other than risk-informed applications. The module has been verified and validated through a series of scrupulous benchmark tests with similar software. The results of the benchmark tests showed that the module has remarkable accuracy and speed even for an extremely large-size top-logic fault tree as well as for the case in which large amount of MCSs may be generated. The risk monitor for nuclear power plants in Taiwan is the first application to adopt the module. The results predicted by the risk monitor are now accepted by the regulatory agency. A tool to determine the risk significance according to the inspection findings will be the next application to adopt the module in the near future. This tool classified the risk significance into four different color codes according to the level of increase on CDF. Experience of application showed that the flexibility, the accuracy and speed of the module make it useful in any risk-informed applications when risk indexes must be determined by resolving a PRA model. (author)

  13. Introduction of accidental procedures in the event trees of the 900MW PWR PRA

    International Nuclear Information System (INIS)

    Bars, G.; Champ, M.; Lanore, J.M.; Pochard, R.

    1985-02-01

    This paper presents the example of the small LOCA Event Trees and the studies related to the introduction of procedure actions is case of HPSI failure. The results illustrate the interest of the approach and its significant impact on the PRA. The present studies are related to the Y actions in case of small LOCAs without HPIS

  14. Hydrogeochemical processes influencing groundwater quality within the Lower Pra Basin

    International Nuclear Information System (INIS)

    Tay, Collins

    2015-12-01

    Hydrogeochemical and social impact studies were carried out within the Lower Pra Basin where groundwater serves as a source of potable water supply to majority of the communities. The main objective of the study was to investigate the hydrogeochemical processes and the anthropogenic impact that influence groundwater as well as the perception of inhabitants about the impact of their socio-economic activities on the quality of groundwater and subsequently make recommendations towards proper management and development of groundwater resources within the basin. The methodology involved quarterly sampling of selected surface and groundwater sources between January 2011 and October 2012 for major ions, minor ions, stable isotopes of deuterium ( 2 H) and oxygen-18 ( 18 O) and trace metals analyses as well as administration of questionnaires designed to collect information on the socio-economic impact on the water resources within the basin. In all, a chemical data-base on three hundred and ninety seven (397) point sources was generated and three hundred (300) questionnaires were administered. The hydrochemical results show that, the major processes responsible for chemical evolution of groundwater include: silicate (SiO 4 ) 4- weathering, ion-exchange reactions, sea aerosol spray, the leaching of biotite, chlorite and actinolite. The groundwater is mildly acidic to neutral (pH 3.5 – 7.3) due principally to natural biogeochemical processes. Groundwater acidity studies show that, notwithstanding the moderately low pH, the groundwater still has the potential to neutralize acids due largely to the presence of silicates/aluminosilicates. Results of the Total Dissolved Solids (TDS) show that 98.6 % of groundwater is fresh (TDS < 500 mg/L). The relative abundance of cations and anions is in the order: Na + > Ca 2 + > Mg 2 + > K + and HCO 3 - > Cl - > SO 4 2- respectively. Stable isotopes results show that, the groundwater emanated primarily from meteoric origin with

  15. Manutenção de brinquedo em praças públicas

    Directory of Open Access Journals (Sweden)

    Fabio Namiki

    2007-12-01

    Full Text Available O artigo apresenta o jacaré, um dos brinquedos executados no âmbito do Programa Centros de Bairro, que foi responsável pela implantação de cerca de 50 praças na cidade de São Paulo entre 2002 e 2004. O conjunto dos brinquedos deste programa foi apresentado e analisado no mestrado “Manutenção de praças na cidade de São Paulo. Estudo de caso: brinquedos do programa Centros de Bairro”, segundo metodologia que pode ser também aplicada para outros componentes de uma praça e mesmo para a praça em si. Espera-se que esta metodologia sirva como instrumento para o planejamento das ações de manutenção de praças e de mobiliários urbanos de modo geral. Neste texto, são apresentadas informações (da mesma forma que seriam em um manual de uso, operação e manutenção do projeto do brinquedo, obtidas junto aos responsáveis pelo programa, em entrevista com o executor dos brinquedos e através dos desenhos e documentos produzidos para a licitação e execução das peças. São também apresentadas as informações obtidas a partir das inspeções a campo e estimativas do custo de manutenção preventiva. Frente ao custo de reposição de um brinquedo novo, os valores da manutenção nos provam a importância econômica de tais ações.

  16. Applications of Living Fire PRA models to Fire Protection Significance Determination Process in Taiwan

    International Nuclear Information System (INIS)

    De-Cheng, Chen; Chung-Kung, Lo; Tsu-Jen, Lin; Ching-Hui, Wu; Lin, James C.

    2004-01-01

    The living fire probabilistic risk assessment (PRA) models for all three operating nuclear power plants (NPPs) in Taiwan had been established in December 2000. In that study, a scenario-based PRA approach was adopted to systematically evaluate the fire and smoke hazards and associated risks. Using these fire PRA models developed, a risk-informed application project had also been completed in December 2002 for the evaluation of cable-tray fire-barrier wrapping exemption. This paper presents a new application of the fire PRA models to fire protection issues using the fire protection significance determination process (FP SDP). The fire protection issues studied may involve the selection of appropriate compensatory measures during the period when an automatic fire detection or suppression system in a safety-related fire zone becomes inoperable. The compensatory measure can either be a 24-hour fire watch or an hourly fire patrol. The living fire PRA models were used to estimate the increase in risk associated with the fire protection issue in terms of changes in core damage frequency (CDF) and large early release frequency (LERF). In compliance with SDP at-power and the acceptance guidelines specified in RG 1.174, the fire protection issues in question can be grouped into four categories; red, yellow, white and green, in accordance with the guidelines developed for FD SDP. A 24-hour fire watch is suggested only required for the yellow condition, while an hourly fire patrol may be adopted for the white condition. More limiting requirement is suggested for the red condition, but no special consideration is needed for the green condition. For the calculation of risk measures, risk impacts from any additional fire scenarios that may have been introduced, as well as more severe initiating events and fire damages that may accompany the fire protection issue should be considered carefully. Examples are presented in this paper to illustrate the evaluation process. (authors)

  17. The Evaluation of the Adequacy of PRA Results for Risk-informed Decision Makings With Respect to Incompleteness

    International Nuclear Information System (INIS)

    Kang, Kyungmin; Jae, Moosung

    2007-01-01

    PRA(Probabilistic Risk Assessment), as a quantitative tool, has many strengths as well as weaknesses. There are several limitations on the use of PRA techniques for risk modeling and analysis. First, the true values of most model inputs are unknown. Ideally, probability distribution models are well developed and assigned to the unknown input parameters to reflect the analyst's state of knowledge of the values of this input parameter. The problem of overconfidence and lack of confidence in the values of certain model input parameters can lead to inaccurate PRA results. Secondly, the analyst's lack of knowledge of a system's practical application as opposed to its theoretical operation can lead to modeling errors. The quality of PRAs has been addressed by a number of regulatory and industry organizations Some have argued that a good PRA should be a complete, full scope, three level PRA, while others have claimed that the quality of a PRA should be measured with respect to the application and decision supported. we show by way of an example that the adequacy of a PRA results is important to risk-informed decision making process and should be measured with respect to the application and decision supported

  18. PRA research and the development of risk-informed regulation at the U.S. nuclear regulatory commission

    International Nuclear Information System (INIS)

    Siu, Nathan; Collins, Dorothy

    2008-01-01

    Over the years, Probabilistic Risk Assessment (PRA) research activities conducted at the U.S. Nuclear Regulatory Commission (NRC) have played an essential role in support of the agency's move towards risk-informed regulation. These research activities have provided the technical basis for NRC's regulatory activities in key areas; provided PRA methods, tools, and data enabling the agency to meet future challenges; supported the implementation of NRC's 1995 PRA Policy Statement by assessing key sources of risk; and supported the development of necessary technical and human resources supporting NRC's risk-informed activities. PRA research aimed at improving the NRC's understanding of risk can positively affect the agency's regulatory activities, as evidenced by three case studies involving research on fire PRA, Human Reliability Analysis (HRA), and Pressurized Thermal Shock (PTS) PRA. These case studies also show that such research can take a considerable amount of time, and that the incorporation of research results into regulatory practice can take even longer. The need for sustained effort and appropriate lead time is an important consideration in the development of a PRA research program aimed at helping the agency address key sources of risk for current and potential future facilities

  19. Probabilistic risk assessment (PRA) update in light of the accident at Fukushima Daiichi Nuclear Power Station - 15461

    International Nuclear Information System (INIS)

    Maeda, K.; Abe, H.; Hirokawa, N.; Satou, C.

    2015-01-01

    We have performed internal and external event probabilistic risk assessments (PRA) for boiling water reactor power nuclear plants to identify the important accident sequence groups and to evaluate the effectiveness of the additional severe accident measures, regarding to the new regulatory requirements implemented after the accident at Fukushima Daiichi Nuclear Power Station in Japan in 2011. In addition, we will further update our PRA by extracting problems and improvements from the current PRA, by catching up the state-of-the-art knowledge, modern PRA methodologies in order to contribute voluntarily to safety improvement as well as to comply with regulations. In this document, prior to the extensive PRA updates, we would describe technical contents and qualitative results about PRA updates that have been performed preliminary so far, especially about the external event (seismic) PRA and how to model the additionally deployed severe accident measures (e.g. power supply car, fire engine) so that they can be function external hazards, such as component failure rate of equipment, human reliability 'out of control room', and mission time extension. (authors)

  20. Development of fire PRA methodologies for the analysis of typical Italian NPP designs

    International Nuclear Information System (INIS)

    Silvestri, E.; Dore, B.; Ferro, G.; Apostolakis, G.

    1987-01-01

    To compute fire induced Core Melt probability, the results of hazard and propagation analyses were combined with the Core Melt frequency computed for the initiating event and the support state as determined by the fire considered. From the PRA for internal event, the average value of this frequency was found 2.5x10 -3 event/year. Using the average fire frequency the resulting fire induced Core Melt frequency is 1.4x10 -8 event/year. Although high separation of safety systems is required in Italian PWR plants, the frequency of fire induced Core Melt can reach values not negligible with respect to Italian safety standards. For this reason, fire PRA studies for the entire plant are considered necessary and should be performed with appropriate modifications of the methods used for the American plants in order to be able to estimate lower fire induced Core Melt frequencies. (orig./HP)

  1. Comments of the PRA Senior Review Panel on the meeting held December 1--3, 1987

    International Nuclear Information System (INIS)

    Sharp, D.A.

    1988-01-01

    This memorandum records the minutes of the PRA Senior Review Panel meeting held at Savannah River Laboratory (SRL) on December 1--3, 1987, and the report on that meeting written subsequently by the panel members. The minutes are contained as Attachment 2 of this memorandum, and the report as Attachment 1. The Panel indicated two principal concerns in their report: (1) that insufficient emphasis is being placed on the reliability data development program, and (2) that excessive detail is being built into the fault trees. These concerns have been addressed in a subsequent meeting with the Panel, held March 2--4, 1988. In addition, the members have been provided with a program document (Reference 1) indicating the extent, the timing, and the limitations of the data analysis effort for the PRA

  2. A PRA case study of extended long term decay heat removal for shutdown risk assessment

    International Nuclear Information System (INIS)

    Roglans, J.; Ragland, W.A.; Hill, D.J.

    1992-01-01

    A Probabilistic Risk Assessment (PRA) of the Experimental Breeder Reactor II (EBR-II), a Department of Energy (DOE) Category A research reactor, has recently been completed at Argonne National Laboratory (ANL). The results of this PRA have shown that the decay heat removal system for EBR-II is extremely robust and reliable. In addition, the methodology used demonstrates how the actions of other systems not normally used for actions of other systems not normally used for decay heat removal can be used to expand the mission time of the decay heat removal system and further increase its reliability. The methodology may also be extended to account for the impact of non-safety systems in enhancing the reliability of other dedicated safety systems

  3. Methodology and application of surrogate plant PRA analysis to the Rancho Seco Power Plant: Final report

    International Nuclear Information System (INIS)

    Gore, B.F.; Huenefeld, J.C.

    1987-07-01

    This report presents the development and the first application of generic probabilistic risk assessment (PRA) information for identifying systems and components important to public risk at nuclear power plants lacking plant-specific PRAs. A methodology is presented for using the results of PRAs for similar (surrogate) plants, along with plant-specific information about the plant of interest and the surrogate plants, to infer important failure modes for systems of the plant of interest. This methodology, and the rationale on which it is based, is presented in the context of its application to the Rancho Seco plant. The Rancho Seco plant has been analyzed using PRA information from two surrogate plants. This analysis has been used to guide development of considerable plant-specific information about Rancho Seco systems and components important to minimizing public risk, which is also presented herein

  4. Advanced Small Modular Reactor (SMR) Probabilistic Risk Assessment (PRA) Technical Exchange Meeting

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Curtis [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2013-09-01

    During FY13, the INL developed an advanced SMR PRA framework which has been described in the report Small Modular Reactor (SMR) Probabilistic Risk Assessment (PRA) Detailed Technical Framework Specification, INL/EXT-13-28974 (April 2013). In this framework, the various areas are considered: Probabilistic models to provide information specific to advanced SMRs Representation of specific SMR design issues such as having co-located modules and passive safety features Use of modern open-source and readily available analysis methods Internal and external events resulting in impacts to safety All-hazards considerations Methods to support the identification of design vulnerabilities Mechanistic and probabilistic data needs to support modeling and tools In order to describe this framework more fully and obtain feedback on the proposed approaches, the INL hosted a technical exchange meeting during August 2013. This report describes the outcomes of that meeting.

  5. Expected proton signal sizes in the PRaVDA Range Telescope for proton Computed Tomography

    International Nuclear Information System (INIS)

    Price, T.; Parker, D.J.; Green, S.; Esposito, M.; Waltham, C.; Allinson, N.M.; Poludniowski, G.; Evans, P.; Taylor, J.; Manolopoulos, S.; Anaxagoras, T.; Nieto-Camero, J.

    2015-01-01

    Proton radiotherapy has demonstrated benefits in the treatment of certain cancers. Accurate measurements of the proton stopping powers in body tissues are required in order to fully optimise the delivery of such treaments. The PRaVDA Consortium is developing a novel, fully solid state device to measure these stopping powers. The PRaVDA Range Telescope (RT), uses a stack of 24 CMOS Active Pixel Sensors (APS) to measure the residual proton energy after the patient. We present here the ability of the CMOS sensors to detect changes in the signal sizes as the proton traverses the RT, compare the results with theory, and discuss the implications of these results on the reconstruction of proton tracks

  6. Clinical analysis of the changes of plasma PRA, AT-II and Aid levels in patients with acute renal failure

    International Nuclear Information System (INIS)

    Zhang Qiuyue; Yang Yongqing

    2002-01-01

    Objective: To investigate the role of changes of plasma PRA, AT-II and Ald levels in the pathogenesis of acute renal failure. Methods: Plasma PRA, AT-II and Ald levels were determined with RIA in 40 normal subjects and 72 cases of acute renal failure. Results: Plasma PRA, AT-II and Ald levels in the patients were markedly increased as compared with those in normal subjects (p < 0.05, p < 0.01, p < 0.001 respectively). There were no linearity and exponential relationship between plasma PRA, AT-II, Ald levels and the 24 h urinary sodium excretion amount (within the range of 89.1 - 365.2 mEq). Conclusion: Acute renal failure could activate the RAAS function

  7. Evaluation of hsp65 Nested PCR-Restriction Analysis (PRA) for Diagnosing Tuberculosis in a High Burden Country

    Science.gov (United States)

    Macente, Sara; Fujimura Leite, Clarice Queico; Santos, Adolfo Carlos Barreto; Siqueira, Vera Lúcia Dias; Machado, Luzia Neri Cosmo; Marcondes, Nadir Rodrigues; Hirata, Mario Hiroyuki; Hirata, Rosário Dominguez Crespo

    2013-01-01

    Current study evaluated the hsp65 Nested PCR Restriction Fragment Length Polymorphism Analysis (hsp65 Nested PCR-PRA) to detect and identify Mycobacterium tuberculosis complex directly in clinical samples for a rapid and specific diagnosis of tuberculosis (TB). hsp65 Nested PCR-PRA was applied directly to 218 clinical samples obtained from 127 patients suspected of TB or another mycobacterial infection from July 2009 to July 2010. The hsp65 Nested PCR-PRA showed 100% sensitivity and 95.0 and 93.1% specificity in comparison with culture and microscopy (acid fast bacillus smear), respectively. hsp65 Nested PCR-PRA was shown to be a fast and reliable assay for diagnosing TB, which may contribute towards a fast diagnosis that could help the selection of appropriate chemotherapeutic and early epidemiological management of the cases which are of paramount importance in a high TB burden country. PMID:24260739

  8. Relay chatter and operator response after a large earthquake: An improved PRA methodology with case studies

    International Nuclear Information System (INIS)

    Budnitz, R.J.; Lambert, H.E.; Hill, E.E.

    1987-08-01

    The purpose of this project has been to develop and demonstrate improvements in the PRA methodology used for analyzing earthquake-induced accidents at nuclear power reactors. Specifically, the project addresses methodological weaknesses in the PRA systems analysis used for studying post-earthquake relay chatter and for quantifying human response under high stress. An improved PRA methodology for relay-chatter analysis is developed, and its use is demonstrated through analysis of the Zion-1 and LaSalle-2 reactors as case studies. This demonstration analysis is intended to show that the methodology can be applied in actual cases, and the numerical values of core-damage frequency are not realistic. The analysis relies on SSMRP-based methodologies and data bases. For both Zion-1 and LaSalle-2, assuming that loss of offsite power (LOSP) occurs after a large earthquake and that there are no operator recovery actions, the analysis finds very many combinations (Boolean minimal cut sets) involving chatter of three or four relays and/or pressure switch contacts. The analysis finds that the number of min-cut-set combinations is so large that there is a very high likelihood (of the order of unity) that at least one combination will occur after earthquake-caused LOSP. This conclusion depends in detail on the fragility curves and response assumptions used for chatter. Core-damage frequencies are calculated, but they are probably pessimistic because assuming zero credit for operator recovery is pessimistic. The project has also developed an improved PRA methodology for quantifying operator error under high-stress conditions such as after a large earthquake. Single-operator and multiple-operator error rates are developed, and a case study involving an 8-step procedure (establishing feed-and-bleed in a PWR after an earthquake-initiated accident) is used to demonstrate the methodology

  9. Uncertainty and sensitivity studies supporting the interpretation of the results of TVO I/II PRA

    International Nuclear Information System (INIS)

    Holmberg, J.

    1992-01-01

    A comprehensive Level 1 probabilistic risk assessment (PRA) has been performed for the TVO I/II nuclear power units. As a part of the PRA project, uncertainties of risk models and methods were systematically studied in order to describe them and to demonstrate their impact by way of results. The uncertainty study was divided into two phases: a qualitative and a quantitative study. The qualitative study contained identification of uncertainties and qualitative assessments of their importance. The PRA was introduced, and identified assumptions and uncertainties behind the models were documented. The most significant uncertainties were selected by importance measures or other judgements for further quantitative studies. The quantitative study included sensitivity studies and propagation of uncertainty ranges. In the sensitivity studies uncertain assumptions or parameters were varied in order to illustrate the sensitivity of the models. The propagation of the uncertainty ranges demonstrated the impact of the statistical uncertainties of the parameter values. The Monte Carlo method was used as a propagation method. The most significant uncertainties were those involved in modelling human interactions, dependences and common cause failures (CCFs), loss of coolant accident (LOCA) frequencies and pressure suppression. The qualitative mapping out of the uncertainty factors turned out to be useful in planning quantitative studies. It also served as internal review of the assumptions made in the PRA. The sensitivity studies were perhaps the most advantageous part of the quantitative study because they allowed individual analyses of the significance of uncertainty sources identified. The uncertainty study was found reasonable in systematically and critically assessing uncertainties in a risk analysis. The usefulness of this study depends on the decision maker (power company) since uncertainty studies are primarily carried out to support decision making when uncertainties are

  10. The Prenylated Rab GTPase Receptor PRA1.F4 Contributes to Protein Exit from the Golgi Apparatus.

    Science.gov (United States)

    Lee, Myoung Hui; Yoo, Yun-Joo; Kim, Dae Heon; Hanh, Nguyen Hong; Kwon, Yun; Hwang, Inhwan

    2017-07-01

    Prenylated Rab acceptor1 (PRA1) functions in the recruitment of prenylated Rab proteins to their cognate organelles. Arabidopsis ( Arabidopsis thaliana ) contains a large number of proteins belonging to the AtPRA1 family. However, their physiological roles remain largely unknown. Here, we investigated the physiological role of AtPRA1.F4, a member of the AtPRA1 family. A T-DNA insertion knockdown mutant of AtPRA1.F4 , atpra1.f4 , was smaller in stature than parent plants and possessed shorter roots, whereas transgenic plants overexpressing HA:AtPRA1.F4 showed enhanced development of secondary roots and root hairs. However, both overexpression and knockdown plants exhibited increased sensitivity to high-salt stress, lower vacuolar Na + /K + -ATPase and plasma membrane ATPase activities, lower and higher pH in the vacuole and apoplast, respectively, and highly vesiculated Golgi apparatus. HA:AtPRA1.F4 localized to the Golgi apparatus and assembled into high-molecular-weight complexes. atpra1.f4 plants displayed a defect in vacuolar trafficking, which was complemented by low but not high levels of HA : AtPRA1.F4 Overexpression of HA:AtPRA1.F4 also inhibited protein trafficking at the Golgi apparatus, albeit differentially depending on the final destination or type of protein: trafficking of vacuolar proteins, plasma membrane proteins, and trans-Golgi network (TGN)-localized SYP61 was strongly inhibited; trafficking of TGN-localized SYP51 was slightly inhibited; and trafficking of secretory proteins and TGN-localized SYP41 was negligibly or not significantly inhibited. Based on these results, we propose that Golgi-localized AtPRA1.F4 is involved in the exit of many but not all types of post-Golgi proteins from the Golgi apparatus. Additionally, an appropriate level of AtPRA1.F4 is crucial for its function at the Golgi apparatus. © 2017 American Society of Plant Biologists. All Rights Reserved.

  11. Estrogen and progesterone receptors have distinct roles in the establishment of the hyperplastic phenotype in PR-A transgenic mice

    Energy Technology Data Exchange (ETDEWEB)

    Simian, Marina; Bissell, Mina J.; Barcellos-Hoff, Mary Helen; Shyamala, Gopalan

    2009-05-11

    Expression of the A and B forms of progesterone receptor (PR) in an appropriate ratio is critical for mammary development. Mammary glands of PR-A transgenic mice, carrying an additional A form of PR as a transgene, exhibit morphological features associated with the development of mammary tumors. Our objective was to determine the roles of estrogen (E) and progesterone (P) in the genesis of mammary hyperplasias/preneoplasias in PR-A transgenics. We subjected PR-A mice to hormonal treatments and analyzed mammary glands for the presence of hyperplasias and used BrdU incorporation to measure proliferation. Quantitative image analysis was carried out to compare levels of latency-associated peptide and transforming growth factor beta 1 (TGF{beta}1) between PR-A and PR-B transgenics. Basement membrane disruption was examined by immunofluorescence and proteolytic activity by zymography. The hyperplastic phenotype of PR-A transgenics is inhibited by ovariectomy, and is reversed by treatment with E + P. Studies using the antiestrogen ICI 182,780 or antiprogestins RU486 or ZK 98,299 show that the increase in proliferation requires signaling through E/estrogen receptor alpha but is not sufficient to give rise to hyperplasias, whereas signaling through P/PR has little impact on proliferation but is essential for the manifestation of hyperplasias. Increased proliferation is correlated with decreased TGF{beta}1 activation in the PR-A transgenics. Analysis of basement membrane integrity showed loss of laminin-5, collagen III and collagen IV in mammary glands of PR-A mice, which is restored by ovariectomy. Examination of matrix metalloproteases (MMPs) showed that total levels of MMP-2 correlate with the steady-state levels of PR, and that areas of laminin-5 loss coincide with those of activation of MMP-2 in PR-A transgenics. Activation of MMP-2 is dependent on treatment with E and P in ovariectomized wild-type mice, but is achieved only by treatment with P in PR-A mice. These data

  12. Results of the Level 1 probabilistic risk assessment (PRA) of internal events for heavy water production reactors (U)

    International Nuclear Information System (INIS)

    Tinnes, S.P.; Cramer, D.S.; Logan, V.E.; Topp, S.V.; Smith, J.A.; Brandyberry, M.D.

    1990-01-01

    This paper reports on a full-scope probabilistic risk assessment (PRA) performed for the Savannah River Site (SRS) production reactors. The Level 1 PRA for the K Reactor has been completed and includes the assessment of reactor systems response to accidents and estimates of the severe core melt frequency (SCMF). The internal events spectrum includes those events related directly to plant systems and safety functions for which transients or failures may initiate an accident

  13. Survey of seismic fragilities used in PRA studies of nuclear power plants

    International Nuclear Information System (INIS)

    Park, Y.J.; Hofmayer, C.H.; Chokshi, N.C.

    1998-01-01

    In recent years, seismic PRA studies have been performed on a large number of nuclear power plants in the USA. This paper presents a summary of a survey on fragility databases and the range of evaluated fragility values of various equipment categories based on past PRAs. The survey includes the use of experience data, the interpretations of available test data, and the quantification of uncertainties. The surveyed fragility databases are limited to data available in the public domain such as NUREG reports, conference proceedings and other publicly available reports. The extent of the availability of data as well as limitations are studied and tabulated for various equipment categories. The survey of the fragility values in past PRA studies includes not only the best estimate values, but also the dominant failure modes and the estimated uncertainty levels for each equipment category. The engineering judgments employed in estimating the uncertainty in the fragility values are also studied. This paper provides a perspective on the seismic fragility evaluation procedures for equipment in order to clearly identify the engineering analysis and judgment used in past seismic PRA studies

  14. Development of a methodology for conducting an integrated HRA/PRA --

    International Nuclear Information System (INIS)

    Luckas, W.J.; Barriere, M.T.; Brown, W.S.; Wreathall, J.; Cooper, S.E.

    1993-01-01

    During Low Power and Shutdown (LP ampersand S) conditions in a nuclear power plant (i.e., when the reactor is subcritical or at less than 10--15% power), human interactions with the plant's systems will be more frequent and more direct. Control is typically not mediated by automation, and there are fewer protective systems available. Therefore, an assessment of LP ampersand S related risk should include a greater emphasis on human reliability than such an assessment made for power operation conditions. In order to properly account for the increase in human interaction and thus be able to perform a probabilistic risk assessment (PRA) applicable to operations during LP ampersand S, it is important that a comprehensive human reliability assessment (HRA) methodology be developed and integrated into the LP ampersand S PRA. The tasks comprising the comprehensive HRA methodology development are as follows: (1) identification of the human reliability related influences and associated human actions during LP ampersand S, (2) identification of potentially important LP ampersand S related human actions and appropriate HRA framework and quantification methods, and (3) incorporation and coordination of methodology development with other integrated PRA/HRA efforts. This paper describes the first task, i.e., the assessment of human reliability influences and any associated human actions during LP ampersand S conditions for a pressurized water reactor (PWR)

  15. Development of a methodology for conducting an integrated HRA/PRA --

    Energy Technology Data Exchange (ETDEWEB)

    Luckas, W.J.; Barriere, M.T.; Brown, W.S. (Brookhaven National Lab., Upton, NY (United States)); Wreathall, J. (Wreathall (John) and Co., Dublin, OH (United States)); Cooper, S.E. (Science Applications International Corp., McLean, VA (United States))

    1993-01-01

    During Low Power and Shutdown (LP S) conditions in a nuclear power plant (i.e., when the reactor is subcritical or at less than 10--15% power), human interactions with the plant's systems will be more frequent and more direct. Control is typically not mediated by automation, and there are fewer protective systems available. Therefore, an assessment of LP S related risk should include a greater emphasis on human reliability than such an assessment made for power operation conditions. In order to properly account for the increase in human interaction and thus be able to perform a probabilistic risk assessment (PRA) applicable to operations during LP S, it is important that a comprehensive human reliability assessment (HRA) methodology be developed and integrated into the LP S PRA. The tasks comprising the comprehensive HRA methodology development are as follows: (1) identification of the human reliability related influences and associated human actions during LP S, (2) identification of potentially important LP S related human actions and appropriate HRA framework and quantification methods, and (3) incorporation and coordination of methodology development with other integrated PRA/HRA efforts. This paper describes the first task, i.e., the assessment of human reliability influences and any associated human actions during LP S conditions for a pressurized water reactor (PWR).

  16. The role of PRA in the safety assessment of VVER Nuclear Power Plants in Ukraine

    International Nuclear Information System (INIS)

    Kot, C.

    1999-01-01

    Ukraine operates thirteen (13) Soviet-designed pressurized water reactors, VVERS. All Ukrainian plants are currently operating with annually renewable permits until they update their safety analysis reports (SARs), in accordance with new SAR content requirements issued in September 1995, by the Nuclear Regulatory Authority and the Government Nuclear Power Coordinating Committee of Ukraine. The requirements are in three major areas: design basis accident (DBA) analysis, probabilistic risk assessment (PRA), and beyond design-basis accident (BDBA) analysis. The last two requirements, on PRA and BDBA, are new, and the DBA requirements are an expanded version of the older SAR requirements. The US Department of Energy (USDOE), as part of its Soviet-Designed Reactor Safety activities, is providing assistance and technology transfer to Ukraine to support their nuclear power plants (NPPs) in developing a Western-type technical basis for the new SARs. USDOE sponsored In-Depth Safety Assessments (ISAs) are in progress at three pilot nuclear reactor units in Ukraine, South Ukraine Unit 1, Zaporizhzhya Unit 5, and Rivne Unit 1, and a follow-on study has been initiated at Khmenytskyy Unit 1. The ISA projects encompass most areas of plant safety evaluation, but the initial emphasis is on performing a detailed, plant-specific Level 1 Internal Events PRA. This allows the early definition of the plant risk profile, the identification of risk significant accident sequences and plant vulnerabilities and provides guidance for the remainder of the safety assessments

  17. Use of plant-specific PRA in an EOP scope audit

    International Nuclear Information System (INIS)

    O'Brien, J.J.

    1991-01-01

    Traditionally, decisions on which accident scenarios to proceduralize as emergency operating procedures (EOPs) have been based on existing design basis analyses, engineering judgment, and probabilistic risk assessments (PRAs) on generic plants. This approach has important strengths and limits. The major limitation of generic PRAs is their inability to account for plant-specific features. Use of plant-specific PRA to determine the impact of proceduralizing, or not proceduralizing, responses to scenarios considers plant-specific features. This helps to eliminate unnecessary EOPs, thus allowing resources to be concentrated on scenarios that are more important for a particular plant. In preparation for a US Nuclear Regulatory Commission audit, a plant-specific PRA was used to assess and quantify the plant's previous decision not to implement six reference emergency response guidelines (ERGs) as procedures. The original justification for nonimplementation of the ERGs was based on engineering judgment. The PRA provided a quantitative justification for implementation/nonimplementation of each guidelines. This analysis accounted for plant-specific design features not common to all reference plants

  18. Use of probabilistic risk assessment (PRA) in expert systems to advise nuclear plant operators and managers

    International Nuclear Information System (INIS)

    Uhrig, R.E.

    1988-01-01

    The use of expert systems in nuclear power plants to provide advice to managers, supervisors and/or operators is a concept that is rapidly gaining acceptance. Generally, expert systems rely on the expertise of human experts or knowledge that has been codified in publications, books, or regulations to provide advice under a wide variety of conditions. In this work, a probabilistic risk assessment (PRA) of a nuclear power plant performed previously is used to assess the safety status of nuclear power plants and to make recommendations to the plant personnel. Nuclear power plants have many redundant systems and can continue to operate when one or more of these systems is disabled or removed from service for maintenance or testing. PRAs provide a means of evaluating the risk to the public associated with the operation of nuclear power plants with components or systems out of service. While the choice of the source term and methodology in a PRA may influence the absolute probability and consequences of a core melt, the ratio of the PRA calculations for two configurations of the same plant, carried out on a consistent basis, can readily identify the increase in risk associated with going from one configuration to the other

  19. Treatment of system dependencies and human interactions in PRA studies: a review and sensitivity study

    International Nuclear Information System (INIS)

    Orvis, D.D.; Joksimovich, V.; Worledge, D.H.

    1985-01-01

    The Electric Power Research Institute sponsored the review and comparison of five PRA studies: Arkansas Nuclear One - Unit 1, Big Rock Point, Grand Gulf, Limerick, and Zion - Unit 1. The review has been conducted in two phases. The Phase I review may be characterized as a qualitative look into many aspects of a PRA study. The Phase II review was performed to quantify the extent that differences in analytical techniques or key assumptions in these areas affect the differences in study results. In each of the PRA studies reviewed, the general descriptions of analytical approaches and descriptions of the analyses of event tree, fault tree and human interaction analyses that affected the dominant core damage sequences were reviewed. When these descriptions aroused interest because of seeming inconsistencies within the study or with other studies, they were pursued in some depth. The approaches or assumptions were contrasted to similar elements from other studies, and sensitivity analyses were performed in many cases to test the significance of results to the analytical models or assumptions. Inferences were drawn from the results regarding significance of the item to plant-specific results and, where possible, were generalized to other PRAs. This paper describes the results of the review of system dependencies and human interactions

  20. RAVEN: a GUI and an Artificial Intelligence Engine in a Dynamic PRA Framework

    Energy Technology Data Exchange (ETDEWEB)

    C. Rabiti; D. Mandelli; A. Alfonsi; J. Cogliati; R. Kinoshita; D. Gaston; R. Martineau; C. Curtis

    2013-06-01

    Increases in computational power and pressure for more accurate simulations and estimations of accident scenario consequences are driving the need for Dynamic Probabilistic Risk Assessment (PRA) [1] of very complex models. While more sophisticated algorithms and computational power address the back end of this challenge, the front end is still handled by engineers that need to extract meaningful information from the large amount of data and build these complex models. Compounding this problem is the difficulty in knowledge transfer and retention, and the increasing speed of software development. The above-described issues would have negatively impacted deployment of the new high fidelity plant simulator RELAP-7 (Reactor Excursion and Leak Analysis Program) at Idaho National Laboratory. Therefore, RAVEN that was initially focused to be the plant controller for RELAP-7 will help mitigate future RELAP-7 software engineering risks. In order to accomplish this task, Reactor Analysis and Virtual Control Environment (RAVEN) has been designed to provide an easy to use Graphical User Interface (GUI) for building plant models and to leverage artificial intelligence algorithms in order to reduce computational time, improve results, and help the user to identify the behavioral pattern of the Nuclear Power Plants (NPPs). In this paper we will present the GUI implementation and its current capability status. We will also introduce the support vector machine algorithms and show our evaluation of their potentiality in increasing the accuracy and reducing the computational costs of PRA analysis. In this evaluation we will refer to preliminary studies performed under the Risk Informed Safety Margins Characterization (RISMC) project of the Light Water Reactors Sustainability (LWRS) campaign [3]. RISMC simulation needs and algorithm testing are currently used as a guidance to prioritize RAVEN developments relevant to PRA.

  1. Effect of antigravity suit inflation on cardiovascular, PRA, and PVP responses in humans.

    Science.gov (United States)

    Kravik, S E; Keil, L C; Geelen, G; Wade, C E; Barnes, P R; Spaul, W A; Elder, C A; Greenleaf, J E

    1986-08-01

    Blood pressure, pulse rate (PR), serum osmolality and electrolytes, as well as plasma vasopressin (PVP) and plasma renin activity (PRA), were measured in five men and two women [mean age 38.6 +/- 3.9 (SE) yr] before, during, and after inflation of an antigravity suit that covered the legs and abdomen. After 24 h of fluid deprivation the subjects stood quietly for 3 h: the 1st h without inflation, the 2nd with inflation to 60 Torr, and the 3rd without inflation. A similar control noninflation experiment was conducted 10 mo after the inflation experiment using five of the seven subjects except that the suit was not inflated during the 3-h period. Mean arterial pressure increased by 14 +/- 4 (SE) Torr (P less than 0.05) with inflation and decreased by 15 +/- 5 Torr (P less than 0.05) after deflation. Pulse pressure (PP) increased by 7 +/- 2 Torr (P less than 0.05) with inflation and PR decreased by 11 +/- 5 beats/min (P less than 0.05); PP and PR returned to preinflation levels after deflation. Plasma volume decreased by 6.1 +/- 1.5% and 5.3 +/- 1.6% (P less than 0.05) during hours 1 and 3, respectively, and returned to base line during inflation. Inflation decreased PVP from 6.8 +/- 1.1 to 5.6 +/- 1.4 pg/ml (P less than 0.05) and abolished the significant rise in PRA during hour 1. Both PVP and PRA increased significantly after deflation: delta = 18.0 +/- 5.1 pg/ml and 4.34 +/- 1.71 ng angiotensin I X ml-1 X h-1, respectively. Serum osmolality and Na+ and K+ concentrations were unchanged during the 3 h of standing.(ABSTRACT TRUNCATED AT 250 WORDS)

  2. Review of KSNP LPSD PSA model based of ANS LPSD PRA standard, rev.0

    International Nuclear Information System (INIS)

    Jang, S. C.; Park, J. H.; Kim, T. W.; Lim, H. G.; Yang, J. E.; Ha, J. J.

    2004-02-01

    Recently, under the de-regulation environment, nuclear industry has attempted various approaches to improve the economics of Nuclear Power Plants (NPP). One of these efforts is the Risk Informed/Performance-based Operation (RIPBO). This approach uses the risk and performance information to manage the resources effectively and efficiently that are used in the operation of NPP. In RIPBO, PSA quality is one of the most important things. The nuclear industry and regulatory body of U.S.A have developed a measure to evaluate the quality of PSA. NEI (Nuclear Energy Institute) has developed a guidance called 'NEI PRA Peer Review Guidance,' and NRC (Nuclear Regulatory Committee) and ASME have developed the 'PRA Standard.' In Korea, several projects are on going now, such as the extension of AOT/STI of RPS/ESFAS, Risk-informed In-service Inspection (RI-ISI). However, in Korea, there have been no attempts to evaluate the quality of PSA model itself. Therefore, we cannot be sure about the quality of PSA whether or not the present PSA model can be used for the risk-informed applications such as mentioned above. We can say that the evaluation of PSA model quality is the basis for the RIPBO. In this report, we have evaluated the quality of PSA model at Low power and Shutdown operation model for Yongkwang 5 and 6 units based on the ANS LPSD PRA Standard. We, also, have derived what items are to be improved to upgrade the quality of LPSD PSA model and how it can be improved. This report can be used as the base of RIPBO work in Korea

  3. EPRI/NRC-RES fire PRA guide for nuclear power facilities. Volume 1, summary and overview

    International Nuclear Information System (INIS)

    2004-01-01

    This report documents state-of-the-art methods, tools, and data for the conduct of a fire Probabilistic Risk Assessment (PRA) for a commercial nuclear power plant (NPP) application. The methods have been developed under the Fire Risk Re-quantification Study. This study was conducted as a joint activity between EPRI and the U. S. NRC Office of Nuclear Regulatory Research (RES) under the terms of an EPRI/RES Memorandum of Understanding (RS.1) and an accompanying Fire Research Addendum (RS.2). Industry participants supported demonstration analyses and provided peer review of this methodology. The documented methods are intended to support future applications of Fire PRA, including risk-informed regulatory applications. The documented method reflects state-of-the-art fire risk analysis approaches. The primary objective of the Fire Risk Study was to consolidate recent research and development activities into a single state-of-the-art fire PRA analysis methodology. Methodological issues raised in past fire risk analyses, including the Individual Plant Examination of External Events (IPEEE) fire analyses, have been addressed to the extent allowed by the current state-of-the-art and the overall project scope. Methodological debates were resolved through a consensus process between experts representing both EPRI and RES. The consensus process included a provision whereby each major party (EPRI and RES) could maintain differing technical positions if consensus could not be reached. No cases were encountered where this provision was invoked. While the primary objective of the project was to consolidate existing state-of-the-art methods, in many areas, the newly documented methods represent a significant advancement over previously documented methods. In several areas, this project has, in fact, developed new methods and approaches. Such advances typically relate to areas of past methodological debate.

  4. Use of probabilistic risk assessment (PRA) in expert systems to advise nuclear plant operators and managers

    International Nuclear Information System (INIS)

    Uhrig, R.E.

    1988-01-01

    The use of expert systems in nuclear power plants to provide advice to managers, supervisors and/or operators is a concept that is rapidly gaining acceptance. Generally, expert systems rely on the expertise of human experts or knowledge that has been modified in publications, books, or regulations to provide advice under a wide variety of conditions. In this work, a probabilistic risk assessment (PRA) 3 of a nuclear power plant performed previously is used to assess the safety status of nuclear power plants and to make recommendations to the plant personnel. 5 refs., 1 fig., 2 tabs

  5. Application of the NUREG/CR-6850 EPRI/NRC Fire PRA Methodology to a DOE Facility

    International Nuclear Information System (INIS)

    Elicson, Tom; Harwood, Bentley; Yorg, Richard; Lucek, Heather; Bouchard, Jim; Jukkola, Ray; Phan, Duan

    2011-01-01

    The application NUREG/CR-6850 EPRI/NRC fire PRA methodology to DOE facility presented several challenges. This paper documents the process and discusses several insights gained during development of the fire PRA. A brief review of the tasks performed is provided with particular focus on the following: Tasks 5 and 14: Fire-induced risk model and fire risk quantification. A key lesson learned was to begin model development and quantification as early as possible in the project using screening values and simplified modeling if necessary. Tasks 3 and 9: Fire PRA cable selection and detailed circuit failure analysis. In retrospect, it would have been beneficial to perform the model development and quantification in 2 phases with detailed circuit analysis applied during phase 2. This would have allowed for development of a robust model and quantification earlier in the project and would have provided insights into where to focus the detailed circuit analysis efforts. Tasks 8 and 11: Scoping fire modeling and detailed fire modeling. More focus should be placed on detailed fire modeling and less focus on scoping fire modeling. This was the approach taken for the fire PRA. Task 14: Fire risk quantification. Typically, multiple safe shutdown (SSD) components fail during a given fire scenario. Therefore dependent failure analysis is critical to obtaining a meaningful fire risk quantification. Dependent failure analysis for the fire PRA presented several challenges which will be discussed in the full paper.

  6. Calculation of Fire Severity Factors and Fire Non-Suppression Probabilities For A DOE Facility Fire PRA

    International Nuclear Information System (INIS)

    Elicson, Tom; Harwood, Bentley; Lucek, Heather; Bouchard, Jim

    2011-01-01

    Over a 12 month period, a fire PRA was developed for a DOE facility using the NUREG/CR-6850 EPRI/NRC fire PRA methodology. The fire PRA modeling included calculation of fire severity factors (SFs) and fire non-suppression probabilities (PNS) for each safe shutdown (SSD) component considered in the fire PRA model. The SFs were developed by performing detailed fire modeling through a combination of CFAST fire zone model calculations and Latin Hypercube Sampling (LHS). Component damage times and automatic fire suppression system actuation times calculated in the CFAST LHS analyses were then input to a time-dependent model of fire non-suppression probability. The fire non-suppression probability model is based on the modeling approach outlined in NUREG/CR-6850 and is supplemented with plant specific data. This paper presents the methodology used in the DOE facility fire PRA for modeling fire-induced SSD component failures and includes discussions of modeling techniques for: Development of time-dependent fire heat release rate profiles (required as input to CFAST), Calculation of fire severity factors based on CFAST detailed fire modeling, and Calculation of fire non-suppression probabilities.

  7. Application of determination of PRA, Ang II and IGF-1 levels in the study of typing of essential hypertension

    International Nuclear Information System (INIS)

    Lu Yongyi; Chen Qun; Yang Yongqing

    2010-01-01

    Objective: To study the clinical application of determination of plasma renin activity (PRA), Angiotensin II (Ang II ) and insulin-like growth factor-1 (IGF-1) levels in typing of essential hypertension (EH). Methods: Determined the levels of PRA and Aug II in 256 patients with EH and 70 healthy volunteers (as control group) by radioimmunoassay, and measured IGF-1 level by enzyme immunoassay. Research on the typing of EH and the difference between the groups. Results: The PRA and Ang II in control group was (0.432±0.236) μg·L -1 ·h -1 and (31.7±7.4) μg/L respectively. In 256 patients with EH, PRA was increased, normal and decreased in 18.0%, 71.8% and 10.2% respectively, while the level of Ang II was increased, normal and decreased in 12.9%, 76.2% and 10.9% respectively. The IGF-1 levels in 256 patients with EH were increased following the increase of blood pressure. Conclusion: Typing of EH patients with PRA and Ang II as well as the determination of IGF-1 were useful in treating and following up the patients with EH. (authors)

  8. Results of the Level 1 probabilistic risk assessment (PRA) of internal events for heavy water production reactors

    International Nuclear Information System (INIS)

    Tinnes, S.P.; Cramer, D.S.; Logan, V.E.; Topp, S.V.; Smith, J.A.; Brandyberry, M.D.

    1990-01-01

    A full-scope probabilistic risk assessment (PRA) is being performed for the Savannah River site (SRS) production reactors. The Level 1 PRA for the K Reactor has been completed and includes the assessment of reactor systems response to accidents and estimates of the severe core melt frequency (SCMF). The internal events spectrum includes those events related directly to plant systems and safety functions for which transients or failures may initiate an accident. The SRS PRA has three principal objectives: improved understanding of SRS reactor safety issues through discovery and understanding of the mechanisms involved. Improved risk management capability through tools for assessing the safety impact of both current standard operations and proposed revisions. A quantitative measure of the risks posed by SRS reactor operation to employees and the general public, to allow comparison with declared goals and other societal risks

  9. Technical requirements for the ASME PRA standard for nuclear power plant applications

    International Nuclear Information System (INIS)

    Fleming, Karl N.; Bernsen, Sidney A.; Simard, Ronald L.

    2000-01-01

    In 1998 the American Society of Mechanical Engineers (ASME) formed the Committee on Nuclear Risk Management (CNRM) and a Project Team to develop a standard on PRAs for use in risk informed applications. This ASME standard is being developed to help provide an adequate level of quality in PRAs that are being used to support ASME initiatives to risk informed in-service inspection (ISI) and in-service testing (IST) of nuclear power plant components. A related need supported by the industry and the U.S. Nuclear Regulatory Commission is to reduce the level of effort that is being expended in pilot applications of risk informed initiatives to address questions about the sufficiency of quality in the supporting PRA models. The purpose of this paper is to discuss the authors' views on some of the technical issues that were encountered in the effort to develop the ASME PRA standard. Draft 12 of this standard has been issued for comment, and is currently being finalized with the aim of releasing the standard in early 2001. (author)

  10. Human factors assessment in PRA using task analysis linked evaluation technique (TALENT)

    International Nuclear Information System (INIS)

    Wells, J.E.; Banks, W.W.

    1990-01-01

    Human error is a primary contributor to risk in complex high-reliability systems. A 1985 U.S. Nuclear Regulatory Commission (USNRC) study of licensee event reports (LERs) suggests that upwards of 65% of commercial nuclear system failures involve human error. Since then, the USNRC has initiated research to fully and properly integrate human errors into the probabilistic risk assessment (PRA) process. The resulting implementation procedure is known as the Task Analysis Linked Evaluation Technique (TALENT). As indicated, TALENT is a broad-based method for integrating human factors expertise into the PRA process. This process achieves results which: (1) provide more realistic estimates of the impact of human performance on nuclear power safety, (2) can be fully audited, (3) provide a firm technical base for equipment-centered and personnel-centered retrofit/redesign of plants enabling them to meet internally and externally imposed safety standards, and (4) yield human and hardware data capable of supporting inquiries into human performance issues that transcend the individual plant. The TALENT procedure is being field-tested to verify its effectiveness and utility. The objectives of the field-test are to examine (1) the operability of the process, (2) its acceptability to the users, and (3) its usefulness for achieving measurable improvements in the credibility of the analysis. The field-test will provide the information needed to enhance the TALENT process

  11. Human reliability analysis in support of a level 1 PRA for Surry during midloop operations

    International Nuclear Information System (INIS)

    Lin, J.C.; Bley, D.C.; Chu, T.-L.

    2004-01-01

    The objectives of this Level 1 probabilistic risk assessment (PRA) are to evaluate the important accident sequences initiated during midloop operations and to compare the qualitative and quantitative results with those for accidents initiated during power operations. The primary types of human actions analyzed in this study involve the dynamic operator actions and recovery actions that take place during the accident sequence following an initiating event. Two parts of the human actions were analyzed: failure to diagnose and failure to perform the action. The scope of the Level 1 PRA for Surry during midloop operations includes internal, fire, and flood initiating events. The major categories of dynamic operator actions taken during the accident sequence following an initiating event are: providing makeup to the reactor coolant system (RCS), restoring residual heat removal (RHR) cooling, establishing steam generator reflux cooling, establishing primary feed and spill, establishing gravity feed from refueling water storage tank (RWST), establishing high pressure recirculation, establishing recirculation spray, and cross-connecting RWSTs. All categories are not applicable to all initiating events and all plant operating states (POS). (author)

  12. Development of extreme rainfall PRA methodology for sodium-cooled fast reactor

    International Nuclear Information System (INIS)

    Nishino, Hiroyuki; Kurisaka, Kenichi; Yamano, Hidemasa

    2016-01-01

    The objective of this study is to develop a probabilistic risk assessment (PRA) methodology for extreme rainfall with focusing on decay heat removal system of a sodium-cooled fast reactor. For the extreme rainfall, annual excess probability depending on the hazard intensity was statistically estimated based on meteorological data. To identify core damage sequence, event trees were developed by assuming scenarios that structures, systems and components (SSCs) important to safety are flooded with rainwater coming into the buildings through gaps in the doors and the SSCs fail when the level of rainwater on the ground or on the roof of the building becomes higher than thresholds of doors on first floor or on the roof during the rainfall. To estimate the failure probability of the SSCs, the level of water rise was estimated by comparing the difference between precipitation and drainage capacity. By combining annual excess probability and the failure probability of SSCs, the event trees led to quantification of core damage frequency, and therefore the PRA methodology for rainfall was developed. (author)

  13. Review of UCN 5,6 Fire PSA Model based on ANS Fire PRA Standard

    International Nuclear Information System (INIS)

    Yang, Joon Eon; Lee, Yoon Hwan

    2006-12-01

    Recently, under the de-regulation environment, nuclear industry has attempted various approaches to improve the economics of Nuclear Power Plants (NPP). This approach uses the fire risk and performance information to manage the resources effectively and efficiently that are used in the operation of NPP. In fire risk informed/performance-based decision/operation, fire PSA quality is one of the most important things. The nuclear industry and regulatory body of U.S.A have developed a measure to evaluate the quality of fire PSA. ANS (American Nuclear Society) has developed a guidance called 'ANS Fire PRA Methodology Standard'. However, in Korea, there have been no attempts to evaluate the quality of fire PSA model itself. Therefore, we cannot be sure about the quality of fire PSA whether or not the present fire PSA model can be used for the risk-informed applications such as mentioned above. We can say that the evaluation of fire PSA model quality is the basis for the fire risk informed/performance-based decision/operation. In this report, we have evaluated the quality of fire PSA model for Ulchin 5 and 6 units based on the ANS Fire PRA Standard. We, also, have derived what items are to be improved to upgrade the quality of fire PSA model and how it can be improved. This report can be used as the base of the fire risk informed/performance-based decision/operation work in Korea

  14. Medical Updates Number 5 to the International Space Station Probability Risk Assessment (PRA) Model Using the Integrated Medical Model

    Science.gov (United States)

    Butler, Doug; Bauman, David; Johnson-Throop, Kathy

    2011-01-01

    The Integrated Medical Model (IMM) Project has been developing a probabilistic risk assessment tool, the IMM, to help evaluate in-flight crew health needs and impacts to the mission due to medical events. This package is a follow-up to a data package provided in June 2009. The IMM currently represents 83 medical conditions and associated ISS resources required to mitigate medical events. IMM end state forecasts relevant to the ISS PRA model include evacuation (EVAC) and loss of crew life (LOCL). The current version of the IMM provides the basis for the operational version of IMM expected in the January 2011 timeframe. The objectives of this data package are: 1. To provide a preliminary understanding of medical risk data used to update the ISS PRA Model. The IMM has had limited validation and an initial characterization of maturity has been completed using NASA STD 7009 Standard for Models and Simulation. The IMM has been internally validated by IMM personnel but has not been validated by an independent body external to the IMM Project. 2. To support a continued dialogue between the ISS PRA and IMM teams. To ensure accurate data interpretation, and that IMM output format and content meets the needs of the ISS Risk Management Office and ISS PRA Model, periodic discussions are anticipated between the risk teams. 3. To help assess the differences between the current ISS PRA and IMM medical risk forecasts of EVAC and LOCL. Follow-on activities are anticipated based on the differences between the current ISS PRA medical risk data and the latest medical risk data produced by IMM.

  15. Giving Student Groups a Stronger Voice: Using Participatory Research and Action (PRA) to Initiate Change to a Curriculum

    Science.gov (United States)

    O'Neill, Geraldine; McMahon, Sinead

    2012-01-01

    Traditional student feedback mechanisms have been criticised for being teacher-centred in design and, in particular, for their absence of transparent follow-up actions. In contrast, this study describes the process and the evaluation of a participatory research and action (PRA) approach used in an undergraduate physiotherapy degree. This approach…

  16. Loss of coolant accident (LOCA) analysis for McMaster Nuclear Reactor through probabilistic risk assessment (PRA)

    Energy Technology Data Exchange (ETDEWEB)

    Ha, T.; Garland, W.J. [McMaster Univ., Dept. of Engineering Physics, Hamilton, Ontario (Canada)]. E-mail: hats@mcmaster.ca

    2006-07-01

    A probabilistic risk assessment (PRA) was conducted for the loss of coolant accident (LOCA) sequence in the McMaster Nuclear Reactor (MNR). A level 1 PRA was completed including event sequence modeling, system modeling, and quantification. To support the quantification of the accident sequence identified, data analysis using the Bayesian method and human reliability analysis (HRA) using the ASEP approach were performed. Since human performance in research reactors is significantly different from that in power reactors, a different time-oriented HRA model was proposed and applied for the estimation of the human error probability (HEP) of core relocation. This HEP estimate was less than that by the ASEP approach by a factor of about 2. These two HEP estimates were used for sensitivity analysis, and modeling uncertainty in the PRA models was quantified. This showed the necessity of appropriate human reliability models in PRA for research reactors. This method could be implemented for the operators' actions which require extensive manual execution with little cognitive load, as might be the case for some maintenance operations in power reactors. (author)

  17. "VEM PRA RUA": THE POLITICAL AND THE POLITICS ON THE WEB

    Directory of Open Access Journals (Sweden)

    Benedito Fernando Pereira

    2014-12-01

    Full Text Available Considering the political and the social division of senses, this paper seeks to check how is the process of signification in a society increasingly challenged by electronic discourse and the ways in which political and policy find themselves affected by it. In order do that, we make the analysis of discursive statements “vem pra rua” and “somos a rede social” that were present in banners and posters in street protests in Brazil in 2013, which were organized and delivered, in large part, by virtual means. We observed that such utterances go through a process of appropriation and re-signification, with shifting meanings that run of market logic, go to the social politics and go back to the market logic. We had also observed how the urban environment is affected by the electronic discourse that now constitutes the ways it makes sense.

  18. Elastin and Mechanics of Pig Pericardial Resistance Arteries (pPRA)

    DEFF Research Database (Denmark)

    Bloksgaard, Maria; Leurgans, Thomas; Rosenstand, Kristoffer

    Resistance arteries are remodeled in hypertension and diabetes. Elastin was reported to play a role herein. The parietal pericardium is opened during cardio-thoracic surgeries and might be a valuable biopsy for research in cardio-vascular diseases. We tested the hypothesis that resistance arteries...... can be isolated from the pericardium to study the micro-architecture of elastin and vascular wall mechanics. The pericardium of pigs served to test the hypothesis. pPRAs were microdissected. Their structure was examined using multiphoton excitation fluorescence microscopy. Diameter......-tension and pressure-diameter-length relationships were recorded in myographs. Findings are compared to rodent mesenteric resistance arteries and –basilar arteries (rMRA, rBA) with comparable lumen diameter (±300µm at 100mmHg). pPRA have no clear external elastic lamina (present in rMRA, but not rBA), scant elastin...

  19. Validation needs of seismic probabilistic risk assessment (PRA) methods applied to nuclear power plants

    International Nuclear Information System (INIS)

    Kot, C.A.; Srinivasan, M.G.; Hsieh, B.J.

    1985-01-01

    An effort to validate seismic PRA methods is in progress. The work concentrates on the validation of plant response and fragility estimates through the use of test data and information from actual earthquake experience. Validation needs have been identified in the areas of soil-structure interaction, structural response and capacity, and equipment fragility. Of particular concern is the adequacy of linear methodology to predict nonlinear behavior. While many questions can be resolved through the judicious use of dynamic test data, other aspects can only be validated by means of input and response measurements during actual earthquakes. A number of past, ongoing, and planned testing programs which can provide useful validation data have been identified, and validation approaches for specific problems are being formulated

  20. Role of seismic PRA in seismic safety decisions of nuclear power plants

    International Nuclear Information System (INIS)

    Ravindra, M.K.; Kennedy, R.P.; Sues, R.H.

    1985-01-01

    This paper highlights the important roles that seismic probabilistic risk assessments (PRAs) can play in the seismic safety decisions of nuclear power plants. If a seismic PRA has been performed for a plant, its results can be utilized to evaluate the seismic capability beyond the safe shutdown event (SSE). Seismic fragilities of key structures and equipment, fragilities of dominant plant damage states and the frequencies of occurrence of these plant damage states are reviewed to establish the seismic safety of the plant beyond the SSE level. Guidelines for seismic margin reviews and upgrading may be developed by first identifying the generic classes of structures and equipment that have been shown to be dominant risk contributors in the completed seismic PRAs, studying the underlying causes for their contribution and examining why certain other items (e.g., piping) have not proved to be high-risk-contributors

  1. Application of RIA of PRA, AT II and NPY in typing and therapy of EH patients

    International Nuclear Information System (INIS)

    Yang Yongqing; Wang Xiaozhou; Jiang Qinian

    2001-01-01

    Objective: To study the typing and AT II receptor inhibitor therapy for essential hypertension (EH) patients. Methods: Plasma RA, AT II and NPY levels were measured by radioimmunoassay (RIA) in 208 Patients with EH and 100 controls; plasma NPY levels were measured in 40 EH patients before and after AT II receptor inhibitor therapy. The mean coefficient of variation for intra and inter batch-assay were less than 10% and 15% respectively. Results: In 208 EH patients plasma PRA levels were increased, normal and decreased in 17.8%, 71.6% and 10.6% respectively, while in 128 EH patients Plasma AT II levels were increased, normal and decreased in 20.3%, 64.1% and 15.6% respectively. In 69 EH Plasma NPY levels were significantly higher than those in 40 control subjects. (17 grade I EH, 137.3 +- 32.6 pg/mL; 28 grade II EH, 148.5 +- 41.1 pg/mL; 24 grade III EH, 162.4 +- 42.7 pg/mL; 40 controls, 118.5 +- 30.5 pg/mL). In 40 EH patients plasma NPY levels were decreased after AT II receptor inhibitor therapy as the blood pressure decreased. Conclusion: Typing of EH patients according to levels of plasma PRA and AT II is useful in guiding treatment. AT II receptor inhibitors are indicated in those patients with increased plasma levels and NPY levels can be used for appraisal of the treatment efficacy

  2. Use of PRA techniques to optimize the design of the IRIS nuclear power plant

    International Nuclear Information System (INIS)

    Muhlheim, M.D.; Cletcher, J.W. II

    2003-01-01

    True design optimization of a plants inherent safety and performance characteristics results when a probabilistic risk assessment (PRA) is integrated with the plant-level design process. This is the approach being used throughout the design of the International Reactor Innovative and Secure (IRIS) nuclear power plant to maximize safety. A risk-based design optimization tool employing a 'one-button' architecture is being developed by the Oak Ridge National Laboratory to evaluate design changes; new modeling approaches, methods, or theories modeling uncertainties and completeness; physical assumptions; and data changes on component, cabinet, train, and system bases. Unlike current PRAs, the one-button architecture allows components, modules, and data to be interchanged at will with the probabilistic effect immediately apparent. Because all of the current and previous design, and data sets are available via the one-button architecture, the safety ramifications of design options are evaluated, feedback on design alternatives is immediate, and true optimization and understanding can be achieved. Thus, for the first time, PRA analysts and designers can easily determine the probabilistic implications of different design configurations and operating conditions in various combinations for the entire range of initiating events. The power of the one-button architecture becomes evident by the number of design alternatives that can be evaluated C11 component choices yielded 160 design alternatives. Surprisingly, the lessons learned can be counter-intuitive and significant. For example, one of the alternative designs for IRIS evaluated via this architecture revealed that because of common-cause failure probabilities, using the most reliable components actually decreased systems' reliability. (author)

  3. Evaluation of safety issues on newly regulated nuclear power plant by tsunami-level 1 PRA

    International Nuclear Information System (INIS)

    Tsuji, Yutaro; Miwa, Shuichiro; Mori, Michitsugu

    2014-01-01

    The tsunami caused by the Great East Japan Earthquake triggered severe accidents involving the units 1 to 4 at the Fukushima Dai-ichi nuclear power station (NPS). In order to re-operate existing nuclear power plants it should be necessary to reduce the core damage frequency on risk by tsunami. In this work, effects of the off-site power supply installation on resuming operation of nuclear power plants were investigated by utilizing the Tsunami-Level 1 Probability Risk Assessment (PRA). Unit 2 of the Onagawa nuclear power station, which resembled units 2 and 3 of Fukushima Dai-ichi, was selected for PRA. First, event-tree was created for the units of the Onagawa nuclear power station with the safety systems such as Emergency Core Cooling System (ECCS), investigating the plant situation at the time of the earthquake and tsunami occurrences. It was assumed that the magnitude of the tsunami was equivalent to the Great East Japan Earthquake. The accident-analytical progression-time was 36 hours, determined from the core-damage occurrence of the unit 3 of Fukushima Dai-ichi nuclear power station. Failure probabilities were calculated by the fault tree, which was created from the elements listed in the event tree. For the calculation, failure rates reported by the NUCIA (NUClear Information Archives) were primarily utilized. Then, obtained failure probabilities were embedded to the event tree. Core damage probabilities were evaluated by calculating success and failure rates for each accidental progression and scenarios. Restoration of the failed equipment and machineries was not considered in the analysis. Installation of the power supply vehicles at the nuclear power plant site reduced the core damage probability from 2.58×10 -6 to 8.56×10 -7 . However, continued addition of the power supply vehicles could not lower the core damage probability further more. In the case of Unit 2 of Onagawa nuclear power station, there could be a limit to lower the core damage

  4. Examination of Conservatism in Early/Latent Fatality Estimation in Level 3 PRA

    International Nuclear Information System (INIS)

    Kim, Sung-yeop; Lee, Haneol; Yim, Man-Sung

    2014-01-01

    Due to the computational model driven-nature of the work, there exist various sources of uncertainty in level 3 PRA. They are related with source release, environmental transport and deposition, human behavior involved in dosimetry, health effect and risk assessment. For instance, a total of 376 parameters have been considered in Probabilistic Accident Consequence Uncertainty Assessment Using COSYMA and the details on the number of parameters in each analysis are listed in Table 1. In 2012, the report of NPP accident consequence simulation was distributed by the Korean Federation for Environmental Movement (KFEM). They insisted that Kori Nuclear Power Plant (NPP) accident would lead to 48,000 early fatalities and 850,000 cancer fatalities in Busan and Hanbit NPP accident would lead to 550,000 cancer fatalities in Seoul. This report exemplifies the misuse of collective dose, that is effective dose multiplied by population and time. Even though very low effective dose is considered, collective dose could give over-conservative estimate when high population and long time period is multiplied. International Commission on Radiological Protection (ICRP) forewarned about the misuse of collective dose, in their ICRP Publication 103, such as applying it to simplified calculation of fatality and risk. As part of investigation of conservatism in early and latent fatality estimation, the existing methods of early and latent fatality calculation was reviewed and the results from the use of the existing methodology were examined in this study. The method of early and latent fatality estimation in level 3 PRA was investigated and the conservatism in the result was examined in this study. For the purpose of estimating both early and latent fatality, appropriate dose distributions among the affected population are found to be important. This study showed that large conservatism may be involved in the estimated fatality if the distribution of population dose as a function of

  5. Examination of Conservatism in Early/Latent Fatality Estimation in Level 3 PRA

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Sung-yeop; Lee, Haneol; Yim, Man-Sung [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of)

    2014-10-15

    Due to the computational model driven-nature of the work, there exist various sources of uncertainty in level 3 PRA. They are related with source release, environmental transport and deposition, human behavior involved in dosimetry, health effect and risk assessment. For instance, a total of 376 parameters have been considered in Probabilistic Accident Consequence Uncertainty Assessment Using COSYMA and the details on the number of parameters in each analysis are listed in Table 1. In 2012, the report of NPP accident consequence simulation was distributed by the Korean Federation for Environmental Movement (KFEM). They insisted that Kori Nuclear Power Plant (NPP) accident would lead to 48,000 early fatalities and 850,000 cancer fatalities in Busan and Hanbit NPP accident would lead to 550,000 cancer fatalities in Seoul. This report exemplifies the misuse of collective dose, that is effective dose multiplied by population and time. Even though very low effective dose is considered, collective dose could give over-conservative estimate when high population and long time period is multiplied. International Commission on Radiological Protection (ICRP) forewarned about the misuse of collective dose, in their ICRP Publication 103, such as applying it to simplified calculation of fatality and risk. As part of investigation of conservatism in early and latent fatality estimation, the existing methods of early and latent fatality calculation was reviewed and the results from the use of the existing methodology were examined in this study. The method of early and latent fatality estimation in level 3 PRA was investigated and the conservatism in the result was examined in this study. For the purpose of estimating both early and latent fatality, appropriate dose distributions among the affected population are found to be important. This study showed that large conservatism may be involved in the estimated fatality if the distribution of population dose as a function of

  6. Comparison of SKIFS 2004:1 and Tillsynshandbok PSA against the ASME PRA Standard and European requirements on PSA

    International Nuclear Information System (INIS)

    Hellstroem, Per

    2005-04-01

    Requirements on PSA for risk informed applications are expressed in different international documents. The ASME PRA standard published in spring 2002 is one such document, PSA requirements are also expressed in the European Utility Requirements (EUR) for new reactors. The Swedish PSA requirements are provided in the Swedish regulators (SKI) statutes SKIFS 2004:1. SKI also has a review handbook for PSA activities (SKI report 2003:48). The review handbook is a support during review of the utilities PSA activities and the PSAs themselves. The review handbook expresses SKIs expectations by providing so called important aspects for both the PSA work and the PSAs, A comparison of SKIFS requirements and the important aspects in the Review handbook, on one side, and the requirements on PSA in EUR and ASME on the other side, is presented. The comparison shows a large difference in the level of detail in the different documents, where ASME is most detailed and specific. This is expected since the SKI review handbook not is a 'PSA guide' in the same way as the ASME PRA standard. A direct comparison of the ASME PRA standard requirements with the important aspects in the review handbook cannot answer the question which ASME capacity level that is achieved by a PSA meeting all important aspects. The conclusion is that it is not likely to achieve capacity level 2 and 3, since very few ASME level 3 attributes are explicitly expressed as important aspects, though many are expressed in general terms. The review handbook important aspects that are most similar to the ASME capacity level 1 attributes are initiating events, sequence analysis, and system analysis while less similarity is found for analysis of operator actions data analysis, quantification and containment analysis (level 2). Less similarity is found for capacity level 2 and 3. However, the number of additional ASME attributes on capacity level 2 and 3 are few. There are also important aspects in the review handbook that

  7. Results and insights of a level-1 internal event PRA of a PWR during mid-loop operations

    International Nuclear Information System (INIS)

    Chu, T.L.; Musicki, Z.; Kohut, P.

    1993-01-01

    Traditionally, probabilistic risk assessments (PRA) of severe accidents in nuclear power plants have considered initiating events potentially occurring only during full power operation. Some previous screening analysis that were performed for other modes of operation suggested that risks during those modes were small relative to full power operation. However, more recent studies and operational experience have implied that accidents during low power and shutdown could be significant contributors to risk. The objective of this paper is to present the approach utilized in the level-1 PRA for the Surry plant, and discuss the results obtained. A comparison of the results with those of other shutdown studies is provided. Relevant safety issues such as plant and hardware configurations, operator training, and instrumentation and control is discussed

  8. Analysis of climate and anthropogenic impacts on runoff in the Lower Pra River Basin of Ghana.

    Science.gov (United States)

    Awotwi, Alfred; Anornu, Geophrey Kwame; Quaye-Ballard, Jonathan; Annor, Thompson; Forkuo, Eric Kwabena

    2017-12-01

    The Lower Pra River Basin (LPRB), located in the forest zone of southern Ghana has experienced changes due to variability in precipitation and diverse anthropogenic activities. Therefore, to maintain the functions of the ecosystem for water resources management, planning and sustainable development, it is important to differentiate the impacts of precipitation variability and anthropogenic activities on stream flow changes. We investigated the variability in runoff and quantified the contributions of precipitation and anthropogenic activities on runoff at the LPRB. Analysis of the precipitation-runoff for the period 1970-2010 revealed breakpoints in 1986, 2000, 2004 and 2010 in the LPRB. The periods influenced by anthropogenic activities were categorized into three periods 1987-2000, 2001-2004 and 2005-2010, revealing a decrease in runoff during 1987-2000 and an increase in runoff during 2001-2004 and 2005-2010. Assessment of monthly, seasonal and annual runoff depicted a significant increasing trend in the runoff time series during the dry season. Generally, runoff increased at a rate of 9.98 × 10 7 m 3 yr -1 , with precipitation variability and human activities contributing 17.4% and 82.3% respectively. The dominant small scale alluvial gold mining activity significantly contributes to the net runoff variability in LPRB.

  9. Application of FIVE methodology in probabilistic risk assessment (PRA) of fire events

    International Nuclear Information System (INIS)

    Lopez Garcia, F.J.; Suarez Alonso, J.; Fiolamengual, M.J.

    1993-01-01

    This paper reflects the experience acquired during the process of evaluation and updating of the fire analysis within the Cofrentes NPP PRA. It determines which points are the least precise, either because of their greater uncertainty or because of their excessive conservatism, as well as the subtasks which have involved a larger work load and could be simplified. These aspects are compared with the steps followed in methodology FIVE (Fire Vulnerability Evaluation Methodology) to assess whether application of this methodology would optimize the task, by making it more systematic and realistic and reducing uncertainties. On the one hand, the FIVE methodology does not have the scope sufficient to carry out a quantitative risk evaluation, but it can easily be complemented -without detriment to its systematic nature- by quantifying core damage in significant areas. On the other hand, certain issues such as definition of the fire growth software program which has to be used, are still not fully closed. Nevertheless, the conclusions derived from this assessment are satisfactory, since it is considered that this methodology would serve to unify the criteria and data of the analysis of fire-induced risks, providing a progressive screening method which would considerably simplify the task. (author)

  10. Value impact analysis utilizing PRA techniques combined with a hybrid plant model

    International Nuclear Information System (INIS)

    Edson, J.L.; Stillwell, D.W.

    1989-01-01

    A value impact analysis (VIA) has been performed by the INEL to support a NRC Regulatory Analysis for resolution of Generic Issue (GI) 29, Bolting Degradation or Failure in Nuclear Power Plants. A VIA for replacing the reactor coolant pressure boundary (RCPB) bolts of BWRs and PWRs was previously prepared by Pacific Northwest Laboratories in 1985 under instructions limiting the VIA to the potential for failure of primary pressure boundary bolting. Subsequently the INEL was requested to perform a VIA that included non primary systems and component support bolts to be compatible with the resolution of the broader issue. Because the initial list of systems and bolting applications that could be included in the VIA was very large, including them all in the VIA would likely result in analyzing some that have little if any effect on public risk. This paper discusses how PRA techniques combined with a hybrid plant model were used to determine which bolts have the potential to be significant contributors to public risk if they were to fail, and therefore were included in the VIA

  11. Perfluoroalkyl acids (PFAAs) in the Pra and Kakum River basins and associated tap water in Ghana.

    Science.gov (United States)

    Essumang, David K; Eshun, Albert; Hogarh, Jonathan N; Bentum, John K; Adjei, Joseph K; Negishi, Junya; Nakamichi, Shihori; Habibullah-Al-Mamun, Md; Masunaga, Shigeki

    2017-02-01

    Perfluoroalkyl acids (PFAAs) are persistent environmental pollutants that have been detected in various media including human serum. Due to concerns regarding their bioaccumulation and possible negative health effects, an understanding of routes of human exposure is necessary. PFAAs are recalcitrant in many water treatment processes, making drinking water a potential source of human exposure. This study presents the first report on contamination from PFAAs in river and drinking water in Ghana. The targeted PFAAs were perfluoroalkyl carboxylic acids (PFCAs) with C 4-14 carbon chain and perfluoroalkane sulphonic acids (PFSAs) with C 6, 8, 10 . Five PFAA congeners - PFOA, PFOS, PFHxA, PFDA and PFPeA - were commonly detected in river and tap water. The mean concentrations of ∑PFAAs in the Kakum and Pra Rivers were 281 and 398ng/L, while tap water (supplied from the treatment of water from those rivers) contained concentrations of 197 and 200ng/L, respectively. PFOA and PFOS constituted about 99% of the ∑PFAAs. The risk quotient (RQ) attributed to drinking of tap water was estimated at 1.01 and 1.74 for PFOA and PFOS, respectively. For a country that has not produced these compounds, the RQs were unexpectedly high, raising concerns particularly about contamination from such emerging pollutants in local water sources. The study revealed limitations of local tap water treatment in getting rid of these emerging pollutants. Copyright © 2016 Elsevier B.V. All rights reserved.

  12. PRA Procedures Guide: a guide to the performance of probabilistic risk assessments for nuclear power plants. Final report, Volume 1 - Chapters 1-8

    International Nuclear Information System (INIS)

    1983-01-01

    This document, the Probabilistic Risk Assessment (PRA) Procedures Guide, is intended to provide an overview of the risk-assessment field as it exists today and to identify acceptable techniques for the systematic assessment of the risk from nuclear power plants. Topics discussed include: organization of PRA; accident-sequence definition and system modeling; human-reliability analysis; data-base development; accident-sequence quantification; physical processes of core-melt accidents; and radionuclide release and transport

  13. Results and insights of a level-1 internal event PRA of a PWR during mid-loop operations

    International Nuclear Information System (INIS)

    Chu, T.L.; Musicki, Z.; Kohut, P.; Yang, J.; Bozoki, G.; Hsu, C.J.; Diamond, D.J.; Wong, S.M.; Holmes, B.; Su, R.F.; Dang, V.; Siu, N.; Bley, D.; Johnson, D.; Lin, J.

    1994-01-01

    Traditionally, probabilistic risk assessments (PRA) of severe accidents in nuclear power plants have considered initiating events potentially occurring only during full power operation. Some previous screening analysis that were performed for other modes of operation suggested that risks during those modes were small relative to full power operation. However, more recent studies and operational experience have implied that accidents during low power and shutdown could be significant contributors to risk. During 1989, the Nuclear Regulatory Commission (NRC) initiated an extensive program to carefully examine the potential risks during low power and shutdown operations. The program includes two parallel projects being performed by BNL and SNL. Two plants, Surry (pressurized water reactor) and Grand Gulf (boiling water reactor), were selected as the plants to be studied. The objectives of the program are to assess the risks of severe accidents initiated during plant operational states other than full power operation and to compare the estimated core damage frequencies, important accident sequences and other qualitative and quantitative results with those accidents initiated during full power operation as assessed in NUREG-1150. The scope of the program includes that of a level-3 PRA. The objective of this paper is to present the approach utilized in the level-1 PRA for the Surry plant, and discuss the results obtained. A comparison of the results with those of other shutdown studies is provided. Relevant safety issues such as plant and hardware configurations, operator training, and instrumentation and control is discussed

  14. Development of margin assessment methodology of decay heat removal function against external hazards. (2) Tornado PRA methodology

    International Nuclear Information System (INIS)

    Nishino, Hiroyuki; Kurisaka, Kenichi; Yamano, Hidemasa

    2014-01-01

    Probabilistic Risk Assessment (PRA) for external events has been recognized as an important safety assessment method after the TEPCO's Fukushima Daiichi nuclear power station accident. The PRA should be performed not only for earthquake and tsunami which are especially key events in Japan, but also the PRA methodology should be developed for the other external hazards (e.g. tornado). In this study, the methodology was developed for Sodium-cooled Fast Reactors paying attention to that the ambient air is their final heat sink for removing decay heat under accident conditions. First, tornado hazard curve was estimated by using data recorded in Japan. Second, important structures and components for decay heat removal were identified and an event tree resulting in core damage was developed in terms of wind load and missiles (i.e. steel pipes, boards and cars) caused by a tornado. Main damage cause for important structures and components is the missiles and the tornado missiles that can reach those components and structures placed on high elevations were identified, and the failure probabilities of the components and structures against the tornado missiles were calculated as a product of two probabilities: i.e., a probability for the missiles to enter the intake or outtake in the decay heat removal system, and a probability of failure caused by the missile impacts. Finally, the event tree was quantified. As a result, the core damage frequency was enough lower than 10 -10 /ry. (author)

  15. Interaction of CREDO [Centralized Reliability Data Organization] with the EBR-II [Experimental Breeder Reactor II] PRA [probabilistic risk assessment] development

    International Nuclear Information System (INIS)

    Smith, M.S.; Ragland, W.A.

    1989-01-01

    The National Academy of Sciences review of US Department of Energy (DOE) class 1 reactors recommended that the Experimental Breeder Reactor II (EBR-II), operated by Argonne National Laboratory (ANL), develop a level 1 probabilistic risk assessment (PRA) and make provisions for level 2 and level 3 PRAs based on the results of the level 1 PRA. The PRA analysis group at ANL will utilize the Centralized Reliability Data Organization (CREDO) at Oak Ridge National Laboratory to support the PRA data needs. CREDO contains many years of empirical liquid-metal reactor component data from EBR-II. CREDO is a mutual data- and cost-sharing system sponsored by DOE and the Power Reactor and Nuclear Fuels Development Corporation of Japan. CREDO is a component based data system; data are collected on components that are liquid-metal specific, associated with a liquid-metal environment, contained in systems that interface with liquid-metal environments, or are safety related for use in reliability/availability/maintainability (RAM) analyses of advanced reactors. The links between the EBR-II PRA development effort and the CREDO data collection at EBR-II extend beyond the sharing of data. The PRA provides a measure of the relative contribution to risk of the various components. This information can be used to prioritize future CREDO data collection activities at EBR-II and other sites

  16. Impact of Gold mining activities on the water quality of the lower pra river

    International Nuclear Information System (INIS)

    Dwamena, Offei Samuel K.

    2013-07-01

    This study was conducted to assess the extent of Mercury (THg) contamination at four locations within the Shama-Mporhor Wassa catchment area of the Lower Pra River. Water, fish and sediment samples were taken twice with the longitudinal transect method at Daboase, Beposo, Bokorkope and Shama during the minor rainy season in October and at the apex of the dry season in March. Careful investigation of the Shama-Mporhor Wassa catchment area revealed that two of the locations Daboase and Beposo had been continuously impacted by the activities of Artisanal Gold miners (AGM). From the study, Total Mercury (THg) levels were found to have persisted in River water several kilometers downstream the second Artisanal Gold mining (AGM) location at Shama estuary for both seasons. Ten trace elements Mercury (Hg), Selenium (Se), Copper (Cu), Chromium (Cr), Lead (Pb), Iron (Fe), Manganese (Mn), Nickel (Ni), Zinc (Zn) and Cadmium (Cd) were determined in water, fish and sediment samples using the Atomic Absorption Spectroscopy (AAS) equipped with both Hydride Generation (HGAAS) for Selenium (Se) and Cold Vapour (CVAAS) for Total Mercury (THg). The levels of Total Mercury (THg) were largely above the WHO and USEPA guidelines for drinking water (1μg/L) and sediments (200 μg/Kg) respectively for the four locations investigated. Total Mercury (THg) exceeded the WHO, 2011 guideline value of 0.5 mg/Kg for fish species Clarias submarginatus but was below the guideline value for Xenomystus nigri. Mean concentration of Cd and Fe exceeded the WHO, 2011 guideline values for drinking water for the wet season. The other trace elements Zn, Ni, Cu, Cr, Se, Mn, and Pb had their mean concentration below the WHO, 2011 guideline values for drinking water. Apart from the mean concentration of Cd that exceeded the Canadian Interim Sediment Quality (ISQG) guideline value of 0.6 mg/Kg for the wet season, Cr, Cu, Zn, Ni and Pb were below their respective guideline values for both seasons. Statistical

  17. Application of multivariate statistical technique for hydrogeochemical assessment of groundwater within the Lower Pra Basin, Ghana

    Science.gov (United States)

    Tay, C. K.; Hayford, E. K.; Hodgson, I. O. A.

    2017-06-01

    Multivariate statistical technique and hydrogeochemical approach were employed for groundwater assessment within the Lower Pra Basin. The main objective was to delineate the main processes that are responsible for the water chemistry and pollution of groundwater within the basin. Fifty-four (54) (No) boreholes were sampled in January 2012 for quality assessment. PCA using Varimax with Kaiser Normalization method of extraction for both rotated space and component matrix have been applied to the data. Results show that Spearman's correlation matrix of major ions revealed expected process-based relationships derived mainly from the geochemical processes, such as ion-exchange and silicate/aluminosilicate weathering within the aquifer. Three main principal components influence the water chemistry and pollution of groundwater within the basin. The three principal components have accounted for approximately 79% of the total variance in the hydrochemical data. Component 1 delineates the main natural processes (water-soil-rock interactions) through which groundwater within the basin acquires its chemical characteristics, Component 2 delineates the incongruent dissolution of silicate/aluminosilicates, while Component 3 delineates the prevalence of pollution principally from agricultural input as well as trace metal mobilization in groundwater within the basin. The loadings and score plots of the first two PCs show grouping pattern which indicates the strength of the mutual relation among the hydrochemical variables. In terms of proper management and development of groundwater within the basin, communities, where intense agriculture is taking place, should be monitored and protected from agricultural activities. especially where inorganic fertilizers are used by creating buffer zones. Monitoring of the water quality especially the water pH is recommended to ensure the acid neutralizing potential of groundwater within the basin thereby, curtailing further trace metal

  18. Treatment of complementary events in event trees in constructing linked fault trees for level 1 and level 2 PRA

    International Nuclear Information System (INIS)

    Jo, Y. G.

    2008-01-01

    Complementary events in the event trees for a PRA model should be treated properly in order to evaluate plant risk correctly. In this study, the characteristics of the following three different cut-set generation methods were investigated first in order to find the best practical way for treating complementary events: 1) exact method which treats complementary events logically, 2) no-delete term method which does not treat complementary events at all, and 3) delete term method which treats complementary events by deleting nonsense cut-sets which are generated as a result of ignoring complementary events. Then, practical methods for treating complementary events in constructing linked fault trees for level 1 and level 2 PRA in EPRI R and R workstation software environment, where CAFTA is the fault tree editor and FORTE is the cut-set engine, were suggested and demonstrated. The suggested methods deal with the following selected four typical cases: Case 1: an event tree event (E) is represented by a fault tree gate whose inputs consist of only fault tree gates, Case 2: E is represented by a single basic event, Case 3: E is represented by an OR fault tree gate which has a single basic event and a fault tree gate as inputs, and Case 4: E is represented by an AND fault tree gate which has a single basic event and a fault tree gate as inputs. In the suggested methods, first the high level logic structures of event tree events are examined and restructured, if needed. Then, the delete term method, the exact method, and the combination of the two methods are applied to Case 1, Case 2, and Cases 3 and 4, respectively. Also, it is recommended to treat complementary events, using the suggested methods, before level 1 and level 2 PRA fault trees are coupled. It should be noted that the selected four typical cases may not cover all different cases encountered in level 1 and level 2 PRA modeling. However, a process similar to the one suggested in this study may be used to find

  19. An overview of insights gained and lessons learned from U.S. plant-specific PRA studies

    International Nuclear Information System (INIS)

    Joksimovich, V.

    1985-01-01

    Probabilistic Risk Assessment (PRA) has been under development for over twenty years, but it has reached the level of widespread use only in the aftermath of the TMI accident. Over thirty PRAs have now been completed in the U.S. PRAs have been in the mainstream of many licensing decisions because the NRC recognizes that they provide independent and comprehensive plant safety audit. Some difficulties have been experienced leading to interpretive and intercomparison studies. Numerous global and plant-specific insights have been derived. A new application termed risk management is clearly emerging. (orig./HP)

  20. Devonian conodonts from the Foča–Prača Paleozoic complex (Durmitor Nappe, southeastern Bosnia and Herzegovina

    Directory of Open Access Journals (Sweden)

    Bogdan Jurkovšek

    2011-06-01

    Full Text Available Conodont study of the Crna Rijeka borehole CR-17, positioned in the frontal part of the Durmitor Nappe (Foča – Prača Paleozoic complex, SE Bosnia and Herzegovina is presented. The obtained fauna indicates an Early-Middle Devonian age and due to poor preservation an identification at a generic level is possible only. The recovered conodont elements have a high Color Alteration Index (CAI = 6,5–7 indicating a degree of metamorphism corresponding to a temperature interval from 440 °C to 720 °C.

  1. Recovery actions in PRA [probabilistic risk assessment] for the Risk Methods Integration and Evaluation Program (RMIEP): Volume 1, Development of the data-based method

    International Nuclear Information System (INIS)

    Weston, L.M.; Whitehead, D.W.; Graves, N.L.

    1987-06-01

    In a probabilistic risk assessment (PRA) for a nuclear power plant, the analyst identifies a set of potential core damage events consisting of equipment failures and human errors and their estimated probabilities of occurrence. If operator recovery from an event within some specified time is considered, then the probability of this recovery can be included in the PRA. This report provides PRA analysts with an improved methodology for including recovery actions in a PRA. A recovery action can be divided into two distinct phases: a Diagnosis Phase (realizing that there is a problem with a critical parameter and deciding upon the correct course of action) and an Action Phase (physically accomplishing the required action). In this methodology, simulator data are used to estimate recovery probabilities for the diagnosis phase. Different time-reliability curves showing the probability of failure of diagnosis as a function of time from the compelling cue for the event are presented. These curves are based on simulator exercises, and the actions are grouped based upon their operational similarities. This is an improvement over existing diagnosis models that rely greatly upon subjective judgment to obtain such estimates. The action phase is modeled using estimates from available sources. The methodology also includes a recommendation on where and when to apply the recovery action in the PRA process

  2. Nasal PCR assay for the detection of Mycobacterium leprae pra gene to study subclinical infection in a community.

    Science.gov (United States)

    Arunagiri, Kamalanathan; Sangeetha, Gopalakrishnan; Sugashini, Padmavathy Krishnan; Balaraman, Sekar; Showkath Ali, M K

    2017-03-01

    Leprosy is a chronic infectious disease caused by Mycobacterium leprae. Identification of Mycobacterium leprae is difficult in part due to the inability of the leprosy bacillus to grow in vitro. A number of diagnostic methods for leprosy diagnosis have been proposed. Both serological tests and molecular probes have shown certain potential for detection and identification of Mycobacterium leprae in patients. In this study, we have investigated whether Mycobacterium leprae DNA from the nasal secretion of healthy household contacts and the non contacts could be detected through PCR amplification as a method to study the sub clinical infection in a community. A total of 200 samples, 100 each from contacts and non contacts representing all age groups and sex were included in this study. The M. leprae specific primer (proline-rich region) of pra gene was selected and PCR was performed using extracted DNA from the sample. A total of 13 samples were found to be positive for nasal PCR for pra gene among the male and female contacts out of which 7% were males and 6% were females. Even though several diagnostic tools are available to detect the cases of leprosy, they lack the specificity and sensitivity. PCR technology has demonstrated the improved diagnostic accuracy for epidemiological studies and requires minimal time. Although nasal PCR studies have been reported from many countries it is not usually recommended due to the high percentage of negative results in the contact. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Sequence variations and protein expression levels of the two immune evasion proteins Gpm1 and Pra1 influence virulence of clinical Candida albicans isolates.

    Science.gov (United States)

    Luo, Shanshan; Hipler, Uta-Christina; Münzberg, Christin; Skerka, Christine; Zipfel, Peter F

    2015-01-01

    Candida albicans, the important human fungal pathogen uses multiple evasion strategies to control, modulate and inhibit host complement and innate immune attack. Clinical C. albicans strains vary in pathogenicity and in serum resistance, in this work we analyzed sequence polymorphisms and variations in the expression levels of two central fungal complement evasion proteins, Gpm1 (phosphoglycerate mutase 1) and Pra1 (pH-regulated antigen 1) in thirteen clinical C. albicans isolates. Four nucleotide (nt) exchanges, all representing synonymous exchanges, were identified within the 747-nt long GPM1 gene. For the 900-nt long PRA1 gene, sixteen nucleotide exchanges were identified, which represented synonymous, as well as non-synonymous exchanges. All thirteen clinical isolates had a homozygous exchange (A to G) at position 73 of the PRA1 gene. Surface levels of Gpm1 varied by 8.2, and Pra1 levels by 3.3 fold in thirteen tested isolates and these differences influenced fungal immune fitness. The high Gpm1/Pra1 expressing candida strains bound the three human immune regulators more efficiently, than the low expression strains. The difference was 44% for Factor H binding, 51% for C4BP binding and 23% for plasminogen binding. This higher Gpm1/Pra1 expressing strains result in enhanced survival upon challenge with complement active, Factor H depleted human serum (difference 40%). In addition adhesion to and infection of human endothelial cells was increased (difference 60%), and C3b surface deposition was less effective (difference 27%). Thus, variable expression levels of central immune evasion protein influences immune fitness of the human fungal pathogen C. albicans and thus contribute to fungal virulence.

  4. MENELAAH HUKUM WARIS PRA-ISLAM DAN AWAL ISLAM SERTA PELETAKAN DASAR-DASAR HUKUM KEWARISAN ISLAM

    Directory of Open Access Journals (Sweden)

    Asrizal Saiin

    2017-03-01

    [Dalam sejarahnya, pembagian harta warisan sudah ada sebelum Islam (pra-Islam. Adapun sistem pewarisannya adalah sistem keturunan dan sistem sebab. Pembagian harta warisan bersifat patrilinear, artinya anak-anak yang belum dewasa dan kaum perempuan tidak berhak mendapatkan harta warisan, sekalipun mereka merupakan ahli waris dari yang telah meninggal. Seseorang baru bisa mendapatkan harta apabila; adanya pertalian kerabat, janji ikatan prasetia, dan pengangkatan anak. Sementara pada masa awal Islam seseorang bisa mendapatkan harta warisan apabila; adanya pertalian kerabat, pengangkatan anak, adanya hijrah dan adanya persaudaraan. Pewarisan, baru terjadi jika ada sebab-sebab yang mengikat pewaris dengan ahli warisnya, seperti adanya perkawinan, kekerabatan, dan wala’. Adapun hal-hal yang dapat menggugurkan hak seseorang menerima warisan adalah; perbudakan, pembunuhan, berlainan agama, murtad, karena hilang tanpa berita dan berlainan negara. Sebelum pembagian warisan ada beberapa hak yang harus dipenuhi terlebih dahulu, seperti; hak yang berkaitan dengan zat harta peninggalan, biaya perawatan jenazah, pelunasan hutang dan pemberian wasiat

  5. Emergence of Participatory Rural Appraisal (PRA Technique as a Strategy towards Sustainable Development: A Sri Lankan Experience

    Directory of Open Access Journals (Sweden)

    D. N. Koralagama

    2007-10-01

    Full Text Available In this millennium all the development activities are mostly focused on sustainable development, i.e. the development which fulfils the requirements of the present without disturbing the utilization of future generation. Basically, the sustainable development deals with environmental, social, and economical initiations. In relation to these three objectives, community participation plays a key role as an effective strategy for sustainable development. Among the numerous types of participation, Participatory Rural Appraisal (PRA technique is the most relevant effective method to receive the participation. Because, it has been strengthen by bottom up approach, well defined objectives, practicable solutions, and remedies. Hence, the out come of such an event is most productive rather than a top bottom approach techniques. In fact, a PRA was practiced to develop a strategic plan for tsunami affected village – Bambaranda east, in southern province of Sri Lanka. PRA sessions were carried out during February, 2007 by the Department of Agric. Economics of Ruhuna University, Sri Lanka in collaboration with Japanese Green Resource Agency, Japan.Participatory mapping, venn diagram, matrix ranking, preference ranking, and pair - wise ranking were demonstrated to gather information from the community. The tsunami affected area, including the paddy fields, four irrigation canals were shown by the group with the help of the participatory map. Preference ranking was resulted the reconstruction of irrigation canals as the most important rehabilitation activity to recover the livelihood of villagers. Intrusion of sea water into the paddy fields was the main limitation revealed by the pair - wise ranking. The second limitation marked as unavailability of enough fertilizer and the dilapidated irrigation canals was the third that has to be solved. Matrix ranking was employed to identify the most facilitated sectors by the government and other institutes in order

  6. The Sanskrit and Arabic Sources of the Praśnatantra Attributed to Nīlakaṇṭha

    Directory of Open Access Journals (Sweden)

    Martin Gansten

    2014-12-01

    Full Text Available The highly popular Praśnatantra attributed to Nīlakaṇṭha of Kāśī (fl. late 16th century and sometimes regarded as the third volume of his Tājikanīlakaṇṭhī is shown to depend for its basic structure on an abridged Sanskrit version of the Kitāb fi l-masāʾil wa-l-aḥkām by Sahl ibn Bishr (early 9th century, apparently authored by Samarasiṃha in the 13th century, to which quotations primarily from Sanskrit astrological works in the classical Indian style have been added, resulting in a hybrid of Indian and Perso-Arabic interrogational astrology.

  7. Review of UCN 3,4 PSA model based on NEI PRA peer review process guidance, rev.0

    International Nuclear Information System (INIS)

    Yang, Joon Eon; Kang, D. I.; Kim, K. Y.; Lee, Y. H.; Jang, S. C.; Ha, J. J.; Han, S. H.; Han, S. J.; Hwang, M. J.

    2003-05-01

    Recently, under the de-regulation environment, nuclear industry has attempted various approaches to improve the economics of Nuclear Power Plants (NPP). One of these efforts is the Risk Informed/Performance-Based Operation (RIPBO). This approach uses the risk and performance information to manage the resources effectively and efficiently that are used in the operation of NPP. In RIPBO, PSA quality is one of the most important things. The nuclear industry and regulatory body of U.S.A have developed a measure to evaluate the quality of PSA. NEI (Nuclear Energy Institute) has developed a guidance called 'NEI PRA Peer Review Guidance,' and NRC (Nuclear Regulatory Committee) and ASME have developed the 'PRA Standard.' In Korea, several projects are on going now, such as the extension of AOT/STI of RPS/ESFAS, Risk-Informed In-Service Inspection (RI-ISI). However, in Korea, there have been no attempts to evaluate the quality of PSA model itself. Therefore, we cannot be sure about the quality of PSA whether or not the present PSA model can be used for the risk-informed applications such as mentioned above. We can say that the evaluation of PSA model quality is the basis for the RIPBO. In this report, we have evaluated the quality of PSA model for Ulchin 3 and 4 units based on the NEI guidance. We, also, have derived what items are to be improved to upgrade the quality of PSA model and how it can be improved. This report can be used as the base of RIPBO work in Korea. The review result based on ASME Standard is published as the separated technical report of KAERI

  8. Clinical evaluation of the new TGDc-01 "PRA" palpebral tonometer: comparison with contact and non-contact tonometry.

    Science.gov (United States)

    García Resúa, Carlos; Giráldez Fernández, Maria J; Cerviño Expósito, Alejandro; González Pérez, Javier; Yebra-Pimentel, Eva

    2005-02-01

    The TGDc-01 "PRA" (Ryazan State Instrument, Ryazan, Russia) tonometer is a new portable small-sized tonometer that measures intraocular pressure (IOP) through the eyelid. The purpose of this study is to assess the repeatability of the TGDc-01 IOP measurements by comparing them against those obtained with Goldmann tonometer and with those from Perkins applanation tonometer, Xpert (Reichert, Depew, NY) noncontact tonometer, and Tono-Pen XL (Medtronic Solan, Jacksonville, FL) digital tonometer. Fifty-eight right eyes of 58 young subjects were measured with each of the tonometers. Noncontact tonometry was performed first, followed by Goldmann and Perkins applanation tonometer (in random order), digital Tono-Pen XL, and finally TGDc-01 tonometer (sitting and supine position). Correlation analysis was used to evaluate the relationship between the Goldmann tonometer and the remaining tonometers used in this study. Plotting the difference between the methods against mean was also done to compare the tonometers. The hypothesis of zero bias was examined by a paired t-test. The 95% limits of agreement (LoA) were also calculated. TGDc-01 showed no statistical difference between the IOP measurements obtained in sitting and supine positions. A poor relationship between the TGDc-01 and Goldmann tonometer was found (r = 0.173; p = 0.001). Although the mean differences between Goldmann and Tonopen XL, Xpert, and TGDc-01 IOP measurements were statistically significant, the wider 95% LoA was observed when comparing the Goldmann and TGDc-01 tonometers. Computation of the 95% LoA resulted in a wide bias range when comparing the TGDc-01 with all the tonometers used in this study. The TGDc-01 "PRA" tonometer was not comparable with the other techniques used in the study. The wide dispersion range of the values obtained shows low repeatability of the TGDc-01 for screening purposes. These results could be because of the technique of measurement and/or interindividual variables.

  9. Primer uticaja filtriranja slike u sistemima za praćenje ciljeva primenom termovizije / An example of image filtering in target tracking systems with thermal imagery

    Directory of Open Access Journals (Sweden)

    Zvonko M. Radosavljević

    2003-07-01

    Full Text Available U radu je dat primer primene jedne vrste niskofrekventnog filtriranja sa usrednjavanjem, koje se primenjuje u sistemima za detekciju i praćenje ciljeva u vazdušnom prostoru primenom termovizije. Date su dve metode filtriranja slike. Prva metoda koristi niskofrekventno konvoluciono filtriranje a druga usrednjavajući filtar na osnovu srednje vrednosti nivoa sivog. Ovi filtri su primenjeni u sistemima za praćenje uz pomoć infracrvenih senzora. Određivanje nivoa praga filtriranja vrši se uz pomoć statističkih osobina slike. Veoma važan korak u procesu praćenja je određivanje prozora praćenja, koji maze biti, po dimenzijama, fiksan ili adaptibilan. Pogrešna procena o postojanju cilja u prozoru može se doneti u slučaju prisustva šuma pozadine, predpojačavača, detektora, itd. Filtriranje je neophodan korak u ovim sistemima, kao značajan činilac U povećanju brzine i tačnosti praćenja. / A case of image filtering in air target detecting and tracking systems is described in this paper. Two image filtering methods are given. The first method is performed using a low pass convolving filter and the second one uses the mean value of gray level filter. The main goal of the cited filtering is implementation in IR (infra red systems. Some statistical features of the images were used for selecting the threshold level. The next step in the algorithm is the determination of a 'tracking window' that can be fixed or adaptive in size. A false estimation of a target existing in the window may be influenced by the background noise, low noise amplifier detector, etc.

  10. Pra que time ele joga?: a produção da identidade homossexual em um vídeo educativo

    Directory of Open Access Journals (Sweden)

    Nilson Fernandes Dinis

    2009-01-01

    Full Text Available This work aims to analyze the discourse about homosexuality by means of a research with undergraduate students of Physical Education. For this purpose, it made use of the film "Pra que time ele joga?" as a tool of discussing the theme with the research group, aiming to observe what kind of opinions these students have about homosexuality, as well as the discursive production of the image of homosexual subject produced by the educational videotape.

  11. Incorporating organizational factors into Probabilistic Risk Assessment (PRA) of complex socio-technical systems: A hybrid technique formalization

    International Nuclear Information System (INIS)

    Mohaghegh, Zahra; Kazemi, Reza; Mosleh, Ali

    2009-01-01

    This paper is a result of a research with the primary purpose of extending Probabilistic Risk Assessment (PRA) modeling frameworks to include the effects of organizational factors as the deeper, more fundamental causes of accidents and incidents. There have been significant improvements in the sophistication of quantitative methods of safety and risk assessment, but the progress on techniques most suitable for organizational safety risk frameworks has been limited. The focus of this paper is on the choice of 'representational schemes' and 'techniques.' A methodology for selecting appropriate candidate techniques and their integration in the form of a 'hybrid' approach is proposed. Then an example is given through an integration of System Dynamics (SD), Bayesian Belief Network (BBN), Event Sequence Diagram (ESD), and Fault Tree (FT) in order to demonstrate the feasibility and value of hybrid techniques. The proposed hybrid approach integrates deterministic and probabilistic modeling perspectives, and provides a flexible risk management tool for complex socio-technical systems. An application of the hybrid technique is provided in the aviation safety domain, focusing on airline maintenance systems. The example demonstrates how the hybrid method can be used to analyze the dynamic effects of organizational factors on system risk

  12. Incorporating organizational factors into Probabilistic Risk Assessment (PRA) of complex socio-technical systems: A hybrid technique formalization

    Energy Technology Data Exchange (ETDEWEB)

    Mohaghegh, Zahra [Center for Risk and Reliability, University of Maryland, College Park, MD 20742 (United States)], E-mail: mohagheg@umd.edu; Kazemi, Reza; Mosleh, Ali [Center for Risk and Reliability, University of Maryland, College Park, MD 20742 (United States)

    2009-05-15

    This paper is a result of a research with the primary purpose of extending Probabilistic Risk Assessment (PRA) modeling frameworks to include the effects of organizational factors as the deeper, more fundamental causes of accidents and incidents. There have been significant improvements in the sophistication of quantitative methods of safety and risk assessment, but the progress on techniques most suitable for organizational safety risk frameworks has been limited. The focus of this paper is on the choice of 'representational schemes' and 'techniques.' A methodology for selecting appropriate candidate techniques and their integration in the form of a 'hybrid' approach is proposed. Then an example is given through an integration of System Dynamics (SD), Bayesian Belief Network (BBN), Event Sequence Diagram (ESD), and Fault Tree (FT) in order to demonstrate the feasibility and value of hybrid techniques. The proposed hybrid approach integrates deterministic and probabilistic modeling perspectives, and provides a flexible risk management tool for complex socio-technical systems. An application of the hybrid technique is provided in the aviation safety domain, focusing on airline maintenance systems. The example demonstrates how the hybrid method can be used to analyze the dynamic effects of organizational factors on system risk.

  13. Workshop on the use of PRA methodology for the analysis of reactor events and operational data: Proceedings

    International Nuclear Information System (INIS)

    Rasmuson, D.M.

    1992-06-01

    A workshop entitled ''The Use of PRA Methodology for the Analysis of Reactor Events and Operational Data'' was held on January 29--30, 1992 in Annapolis, Maryland. Over 50 participants from the NRC, its contractors, and others participated in the meetings. During the first day, presentations were made by invited speakers to discuss issues in relevant topics. On the second day, discussion groups were held to focus on three areas: risk significance of operational events, industry risk profile and generic concerns, and risk monitoring and risk-based performance indicators. Important considerations identified from the workshop are the following: Improve the Accident Sequence Precursor models and data. Improve the SCSS and NPRDS (e.g., by adding detailed performance information on selected components, by improving narratives on failure causes). Develop risk-based performance indicators. Use risk insights to help focus trending and performance analyses of components, systems, initiators, and sequences. Improve the statistical quality of trending and performance analyses. Flag implications of special conditions (e.g., external events, containment performance) during data studies. Trend common cause and human performance using appropriate models to obtain a better understanding of the impact and causes of failure. Develop a method for producing an industry risk profile

  14. Implications of an HRA framework for quantifying human acts of commission and dependency: Development of a methodology for conducting an integrated HRA/PRA

    International Nuclear Information System (INIS)

    Barriere, M.T.; Luckas, W.J.; Brown, W.S.; Cooper, S.E.; Wreathall, J.; Bley, D.C.

    1993-01-01

    To support the development of a refined human reliability analysis (HRA) framework, to address identified HRA user needs and improve HRA modeling, unique aspects of human performance have been identified from an analysis of actual plant-specific events. Through the use of the refined framework, relationships between the following HRA, human factors and probabilistic risk assessment (PRA) elements were described: the PRA model, plant states, plant conditions, PRA basic events, unsafe human actions, error mechanisms, and performance shaping factors (PSFs). The event analyses performed in the context of the refined HRA framework, identified the need for new HRA methods that are capable of: evaluating a range of different error mechanisms (e.g., slips as well as mistakes); addressing errors of commission (EOCs) and dependencies between human actions; and incorporating the influence of plant conditions and multiple PSFs on human actions. This report discusses the results of the assessment of user needs, the refinement of the existing HRA framework, as well as, the current status on EOCs, and human dependencies

  15. Implications of an HRA framework for quantifying human acts of commission and dependency: Development of a methodology for conducting an integrated HRA/PRA

    International Nuclear Information System (INIS)

    Barriere, M.T.; Luckas, W.J.; Brown, W.S.; Cooper, S.E.; Wreathall, J.; Bley, D.C.

    1994-01-01

    To support the development of a refined human reliability analysis (HRA) framework, to address identified HRA user needs and improve HRA modeling, unique aspects of human performance have been identified from an analysis of actual plant-specific events. Through the use of the refined framework, relationships between the following HRA, human factors and probabilistic risk assessment (PRA) elements were described: the PRA model, plant states, plant conditions, PRA basic events, unsafe human actions, error mechanisms, and performance shaping factors (PSFs). The event analyses performed in the context of the refined HRA framework, identified the need for new HRA methods that are capable of: evaluating a range of different error mechanisms (e.g., slips as well as mistakes); addressing errors of commission (EOCs) and dependencies between human actions; and incorporating the influence of plant conditions and multiple PSFs on human actions. This report discusses the results of the assessment of user needs, the refinement of the existing HRA framework, as well as, the current status on EOCs, and human dependencies

  16. Development of a methodology for conducting an integrated HRA/PRA --. Task 1, An assessment of human reliability influences during LP&S conditions PWRs

    Energy Technology Data Exchange (ETDEWEB)

    Luckas, W.J.; Barriere, M.T.; Brown, W.S. [Brookhaven National Lab., Upton, NY (United States); Wreathall, J. [Wreathall (John) and Co., Dublin, OH (United States); Cooper, S.E. [Science Applications International Corp., McLean, VA (United States)

    1993-06-01

    During Low Power and Shutdown (LP&S) conditions in a nuclear power plant (i.e., when the reactor is subcritical or at less than 10--15% power), human interactions with the plant`s systems will be more frequent and more direct. Control is typically not mediated by automation, and there are fewer protective systems available. Therefore, an assessment of LP&S related risk should include a greater emphasis on human reliability than such an assessment made for power operation conditions. In order to properly account for the increase in human interaction and thus be able to perform a probabilistic risk assessment (PRA) applicable to operations during LP&S, it is important that a comprehensive human reliability assessment (HRA) methodology be developed and integrated into the LP&S PRA. The tasks comprising the comprehensive HRA methodology development are as follows: (1) identification of the human reliability related influences and associated human actions during LP&S, (2) identification of potentially important LP&S related human actions and appropriate HRA framework and quantification methods, and (3) incorporation and coordination of methodology development with other integrated PRA/HRA efforts. This paper describes the first task, i.e., the assessment of human reliability influences and any associated human actions during LP&S conditions for a pressurized water reactor (PWR).

  17. Munich Re konsultant Gerhard Berz : katastroofid on meie ärile kasulikud / Gerhard Berz ; interv. Ulrich Schnabel, tõlk. Erik Aru

    Index Scriptorium Estoniae

    Berz, Gerhard

    2005-01-01

    Intervjuu meteoroloogiga, kes on kolm aastakümmet arvutanud edasikindlustusfirma Munich Re heaks loodusõnnetuste riske ja viibinud ligi viiekümnes katastroofipiirkonnas. Vaatamata sellele, et 2004. aasta oli kõige kulukamate looduskatastroofide aasta, saavutas firma läbi aegade parimad majandustulemused. Lisa: Meeletu kahju

  18. NOVOS LETRAMENTOS NA CULTURA DIGITAL: O REMIX VEM PRA RUA - O GIGANTE ACORDOU COMO UM HÍBRIDO

    Directory of Open Access Journals (Sweden)

    Rosivaldo Gomes

    2015-07-01

    Full Text Available A utilização da internet, das mídias e redes sociais digitais e de celulares se constituiu como um diferencial importantíssimo no grande movimento social que mexeu com o País e com as visões sobre ele nas manifestações ocorridas em junho de 2013. Essas mídias e redes sociais digitais (YouTube, Flickr, Facebook, Instagram, Twitter, etc. se constituíram como canais de informação, ambientes comunicacionais, pontos de encontro, enfim, em redes e, às vezes, até em comunidades que facilitaram os relacionamentos entre os que estavam conectados e dispostos a se manifestarem de algum modo. Nessa direção, os novos letramentos digitais e o novo ethos como defendido por Lankshear e Knobel (2007 proporcionaram contribuições significativas para o uso das tecnologias digitais de informação e comunicação na propagação dessas manifestações, e, buscando compreender o modo como esses novos letramentos favoreceram isso, neste artigo buscamos, a partir das noções de hibridismo e intercalação (GARCÍA CANCLINI, 2008 [1989]; BAKHTIN, 2002 [1934-5] e  nas discussões de Lankshear e Knobel (2007; 2008 sobre remix e sobre linguagens hipermidiática e híbrido digital (SANTAELLA, 2003; 2004, realizar uma análise qualitativa do remix digita Vem pra rua - O gigante acordou,  no que diz respeito as técnicas de produção e constituição desse gênero na construção de novos significado, considerando o horizonte espacial e temporal (VOLOCHINOV/BAKHTIN, [1926]1976 nos quais foi produzido

  19. Development of risk assessment methodology against natural external hazards for sodium-cooled fast reactors: project overview and strong Wind PRA methodology - 15031

    International Nuclear Information System (INIS)

    Yamano, H.; Nishino, H.; Kurisaka, K.; Okano, Y.; Sakai, T.; Yamamoto, T.; Ishizuka, Y.; Geshi, N.; Furukawa, R.; Nanayama, F.; Takata, T.; Azuma, E.

    2015-01-01

    This paper describes mainly strong wind probabilistic risk assessment (PRA) methodology development in addition to the project overview. In this project, to date, the PRA methodologies against snow, tornado and strong wind were developed as well as the hazard evaluation methodologies. For the volcanic eruption hazard, ash fallout simulation was carried out to contribute to the development of the hazard evaluation methodology. For the forest fire hazard, the concept of the hazard evaluation methodology was developed based on fire simulation. Event sequence assessment methodology was also developed based on plant dynamics analysis coupled with continuous Markov chain Monte Carlo method in order to apply to the event sequence against snow. In developing the strong wind PRA methodology, hazard curves were estimated by using Weibull and Gumbel distributions based on weather data recorded in Japan. The obtained hazard curves were divided into five discrete categories for event tree quantification. Next, failure probabilities for decay heat removal related components were calculated as a product of two probabilities: i.e., a probability for the missiles to enter the intake or out-take in the decay heat removal system, and fragility caused by the missile impacts. Finally, based on the event tree, the core damage frequency was estimated about 6*10 -9 /year by multiplying the discrete hazard probabilities in the Gumbel distribution by the conditional decay heat removal failure probabilities. A dominant sequence was led by the assumption that the operators could not extinguish fuel tank fire caused by the missile impacts and the fire induced loss of the decay heat removal system. (authors)

  20. Perbandingan Tinggi Tulang Maksila dan Mandibula di Regio Interisisivi Sentral antara Pra dan Pasca Perawatan Ortodontik dengan Pencabutan ke Empat Gigi Premolar Pertama (Kajian pada Foto Panoramik

    Directory of Open Access Journals (Sweden)

    Wayan Ardhana

    2012-12-01

    Full Text Available Latar belakang. Perawatan ortodontik pada kasus-kasus gigi berjejal dan protusif sering membutuhkan pencabutan gigi premolar untuk penyediaan ruang agar gigi berjejal dapat dirapikan dan gigi depan yang protusif dapat diundurkan. Gigi insisivus sentral merupakan salah satu gigi yang paling banyak mengalami pergerakan selama proses retrusi. Pergerakan gigi insisivus mengakibatkan terjadinya perubahan pada puncak tulang alveolar selama perawatan yang mungkin akan mempengaruhi tinggi tulang maksila dan mandibula pasca perawatan. Tujuan penelitian. Membandingkan tinggi tulang maksila dan mandibula di daerah interdental gigi insisivi sentral pada foto panoramic antara pra dan pasca perawatan maloklusi dengan pencabutan ke empat gigi premolar pertama. Metode penelitian. Digunakan 30 pasang foto panoramic pra dan pasca perawatan yang dipilih sesuai dengan kriteria penelitian dari pasien-pasien peneliti yang telah selesai mendapat perawatan aktif dengan teknik edgewise. Analisis Kolmogorov-Smirnov dan Shaviro-Wilk digunakan untuk uji normalitas dan Student t-test data berpasangan digunakan untuk menguji perbedaan tinggi tulang maksila dan mandibula antara pra dan pasca perawatan. Hasil Penelitian. Tidak didapatkan perbedaan (p>0,05 tinggi tulang maksila dan amndibula antara pra dan pasca perawatan ortodontik dengan pencabutan keempat gigi premolar pertama.   Background. In orthodontic treatment, premolar extractions are often needed in crowding and prostrusive cases to provide space for the teeth can be aligned and retracted to their desire position. Central incisor teeth are the teeth that mostly undergone more movement during retrusion. The change of the alveolar bone crest in this incisors might affect the maxillary and mandibular bone height post-treatment. Research objectives. The present study aimed to compare the bone height in the interdental maxillary and mandibular central incisors regions before and after orthodontic treatment with four

  1. Pulsa o coração da cidade: errâncias, afectos e potências no dia e na noite da Praça do Ferreira

    Directory of Open Access Journals (Sweden)

    Alice Dote

    2017-12-01

    Full Text Available O presente artigo aborda a potência dos usos, contra-usos e modos de habitar dos artistas de rua da Praça do Ferreira, na cidade de Fortaleza, Ceará. O trabalho apoia-se nos percursos e nas errâncias urbanas da vivência na e da Praça do Ferreira em diferentes temporalidades (diurna e noturna, especialmente no contexto de apresentações noturnas do Grupo As 10 Graças de Palhaçaria aos moradores da Praça. Através desses que têm a rua como casa, agem pelas brechas e proliferam-se pelas margens, proponho-me a perceber a potência da arte de rua, do encontro e da experiência de alteridade na Praça do Ferreira. Finalizo o texto apontando que esse local, assim ocupado, se impregna de significados outros e revela-se como um território de criação, de inventividade, de existência e resistência, portanto, de potência de vida que é, em si, potência política. Palavras-chave: Praça do Ferreira; Fortaleza; cidade; arte urbana; artista de rua

  2. Can we trust PRA?

    Energy Technology Data Exchange (ETDEWEB)

    Epstein, S. [ABS Consulting, Koraku Mori, Building, 1-4-14 Koraku Chome, Bunkyo-ku, Tokyo 112-0004 (Japan)]. E-mail: sepstein@absconsulting.com; Rauzy, A. [Institut de Mathematique de Luminy (IML/CNRS), 163 Avenue de Luminy, Case 907, Marseille, Cedex 913288 (France)]. E-mail: arauzy@iml.univ-mrs.fr

    2005-06-01

    The Fault-Tree/Event-Tree method is widely used in industry as the underlying formalism of probabilistic risk assessment. Almost all of the tools available to assess Event-Tree models implement the 'classical' assessment technique based on minimal cutsets and the rare event approximation. Binary decision diagrams (BDDs) are an alternative approach, but they were up to now limited to medium size models because of the exponential blow up of the memory requirements. We have designed a set of heuristics, which make it possible to quantify, by means of BDD, all of the sequences of a large Event-Tree model coming from the nuclear industry. For the first time, it was possible to compare results of the classical approach with those of the BDD approach, i.e. with exact results. This article reports this comparison and shows that the minimal cutsets technique gives overestimated results in a significant proportion of cases and underestimated results in some cases as well. Hence, the (indeed provocative) question in the title of this article.

  3. Espaços livres em praças inglesas do século XVII: o caso de Convent Garden

    Directory of Open Access Journals (Sweden)

    Maria Fernanda Derntl

    2006-12-01

    Full Text Available Covent Garden é considerada uma experiência modelar entre as primeiras transformações no espaço urbano ainda de aparência medieval de Londres no século XVII. A partir da iconografia da época e das indicações da bibliografia pertinente, procura-se apresentar uma análise abrangente da configuração formal dessa praça. Destaca-se a existência de diferentes tipos de espaços livres contribuindo para determinar seu desenho: além do espaço central, também fizeram parte da praça o pátio da igreja de St. Paul, a oeste e os jardins da mansão Bedford, ao sul. Conclui-se que o desenho apresentado por Covent Garden não era completamente regular ou simétrico e teria sido bem diferente das squares londrinas dos séculos XVII e XVIII.

  4. Applicability of PRISM PRA Methodology to the Level II Probabilistic Safety Analysis of KALIMER-600 (I) (Core Damage Event Tree Analysis Part)

    International Nuclear Information System (INIS)

    Park, S. Y.; Kim, T. W.; Ha, K. S.; Lee, B. Y.

    2009-03-01

    The Korea Atomic Energy Research Institute (KAERI) has been developing liquid metal reactor (LMR) design technologies under a National Nuclear R and D Program. Nevertheless, there is no experience of the PSA domestically for a fast reactor with the metal fuel. Therefore, the objective of this study is to establish the methodologies of risk assessment for the reference design of KALIMER-600 reactor. An applicability of the PSA of the PRISM plant to the KALIMER-600 has been studied. The study is confined to a core damage event tree analysis which is a part of a level 2 PSA. Assuming that the accident types, which can be developed from level 1 PSA, are same as the PRISM PRA, core damage categories are defined and core damage event trees are developed for the KALIMER-600 reactor. Fission product release fractions of the core damage categories and branch probabilities of the core damage event trees are referred from the PRISM PRA temporarily. Plant specific data will be used during the detail analysis

  5. Avaliação qualitativa e quantitativa da arborização das praças de Vinhedo, SP.

    Directory of Open Access Journals (Sweden)

    Roberval de Cássia Salvador Ribeiro

    2006-06-01

    Full Text Available O inventário das espécies arbóreas e dos respectivos números de indivíduos das praças da cidade de Vinhedo foi realizado no perímetro urbano, excetuando-se os condomínios, as áreas de parques e as de preservação de mananciais. Para a localização das áreas, consultou-se a planta do município de 1997. Realizou-se o inventário da vegetação arbórea, considerando-se apenas os indivíduos com CAP (circunferência à altura do peito acima de 10 cm listando-se as seguintes informações: nomes comum e científico das espécies; CAP; altura; aspecto geral; diâmetro de copa; presença de pragas, doenças ou parasitas; ocorrência de podas (drástica e/ou de condução; fitossanidade da raiz, tronco e copa. Foram registradas 22 praças por nome, localização e número total de árvores, totalizando 764 indivíduos pertencentes a 23 famílias botânicas e 53 espécies, além de 32 indivíduos não identificados. A espécie de maior abundância relativa foi Syagrus romanzoffiana (jerivá, com 31,94% do número total de indivíduos. Em 63,64% das praças 33,13% das espécies eram exóticas. A maior parte dos indivíduos tinha aspecto geral normal, demonstrando prática de tratos culturais adequados. Na maioria dos casos, as podas foram feitas corretamente, ou não houve a necessidade de nenhuma intervenção. Do total de 22 praças, apenas cinco tinham bom estado geral de conservação dos elementos naturais (arbustos, canteiros e gramados. Em 68,18% das praças as árvores tinham altura superior a 6 metros, indicando que essas áreas necessitavam apenas de procedimentos de manutenção de rotina. E 22,72% necessitavam de práticas de manutenção mais direcionadas ao desenvolvimento das árvores, tais como adubações periódicas, capinas, podas de condução e, finalmente, em 13,64% deveriam ocorrer intervenções tanto de manutenção, como de recuperação por meio de novos plantios, ou mesmo, de planejamento para remodelação da área.

  6. Karakteristik Reverse Transcriptase Gen Polymerase Virus Hepatitis B Pada Penderita Hepatitis B Kronis Asimptomatik Pra-Pengobatan

    Directory of Open Access Journals (Sweden)

    Turyadi Turyadi

    2018-01-01

    Full Text Available Abstrak Antiviral nucleos(tide analogue (NUCs merupakan pengobatan utama pada hepatitis B kronis (HBK. Pemberian jangka panjang dinilai cukup efektif menekan progresivitas penyakit, namun dapat menimbulkan mutasi resisten. Studi ini melihat karakteristik gen polimerase yang berkaitan dengan resistensi NUCs pada penderita HBK asimptomatik pra-pengobatan. Penelitian dilakukan di Laboratorium Hepatitis, Lembaga Biologi Molekuler Eijkman, Jakarta. Sebanyak 38 sampel individu dengan hepatitis B surface antigen (HBsAg positif dikarakterisasi dengan PCR-sekuensing. Genotipe dan subtipe ditentukan berdasarkan sekuens HBsAg. Sebanyak 37 (97,4% sampel menunjukkan mutasi rtQ238H/N dan satu sampel wildtype. Sebanyak 23 (62,2% memiliki mutasi rtQ238H, 10 (27,0% rtQ238N, dan empat (10,8% dengan mutasi ganda rtA194T dan rtQ238H. Genotipe B ditemukan pada 26 (68,4% sampel, genotipe C pada 11 (28,9%, dan genotipe D pada satu (2,6% sampel. Secara statistik, mutasi rtQ238H berasosiasi dengan genotipe B (p<0,001 dan mutasi rtQ238N dengan genotipe C (p<0,001. Subtipe ayw ditemukan pada 25 (65,8% sampel, adr pada 11 (28,9%, dan adw pada dua (5,3% sampel. Sebagian besar sampel tidak menunjukkan mutasi yang berkaitan dengan resistensi NUCs, sehingga pemberian NUCs masih. Mutasi rtQ238H merupakan varian yang berkaitan dengan genotipe B dan rtQ238N dengan genotipe C. Kata kunci: virus hepatitis B; mutasi; pengobatan; polymerase.   Reverse-Transcriptase Characteristics of Hepatitis B Virus Polymerase Gene in Treatment-Naïve Asymptomatic Chronic Hepatitis B Individuals Abstract Nucleos(tide analogues (NUCs remain the main treatment for chronic hepatitis B (CHB. Long-term use of NUCs significantly reduces disease progression; however, it might lead to resistance-associated mutations. We studied characteristics of polymerase gene related to NUCs resistance in naïve hepatitis B surface antigen (HBsAg-positive individuals. The research was done at Laboratory of Hepatitis

  7. Praça da Matemática: as faces da história na construção de um monumento

    OpenAIRE

    Pimentel, Augusto Cesar Aguiar

    2008-01-01

    O presente trabalho consiste na investigação histórico-cultural da construção de uma praça, com um monumento em homenagem à Matemática, idealizado por um prefeito visionário, de 29 anos, na cidade de Itaocara, interior do Estado do Rio de Janeiro, no ano de 1943. O que é hoje uma atração turística, surgiu da criatividade do jovem político que apesar de advogado, via na matemática sua fonte de prazer. Para essa pesquisa, realizou-se entrevistas com o próprio prefeito da época...

  8. Proceedings of the twenty-fourth water reactor safety information meeting. Volume 3: PRA and HRA; Probabilistic seismic hazard assessment and seismic siting criteria

    International Nuclear Information System (INIS)

    Monteleone, S.

    1997-02-01

    This three-volume report contains papers presented at the Twenty-Fourth Water Reactor Safety Information Meeting held at the Bethesda Marriott Hotel, Bethesda, Maryland, October 21--23, 1996. The papers are printed in the order of their presentation in each session and describe progress and results of programs in nuclear safety research conducted in this country and abroad. Foreign participation in the meeting included papers presented by researchers from Czech Republic, Finland, France, Japan, Norway, Russia and United Kingdom. This volume is divided into the following sections: PRA and HRA and probabilistic seismic hazard assessment and seismic siting criteria. Selected papers are indexed separately for inclusion in the Energy Science and Technology Database

  9. Hubungan antara Pengetahuan, Sikap, dan Perilaku terhadap Pemeliharaan Kebersihan Gigi dan Mulut dengan Status Kesehatan Periodontal Pra Lansia di Posbindu Kecamatan Indihiang Kota Tasikmalaya

    Directory of Open Access Journals (Sweden)

    Culia Rahayu

    2014-06-01

    Full Text Available Proses penuaan merupakan salah satu faktor sistemik yang mempengaruhi respon tubuh terhadap terjadinya penyakit periodontal. Penelitian ini bertujuan untuk mengetahui hubungan antara pengetahuan, sikap dan perilaku terhadap pemeliharaan kebersihan gigi dan mulut dengan status kesehatan periodontal pra lansia. Penelitian ini merupakan penelitian non eksperimental, dengan rancangan cross sectional. Subjek penelitian berjumlah 225 orang pra lansia dari 9 Posbindu di Kecamatan Indihiang Tasikmalaya, yang diambil dengan cara purposive sampling. Variabel pengaruh terdiri dari pengetahuan, sikap dan perilaku terhadap pemeliharaan kebersihan gigi dan mulut. Variabel pengetahuan diukur menggunakan kuesioner tertutup dengan pilihan jawaban benar atau salah. Variabel sikap dan perilaku diukur menggunakan kuesioner dibuat menurut skala Likert. Kuesioner telah diuji validitas (koefisien korelasi ≥ 0,30 dan uji reliabilitas (alpha cronbach >0,60. Variabel terpengaruh adalah status kesehatan periodontal yang diukur menggunakan indeks CPITN. Analisa data menggunakan analisis korelasi dan regresi berganda. Hasil analisis regresi berganda menunjukkan bahwa variabel pengetahuan, sikap dan perilaku terhadap pemeliharaan kebersihan gigi dan mulut mempunyai hubungan signifikan terhadap status kesehatan periodontal (F =30,681 dan p =0,001, dan memberikan kontribusi pengaruh sebesar 29,4% (R² = 0,294 terhadap status kesehatan periodontal. Perilaku terhadap pemeliharaan kebersihan gigi dan mulut memberikan kontribusi pengaruh paling besar terhadap status kesehatan periodontal yaitu sebesar 6,9%. Kesimpulan dari penelitian ini adalah semakin baik pengetahuan, sikap dan perilaku terhadap pemeliharaan kebersihan gigi dan mulut, semakin baik status kesehatan periodontal pra lansia. Perilaku terhadap pemeliharaan kebersihan gigi dan mulut memberikan kontribusi pengaruh paling besar terhadap status kesehatan periodontal pra lansia. Correlation Between Knowledge, Attitude

  10. Tortura e transição democrática: uma análise histórica do filme “Pra frente, Brasil”

    Directory of Open Access Journals (Sweden)

    Paulo Jorge Corrêa Campos

    2014-06-01

    Full Text Available O presente trabalho pretende analisar o filme “Pra frente, Brasil” situando o mesmo no contexto da abertura democrática dos anos 1980. Para tal, busca-se tecer o contexto e o lugar social onde foi concebido o filme. Na análise, atenta-se para o papel da tortura presente na obra cinematográfica e para os elementos semióticos usados no filme para incutir uma visão específica no espectador. Ademais, considerando-se que o mesmo sofre censura prévia do governo, procura-se questionar a superficialidade da democracia mesmo no agonizar da ditadura civil-militar.

  11. Proceedings of the twenty-fourth water reactor safety information meeting. Volume 3: PRA and HRA; Probabilistic seismic hazard assessment and seismic siting criteria

    Energy Technology Data Exchange (ETDEWEB)

    Monteleone, S. [comp.] [Brookhaven National Lab., Upton, NY (United States)

    1997-02-01

    This three-volume report contains papers presented at the Twenty-Fourth Water Reactor Safety Information Meeting held at the Bethesda Marriott Hotel, Bethesda, Maryland, October 21--23, 1996. The papers are printed in the order of their presentation in each session and describe progress and results of programs in nuclear safety research conducted in this country and abroad. Foreign participation in the meeting included papers presented by researchers from Czech Republic, Finland, France, Japan, Norway, Russia and United Kingdom. This volume is divided into the following sections: PRA and HRA and probabilistic seismic hazard assessment and seismic siting criteria. Selected papers are indexed separately for inclusion in the Energy Science and Technology Database.

  12. Variáveis meteorológicas e cobertura vegetal de espécies arbóreas em praças urbanas em Cuiabá, Brasil

    Directory of Open Access Journals (Sweden)

    Angela Santana de Oliveira

    2013-12-01

    Full Text Available A influência da vegetação nas variáveis meteorológicas foi avaliada por meio do índice de área foliar (IAF e índice de sombreamento arbóreo (ISA em duas praças públicas em Cuiabá-MT, Brasil. Medidas de temperatura do ar (T e umidade relativa (UR foram obtidas sob a copa das árvores em diferentes sítios da cidade para o período seco e chuvoso no ano de 2009. A análise dos valores médios destas variáveis mostraram maiores valores de T e menores UR ocorrendo durante o período seco e sendo semelhantes nas duas praças. Com relação à UR, entretanto, não houve diferenças significativas entre a medida sob as árvores e a atmosfera. O índice de área foliar foi calculado e variou em função das espécies arbóreas das praças, e mostrou valores entre 5,64 e 2,79 m². m-2, sendo a média do IAF e do ISA na Praça Popular superiores ao da Praça 8 de Abril. Conclui-se que as espécies arbóreas melhoraram o ambiente térmico em virtude da atenuação da radiação proporcionada pelo sombreamento das diferentes espécies, principalmente no horário com menor ângulo solar.

  13. As praças dr. Augusto Silva e Leonardo Venerando Pereira, 1701 Lavras - MG, segundo a visão dos seus freqüentadores The park dr. Augusto Silva, Lavras - MG, according to viewpoint of its users

    Directory of Open Access Journals (Sweden)

    Alessandra Teixeira da Silva

    2008-12-01

    Full Text Available As praças públicas, além de contribuírem para o embelezamento das cidades, também desempenham uma função importante no contexto urbanístico ambiental. A Praça Dr. Augusto Silva, situada no município de Lavras, MG, também já foi chamada de Largo da Matriz, Praça Central e Jardim Municipal, que foi inaugurado oficialmente em 29 de novembro de 1908, quando passou a ter o nome de um ilustre médico lavrense. A praça Dr. Augusto Silva, possui atualmente, área de 7.552,65 m² e apresenta como prolongamento a praça Leonardo Venerando Pereira, com área atual de 2.041,72 m². Até 1940, esse prolongamento era denominado de Praça da Bandeira. Constatou-se, que desde o início da década de 1910, o local foi palco de grandes celebrações e encontros políticos e também foi muito freqüentado pela população. A Praça possui rica vegetação, onde se destacam uma centenária Tipuana (Tipuana tipu, diversos ipês (Tabebuia spp., palmeiras-imperiais (Roystonea oleracea. Objetivando-se avaliar a situação atual e usos, foi realizada uma avaliação, mediante análise quantitativa e pesquisa junto à população. Foram feitas uma série de avaliações referentes aos seguintes itens: aspectos urbanísticos, físicos e a vegetação. A pesquisa de opinião foi aplicada a aproximadamente 600 usuários, na própria praça, em dias da semana e horários diferentes, por meio de um questionário com perguntas diretas ao próprio entrevistado. Os dados coletados foram analisados estatisticamente utilizando o Software SPSS, de onde foram obtidas as freqüências porcentuais. A maior parte dos entrevistados julga a praça como um ponto de encontro entre amigos, onde contemplam a sua beleza e descansam. Por meio de pesquisa de opinião realizada com os usuários da praça, pôde-se identificar que se trata de um local muito freqüentado por várias faixas etárias, em diferentes períodos do dia. A praça Dr. Augusto Silva mostra-se de grande import

  14. Identification and screening of hazards for the external event PRA - External hazard identification, screening and studies for a new plant site

    International Nuclear Information System (INIS)

    Hellander, Juho

    2014-01-01

    Fennovoima is constructing a new nuclear power plant on a greenfield site in Northern Finland. Various evaluations for site-specific hazards are needed to ensure sufficient plant design basis values, proper design solutions and to provide input for the PRA model. This paper presents the general process used in identifying the relevant site-specific external hazards. The applicable legislative requirements, guides and standards regarding external hazards and external event PRA shall be identified. Based on these, an initial comprehensive list of events should be compiled. The initial list shall be filtered to exclude irrelevant events. Events can be screened out if the probability is very low or if the consequences are only mild. Events with similar consequences should be combined. Events can be grouped in several ways, and in this paper the risks are categorized into events related to air, water bodies, ground and human behaviour. In addition, the simultaneously occurring combinations of events should be identified. The paper also summarizes some hazard studies already performed and required in the future in Fennovoima's project. A comprehensive study is ongoing related to earthquake risks. The study aims at identifying all relevant seismic sources and taking into account various expert opinions in seismic modelling. Also frazil ice and anchor ice studies are being performed to eliminate the risk of cooling water intake blockage due to ice. In addition, some other study areas are mentioned. This paper presented a list of Finnish and international guides and standards useful in evaluating external hazards. Also a methodology was presented to identify and screen site-specific hazards in a new nuclear power plant project. The screened list of relevant events for the Hanhikivi site requiring further studies was presented. Also the studies needed in different phases of a new nuclear power plant project were discussed. Some specific studies regarding earthquakes and

  15. Análise quali-quantitativa da arborização na praça XV de novembro em Ribeirão Preto - SP, Brasil

    Directory of Open Access Journals (Sweden)

    Gustavo de Nobrega Romani

    2012-06-01

    Full Text Available A Praça XV de Novembro, implantada em meados do século XIX, tem grande valor histórico-cultural, além de se constituir em uma das principais áreas verdes do centro da cidade de Ribeirão Preto. Visando ao conhecimento detalhado da vegetação para fins de orientação do manejo e conservação dessa área, foi feito um levantamento quali-quantitativo e fitossociológico das árvores e palmeiras da praça. Foram medidas altura e Diâmetro à Altura do Peito (DAP e identificados todos os indivíduos de porte arbóreo (árvores e palmeiras presentes na Praça, em nível de espécie. A praça ocupa uma área de 15.456,00 m², onde foram amostradas 42 espécies distribuídas por 19 famílias, num total de 161 indivíduos. Apesar de o local apresentar arborização com alto índice de diversidade de espécies (Shannon-Weaver de 3,14, os exemplares necessitam de maior atenção quanto a problemas ligados à fitossanidade e podas adequadas, fazendo que resulte em espaço seguro para os frequentadores e em boa qualidade paisagística.

  16. O gigante adormecido vem pra rua: construções enunciativas de Johnnie Walker e Fiat durante as manifestações brasileiras de 2013

    Directory of Open Access Journals (Sweden)

    Carolina Fernandes da Silva Mandaji

    2014-04-01

    Full Text Available O tema deste trabalho são as manifestações ocorridas nos meses de junho e julho de 2013 em todo o Brasil. Trata-se de uma reflexão sobre as construções enunciativas de discursos midiáticos no cenário nacional e internacional.  Esta investigação se propõe a entender os processos enunciativos, e portanto, discursivos e interacionais no uso da materialidade sincrética e audiovisual de anúncios publicitários das marcas Johnnie Walker e Fiat. Tanto a campanha “Keep walking, Brazil” como  a “Vem pra rua” da Fiat foram (re contextualizadas em outros processos enunciativos durante as manifestações brasileiras. Será possível identificar que tipo de interação discursiva ocorre entre marcas e público a partir de tal (re contextualização? Qual relação enunciativa existe entre as marcas e as manifestações e quais são os papeis enunciativos e discursivos propostos por tal relação?  Tais perguntas irão nos levar ao contexto de produção das campanhas, mas também a uma nova apreensão de sentido pautada por processos enunciativos que não os das próprias marcas, mas sim, de novas posições enunciativas. A base metodológica guia-se pelos estudos da Semiótica Discursiva de A. J. Greimas e pelos pressupostos teóricos da Sociossemiótica proposto por Eric Landowski e nas pesquisas de Ana Claudia de Oliveira.

  17. A cultura organizacional do restaurante chalé da praça XV em Porto Alegre: espaços e tempos sendo revelados

    Directory of Open Access Journals (Sweden)

    Letícia Dias Fantinel

    2010-02-01

    Full Text Available Este estudo busca desvendar aspectos da cultura organizacional de um restaurante, ponto turístico da cidade de Porto Alegre, compreendendo sua dimensão simbólica por meio das representações sociais que circulam em seu ambiente, notadamente no que tange às categorias espaço e tempo. Em virtude da complexidade do tema, foram utilizados conceitos e quadros de referência teóricos da antropologia e de outras ciências humanas. O Chalé da Praça XV é um patrimônio que se localiza no centro histórico da cidade, espaço antigo, valorizado no passado pela população e hoje considerado uma vítima da degradação urbana. O método etnográfico foi utilizado na identificação das representações que circulam nesse espaço. O trabalho de campo etnográfico foi conduzido no restaurante entre fevereiro e maio de 2008. Identificaram-se as representações de tempo e espaço elaboradas por clientes e funcionários do restaurante, e desvendaram-se as homogeneidades e as heterogeneidades de sua cultura organizacional. As categorias de análise estabelecidas evidenciam as heterogeneidades presentes em seu espaço como lugar antropológico. Por fim, apresentam-se algumas alternativas para que se pense a gestão do estabelecimento, considerando, entre outros aspectos, seu potencial turístico insuficientemente explorado.

  18. Entre la literatura y la práctica política. Una aproximación a la Venezuela de Rómulo Gallegos

    Directory of Open Access Journals (Sweden)

    Lisandro Angelini

    2014-01-01

    Full Text Available La trayectoria de Rómulo Gallegos, reflejada en sus obras literarias, así como en su rol intelectual y político, resulta una opción pertinente para el análisis del pensamiento de este autor durante el período de consolidación del modelo de Estado-Nación venezolano moderno. Así, el objetivo general de este trabajo es determinar la interacción entre la producción literaria de Rómulo Gallegos y el pro- ceso de construcción del Estado-Nación, teniendo como referencia las condiciones sociales, culturales y políticas del espacio venezolano y el contexto latinoamericano del siglo XX. En tanto que como objetivos específicos se persigue, en primer lugar, identificar el rol intelectual de Gallegos y princi- palmente el impacto de su obra durante la primera mitad del siglo XX. En segundo lugar, analizar las preocupaciones políticas del autor, y el modo en que estas condicionan y contribuyen al contenido de sus narraciones literarias. Respecto al abordaje metodológico de la investigación, este se ha planteado en términos cuali- tativos, debido al carácter del problema y los objetivos definidos. Se ha realizado paralelamente una lectura profunda de las fuentes obtenidas, así como de la bibliografía en general, procediendo a su recolección y organización de las mismas siguiendo la lógica de los objetivos propuestos. Los resultados a los que nos ha conducido el relevamiento de las fuentes y la bibliografía, po- nen de manifiesto que el intento de reconfigurar el relato fundacional venezolano desde la ficción literaria, por un lado, y el objetivo de consolidar un proyecto político renovador, por otro, si bien gozaron de una amplia difusión editorial, no pudieron verse materializados desde la práctica polí- tica, ya que un golpe de Estado, que alejó a Gallegos tempranamente del poder ejecutivo, reinstauró en Venezuela una visión republicana tradicional y un gobierno elitista y autoritario.

  19. Primary care practice-based care management for chronically ill patients (PraCMan: study protocol for a cluster randomized controlled trial [ISRCTN56104508

    Directory of Open Access Journals (Sweden)

    Baldauf Annika

    2011-06-01

    Full Text Available Abstract Background Care management programmes are an effective approach to care for high risk patients with complex care needs resulting from multiple co-occurring medical and non-medical conditions. These patients are likely to be hospitalized for a potentially "avoidable" cause. Nurse-led care management programmes for high risk elderly patients showed promising results. Care management programmes based on health care assistants (HCAs targeting adult patients with a high risk of hospitalisation may be an innovative approach to deliver cost-efficient intensified care to patients most in need. Methods/Design PraCMan is a cluster randomized controlled trial with primary care practices as unit of randomisation. The study evaluates a complex primary care practice-based care management of patients at high risk for future hospitalizations. Eligible patients either suffer from type 2 diabetes mellitus, chronic obstructive pulmonary disease, chronic heart failure or any combination. Patients with a high likelihood of hospitalization within the following 12 months (based on insurance data will be included in the trial. During 12 months of intervention patients of the care management group receive comprehensive assessment of medical and non-medical needs and resources as well as regular structured monitoring of symptoms. Assessment and monitoring will be performed by trained HCAs from the participating practices. Additionally, patients will receive written information, symptom diaries, action plans and a medication plan to improve self-management capabilities. This intervention is addition to usual care. Patients from the control group receive usual care. Primary outcome is the number of all-cause hospitalizations at 12 months follow-up, assessed by insurance claims data. Secondary outcomes are health-related quality of life (SF12, EQ5D, quality of chronic illness care (PACIC, health care utilisation and costs, medication adherence (MARS, depression

  20. Revision of the AESJ Standard for Seismic Probabilistic Risk Assessment (PRA). Updating requirements based on the lessons learned from the Fukushima Dai-ichi NPP Accidents (3). Fragility evaluation and outline of the updated points

    International Nuclear Information System (INIS)

    Yamaguchi, Akira; Nakamura, Susumu; Mihara, Yoshinori

    2014-01-01

    Lessons learned from Great East Japan earthquake and other new findings had been accumulated on the fragility evaluation of buildings and components. And also new analysis and evaluation method had been proposed with the advancement of recent analysis and evaluation technology. These were reflected in revision of the AESJ Standard for Seismic Probabilistic Risk Assessment (PRA). Scope of the fragility evaluation were extended to all equipment on the site, severe accident management equipment including portable equipment and earthquake concomitant incident (such as tsunami) countermeasure equipment. This article described outlines of updating points of the fragility evaluation of the AESJ Standard for Seismic PRA; (1) requirements for seismic induced other risk evaluations such as fire, inundation and tsunami, (2) simulation technology based on recent findings such as three dimensional responses of buildings / structures and its effect on equipment, (3) requirements of the fragility evaluation for various failure mode of several equipment such as severe accident management equipment, fine failure mode of buildings / structures, failures of equipment related with earthquake concomitant incidents (embankment and seawall) and spent fuel pool, and (4) requirements for the fragility evaluation of aftershocks and soil deformation due to fault displacement. (T. Tanaka)

  1. Learning Astronomy by Playing in a Park. (Spanish Title: Aprender AstronoMía Jugando en Una Plaza.) Aprender Astronomia Brincando em Uma Praça

    Science.gov (United States)

    Camino, Néstor

    2012-12-01

    trabalho alguns jogos de praça, considerados como módulos didáticos para imaginar processos astronômicos, a partir da concepção de que a aprendizagem em Astronomia deve-se desenvolver fortalecendo a relação do próprio corpo com o espaço tridimensional e com o tempo, tal como se vive ao observar o céu, construindo um "diálogo" entre o mundo real e as aprendizagens a construir. Os jogos apresentados (carrosséis e tobogãs) foram desenhados para trabalhar sobre a translação da Terra em torno do Sol, as fases da Lua e a gravidade, e sobre o que um observador percebe dos mesmos. Dá-se a descrição de cada jogo, discutem-se seus fundamentos físicos e astronômicos, e desenvolve-se uma crítica didática dos mesmos. Finalmente, comenta-se o papel que deveriam ter os docentes no apoio aos aprendizes no processo de interação com os jogos apresentados.

  2. Ovos de Toxocara sp. e larvas de Ancylostoma sp. em praça pública de Lavras, MG Toxocara sp. eggs and Ancylostoma sp. larva in public parks, Brazil

    Directory of Open Access Journals (Sweden)

    Antônio Marcos Guimarães

    2005-04-01

    Full Text Available Larva migrans visceral e cutânea são zoonoses parasitárias causadas pela infecção da larva de Toxocara sp. e Ancylostoma sp., respectivamente. O objetivo do estudo foi verificar a contaminação por ovos de Toxocara sp. e ovos e larvas de Ancylostoma sp. em amostras de solos coletadas de praças públicas e de áreas de recreação infantil de Lavras, Estado de Minas Gerais, por meio da técnica de centrífugo-flutuação e do método de Baermann. A ocorrência de ovos de Toxocara sp. e, ovos e larvas de Ancylostoma sp. foi observada em 69,6% (16/23 das amostras de solo coletadas de praças públicas. A contaminação somente por ovos de Ancylostoma sp. em amostras de solo coletadas em escolas/creches foi de 22,2% (4/18. A percentagem de amostras de areia coletadas de escolas/creches contaminadas somente com larvas de Ancylostoma sp. foi de 11,1% (2/18. Praças públicas são as áreas com maior risco potencial de infecção por Toxocara sp. e Ancylostoma sp. Exame coproparasitológico realizado em 174 amostras de fezes de cães observou 58% e 23%, respectivamente, com ovos de Ancylostoma sp. e Toxocara sp.Visceral and cutaneous larva migrans are parasitic zoonoses caused by the infection of larval nematodes Toxocara sp. and Ancylostoma sp. respectively. The objective of this study was to investigate the contamination by Toxocara sp. eggs and Ancylostoma sp. eggs and larva of soil samples collected from public parks and children's playground areas in state of Minas Gerais, Brazil, using both Baermann's method and centrifugal flotation technique. Toxocara sp. and Ancylostoma sp. eggs were observed in soil samples collected from public squares in 17.4% (4/23 and 69.6 (16/23 respectively. In schools and child day care settings the contamination by Ancylostoma sp. larva in sand samples was 11.1% (2/18. Public parks are settings of more potential risk of Toxocara sp. eggs and Ancylostoma sp. infection. Stool parasitology testing of 174 stool

  3. A paisagem urbana como herança cultural: a praça Santos Dumont, Umuarama, Estado do Paraná, Brasil = The urban landscape as a cultural heritage: Santos Dumont plaza, Umuarama, Paraná State, Brazil

    Directory of Open Access Journals (Sweden)

    Alexander Fabbri Hulsmeyer

    2011-04-01

    Full Text Available A paisagem urbana possui uma forte conotação histórica, e pode ser considerada uma herança cultural. Neste contexto, os espaços livres públicos podem converter-se em registros importantes, fortalecendo tradições, valores e identidades. Nos quatro principais núcleosurbanos projetados pela Companhia de Terras do Norte do Paraná CTNP, e denominada Companhia Melhoramentos Norte do Paraná CMNP após 1942, as praças exercem o papel de elementos ordenadores na configuração dos centros cívico, religioso e comercial, demonstrando a íntima relação entre os espaços livres públicos e seu entorno. Esta pesquisa1 teve o objetivo de analisar, a partir da pesquisa dos registros fotográficos, jornais de época e bibliografia referente àsraízes conceituais do traçado morfológico da cidade e seu contexto histórico, a Praça Santos Dumont, maior praça e palco de importantes momentos da história da jovem cidade de Umuarama, Estado do Paraná.The urban landscape has strong historical meaning because it can be considered as cultural heritage. In this context, public open spaces are important registries, reinforcing traditions, values and identities. In the four main cities projected by the Companhia Melhoramentos Norte do Paraná (CMNP, the squares and plazas carry out the task of ordination elements for the configuration of the civic, religious and commercial centers, reinforcing the close relation between public open spaces and their surroundings. This research was done under the Scientific Initiation Program of Universidade Paranaense, and is about Santos Dumont Plaza, the biggest one that supported important historical moments of earlyUmuarama, in northwestern Paraná, Brazil. The analysis was based on the research of photographic registries, newspapers, and the publications about the conceptual roots of the urban morphology of the city and its historical context.

  4. Toxocara spp. eggs in public squares of Sorocaba, São Paulo State, Brazil Ovos de Toxocara spp. em praças públicas no município de Sorocaba, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Lina Maria De Petrini da Silva COELHO

    2001-08-01

    Full Text Available The visceral larva migrans (VLM is a syndrome observed in human infection with helminth larval eggs such as the Toxocara spp. that usually infects dogs and cats. Among the risk factors involved in the occurrence of VLM, particularly important is the size of these animal populations. Sorocaba is a city with a dog population twice as large as that recommended by the World Health Organization. This fact has led to a survey of the presence of Toxocara spp. eggs in public square soils of this city. Thirty squares were selected, fifteen located in the outskirts of the city and fifteen downtown. Soil samples were collected from five distinct sites in the same area. The material was homogenized and drained and 100 g was mixed with a saturated solution of magnesium sulfate and 5% potassium iodine. The floating material was analyzed under the light microscope. Toxocara spp. eggs were found in 16 squares, nine of which were located in the outskirts of the city and seven downtown. It was concluded that Sorocaba squares present a high rate of contamination with Toxocara spp. eggs. The squares in the outskirts of the city presented a higher occurrence of these eggs in comparison with those downtown, although the difference was not statistically significant (p > 0.05.A larva migrans visceral - LMV - é uma síndrome causada pela infecção humana por ovos larvados de helmintos como o Toxocara spp., que usualmente compromete o cão e o gato. Dentre os fatores de risco para a ocorrência da LMV, destaca-se o tamanho da população desses animais. Sorocaba é uma cidade com uma população canina duas vezes superior à recomendada pela Organização Mundial de Saúde. Este fato levou à pesquisa da presença de ovos de Toxocara spp. no solo de áreas públicas nessa cidade. Foram escolhidas 30 praças, sendo 15 de regiões periféricas e 15 centrais. Coletaram-se amostras de solo de 5 locais distintos da mesma área. O material foi homogeneizado, tamisado e, em

  5. ANALYSIS OF AGRO-ECOLOGICAL SITUATION FOR IDENTIFICATION OF PROBLEMS BY PRA TECHNIQUES IN ADAPTIVE VILLAGE OF KRISHI VIGYAN KENDRA UNDER NEW ALLUVIA ZONE OF MURSHIDABAD DISTRICT OF WEST BENGAL

    Directory of Open Access Journals (Sweden)

    Abhishake Naskar

    2011-07-01

    Full Text Available Agro Ecosystem analysis using the Participatory Rural Appraisal (PRA techniques of an adaptive village (Jainpur of New Alluvial Zone of Murshidabad-Jiaganj block in Murshidabad district, West Bengal revealed that the village basically has rice and jute based farming system. The cropping intensity of the village is 233%. Out of 363 household 80% is engaged in Agriculture, Animal Husbandry and other allied activities. The land availability per household is 0.40 ha. The villagers are mostly scheduled caste. By snow ball technique major problems were identified .On the basis of bio-physical and socio-economic problems, thrust area were selected. Area specific On Farm Trials (OFT in farmers' were conducted on some researchable issues. Front Line Demonstration (FLD, training programme, health camp, awareness camp and other different extension activities were arranged to mitigate the problems.

  6. Failure Modes Taxonomy for Reliability Assessment of Digital Instrumentation and Control Systems for Probabilistic Risk Analysis - Failure modes taxonomy for reliability assessment of digital I and C systems for PRA

    International Nuclear Information System (INIS)

    Amri, A.; Blundell, N.; ); Authen, S.; Betancourt, L.; Coyne, K.; Halverson, D.; Li, M.; Taylor, G.; Bjoerkman, K.; Brinkman, H.; Postma, W.; Bruneliere, H.; Chirila, M.; Gheorge, R.; Chu, L.; Yue, M.; Delache, J.; Georgescu, G.; Deleuze, G.; Quatrain, R.; Thuy, N.; Holmberg, J.-E.; Kim, M.C.; Kondo, K.; Mancini, F.; Piljugin, E.; Stiller, J.; Sedlak, J.; Smidts, C.; Sopira, V.

    2015-01-01

    Digital protection and control systems appear as upgrades in older nuclear power plants (NPP), and are commonplace in new NPPs. To assess the risk of NPP operation and to determine the risk impact of digital systems, there is a need to quantitatively assess the reliability of the digital systems in a justifiable manner. Due to the many unique attributes of digital systems (e.g., functions are implemented by software, units of the system interact in a communication network, faults can be identified and handled online), a number of modelling and data collection challenges exist, and international consensus on the reliability modelling has not yet been reached. The objective of the task group called DIGREL has been to develop a taxonomy of failure modes of digital components for the purposes of probabilistic risk analysis (PRA). An activity focused on the development of a common taxonomy of failure modes is seen as an important step towards standardised digital instrumentation and control (I and C) reliability assessment techniques for PRA. Needs from PRA has guided the work, meaning, e.g., that the I and C system and its failures are studied from the point of view of their functional significance point of view. The taxonomy will be the basis of future modelling and quantification efforts. It will also help to define a structure for data collection and to review PRA studies. The proposed failure modes taxonomy has been developed by first collecting examples of taxonomies provided by the task group organisations. This material showed some variety in the handling of I and C hardware failure modes, depending on the context where the failure modes have been defined. Regarding the software part of I and C, failure modes defined in NPP PRAs have been simple - typically a software CCF failing identical processing units. The DIGREL task group has defined a new failure modes taxonomy based on a hierarchical definition of five levels of abstraction: 1. system level (complete

  7. A praça: intervenções contemporâneas em espaços de património The square: contemporary interventions in heritage places

    Directory of Open Access Journals (Sweden)

    Flavio Barbini

    2012-12-01

    Full Text Available Na cidade portuguesa contemporânea, a praça constitui uma herança urbanística de matriz europeia cujo valor patrimonial é fundamental como parte da história urbana, mas também de sua vivência e memória. Essa matriz foi, posteriormente, exportada para países não europeus, tornando-se indispensável na cidade colonial. Nos últimos 20 anos, as políticas urbanas de salvaguarda e conservação dos centros históricos deram origem a três tipos de ações de remodelação de praças: intervenções da responsabilidade dos serviços técnicos das câmaras municipais; intervenções resultantes de concursos públicos, lideradas por arquitetos; intervenções sob encomenda direta, geralmente coordenadas por arquitetos de reconhecido mérito nacional e internacional. Nesse contexto, existem duas metodologias de projeto fundamentais: de cariz estritamente conservacionista ou mais abertas a uma reinterpretação contemporânea de modelos, desenhos e sistemas construtivos resultantes da cultura urbana local. A opção por uma dessas abordagens é, frequentemente, marcada pela época em que é realizada e está fortemente relacionada com a produção teórica e as cartas e recomendações de organismos internacionais existentes e também com uma prática associada a uma disciplina de intervenção em arquitetura, regida por influências globalizantes. Neste artigo, propõe-se a análise do contexto português, tendo como ponto de chegada um duplo objetivo: fornecer uma análise urbana da intervenção na cidade consolidada, identificando as inflexões fundamentais que lhe deram origem; e estabelecer as bases para um projeto de investigação congénere no espaço da lusofonia, que identifique eventuais semelhanças e dissemelhanças, conducentes ao estudo de uma hipótese de existência de lusofilias urbanas contemporâneas dentro dessa temática.

  8. Presença de ovos de Toxocara spp em praças públicas da cidade de Uberlândia, Minas Gerais, Brasil Presence of Toxocara spp eggs in public squares of Uberlândia city, Minas Gerais, Brazil

    Directory of Open Access Journals (Sweden)

    Julia Maria Costa-Cruz

    1994-02-01

    Full Text Available O objetivo deste trabalho foi verificar a presença de ovos de Toxocara spp nos solos de praças públicas da cidade de Uberlândia, região do Triângulo Mineiro, no período de outubro de 1991 a janeiro de 1992. A cidade possui 89 praças distribuídas em 39 bairros. Para que se tivesse um perfil da ocorrência do parasita, foram colhidas amostras de terra e areia (quando existente de uma praça, determinada por sorteio, por bairro. As amostras de solo homogeneizadas de 5 pontos distintos das 39 praças foram colhidas em frascos plásticos e analisadas empregando-se os métodos de flutuação em solução saturada de cloreto de sódio e de solução saturada de sulfato de magnésio contendo 5% de iodeto de potássio. Para cada amostra foram realizados os dois métodos em duplicata. Os resultados mostraram estarem contaminados os solos de 9 praças (23,07%, das quais 6 localizavam-se próximas ao centro da cidade. A realização de mais de um método laboratorial permitiu a identificação do agente em maior porcentagem de locais.The objective of this study was to verify the presence of Toxocara spp eggs in the public squares ground in Uberlândia, region of Triângulo Mineiro, from October 1991 to January 1992. The city has 89 squares distributed in 39 boroughs. In order to have an outline of the parasite's occurrence, ground and sand (when existent samples were collected from one square per boroughors. The squares were determined by draw. The homogenized ground samples of distinct points of the 39 squares, were colected in plastic flasks and analysed by the methods of fluctuation in sodium chloride saturated solution and magnesium sulphate saturated solution which contained 5% of potassium iodate. Both methods were executed twice for each sample. The results showed that the ground of 9 squares (23.07% was contaminated, 6 of which were located near downtown. The execution of more than one laboratorial method permited the agent's identification

  9. Overview of NRC PRA research program

    International Nuclear Information System (INIS)

    Cunningham, M.A.; Drouin, M.T.; Ramey-Smith, A.M.; VanderMolen, M.T.

    1997-01-01

    The NRC's research program in probabilistic risk analysis includes a set of closely-related elements, from basic research to regulatory applications. The elements of this program are as follows: (1) Development and demonstration of methods and advanced models and tools for use by the NRC staff and others performing risk assessments; (2) Support to agency staff on risk analysis and statistics issues; (3) Reviews of risk assessments submitted by licensees in support of regulatory applications, including the IPEs and IPEEEs. Each of these elements is discussed in the paper, providing highlights of work within an element, and, where appropriate, describing important support and feedback mechanisms among elements

  10. Something important is missing from PRA

    International Nuclear Information System (INIS)

    Ward, D.A.

    1991-01-01

    This paper provides some views on priorities and directions for the future or risk management. There are some problems with the priorities and directions that now seem dominant. Norm Rasmussen of MIT and the late Saul Levine, who was then with the U.S. Atomic Energy Commission (AEC) (the NRC's predecessor), and their colleagues deserve much credit for the invention of the art of Probabilistic Risk Assessment. Certainly the elements of risk analysis were well known and used, at least implicitly, in much of engineering and technology. But, WASH-1400, The Reactor Safety Study issued in 1975, put these elements together in a comprehensive and courageously rational way

  11. Applications of PRA in nuclear criticality safety

    International Nuclear Information System (INIS)

    McLaughlin, T.P.

    1992-01-01

    Traditionally, criticality accident prevention at Los Alamos National Laboratory (LANL) has been based on a thorough review and understanding of proposed operations or changes to operations involving both process supervision and criticality safety staff. The outcome of this communication was usually an agreement, based on professional judgment, that certain accident sequences were credible and had to be precluded by design; others were incredible and thus did not warrant expenditures to further reduce their likelihood. The extent of documentation was generally in proportion to the complexity of the operation but never as detailed as that associated with quantified risk assessments. During the last 3 yr, nuclear criticality safety-related probabilistic risk assessments (PRAs) have been performed on operations in two LANL facilities. Both of these were conducted in order to better understand the cost/benefit aspects of PRAs as they apply to largely hands-on operations with fissile material

  12. Praça adaptada de um centro de reabilitação em Pelotas/RS: a visão de profissionais e estagiários atuantes no local / An adapted square in a rehabilitation center in Pelotas/RS: the view of professionals and trainees working there

    Directory of Open Access Journals (Sweden)

    Franciele Costa Berní

    2018-01-01

    Full Text Available O terapeuta ocupacional é o profissional que estuda a ocupação humana, intervindo no desempenho das habilidades físicas, mentais, sociais e ambientais de cada indivíduo, a fim de proporcionar a participação deste nas atividades em casa, na escola e no trabalho. O brincar favorece a intervenção terapêutica e está presente em diversos contextos da vida das crianças e adolescentes, inclusive no contexto de uma praça adaptada. Desta forma, este estudo tem como objetivo verificar a percepção de profissionais de um centro de reabilitação de crianças e adolescentes com deficiência, e estagiários de Terapia Ocupacional, sobre a utilização de uma praça adaptada como um recurso terapêutico e de recreação. Para isto, identificou-se uma amostra composta por 20 sujeitos, de ambos os sexos. Foram utilizados dois questionários semiestruturados para coleta dos dados, ambos com a mesma finalidade, porém com linguagens adaptadas a cada área de atuação. A partir disto, constatou-se idade média de 33 anos, e diferenças nas respostas dos profissionais e estagiários em relação as atividades e objetivos propostos na praça adaptada, bem como na identificação desta como um recurso terapêutico. Todos os pesquisados qualificaram a praça como importante para instituição. Este estudo identificou que a praça adaptada é um ambiente utilizado como recurso terapêutico/pedagógico pelos sujeitos, porém, ainda é uma área inovadora para a Terapia Ocupacional, a qual busca aprimorar o desempenho ocupacional dos indivíduos. No entanto, são necessários novos estudos que possam auxiliar na fidedignidade destes resultados, e evidenciar as possibilidades de atuação do terapeuta ocupacional neste âmbito. Abstract An occupational therapist is a professional who studies human occupation by intervening in the performance of physical, mental, social and environmental skills of each subject in order to provide their participation in

  13. DETECÇÃO DO COMPLEXO Mycobacterium tuberculosis NO LEITE PELA REAÇÃO EM CADEIA DA POLIMERASE SEGUIDA DE ANÁLISE DE RESTRIÇÃO DO FRAGMENTO AMPLIFICADO (PRA DETECTION OF Mycobacterium tuberculosis COMPLEX BY PCR-RESTRICTION FRAGMENT LENGTH POLYMORFISM ANALYSIS OF THE HSP65 GENE

    Directory of Open Access Journals (Sweden)

    Joab Trajano Silva

    2008-12-01

    Full Text Available Mycobacterium bovis é membro do complexo Mycobacterium tuberculosis (MTBC, grupo este composto por espécies com grande homologia genética. É o agente etiológico da tuberculose bovina, importante zoonose transmissível ao homem, principalmente através da inalação do bacilo e/ou pelo consumo de leite e derivados não-pasteurizados provenientes de vacas tuberculosas. O objetivo deste estudo foi padronizar a identificação de micobactérias do complexo M. tuberculosis presentes no leite, por metodologia molecular. Fez-se a extração de DNA diretamente do leite contaminado e realizou-se a identificação molecular pela reação em cadeia da polimerase seguida de análise de restrição do fragmento amplificado (PRA. Utilizaram-se inhagens de referência e leite cru artificialmente contaminado com M. bovis IP. Um fragmento de 441pb do gene hsp65 foi amplificado, tratado com BstEII e HaeIII e empregou-se o perfil de restrição enzimática obtido para identificar o complexo M. tuberculosis no leite. Com a PRA foi possível detectar com especificidade e sensibilidade a presença de M. bovis em até 10 UFC/mL de leite. A metodologia padronizada poderá auxiliar os métodos microbiológicos e bioquímicos tradicionalmente usados na identificação do bacilo em alimentos suspeitos de contaminação, como, por exemplo, o leite proveniente de animais suspeitos de infecção por M. bovis.

    Palavras-chaves: Análise de perfil de restrição enzimática (PRA, complexo Mycobacterium tuberculosis, leite, Mycobacterium bovis, limite de detecção (PCR. Mycobacterium bovis is a member of the M. tuberculosis complex, a group composed by species with high genetic homology. The pathogen is the etiological agent of bovine tuberculosis, an important zoonosis that is mainly transmitted by inhalation of infectious droplet nuclei or by ingestion of milk and crude milk derivative products from tuberculosis cows. The definitive identification of M. bovis

  14. Contamination of public parks in Presidente Prudente (São Paulo, Brazil by Toxocara spp. eggs Contaminação de praças públicas de Presidente Prudente, São Paulo, Brasil, por ovos de Toxocara spp

    Directory of Open Access Journals (Sweden)

    Vamilton Alvares Santarém

    2012-09-01

    Full Text Available This study aims to evaluate soil contamination by Toxocara spp. eggs in public parks in Presidente Prudente, São Paulo, Brazil. Soil samples (500 g were collected every month over a 12-month period, from 25 parks in different parts of the city (northern, southern, eastern, western and central areas. Two 10-g aliquots of the material collected from each park were subjected to the centrifuge-flotation method to recover Toxocara spp. eggs. Twenty-four out of the 25 squares studied (96.0% were contaminated and the number of eggs recovered ranged from 1 to 398 per sample. Eggs were recovered all over the year. Despite the number being greater in autumn (p O objetivo do estudo foi avaliar a contaminação do solo de praças públicas por ovos de Toxocara spp. em Presidente Prudente, São Paulo. Amostras de solo (500 g foram coletadas mensalmente, durante um período de 12 meses, de 25 praças de cinco diferentes setores da cidade (norte, sul, leste, oeste e central. Duas alíquotas de 10 g do material coletado foram submetidas ao método de centrífugo-flutuação (sulfato de zinco; d = 1.200 g/cm³, para recuperação dos ovos. Das 25 praças estudadas, 24 (96,0% estavam contaminadas e o número variou de 1 a 398 ovos por amostra analisada. A recuperação foi verificada durante todos os meses do ano, sendo maior no outono (p < 0,001. Entretanto, não houve correlação entre o número de ovos e a temperatura média (r = -0,492; p = 0,148 e a precipitação pluviométrica (r = -0,299; p = 0,402 mensal. Não houve influência da localização dos parques sobre a quantidade de ovos (p = 0,7116. Devido ao alto nível de contaminação de parques públicos por ovos de Toxocara spp., a prevenção da contaminação de áreas públicas pelos agentes de larva migrans é indicada.

  15. Avaliação da influência sazonal na incidência de ovos e larvas de parasitos intestinais em praças no município de Macapá-AP | Evaluation of seasonal influence on the incidence of eggs and larvae of intestinal parasites in squares in the city of Macapá-AP

    Directory of Open Access Journals (Sweden)

    Felipe Ferreira Rêgo

    2017-05-01

    Full Text Available Doenças relacionadas a parasitoses mostram-se um relevante problema de saúde pública devido às diferentes complicações que estas podem causar, e o fornecimento de dados epidemiológicos tem o objetivo de reverter esse quadro. O trabalho visou avaliar a frequência de ovos e larvas de helmintos no município de Macapá, assim como a influência da sazonalidade na incidência da contaminação das praças públicas nos períodos compreendidos como inverno e verão. Nesse estudo foi analisado uma amostra contendo três pontos estratégicos de solo de cada praça, totalizando 39 praças, divididas em diferentes bairros. A escolha foi feita de acordo com as zonas que dividem o município, totalizando 39 amostras em recipientes devidamente vedados. Os métodos utilizados foram: Hoffman, Direto, Willis e Baermann Moraes. Os resultados mostraram a alta carga parasitária nos locais públicos, principalmente na época do inverno, onde se notou a alta prevalência de ovos Toxocara spp. no período do verão e, no período do inverno, obteve-se a prevalência maior de ovos de Ancylostoma spp., o que justifica uma ação imediata do poder público em relação a presença desses agentes no meio ambiente, com controle de animais, saneamento básico, disponibilização de tratamento e manutenção periódica das praças públicas. ============================================ Diseases related to parasitosis are a relevant public health problem due to the different complications that these can cause, and the provision of epidemiological data is aimed at reversing this situation. The objective of this work was to evaluate the frequency of eggs and larvae of helminths in the county of Macapá, as well as the influence of seasonality on the incidence of contamination of public squares in seasons from winter to summer. In this study 1 sample containing 3 strategic points of soil of each square was analyzed, totaling 39 squares, divided in different

  16. Parasitas zoonóticos em fezes de cães em praças públicas do município de Itabuna, Bahia, Brasil Zoonotic parasites in dog feces at public squares in the municipality of Itabuna, Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Pedro C. Campos Filho

    2008-12-01

    Full Text Available Avaliou-se a contaminação de praças públicas da área urbana do município de Itabuna, BA, Brasil, por parasitos zoonóticos presentes em fezes de cães. Foram coletadas 119 amostras fecais de cães em 10 praças. Logo após, estas fezes foram encaminhadas ao Laboratório de Parasitologia da UESC e analisadas pelo método de Mariano e Carvalho. Do total das amostras analisadas, 56,3% continham alguma forma evolutiva parasitária, sendo o parasita mais freqüente Ancylostoma sp. com 47,9%, seguido por 6,7% de Strongyloides stercortalis, 4,2% tanto para ovos de Toxocara canis quanto de Trichuris vulpis, 2,5% para cistos de Endolimax nana, e 0,8% tanto para cistos de Giardia intestinalis quanto para os de Entamoeba coli.The contamination of public squares by zoonotic potential parasites was evaluated at the urban areas in the municipality of Itabuna Brasil. For such, 119 fecal samples of dogs were collected at 10 public squares. After that, these feces samples were transported to the Parasitology Laboratory in the UESC and they were analyzed by Mariano and Carvalho's method. Of the total analized samples, 56.3% show some parasitic evolutive form. Ancylostoma sp. was the most frequently (47.9%, followed by Strongyloides stercortalis (6.7%, Toxocara canis and Trichuris vulpis eggs (4.2% each, Endolimax nana cysts (2.5%, and Giardia intestinalis and Entamoeba coli cysts (0.8% each.

  17. O processo de renovação das áreas centrais na cidade contemporânea: O caso do conjunto arquitetônico e paisagístico da Praça do Congresso, em Criciúma (SC

    Directory of Open Access Journals (Sweden)

    Gustavo Rogério De Lucca

    2015-05-01

    Full Text Available A expansão urbana desordenada no Brasil e a consolidação da cidade corporativa têm estimulado, com a conivência do Estado neoliberal, a propagação de modos de ocupação cada vez mais vinculados a interesses imobiliários imediatos. A ausência de planejamento urbano de caráter social é percebida principalmente nos médios e grandes centros urbanos, onde se registra um agressivo processo de renovação das áreas centrais, cada vez mais ousado, alterando inclusive, irreversivelmente, a paisagem de núcleos históricos. É o caso de setores da centralidade urbana de Criciúma/SC, cidade produzida sob influências econômicas da mineração de carvão e, posteriormente, por outras atividades industriais. É destaque o conjunto arquitetônico e paisagístico da Praça do Congresso, objeto de estudo deste artigo, formado a partir das primeiras décadas do século XX com residências em estilos variados, desde chalés com influências no Romantismo europeu a exemplares da arquitetura modernista. Juntas com a praça, configuravam um espaço de referência em qualidade de vida e importante para a preservação de vínculos identitários e de memória. Considera-se, no entanto, que as transformações mais recentes são parte de um quadro nacional de empobrecimento da urbanização e demonstram que a subserviência das políticas públicas a interesses econômicos imediatos tendem a desaparecer, em breve, com parte importante da diversidade dos conjuntos históricos brasileiros.

  18. A literatura infanto-juvenil como “suporte” na formação didática de professores de língua materna: uma reflexão teórico-metodológica a partir do texto de Elias José, em Uma escola assim, eu quero pra mim

    Directory of Open Access Journals (Sweden)

    Maria Lúcia Ribeiro de Oliveira

    2010-11-01

    Full Text Available ResumoO objetivo deste estudo é chamar a atenção dos docentes que trabalham na formação de professores delíngua materna, notadamente nos cursos de pedagogia e letras, para a função didática da literatura infantojuvenil.Em Uma escola assim, eu quero pra mim, publicada em 1997. Elias José, formado em letras epedagogia, aborda problemas e soluções de caráter sociolinguístico que podem ocorrer no contexto da salade aula. Ele conta a trajetória escolar de um menino que falava diferente por ser da zona rural e que, graçasa uma professora cheia de criatividade e intuição pedagógica, consegue transformar o inferno em que elevivia na escola, inicialmente, com uma professora bastante repressora e cheia de preconceito, numverdadeiro paraíso em que estudar era algo prazeroso, lúdico e transformador.

  19. Can professors be socialized in good teaching practices? The case of the Project Visibilidad Socialización Docente de Profesores Universitarios Españoles con Buenas Prácticas Docentes Podem os Professores socializar-se em boas práticas de ensino? O caso do Projeto Visibilidade

    Directory of Open Access Journals (Sweden)

    María Muradás López

    2010-08-01

    ́s presencia en las experiencias de los docentes entrevistados; esto sugiere que reforzando estos elementos de un modo deliberado a nivel institucional se podría mejorar el proceso de socialización de los profesores noveles de Educación Superior, así como sus prácticas docentes.
    O objetivo deste estudo é a análise das experiências de socialização docente vividas pelos professores que participam do projeto Visibilidade. O objetivo principal desse programa era obter de conhecimento dos professores especializados identificados como bons professores em universidades espanholas. A experiência destes professores podem esclarecer como são os processos de socialização professor e insights sobre como melhorar esses processos. Com base na literatura internacional sobre a socialização no Ensino Superior e um modelo de geração indutiva de categorias, foram analisados as experiências de professores ao inicio das suas carreiras docentes. Os dados foram coletados através de entrevistas semi-estruturadas. Achamos que os modelos de socialização, a auto-reflexão, e socialização formal são os temas com maior presença nas experiências dos professores entrevistados, sugerindo que o fortalecimento desses elementos em um nível institucional pode melhorar o processo de socialização dos professores novatos e as suas práticas de ensino.

  20. The RISMC approach to perform advanced PRA analyses - 15332

    International Nuclear Information System (INIS)

    Mandelli, D.; Smith, C.; Riley, T.; Nielsen, J.; Alfonsi, A.; Rabiti, C.; Cogliati, J.

    2015-01-01

    The existing fleet of nuclear power plants is in the process of extending its lifetime and increasing the power generated from these plants via power up-rates. In order to evaluate the impact of these two factors on the safety of the plant, the RISMC (Risk Informed Safety Margin Characterization) Pathway aims to develop simulation-based tools and methods to assess risks for existing nuclear power plants in order to optimize safety. This pathway, by developing new methods, is extending the state-of-the-practice methods that have been traditionally based on logic structures such as Event-Trees and Fault-Trees. These static types of models mimic system response in an inductive and deductive way respectively, yet are restrictive in the ways they can represent spatial and temporal constructs. RISMC analyses are performed by using a combination of thermal-hydraulic codes and a stochastic analysis tool (RAVEN)currently under development at the Idaho National Laboratory. This paper presents a case study in order to show the capabilities of the RISMC methodology to assess impact of power up-rate of a boiling water reactor system during a station blackout accident scenario. We employ the system simulator code, RELAP5-3D, coupled with RAVEN which perform the stochastic analysis. Our analysis is in fact performed by: 1) sampling values of a set of parameters from the uncertainty space of interest, 2) simulating the system behavior for that specific set of parameter values and 3) analyzing the set of simulation runs. Results obtained give a detailed investigation of the issues associated with a plant power up-rate including the effects of station blackout accident scenarios. We are able to quantify how the timing of specific events was impacted by a higher nominal reactor core power. Such safety insights can provide useful information to the decision makers to perform risk informed margins management

  1. Model Penilaian untuk Kematangan Perencanaan Keselamatan dalam Tahap Pra Konstruksi

    Directory of Open Access Journals (Sweden)

    Bambang Endroyo

    2015-10-01

    Full Text Available The construction sector still has a low achievement in safety issues. Fatal accident rate in construction is higher than average rate in other industries. Because of it, need some attention to minimize the rate of accident in construction. This research examined the key factors of safety planning in the pre-construction stage, and it was based on the theories of accidents causation having the upstream approach. Some theories were: Constraint-Response Theory (CR; Construction Design Management (CDM, and the Process Protocol (Pp. This research broke down the three theories above (CR; CDM; Pp into the concept of the key factors of safety planning in pre-construction. Then, the concept was verified by construction practitioners and academician, using Delphi method three rotations. During the verification, from the first to the third round, there were reduction and the addition concept and language appropriateness. The findings of this research were assessment models of maturity safety planning in the pre construction stages. There were two models, the model of "radar chart" or MISAP 1 and the model of "worksheet" or MISAP 2.

  2. Broadening failure rate distributions in PRA uncertainty analyses

    International Nuclear Information System (INIS)

    Martz, H.F.

    1984-01-01

    Several recent nuclear power plant probabilistic risk assessments (PRAs) have utilized broadened Reactor Safety Study (RSS) component failure rate population variability curves to compensate for such things as expert overvaluation bias in the estimates upon which the curves are based. A simple two-components of variation empirical Bayes model is proposed for use in estimating the between-expert variability curve in the presence of such biases. Under certain conditions this curve is a population variability curve. Comparisons are made with the existing method. The popular procedure appears to be generally much more conservative than the empirical Bayes method in removing such biases. In one case the broadened curve based on the popular method is more than two orders of magnitude broader than the empirical Bayes curve. In another case it is found that the maximum justifiable degree of broadening of the RSS curve is to increase α from 5% to 12%, which is significantly less than 20% value recommended in the popular approach. 15 references, 1 figure, 5 tables

  3. Pra Desain Pabrik Dimethyl Ether (DME dari Gas Alam

    Directory of Open Access Journals (Sweden)

    Ajeng Puspitasari Yudiputri

    2014-09-01

    Full Text Available Berdasarkan data PT Pertamina (Persero, total konsumsi LPG 2008 mencapai 1,85 juta ton dan 600.000 ton di antaranya untuk program konversi. Pada 2009 kebutuhan LPG akan meningkat menjadi 3,67 juta ton dan 2 juta ton di antaranya untuk program konversi sampai akhir tahun. Namun, sumber pasokan LPG dari dalam negeri diperkirakan tidak akan beranjak dari angka 1,8 juta ton per tahun dalam beberapa tahun mendatang. Sehingga, Indonesia harus menutup kebutuhan dengan mengimpor LPG dalam jumlah cukup besar. Maka dari itu dibutuhkan bahan bakar gas lain yang mampu mengatasi permasalahan yang ditimbulkan tersebut. Dimethyl Ether (DME merupakan senyawa ether yang paling sederhana dengan rumus kimia CH3OCH3. Produksi DME dapat dihasilkan melalui sintesis gas alam. DME berbentuk gas yang tidak berwarna pada suhu ambien, zat kimia yang stabil, dengan titik didih -25,1oC. Tekanan uap DME sekitar 0,6 Mpa pada 25oC dan dapat dicairkan seperti halnya LPG. Viskositas DME 0,12-0,15 kg/ms, setara dengan viskositas propana dan butane (konstituen utama LPG, sehingga infrastruktur untuk LPG dapat juga digunakan untuk DME. Berdasarkan data Departemen ESDM pada Januari 2012, total cadangan gas alam Indonesia tercatat mencapai 150,70 Trillion Square Cubic Feet (TSCF. Berdasarkan jumlah tersebut, sebanyak 103,35 TSCF merupakan gas alam terbukti, sementara 47,35 TSCF sisanya masih belum terbukti. Berdasarkan hal tersebut, diketahui bahwa senyawa DME merupakan senyawa yang sesuai untuk bahan substitusi LPG. Dan ditinjau dari analisa ekonomi, didapatkan besar Investasi : $ 636,447,074.69 ; Internal Rate of Return\t: 20.51%; POT: 4.13 tahun; BEP : 37.36 %; dan NPV 10 year : $ 518,848,692. Dari ketiga parameter sensitifitas yaitu fluktuasi biaya investasi, harga bahan baku, dan harga jual dari produk, terlihat bahwa ketiganya tidak memberikan pengaruh yang cukup signifikan terhadap kenaikan atau penurunan nilai IRR pabrik. Sehingga pabrik DME dari Gas Alam ini layak untuk didirikan.

  4. Quantification methodology for the French 900 MW PWR PRA

    International Nuclear Information System (INIS)

    Ducamp, F.; Lanore, J.M.; Duchemin, B.; De Villeneuve, M.J.

    1985-02-01

    This paper develops some improvements brought to provide to the classical way of risk assessment. The calculation of the contribution to the risk of one peculiar sequence of an event tree is composed of four stages: creation of a fault tree for each system which appears in the event trees, in terms of component faults; simplification of these fault trees into smaller ones, in terms of macrocomponents; creation of one ''super-tree'' by regrouping the fault trees of down systems (systems which fail in the sequence) under an AND gate and calculation of minimal cut sets of this super-tree, taking into account the up systems (systems that do not fail in the sequence) and peculiarities related to the initiating event if needed; quantification of the minimal cut sets so obtained, taking into account the duration of the scenario depicted by the sequence and the possibilities of repair. Each of these steps is developed in this article

  5. PENGARUH TRADISI ARAB PRA ISLAM TERHADAP HUKUMAN RAJAM

    OpenAIRE

    Ali Ali

    2014-01-01

    This article was written to answer the question of how the punishment of adultery in the tradition of pre-Islamic Arabia and whether the punishment of stoning in adultery punishment traditions influenced by pre-Islamic? This is also done as most of the literature (especially fiqh) which is likely to assume muhsan stoning sentence for the perpetrator is Sunnah and is therefore considered final. This is different from the Qur'an which contains only the caning without perpetrator category. The a...

  6. Top event prevention analysis - a deterministic use of PRA

    International Nuclear Information System (INIS)

    Blanchard, D.P.; Worrell, R.B.

    1995-01-01

    Risk importance measures are popular for many applications of probabilistic analysis. Inherent in the derivation of risk importance measures are implicit assumptions that those using these numerical results should be aware of in their decision making. These assumptions and potential limitations include the following: (1) The risk importance measures are derived for a single event at a time and are therefore valid only if all other event probabilities are unchanged at their current values. (2) The results for which risk importance measures are derived may not be complete for reasons such as truncation

  7. Pra Desain Pabrik Sorbitol dari Tepung Tapioka dengan Hidrogenasi Katalitik

    Directory of Open Access Journals (Sweden)

    Hellen Kartika Dewi

    2014-03-01

    Full Text Available Sorbitol yang dikenal juga sebagai glusitol, adalah suatu gula alkohol yang dimetabolisme lambat di dalam tubuh. Sorbitol banyak digunakan sebagai bahan baku untuk industri barang konsumsi dan makanan seperti pasta gigi, permen, kosmetika, farmasi, vitamin C, termasuk industri tekstil dan kulit. Pembuatan sorbitol dari bahan baku tepung tapioka. Pabrik sorbitol ini direncanakan akan didirikan di Propinsi Jawa Tengah tepatnya di Kabupaten Batang dengan kapasitas produksi 30.000 ton/tahun. Proses produksi Sorbitol menggunakan proses hidrogenasi katalitik. Pembuatan sorbitol dari bahan baku pati melalui dua tahap proses utama yaitu proses perubahan starch menjadi glukosa melalui hidrolisa double enzym. Enzim yang digunakan yaitu α-amylase dan glukoamylase. Proses hidrogenasi katalitik dilakukan dengan mereaksikan larutan dekstrose dan gas hidrogen bertekanan tinggi dengan menambahkan katalis nikel dalam reaktor (Reaktor Hidrogenasi. Gas hidrogen masuk dari bawah reaktor secara bubbling dan larutan dekstrose diumpankan dari atas reaktor sehingga kontak yang terjadi semakin baik. Sorbitol yang di hasilkan dalam pradesain pabrik sorbitol ini dengan konsentrasi 58,2%. Pendirian pabrik sorbitol memerlukan biaya investasi modal tetap (fixed capital sebesar Rp 168.801.192.952, modal kerja (working capital  Rp 29.788.445.815, investasi total Rp 198.589.638.767, Biaya produksi per tahun Rp 368.832.813.809 dan  hasil penjualan per tahun Rp 540.000.078.750. Dari analisa ekonomi didapatkan BEP sebesar 26,32%. ROI sesudah pajak 48,5 %, POT sesudah pajak 2,14 tahun. Dari segi teknis dan ekonomis, pabrik ini layak untuk didirikan.

  8. KONTRIBUSI PEMIKIRAN MUHAMMAD SAW PRA DAN PASCA KENABIAN ERA MAKKIAH

    Directory of Open Access Journals (Sweden)

    Agus Jaya

    2011-11-01

    Full Text Available Abstract:Muhammad is the greatest phenomenon in human history. Signs He enshrined in the presence of the holy scriptures is  as a justification former glory. His presence was expected by every group and interest, although later become a boomerang for them because the treatise was carrying remodel beliefs and traditions handed down from their ancestors. The suffering experiences completed His life’s history  as a candidate of  a prophet. Born with orphan status, grew by profession and lived as a shepherd, had suffering experiences has  formed  the identity of Muhammad to become an intelligent and wise leader. Muhammad's intelligence and wisdom in deciding the issue and genius as well as the accuracy of missionary strategy embedded in the period of Mecca is the contribution of thinking which is priceless. Keywords: the contribution of ideas, leadership training, intelligence, wisdom, leadership characteristics

  9. Improvement of human reliability analysis method for PRA

    International Nuclear Information System (INIS)

    Tanji, Junichi; Fujimoto, Haruo

    2013-09-01

    It is required to refine human reliability analysis (HRA) method by, for example, incorporating consideration for the cognitive process of operator into the evaluation of diagnosis errors and decision-making errors, as a part of the development and improvement of methods used in probabilistic risk assessments (PRAs). JNES has been developed a HRA method based on ATHENA which is suitable to handle the structured relationship among diagnosis errors, decision-making errors and operator cognition process. This report summarizes outcomes obtained from the improvement of HRA method, in which enhancement to evaluate how the plant degraded condition affects operator cognitive process and to evaluate human error probabilities (HEPs) which correspond to the contents of operator tasks is made. In addition, this report describes the results of case studies on the representative accident sequences to investigate the applicability of HRA method developed. HEPs of the same accident sequences are also estimated using THERP method, which is most popularly used HRA method, and comparisons of the results obtained using these two methods are made to depict the differences of these methods and issues to be solved. Important conclusions obtained are as follows: (1) Improvement of HRA method using operator cognitive action model. Clarification of factors to be considered in the evaluation of human errors, incorporation of degraded plant safety condition into HRA and investigation of HEPs which are affected by the contents of operator tasks were made to improve the HRA method which can integrate operator cognitive action model into ATHENA method. In addition, the detail of procedures of the improved method was delineated in the form of flowchart. (2) Case studies and comparison with the results evaluated by THERP method. Four operator actions modeled in the PRAs of representative BWR5 and 4-loop PWR plants were selected and evaluated as case studies. These cases were also evaluated using THERP method to compare the results with the improved method. In general, HEPs evaluated by the improved method are greater than HEPs evaluated by THERP method. (3) Characteristics of the improved HRA method. As many reference tables which can be applied for various cases are prepared in the improved HRA method, the prospect of realization of reproducibility, i.e. similar results are obtained independently to analysis, and traceability, i.e. process to the final results is clear and is also to be shared among analysts, can be said to be achieved. (author)

  10. Causative mutations for progressive retinal atrophy (PRA) in the dog

    Czech Academy of Sciences Publication Activity Database

    Dostál, Jaromír; Horák, Pavel; Bechyňová, Renata; Přibáňová, M.; Stratil, Antonín; Schröffelová, D.

    2008-01-01

    Roč. 25, č. 1 (2008), s. 55-58 ISSN 1803-4403. [Genetické dny /23./. České Budějovice, 10.09.2008-12.09.2008] Institutional research plan: CEZ:AV0Z50450515 Keywords : progressive retinal atrophy * dog Subject RIV: EB - Genetics ; Molecular Biology

  11. Loss of spent fuel pool cooling PRA: Model and results

    International Nuclear Information System (INIS)

    Siu, N.; Khericha, S.; Conroy, S.; Beck, S.; Blackman, H.

    1996-09-01

    This letter report documents models for quantifying the likelihood of loss of spent fuel pool cooling; models for identifying post-boiling scenarios that lead to core damage; qualitative and quantitative results generated for a selected plant that account for plant design and operational practices; a comparison of these results and those generated from earlier studies; and a review of available data on spent fuel pool accidents. The results of this study show that for a representative two-unit boiling water reactor, the annual probability of spent fuel pool boiling is 5 x 10 -5 and the annual probability of flooding associated with loss of spent fuel pool cooling scenarios is 1 x 10 -3 . Qualitative arguments are provided to show that the likelihood of core damage due to spent fuel pool boiling accidents is low for most US commercial nuclear power plants. It is also shown that, depending on the design characteristics of a given plant, the likelihood of either: (a) core damage due to spent fuel pool-associated flooding, or (b) spent fuel damage due to pool dryout, may not be negligible

  12. Enhanced Fire Events Database to Support Fire PRA

    International Nuclear Information System (INIS)

    Baranowsky, Patrick; Canavan, Ken; St. Germain, Shawn

    2010-01-01

    This paper provides a description of the updated and enhanced Fire Events Data Base (FEDB) developed by the Electric Power Research Institute (EPRI) in cooperation with the U.S. Nuclear Regulatory Commission (NRC). The FEDB is the principal source of fire incident operational data for use in fire PRAs. It provides a comprehensive and consolidated source of fire incident information for nuclear power plants operating in the U.S. The database classification scheme identifies important attributes of fire incidents to characterize their nature, causal factors, and severity consistent with available data. The database provides sufficient detail to delineate important plant specific attributes of the incidents to the extent practical. A significant enhancement to the updated FEDB is the reorganization and refinement of the database structure and data fields and fire characterization details added to more rigorously capture the nature and magnitude of the fire and damage to the ignition source and nearby equipment and structures.

  13. EVNTRE, Code System for Event Progression Analysis for PRA

    International Nuclear Information System (INIS)

    2002-01-01

    1 - Description of program or function: EVNTRE is a generalized event tree processor that was developed for use in probabilistic risk analysis of severe accident progressions for nuclear power plants. The general nature of EVNTRE makes it applicable to a wide variety of analyses that involve the investigation of a progression of events which lead to a large number of sets of conditions or scenarios. EVNTRE efficiently processes large, complex event trees. It can assign probabilities to event tree branch points in several different ways, classify pathways or outcomes into user-specified groupings, and sample input distributions of probabilities and parameters. PSTEVNT, a post-processor program used to sort and reclassify the 'binned' data output from EVNTRE and generate summary tables, is included. 2 - Methods: EVNTRE processes event trees that are cast in the form of questions or events, with multiple choice answers for each question. Split fractions (probabilities or frequencies that sum to unity) are either supplied or calculated for the branches of each question in a path-dependent manner. EVNTRE traverses the tree, enumerating the leaves of the tree and calculating their probabilities or frequencies based upon the initial probability or frequency and the split fractions for the branches taken along the corresponding path to an individual leaf. The questions in the event tree are usually grouped to address specific phases of time regimes in the progression of the scenario or severe accident. Grouping or binning of each path through the event tree in terms of a small number of characteristics or attributes is allowed. Boolean expressions of the branches taken are used to select the appropriate values of the characteristics of interest for the given path. Typically, the user specifies a cutoff tolerance for the frequency of a pathway to terminate further exploration. Multiple sets of input to an event tree can be processed by using Monte Carlo sampling to generate approximate mapping from input to output. 3 - Restrictions on the complexity of the problem: A preprocessor program supplied can be used to replace a PARAMETER statement if array sizes require adjustment

  14. PERUBAHAN PANDANGAN ONTOLOGI PADA WAYANG MASA ISLAM DAN PRA ISLAM

    Directory of Open Access Journals (Sweden)

    Nurhadi Siswanto

    2017-03-01

    Full Text Available Puppet has developments and changes over time. Puppet continues to grow and develop in accordance with the development of the dominant civilization that accompanies it. A change in the function of puppet strikingly occurs in Islam and pre-Islamic era. Puppet that previously acted as a form of religious ritual to worship the ancestors and the ‘Dewa’ has been changes in function to serve as a media for the sake of religion propaganda and education. There was also a change on the ontological view in puppet. The changes occur due to difference concept of Deity’s thought in Islam and Hinduism. The Islam belief that does not recognize the concept ‘dewa’, it is not eliminating the existence of ‘dewa’ in various puppet stories, but instead desecrated it. ‘Dewa’ no longer considered sacred, perfect and unbeatable, but the god is considered common creatures that could also be defeated and make mistakes.

  15. Validation and verification plan for safety and PRA codes

    International Nuclear Information System (INIS)

    Ades, M.J.; Crowe, R.D.; Toffer, H.

    1991-04-01

    This report discusses a verification and validation (V ampersand V) plan for computer codes used for safety analysis and probabilistic risk assessment calculations. The present plan fulfills the commitments by Westinghouse Savannah River Company (WSRC) to the Department of Energy Savannah River Office (DOE-SRO) to bring the essential safety analysis and probabilistic risk assessment codes in compliance with verification and validation requirements

  16. Use of PRA methodology for enhancing operational safety and reliability

    International Nuclear Information System (INIS)

    Chu, B.; Rumble, E.; Najafi, B.; Putney, B.; Young, J.

    1985-01-01

    This paper describes a broad scope, on-going R and D study, sponsored by the Electric Power Research Institute (EPRI) to utilize key features of the state-of-the-art plant information management and system analysis techniques to develop and demonstrate a practical engineering tool for assisting plant engineering and operational staff to perform their activities more effectively. The study is foreseen to consist of two major activities: to develop a user-friendly, integrated software system; and to demonstrate the applications of this software on-site. This integrated software, Reliability Analysis Program with In-Plant Data (RAPID), will consist of three types of interrelated elements: an Executive Controller which will provide engineering and operations staff users with interface and control of the other two software elements, a Data Base Manager which can acquire, store, select, and transfer data, and Applications Modules which will perform the specific reliability-oriented functions. A broad range of these functions has been envisaged. The immediate emphasis will be focused on four application modules: a Plant Status Module, a Technical Specification Optimization Module, a Reliability Assessment Module, and a Utility Module for acquiring plant data

  17. POLA ASUH KELUARGA DAN PERKEMBANGAN EMOSIONAL ANAK PRA SEKOLAH

    OpenAIRE

    WANDA, RUNI; NYOKO, YUNETI OCTAVIANUS; KODY, MARTHA METI; AGUSTINE, ULY

    2017-01-01

    Introduction:The family is the first and main vehicle for character education. If a family fails to educate character on its children, it will be difficult for other institutions outside the family to improve it and will affect the child's own emotional development. Based on the observation of some students who have not been active during the learning process is going on, often disrupt his friends while playing, fighting and grabbing toys. The purpose of this research is to know the descripti...

  18. Les peintures murales dans les anciens territoires de Bourgogne (xie-xiie siècles. De Berzé-la-Ville à Rome et d’Auxerre à Compostelle

    Directory of Open Access Journals (Sweden)

    Juliette Rollier-Hanselmann

    2010-10-01

    Full Text Available L'étude des peintures murales de Bourgogne est complexe et doit être mise en relation avec le contexte historique et géopolitique de l’époque. Le duché de Bourgogne se trouvait dans une position stratégique entre le royaume de France et l’empire germanique. L’implantation de Cluny à la frontière de ces deux grands territoires marqua d’une façon particulière la région et eut des implications fortes dans toute la chrétienté occidentale. Nous avons réuni un corpus de peintures murales des xie et...

  19. Induction of morphological aberrations by enzyme inhibition in Drosophila melanogaster

    NARCIS (Netherlands)

    Bos, M.; Scharloo, W.; Bijlsma, R.; de Boer, I.M.; den Hollander, J.

    1969-01-01

    Zusatz zum Futter vonDrosophila melanogaster von 5-Fluoro-2-deoxyuridin oder Aminopterin induziert überzählige Skutellar- und Dorsozentralborsten sowie gekerbte Flügel. Diese Modifikationen wurden als Konsequenz von Enzymhemmung interpretiert.

  20. Soil Erosion and Sediment Yield Modelling in the Pra River Basin of ...

    African Journals Online (AJOL)

    kusimi

    sediment delivery ratio; soil erosion modelling; sediment yield modelling. .... The basin falls within the wet semi-equitorial climatic belt which is ... influence of the moist south-west monsoons during the rainy season, with high .... availability of good satellite images covering the study area; because of thick cloud cover most.

  1. PERAWATAN PRA PROSTODONTIK DENGAN SPLIN OKLUSAL PADA KASUS KEHILANGAN GIGI YANG DISERTAI GANGGUAN SENDI TEMPOROMANDIBULA

    Directory of Open Access Journals (Sweden)

    Ira S Wardani

    2015-08-01

    Full Text Available Pre-prosthetic treatment is very important step to get a successful prosthodontic treatment. This study reported a case of patient with missing teeth on left and right lower first and second molar, with TMJ symptoms. Other symptoms felt by the patients were ear pain, and shoulder pain. After detailed examination, pre-prosthetic treatment needed by the patient was the TMJ treatment. The usage of occlusal splint as one of the methods to treat the TMD were i.e. to eliminate the occlusal disorder, to reduce the neuromuscular activity, and to regain a stable centric relation. After splint treatment, an open bite on the posterior teeth appeared. To solve this problem, a removable frame prosthesis enhanced with overlay rest was fabricated. With this prosthesis, the TMJ symptoms stopped recurring. It was concluded that to achieve a successful prosthesis, a detailed and comprehensive treatment was needed, including the pre-prosthetic treatment, along with the patient’s motivation and cooperation.

  2. Review of the turbine-building flooding study of the Oconee PRA

    International Nuclear Information System (INIS)

    Ilberg, D.; Hanan, N.A.

    1986-01-01

    A peer review of the Oconee Probabilistic Risk Assessment (OPRA) for Unit no. 3 was conducted at BNL for the NRC. This paper discusses the review of the OPRA turbine-building internal-flooding study, which is one of the dominant contributors, and was performed in great detail. This paper also includes a comparison with other flooding studies performed elsewhere. 5 refs., 1 tab

  3. Astronomický ciferník pražského orloje

    Czech Academy of Sciences Publication Activity Database

    Křížek, Filip; Křížek, Michal

    2011-01-01

    Roč. 86, č. 1 (2011), s. 1-6 ISSN 0035-9343 Institutional research plan: CEZ:AV0Z10190503; CEZ:AV0Z10480505 Keywords : great circle * Ptolemy theorem * stereographic projection Subject RIV: BA - General Mathematics

  4. Status of efforts to evaluate LOCA frequency estimates using combined PRA and PFM approaches

    International Nuclear Information System (INIS)

    Wilkowski, G.; Rudland, D.; Tregoning, R.; Scott, P.

    2002-01-01

    The risk-informed reevaluation of 10 CFR 50.46 (along with Appendix K and GDC 35), the emergency core cooling system (ECCS) requirements, utilizes loss of coolant accident (LOCA) initiating event frequencies to evaluate the technical basis for potential related rule changes. A longer-term effort is considering redefining the maximum design basis pipe break size for sizing the ECCS system. In the past few years, the U.S. Nuclear Regulatory Commission (NRC) has utilized NUREG/CR-5750 pipe-break LOCA estimated for initiating event frequencies. However, several failure mechanisms have recently emerged at plants which have not been evident within the service period covered by the NUREG/CR-5750 estimates. The concern is that these and other potential aging-related mechanisms may not be adequately represented within the NUREG/CR-5750 LOCA estimates. Additionally, LOCAs can occur from failure of active components (e.g. safety relief valves, reactor coolant pump seals, etc.) and other non-pipe break passive failures (e.g. steam generator tubes). The LOCA contributions from these additional sources must also be considered in deciding the design basis break size. The LOCA estimates must also attempt to capture expected future changes in the LOCA frequencies so that the estimates are pertinent up through the end of the license renewal period. (orig.)

  5. Verification and validation of the SAPHIRE Version 4.0 PRA software package

    International Nuclear Information System (INIS)

    Bolander, T.W.; Calley, M.B.; Capps, E.L.

    1994-02-01

    A verification and validation (V ampersand V) process has been performed for the System Analysis Programs for Hands-on Integrated Reliability Evaluation (SAPHIRE). SAPHIRE is a set of four computer programs that the Nuclear Regulatory Commission (NRC) developed to perform probabilistic risk assessments (PRAs). These programs allow an analyst to create, quantify, and evaluate the risk associated with a facility or process being analyzed. The programs included in this set are Integrated Reliability and Risk Analysis System (IRRAS), System Analysis and Risk Assessment (SARA), Models and Results Database (MAR-D), and Fault Tree/Event Tree/Piping and Instrumentation Diagram (FEP) graphical editor. The V ampersand V steps included a V ampersand V plan to describe the process and criteria by which the V ampersand V would be performed; a software requirements documentation review to determine the correctness, completeness, and traceability of the requirements; a user survey to determine the usefulness of the user documentation, identification and testing of vital and non-vital features, and documentation of the test results

  6. An evaluation of internal event Level 1 PRA methods used in NUREG-1150

    International Nuclear Information System (INIS)

    Camp, A.L.; Cramond, W.R.

    1989-01-01

    As part of the effort to support NUREG-1150, Sandia National Laboratories and its subcontractors have developed innovative techniques for efficiently performing internal event Level I probabilistic risk assessments. This methodology is one of the alternatives for industry to use in performing individual plant evaluations in the future. While this new methodology was very successful, there are some areas where improvements can be made. This paper evaluates the strengths and weaknesses of the methodology and makes some important recommendations for modifications in order to provide insights to future users

  7. Diablo Canyon internal events PRA [Probabilistic Risk Assessment] review: Methodology and findings

    International Nuclear Information System (INIS)

    Fitzpatrick, R.G.; Bozoki, G.; Sabek, M.

    1990-01-01

    The review of the Diablo Canyon Probabilistic Risk Assessment (DCRPA) incorporated some new and innovative approaches. These were necessitated by the unprecedented size, scope and level of detail of the DCRPA, which was submitted to the NRC for licensing purposes. This paper outlines the elements of the internal events portion of the review citing selected findings to illustrate the various approaches employed. The paper also provides a description of the extensive and comprehensive importance analysis applied by BNL to the DCRPA model. Importance calculations included: top event/function level; individual split fractions; pair importances between frontline-support and support-support systems; system importance by initiator; and others. The paper concludes with a brief discussion of the effectiveness of the applied methodology. 3 refs., 5 tabs

  8. External hazards in the PRA of Olkiluoto 1 and 2 NPP units - Accidental oil spills

    International Nuclear Information System (INIS)

    Tunturivuori, Lasse

    2014-01-01

    Oil transports in Finnish territorial waters have increased significantly during the last 10 years. The Gulf of Finland is at this moment a very important route of oil being transported from Russia to the Western Europe. Although the number of accidental oil spills is decreasing in amount and in size, there is a growing concern of their effects to nuclear power plants (NPPs). The amounts of oil transported on the Gulf of Bothnia are much smaller than on the Gulf of Finland. However, accidental oil spills have occurred also there, the size and amount of which are smaller, though. Accidental oil spills are often a result of grounding of a ship or collision of two ships, and often occur during harsh weather conditions like storm or dense fog. However, also coastal oil depots may break, the oil of which may spread over wide distances on the sea. The modelling of initiating events resulting from accidental oil spills includes oil spill response actions performed by the regional rescue services, alarming of the oil spill by the emergency response centre to the NPP rescue services and spill response by the NPPs rescue services. It is unclear what the consequences are if drifted oil would enter the coolant water tunnels. The effect of different oil types to the operation of the safety-related service water systems and components are being assessed. In the ultimate case, an oil spill would clog the inlet channels thus failing the ultimate heat sink of the NPP units. The licensee is evaluating what is the optimal way to operate the NPP units in the case that an oil slick is threatening the plant to ensure reactor core cooling and RHR. The continued operation of, and especially the cooling of, at least one auxiliary feedwater pump is critical in the mitigation of the initiating event. Strategies, like reversing the water flow of the cooling water channels or closing of the cooling water channels, are being evaluated. (authors)

  9. Bohemicalia Zachiana II. Pražské období Jana Zacha

    Czech Academy of Sciences Publication Activity Database

    Slavický, Tomáš

    2002-01-01

    Roč. 39, č. 1 (2002), s. 3-23 ISSN 0018-7003 Institutional research plan: CEZ:AV0Z8059909 Keywords : Jan Zach * Music in Prague in the 18th Century Subject RIV: AL - Art, Architecture, Cultural Heritage

  10. TERAPI BERMAIN MENDONGENG DAPAT MENURUNKAN TINGKAT KECEMASAN PADA ANAK USIA PRA SEKOLAH AKIBAT HOSPITALISASI

    Directory of Open Access Journals (Sweden)

    Aji Kiyat W ,

    2014-04-01

    Full Text Available Background: Child is a unique individual and can also be sick with a greater risk so they need ahospitalization for diagnosing and treating thedisease. Hospitalization can trigger anxiety. Reaction toanxiety can be shown by, among others: crying, being afraid, being agressive, curiosity, control-lost,confusion, refusing to eat, and refusing invasive treatment. Implementation of care for children can not beseparated with the play therapy as an attempt to decrease anxiety, enhance cooperative behaviour, andstimulate the growth and development of children during their hospitalization. One of the recommendedintervention is storytelling play therapy.Objective:Determine the influence of storytelling play therapy on the level of anxiety in pre-schoolchildren due to hospitalization at cempaka ward RAA Soewondo Pati Hospital.Methods:This study is quassy-experimental research design with a “one-group-before-after” (pretest-posttest design without control group. Total sampel in this study were 19 pre-school children using totalsampling technique. Data collection was performed before and after the treatment using the instrument toknow the level of anxiety that knew as HARS-A and statistic test which used is Wilcoxon signed rank test(α= 0,05.Result:The result of statistic analysis using Wilcoxon signed rank test shows significant p-value=0,000(α= 0,05. It means storytelling play therapy has an influence on the level of anxiety in pre-school childrendue to hospitalization at Cempaka ward RAA Soewondo Pati Hospital.Conclusion:Storytelling play therapy has an effect to decrease the level of anxiety in pre-schoolchildren

  11. PRA has many faces - can the safety goal be well-posed

    International Nuclear Information System (INIS)

    Bargmann, H.

    1983-01-01

    The question is discussed whether probabilistic reliability problems can, principally, be well-posed in practical situations. The problem is reduced to the question whether an underlying probabilistic experiment which is, essentially, the set of outcomes can be precisely specified such that the solution of the problem is unique. Upon reexamination of a classical paradox due to Bertrand and consideration of a typical problem of structural reliability we conclude that the possibility of well-posing a reliability problem should be considered illusory, for fundamental reasons which are inherent in practical situations. In particular, it should not be assumed that a quantitative safety goal could be verified. Generally, a probabilistic assessment should be considered as a quantitative method for establishing rational results which should, however, not be viewed as quantitative measures but as qualitative guides

  12. Proračun produktivnosti zaposlenika na osnovi podataka praćenja proizvodnje

    OpenAIRE

    Dolenc, Filip

    2017-01-01

    U ovom radu analizirala se važnost upravljanja bazama podataka u teorijskom smislu te se na primjeru stvarne tvrtke analizirao proces upravljanja bazama podataka od strane asistenta voditelja odjela. Da bi poduzeće bilo produktivno, odnosno da bi ostvarivalo pozitivne poslovne rezultate, asistent voditelja odjela mora prije konačnog obračuna i analize produktivnosti provjeriti i editirati eventualne greške te pratiti i ažurirati niz drugih datoteka i aktivnosti koje su prikazane u ovom ra...

  13. Identification and analysis of external event combinations for Hanhikivi 1PRA

    Energy Technology Data Exchange (ETDEWEB)

    Helander, Juho [Fennovoima Oy, Helsinki (Finland)

    2017-03-15

    Fennovoima's nuclear power plant, Hanhikivi 1, Pyhäjoki, Finland, is currently in design phase, and its construction is scheduled to begin in 2018 and electricity production in 2024. The objective of this paper is to produce a preliminary list of safety-significant external event combinations including preliminary probability estimates, to be used in the probabilistic risk assessment of Hanhikivi 1 plant. Starting from the list of relevant single events, the relevant event combinations are identified based on seasonal variation, preconditions related to different events, and dependencies (fundamental and cascade type) between events. Using this method yields 30 relevant event combinations of two events for the Hanhikivi site. The preliminary probability of each combination is evaluated, and event combinations with extremely low probability are excluded from further analysis. Event combinations of three or more events are identified by adding possible events to the remaining combinations of two events. Finally, 10 relevant combinations of two events and three relevant combinations of three events remain. The results shall be considered preliminary and will be updated after evaluating more detailed effects of different events on plant safety.

  14. Nirmal Varma o Pražském jaru a srpnu 1968

    Czech Academy of Sciences Publication Activity Database

    Marková, Dagmar

    2008-01-01

    Roč. 63, č. 2 (2008), s. 42-45 ISSN 0029-5302 Institutional research plan: CEZ:AV0Z90210515 Keywords : Nirmal Varma * Prague Spring * Hindi literature Subject RIV: AJ - Letters, Mass-media, Audiovision

  15. Celebrity marketing pražských muzikálů

    OpenAIRE

    Kuzmová, Tereza

    2017-01-01

    This Diploma Thesis deals with the issue of Prague musicals celebrity marketing, which is a significant characteristics of the contemporary Prague musical scene. The theoretical part of this thesis introduces the basic theories of celebrity studies and the specifics of marketing mix of musicals, in which celebrities play a significant role. On the margine, the thesis is also focused on current overproduction of musicals and related problems in marketing activities of musical productions. The ...

  16. HUBUNGAN ANTARA POLA ASUH ORANG TUA DENGAN KETRAMPILAN MOTORIK ANAK PRA SEKOLAH

    Directory of Open Access Journals (Sweden)

    Didik Budijanto

    2012-11-01

    Full Text Available The growth of nucleus family, a couple (wife and husband have to work outdoor, prosecute their role in caring their children. The  pattern in caring the children changed, which the husband has to do more actively. The objective of the study was to learn the relationship between parents role in caring children with motoric creatively among pre-pupil. The population of this study was pre-pupil of Dharma Wanita II/IKIP kindergarten Surabaya. 42 children and their parents were selected by applying simple random sampling. Data was collected by observation and interview. Variables were measured from children motoric creativity, parents  guidence in caring children, parents interaction, interfere of the 3 m person, the quantity of children that should be nursed. Data was analized by applying multiple logistic regression. The result shows that just the parents guidence in caring children can influence the children motoric creativity. Pattern of caring children which dominated by mother causes the decrease of children motoric creativity reaches double in comparason with care system that hasn't domination/balance (OR= 1,9286. The pattern wich dominated by father will have risk to the children motoric creativity decrease (9x comparaed to the balance care (OR = 8,999. This condition in line with Haditono's opinion (1988 that there are many factors which most important is the system which is professed and-doneby parent in daily life. Hurlock (1973 said that, in order to build the children motoric creativity faster, needed stimulant, the main and first support received from their parents at home. Hendy Margono (1996 said that a child will be grown up better, can interac with the society easily if the care system is created together with both-father and mother­ which is the couple (husband and  wife  have the same positioning taking care their children.

  17. 78 FR 77597 - Safety Zone; Allied PRA-Solid Works, San Diego Bay; San Diego, CA

    Science.gov (United States)

    2013-12-24

    ... authority under section 4(a) of the Administrative Procedure Act (APA) (5 U.S.C. 553(b)). This provision... M16475.lD, which guide the Coast Guard in complying with the National Environmental Policy Act of 1969...

  18. POTENSI ALELOPAT DAUN PINUS (Pinus spp. SEBAGAI BIOHERBISIDA PRA TUMBUH PADA GULMA KROKOT (Portulaca oleracea

    Directory of Open Access Journals (Sweden)

    Lutfy Ditya Cahyanti

    2015-06-01

    Full Text Available The aim of this experiment was to study the effectof pine leaf as allelophaty on purslane germination. Theexperiment were conducted at screen house Departmentof Biology, Faculty of Mathematics and Science, BrawijayaUniversity. The research is experimental design by nonfactorial Completely Randomized Blok Design, with threereplications, consisted of eleven levels. Purslane seeds sprout with control treatment, signifi cantly different from seedssprout ability in treatment solution leaves Pinus merkusii 2000ppm, and solution leaves of P. longaeva 2000 ppm. The resultshowed that 2000 ppm of P. merkusii extraction signifi cantlysuppressed 46% of purslane germination whereas 2000 ppmPinus longeava extraction signifi cantly suppressed of 41%campared to without any treatments (control.

  19. Experience in integrating the operator contributions in the PRA of actual operating plants

    International Nuclear Information System (INIS)

    Potash, L.M.; Stewart, M.; Dietz, P.E.; Lewis, C.M.; Dougherty, E.M. Jr.

    1982-01-01

    While working on the human factors' portion of the Oconee Probabilistic Risk Assessment, we identified several major problems that inhibit any effort to handle operator error in PRAs. The approaches we developed should help to direct future efforts in dealing with these problems

  20. Pra Desain Pabrik Substitute Natural Gas (SNG dari Low Rank Coal

    Directory of Open Access Journals (Sweden)

    Asti Permatasari

    2014-09-01

    Full Text Available Substitute Natural Gas (SNG merupakan campuran gas hidrokarbon dengan sifat mirip seperti gas alam yang dapat diproduksi dari gasifikasi dengan bahan baku berupa batubara atau biomassa. Gasifikasi adalah proses perubahan bahan baku padat menjadi gas. Dengan mengubah bahan baku padat menjadi gas, maka material yang tidak diinginkan yang terkandung di dalam bahan baku tersebut seperti senyawa sulfur, karbon dioksida dan abu dapat dihilangkan dengan menggunakan metode tertentu sehingga dapat dihasilkan gas bersih yang disebut dengan syngas. Syngas yang memiliki kandungan utama CO dan H2 kemudian dikonfersi menjadi SNG yang berupa metana (CH4 melalui proses metanasi sehingga menghasilkan produk utama berupa CH4. SNG merupakan suatu bahan bakar baru yang dapat digunakan industri untuk menggantikan gas alam. Permintaan gas alam masa mendatang diperkirakan akan tumbuh cukup pesat terkait dengan upaya industri untuk beralih ke gas untuk mengurangi ketergantungan terhadap BBM. Gas alam dan minyak bumi sebagai salah satu sumber daya alam memiliki manfaat yang sangat banyak dalam menunjang berbagai sektor kehidupan manusia. Banyaknya manfaat dari sumber daya alam gas alam menyebabkan banyaknya kebutuhan akan gas alam di dunia, dimana kebutuhan tersebut terus bertambah setiap tahunnya. Padahal gas alam yang selama ini banyak dimanfaatkan berbagai sektor di Indonesia sifatnya tidak terbarukan (non renewable serta cadangannya diperkirakan akan menurun. Pemerintah harus menggalakkan pengembangan sumber energy alternative pengganti gas alam dan minyak bumi sesuai dengan Peraturan Presiden nomor 5 tahun 2006. Salah satu energi potensial yang dapat menggantikannya adalah SNG dari batubara. Indonesia memiliki cadangan batubara dalam jumlah yang sangat banyak. Wilayah Indonesia diketahui memiliki potensi endapan batubara yang sangat luas. Data dari Pusat Sumber Daya Geologi (2006 menyebutkan bahwa wilayah Sumatera Selatan memiliki jumlah cadangan batubara kualitas rendah dan sedang yang sangat banyak, yaitu masing-masing sebesar 2.426,00 juta ton dan 186,00 juta ton. Maka dari itu, pabrik SNG dari low rank coal ini akan didirikan di Kecamatan Ilir Timur, Sumatera Selatan. Rencananya pabrik ini akan didirikan pada tahun 2016 dan siap beroperasi pada tahun 2018. Diperkirakan konsumsi gas alam pada tahun 2018 sebesar 906.599,3 MMSCF sehingga pendirian pabrik yang baru diharapkan dapat menggantikan kebutuhan gas alam sebesar 4% di Indonesia, yaitu sebanyak 36.295,502 MMSCF per tahun atau sebesar 109.986 MMSCFD. Proses pembuatan SNG dari low rank coal terdiri dari empat proses utama, yaitu coal preparation, gasifikasi, gas cleaning, dan metanasi. Dari analisa perhitungan ekonomi didapat Investasi 823.947.924 USD, IRR sebesar 13,12%, POT selama 5 tahun, dan BEP sebesar 68,55%.

  1. Probabilistic risk assessment (PRA) on the effectiveness of a core rescue system (SSN) for PWRs

    International Nuclear Information System (INIS)

    Petrangeli, G.; Valeri, A.

    1983-01-01

    Safety systems for the prevention of LWR core severe damage have recently been studied, which are based on automatic primary system depressurization and on borated water injection by low pressure accumulators. These systems have been named Core Rescue System (SSN). The present study evaluates the reduction in core melt probability brought about by the installation of a SSN system on the RSS (WASH 1400) PWR plant (Surry 1). The calculated result is a core melt probability reduction factor of about 250. Taking into account the possible effect of external or internal unknown events of negligible, yet undefined, probability it is concluded that a SSN system can make a plant ten times safer. The first part of a review report by Prof. N.C.Rasmussen, MIT, dealing with general comment, is attached

  2. Pražskij lingvističeskij kružok i jevrazijstika

    Czech Academy of Sciences Publication Activity Database

    Savický, Nikolaj

    2011-01-01

    Roč. 80, 2/3 (2011), s. 171-173 ISSN 0037-6736 Institutional research plan: CEZ:AV0Z90920516 Keywords : linguistic geography * physical geograpfy * language union * interdisciplinarity Subject RIV: AI - Linguistics

  3. Risk-based configuration control: Application of PRA in improving technical specifications and operational safety

    International Nuclear Information System (INIS)

    Samanta, P.K.; Kim, I.S.; Vesely, W.E.

    1991-01-01

    The objective of risk-based configuration control is to detect and control plant configurations form a risk perspective. The configurations of particular interest involve components which are down during power operation. Controlling plant configurations from a risk-perspective can provide more direct risk control and also more operational flexibility by allowing looser control in areas unimportant to risk

  4. RABIES, PENYEBAB DAN MANAJEMEN PRA-PAJANAN SERTA PASCA-PAJANAN

    Directory of Open Access Journals (Sweden)

    Hemavalli Ragunathan

    2016-03-01

    Full Text Available RABIES, ETIOLOGY,PRE-EXPOSURE AND POST-EXPOSURE MANAGEMENT ABSTRACT Rabies is an acute viral disease that causes fatal encephalomyelitis in virtually all the warm-blooded animals including man. The virus is found in wild and some domestic animals, and is transmitted to other animals and to humans through their saliva (i.e. following bites, scratches, licks on broken skin and mucous membrane. Guidelines throughout worldwide quote that dogs are responsible for about 97% of human rabies, followed by cats (2%, jackals, mongoose and others (1%. The disease is mainly transmitted by the bite of a rabid dog. Keyword: Rabies, Epidemiology, Causes, Management

  5. PENILAIAN PROGRAM PRAKTIKUM TERHADAP PENINGKATAN KUALITI GURU PRA PERKHIDMATAN: ANALISIS BERDASARKAN LATENT GROWTH CURVE MODELLING

    Directory of Open Access Journals (Sweden)

    Azizah Sarkowi

    2015-12-01

    Full Text Available Practicum is an important component in teacher education programs. This study identify the improvement in the quality of pre-service teachers for three phases practicum. Multi-point prospective panel study has been conducted on a 541 pre-service teachers at the Institute of Teacher Education. Teacher’s quality is measured based on the achievement of program learning outcomes. Based on matching last six digit identification card number for three studies series, 337 questionnaires were analyzed using a latent growth curve model using AMOS 18.0. Latent Analysis shows that the model achieve goodness of fit. There is a linear trend of improvement in the performance of the three phases of the practicum. This increase varies between individuals and the rate of growth depends on the level of achievement at practicum phase I. Studies indicate that the increase in the practicum period of teacher education policy should be continued.

  6. KONSELING PRA NIKAH DALAM MEWUJUDKAN KELUARGA BAHAGIA (STUDI PENDEKATAN HUMANISTIK CARL R. ROGERS)

    OpenAIRE

    Mubasyaroh Mubasyaroh

    2017-01-01

    Pernikahan merupakan sunnatullah, karena semua yang ada di dunia ini diciptakan berpasang-pasangan. Sebagaimana difirmankan Allah SWT dalam QS.Adza-Dzariyat: 47-49. “Dan langit itu Kami bangun dengan kekuasaan (Kami) dan seseungguhnya Kami benar-benar meluaskannya. Dan Bumi itu Kami hamparkan maka sebaik-baik yang menghamparkan (adalah Kami). Dan segala sesuatu Kami ciptakan berpasang-pasangan supaya kamu mengingat akan kebesaran Allah” ( Adz-Dzariyat:47-49). Pada tulisan ini penulis akan men...

  7. PRA (probabilistic risk analysis) in the nuclear sector. Quantifying human error and human malice

    International Nuclear Information System (INIS)

    Heyes, A.G.

    1995-01-01

    Regardless of the regulatory style chosen ('command and control' or 'functional') a vital prerequisite for coherent safety regulations in the nuclear power industry is the ability to assess accident risk. In this paper we present a critical analysis of current techniques of probabilistic risk analysis applied in the industry, with particular regard to the problems of quantifying risks arising from, or exacerbated by, human risk and/or human error. (Author)

  8. René Wellek a Pražská škola

    Czech Academy of Sciences Publication Activity Database

    Sládek, Ondřej

    2016-01-01

    Roč. 1, č. 1 (2016), s. 19-30 ISSN 2453-8507 Institutional support: RVO:68378068 Keywords : literary theory ; structuralism ; poetics ; Wellek, René ; Prague School * structuralism * poetics * Wellek, René * Prague School * Prague linguistic circle * Mukařovský, Jan Subject RIV: AJ - Letters, Mass-media, Audiovision

  9. Archeologie na pražském pracovišti NPÚ

    Czech Academy of Sciences Publication Activity Database

    Sommer, Petr

    2015-01-01

    Roč. 31, č. 2 (2015), s. 115-117 ISSN 0231-6056 Institutional support: RVO:67985912 Keywords : cultural heritage * National Institute * archaeological monuments Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. Pengaruh Penerapan Experiential Marketing terhadap Loyalitas Konsumen Kartu PRA Bayar Simpati Telkomsel

    OpenAIRE

    SE, MM, Mareta Kemala Sari

    2012-01-01

    This research aims to analyze influences of experiential marketing variable as dependent variable and provides consumer experiences in getting benefit from communication services to simPATI consumer loyalty. This research is descriptive research with non probability sampling technique – convenience sampling method. Sample size is Hair income that is 20 times of variable, number of respondent is 100 people. The data is analyzed by using multiple regressions with SPSS program, test, F test, alp...

  11. Imigrantes bolivianos em São Paulo : a Praça Kantuta e o futebol

    OpenAIRE

    Ubiratan Silva Alves

    2011-01-01

    Resumo: A migração para o Brasil tem um marco nos anos 50 quando os bolivianos vieram para estudar através de um intercâmbio Brasil-Bolívia ou ainda por fuga política. Mas a relevância dos movimentos migratórios da América Latina se destaca a partir da década de 70 devido ao processo de industrialização de países como o Brasil, a Argentina e a Venezuela além da fuga de suas respectivas pátrias por divergências políticas. A partir da década de 1980, houve um grande aumento de bolivianos que vi...

  12. Scientific and technological monitoring: international overview on R. and D. related to Pra's

    International Nuclear Information System (INIS)

    Llory, M.; Stioui, A.

    1993-03-01

    In 1989, the R and D Division of Electricite de France launched a programme for a Technological and Scientific Overview (TSO) covering a certain number of topics considered to be important for the future of EDF. Probabilistic approaches to studies related to safety were considered to be strategically important to EDF, and therefore this area was selected for further study. A TSO is a process which can only start on the basis of a structured state-of-the-art organized as a basis of knowledge, together with the highlighting of a certain number of scientific and strategic ''set of references . The state-of-the-art of R and D related to Probabilistic Safety Assessment (PSA) was carried out in collaboration between the EDF R and D Division (SR branch) and SRI International. The approach chosen included: segmentation of the wide field of PSAs into subject areas, topics and sensitive points to be monitored; conception of a grid for the interviews; approximately thirty in-depth interviews of organizations and experts representative of the domain; analysis leading to identify certain problems areas or particularly important features. Emerging themes for research and further consideration in relation to PSAs, their application and their limits were also identified. Based on this state-of-the-art, various themes of monitoring were defined (living PSAs, limits of PSAs,...) and an organizational structure for monitoring was set up in the branch. The state of the art is not static, it is the reason why an in-depth extension of the study was undertaken on issues of special interest for EDF. (authors). 2 figs., 2 refs

  13. KONTINUITAS DAN DISKONTINUITAS AL-QUR'AN TERHADAP TRADISI ARAB PRA-ISLAM

    Directory of Open Access Journals (Sweden)

    Kurdi Kurdi

    2015-05-01

    Full Text Available This article discusses on continuity and discontinuity of the Qur'an to Arabs traditions before revelation provided from either doctrine of prior religions or native agreements of society. The Qur'an has given response on many aspects of rituals, economy, family, law and punishments. Many of such traditions become as Islamic doctrine and others are rejected. The steps of the continuity are total acceptance, distinctive way, conditional limitation and corrective response, while the styles of the discontinuity are total, gradual and continuous liberations.

  14. MEDIA REKAM JEJAK TAHAPAN PRA DESAIN DENGAN POSTER : MENINGKATKAN KINERJA DAN LUARAN PADA STUDIO PERANCANGAN ARSITEKTUR

    Directory of Open Access Journals (Sweden)

    Fibria Conytin Nugrahini

    2015-12-01

    Full Text Available A Pre-design process in studio design class includes observation phase, analysis and programming, a directed process of searching and recording information. Based on an early observation, currently pre-design activities in class or studio often has been less optimal due to the low of students performance and the creativities. This causes the output generated from pre-design process was not maximized while undocumented or do not have a good track records. This paper aims to explore the use of posters as a creative ideas in the documentation of of pre-design stage. This is a class-action research as the result of the development of pre-design activities with inquiry methods using the poster as a medium track record in architectural design studio. Research methods include observation and assessment pre-design student outcomes, and questionnaire. Poster outcomes observation were ratings based on several criterias. The questionnnaires tested the posters feasibility in improving the performance and outcomes based on the process and student experiences. Because it is class-action reasearch, this study is limited to the studio class where the author conducted lectures and studio guidance. The results showed an increase in the performance of students in search of matter, observations, material analysis, as well as programming in the use of posters as track record media. In addition, students were satisfied and more creatively visualize their ideas in the pr e-design phase by using the poster media

  15. Assessing Sediment and Nutrient Transport in the Pra Basin of Ghana

    African Journals Online (AJOL)

    Regression analysis was used to establish relationships between suspended sediment yield and nutrient export coefficient as the dependent variable, and runoff and catchment area as the independent variables. The established regression equation can be used to estimate suspended sediment or nutrient yield at any ...

  16. Novinky pražského mozartovského výzkumu

    Czech Academy of Sciences Publication Activity Database

    Jonášová, Milada

    2016-01-01

    Roč. 24, č. 4 (2016), s. 20-22 ISSN 1210-9525 R&D Projects: GA ČR GAP409/12/2563 Institutional support: RVO:68378076 Keywords : copyists research * autograph * operas Subject RIV: AL - Art, Architecture, Cultural Heritage

  17. PENGARUH PENERAPAN EXPERIENTIAL MARKETING TERHADAP LOYALITAS KONSUMEN KARTU PRA BAYAR SIMPATI TELKOMSEL

    Directory of Open Access Journals (Sweden)

    mareta kemala sari

    2012-10-01

    Full Text Available This research aims to analyze influences of experiential marketing variable as dependent variable and provides consumer experiences in getting benefit from communication services to simPATI consumer loyalty. This research is descriptive research with non probability sampling technique – convenience sampling method. Sample size is Hair income that is 20 times of variable, number of respondent is 100 people. The data is analyzed by using multiple regressions with SPSS program, test, F test, alpha 0.05. The research shows, (1. No significant influences between sense marketing and customer loyalty (sig=0.166. (2. There is significant influences between feel marketing and customer loyalty (Sig = 0.029. (3. No significant influences between feel marketing and customer loyalty (Sig = 0,689. (4. There is a significant influence between act marketing and customer loyalty. (5. No significant influences between relate marketing and customer loyalty (Sig = 0,572. (6. There is a significant influence between all variables experiential marketing and customer loyalty (Sig = 0,000. Researcher suggests company to review sense marketing, act marketing and relate marketing strategy that has applied and consider other factors that influences consumer loyalty and also increase feel marketing and think marketing strategies.

  18. Olha pra mim: encontro de gerações intermediado pela escrita de cartas

    OpenAIRE

    Santos, Divina de Fátima dos

    2015-01-01

    Esta tese analisou os benefícios da troca de cartas entre gerações muito distintas, investigando o quanto o ato de escrever sobre acontecimentos da vida cotidiana pode estar associado a uma melhor autopercepção dos participantes do processo. Procurou-se compreender o significado de uma troca de correspondências ocorrida entre crianças e idosos, residentes na cidade de Caraguatatuba, no litoral norte de São Paulo, e os seus efeitos sobre suas subjetividades. O trabalho analisou a participação ...

  19. PRA insights applicable to the design of a broad applications test reactor

    International Nuclear Information System (INIS)

    Khericha, S.T.; Reilly, H.J.

    1993-01-01

    Design insights applicable to the design of a new Broad Applications Test Reactor (BATR), studied during Fiscal Years 1992 an d1993 at Idaho National Engineering Laboratory (INEL), are summarized. Sources of design insights include past probabilistic risk assessments (PRAs) and related studies for Department of Energy (DOE)-owned Class A reactors and for commercial reactors. The report includes preliminary risk allocations for the BATR. The survey addressed those design insights that would affect the reactor core damage frequency (CDF). The design insights, while selected specifically for BATR, should be applicable to any new advanced test reactor

  20. Em busca do tempo nas ruas e praças de São Paulo

    OpenAIRE

    Frehse, Fraya

    2016-01-01

    Como será que o cotidiano de nós, pesquisadores urbanos, nas cidades em que vivemos, repercute em nossa trajetória investigativa sobre tais cidades? Argumento neste estudo que há inquietações intelectuais derivadas de nossa condição urbana, por assim dizer. Basta assumir o urbano em termos lefebvrianos; isto é, como referência metodológica para refletir sobre as contradições históricas que impregnam a vida cotidiana na cidade como espaço que simultaneamente favorece e dificulta, de modo privi...

  1. Prävalenz des Drogenkonsums in der Anästhesie-Ambulanz

    OpenAIRE

    Kondschak, Johannes

    2017-01-01

    The abuse of illicit substances and prescription drugs is a worldwide problem. Supportive strategies seem more appropriate and effective than confrontative strategies when treating and preventing substance abuse. However, supportive strategies are neither sufficiently evaluated nor widely established. The pre-anaesthetic assessment clinic of the Charité – Universitäts Medizin Berlin is a potential contact point for people with risky consumption of narcotic substances. Some initial studie...

  2. Upaya Peningkatan Tingkat Pengetahuan Siswi MAN 2 Palembang Mengenai Sindrom Pra Menstruasi

    Directory of Open Access Journals (Sweden)

    Muhammad Aditya Alfarizki

    2017-03-01

    Full Text Available Premenstrual syndrome characterized by affective, physical, and behavior symptoms with moderate to severe grade, that usually recurrent every luteal phase of menstrual cycle and disappear within menstruation. The frequency of premenstrual syndrome is still high, in Indonesia and all over the world. To overcome this situation, there should be a health promotion. The aim of this community service was to increase the girl’s knowledge of premenstrual syndrome. This community service was held in one day on November 2016 in public islamic high school MAN 2 Palembang. The schedule was start with pre test consist of 15 questions, counseling sesssion using power point media, discussion session, and post test consist of the same questions to measure the knowledge after counseling. Pre test score showed that 13.9% students had good knowledge and post test score showed an increase of good knowledge (66.7%. Conclusion, heatlh education through counseling method bring a change of knowledge.

  3. PRA insights applicable to the design of the Broad Applications Test Reactor

    International Nuclear Information System (INIS)

    Khericha, S.T.; Reilly, H.J.

    1993-01-01

    Design insights applicable to the design of a new Broad Applications Test Reactor (BATR), being studied at Idaho National Engineering Laboratory, are summarized. Sources of design insights include past probabilistic risk assessments and related studies for department of Energy-owned Class A reactors and for commercial reactors. The report includes a preliminary risk allocation scheme for the BATR

  4. Popularita e-sportu u pražské mládeže

    OpenAIRE

    Inneman, Martin

    2017-01-01

    Title: Popularity of e-sports among Prague's youth Objectives: The main objective of this thesis is to determine popularity of e-sports among Prague's youth and the associated marketing potential of this industry. The thesis also tests the depth of knowledge, so that it is possible to create an overall opinion on the current state of e-sports among Prague's youth. Methods: The method used in this thesis is marketing research. Due to the lack of secondary data it was necessary to obtain primar...

  5. Human factors assessment in PRA using Task Analysis Linked Evaluation Technique (TALENT)

    International Nuclear Information System (INIS)

    Wells, J.E.; Banks, W.W.

    1991-01-01

    Thirty years ago the US military and US aviation industry, and more recently, in response to the US Three Mile Island and USSR Chernobyl accidents, the US commercial nuclear power industry, acknowledged that human error, as an immediate precursor, and as a latent or indirect influence in the form of training, maintainability, inservice test, and surveillance programs, is a primary contributor to unreality and risk in complex high-reliability systems. A 1985 Nuclear Regulatory Commission (NRC) study of Licensee Event Reports (LERs) suggests that upwards of 65% of commercial nuclear system failures involve human error. Despite the magnitude and nature of human error cited in that study, there has been limited attention to personnel-centered issues, especially person-to-person issues involving group processes, management and organizational environment. The paper discusses NRC integration and applications research with respect to the Task Analysis Linked Evaluation Technique (TALENT) in risk assessment applications

  6. El Pràcticum al grau de Pedagogia de la Universitat de Barcelona: el mapa de la professió, la pràctica simulada i la immersió en una organització

    Directory of Open Access Journals (Sweden)

    Ruth Vilà Baños

    2014-01-01

    Full Text Available Es presenta el treball innovador que l’equip de coordinació del Pràcticum del grau de Pedagogia de la Universitat de Barcelona ha elaborat per organitzar les assignatures vinculades a la pràctica dels professionals de la pedagogia. Amb la finalitat de preparar els futurs professionals en els aspectes més pràctics de la seva formació, s’estructuren tres assignatures: Professionalització i Sortides Laborals, Pràctiques d’Iniciació Professional i Pràctiques Externes. En aquestes assignatures es treballa de forma innovadora el perfil del pedagog i el mapa de la professió, a primer curs del grau; la pràctica simulada a través de casos, a tercer, i la immersió en una organització, com a pràctica externa, acompanyada dels seminaris de pràctica reflexiva.

  7. Renesanční podoba Pražského hradu z archeologického pohledu

    Czech Academy of Sciences Publication Activity Database

    Blažková, Gabriela

    2015-01-01

    Roč. 7, č. 2 (2015), s. 121-134 ISSN 1804-1132. [Prag - Residenz des Habsburgers Ferdinand I. 1526-1564. Praha, 26.03.2015-28.03.2015] R&D Projects: GA ČR GP13-34374P Institutional support: RVO:67985912 Keywords : Prague * Prague Castle * Renaissance * ceramic * glass Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. Análisis de los impactos ambientales generados por parques eólicos. Caso práctico

    OpenAIRE

    Avilés, Antonio

    2017-01-01

    De conformidad con el Anexo II del Decreto -ley 5/2014, de 22 de abril, de medidas normativas para reducir las trabas administrativas para las empresas, los parques eólicos si tienen más de 6 aerogeneradores o 10 MW de potencia instalada, requieren una Autorización Ambiental Unificada ordinaria (AAU). Dicha autorización exige la redacción de un Estudio de Impacto Ambiental que analice y cuantifique los principales impactos a lo largo de las distintas fases del proyecto y establezca la...

  9. Joris Karl Huysmans jako kritik umění a jeho pražské odezvy

    Directory of Open Access Journals (Sweden)

    Tomáš Kolich

    2017-09-01

    Generally speaking, Huysmans’s reviews were widely read in the Czech Lands, although their selection was limited. Czech art periodicals found his reviews interesting for his daring style and a broad range of themes, which also included little-known artists, caricatures and posters.

  10. Pojem významu ve světle pražské poetiky a estetiky

    Czech Academy of Sciences Publication Activity Database

    Kubínová, Marie

    2005-01-01

    Roč. 66, č. 2 (2005), s. 98-102 ISSN 0037-7031 R&D Projects: GA ČR GA405/03/0416 Institutional research plan: CEZ:AV0Z90560517 Keywords : semiotics * structuralism Subject RIV: AJ - Letters, Mass-media, Audiovision

  11. Perda de patrimônio paisagístico: Praça Rui Barbosa, Bauru-SP

    Directory of Open Access Journals (Sweden)

    Emília Falcão

    2006-12-01

    Full Text Available O artigo relata as implicações da execução de um projeto paisagístico, datado de 1991, na cidade de Bauru, interior paulista, que incorpora como problema central à revitalização do centro urbano. Questiona-se a validade dos conceitos e métodos utilizados nesse projeto e procura-se dar subsídio à compreensão de que houve perda com a destruição da configuração espacial anterior que apresentava significativo valor simbólico. Coloca-se o contexto de criação do projeto executado no início do século XX, assim como suas características, e o do projeto implantado em fins do mesmo século, 1991, numa perspectiva histórica.

  12. Teške kovine u čeličanskoj elektropećnoj prašini

    Directory of Open Access Journals (Sweden)

    Mandrino Dj.

    2005-12-01

    Full Text Available Within the scope of corporate waste management, Sisak Steelworks initiated a thorough and systematic examination of physical and chemical properties of metallurgical waste and of its behaviour in interaction with the environment. Electric arc furnace (EAF dust has been categorized as hazardous technological waste and it can not be directly disposed of to the ground / in a land fill. Therefore, it is necessary to find a way to dispose of it in an environmentally friendly and economically acceptable manner. In order to elaborate different options and chose the optimal practice for the disposal of the accumulated volumes of hazardous metallurgical waste, comprehensive and systematic research has been conducted. This paper provides only a partial survey of the research of the heavy metal Zn, Pb, Cd content in electric arc furnace dust as well. Qualitative chemical analysis of samples of electric arc furnace dust was conducted on all observed samples and the presence of Fe, Zn, Pb, Mn, Cu, Al, Ca, Mg, K, S, P, C, O and Cl was established. The results of qualitative chemical analysis of monthly average samples of electric arc furnace dust obtained by other methods established that the mass fraction of iron was between 41.08 and 48.58 %, zinc between 3.75 and 8.10 %, lead between 0.94 and 2.07 %, and cadmium between 0.010 and 0.027 %. The results of the Zn, Pb, Cd fraction analysis in the observed samples of electric arc furnace dust are considerably lower, than the content of those metals in EAF dusts presented in the available references, where the mass fraction of zinc varies between 0.14 and 50 %, lead between 0.03 and 6.8 %, and cadmium between < 0.01 and 1.8 %. Quantitative analysis of Fe, Zn, Pb and Cd fraction was carried out in grain-metrical fractions of individual samples of EAF dust as well. The results have shown that the concentrations of Fe tend to increase with smaller fraction grains compared to an average sample, whereas concentrations of Zn, Pb and Cd in the same proportion display a descending tendency. Results of the Zn, Pb and Cd fraction analysis in the EAF dust samples from Sisak Steelworks compared to the mass fraction of those metals in EAF dust from other steel mills imply that the measured concentrations of zinc, lead, and cadmium are much higher. Therefore, it is not economically viable to recycle this dust for the lead, zinc or cadmium recovery. Consequently, the disposal of this kind of hazardous metallurgical waste must first be handled in another, environmentally acceptable and economically justifiable way. Additional investigations must be carried out before the final decision is made.

  13. Bratři Pražákové na meziválečném Slovensku

    Czech Academy of Sciences Publication Activity Database

    Jindra, Jiří

    2017-01-01

    Roč. 24, č. 3 (2017), s. 22-23 ISSN 1213-0249 Institutional support: RVO:68378114 Keywords : Slovakia * inter- war Slovakia Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  14. Pražské setkání národnostních menšin

    Czech Academy of Sciences Publication Activity Database

    Štědroň, J.; Sulitka, Andrej

    -, č. 3 (2014), s. 14 ISSN 1210-9525 Institutional support: RVO:68378076 Keywords : national minorities * minorities organizations * Prague * coexistence of minorities * Annual Conference Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. Z historie výuky fyziky pro mediky na pražských univerzitách

    Czech Academy of Sciences Publication Activity Database

    Těšínská, Emilie; Hlaváčková, Ludmila

    2012-01-01

    Roč. 51, č. 1 (2012), s. 11-57 ISSN 0323-0562 Institutional research plan: CEZ:AV0Z80630520 Keywords : history of physics * history of medicine * history of the Charles University Subject RIV: AB - History

  16. The retinal fascin gene 2 (FSCN2) - partial structural analysis and polymorphisms detection in dogs with progressive retinal atrophy (PRA)

    Czech Academy of Sciences Publication Activity Database

    Horák, Pavel; Knoll, Aleš; Dvořák, J.

    2006-01-01

    Roč. 47, č. 4 (2006), s. 361-364 ISSN 1234-1983 R&D Projects: GA AV ČR 1QS500450578 Institutional research plan: CEZ:AV0Z50450515 Keywords : canis familiaris * FSCN2 gene * PCR-RFLP Subject RIV: EB - Genetics ; Molecular Biology

  17. PENGARUH PROGRAM PEMBERIAN MAKANAN TAMBAHAN TERHADAP KEADAAN GIZI ANAK-ANAK PRA-SEKOLAH DI LINGKUNGAN KEBON KELAPA BOGOR

    Directory of Open Access Journals (Sweden)

    Darwin Karyadi

    2012-11-01

    Full Text Available Pengaruh program pemberian makanan tambahan terhadap ke­adaan gizi anak2 prasekolah di Lingkungan Kebon Kelapa, Bogor. (The effect of food supplementation program on the nutritional status of pre-school children. Presented at the Second National Pediatric Congress. Bandung. 1971. One of the main nutrition problems in developing countries is protein calorie malnutrition. The age group that has been most affected is the pre-school child. Serious dietary deficiency will impair his physical and mental developments. The pilot project was designed for the care of pre-school children with signs of malnutrition through a supplementary feeding program. The approach is to educate mothers on how to feed, with locally available foods, and care for their pre-school children; using techniques that are compatible with their under­standing and financial   limitation through   active participation. The duration of the supplementary feeding program was three months. In order to evaluate the program some anthro­pometric measurements, dietary intake study and clinical assess­ment were carried out before and after the program. The results of the study reveal that this program-approach can be recommended in the prevention and in combating malnu­trition in the pre-school child.

  18. Kosík, Kalivoda, Sviták a Pražské jaro 1968

    Czech Academy of Sciences Publication Activity Database

    Mervart, Jan

    2012-01-01

    Roč. 60, Suppl. 2 (2012), s. 195-209 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : Marxist humanism * Prague spring 1968 * Karel Kosík * Robert Kalivoda * Ivan Sviták Subject RIV: AA - Philosophy ; Religion

  19. Automated system for review of radiotherapy treatment sheets; Sistema automatizado pra la revision de hojas de tratamiento en radioterapia

    Energy Technology Data Exchange (ETDEWEB)

    Collado Chamorro, P.; Sanz Freire, C. J.; Vazquez Galinanes, A.; Diaz Pascual, V.; Gomez amez, J.; Martinez Sanchez, S.; Ossola Lentati, G. A.

    2011-07-01

    In many modern radiotherapy services begins to leaf treatment implemented in electronic form. In our department has developed an automated reporting system, that check the following parameters: treatment completed correctly, number of sessions and cumulative dose administered. Likewise treatments are verified in the allocated separate unit, and over-writing table parameters.

  20. Živý slon a pražské dvorské slavnosti v roce 1570

    Czech Academy of Sciences Publication Activity Database

    Šárovcová, Martina

    2014-01-01

    Roč. 59, 1/2 (2014), s. 34-40, 43 ISSN 0036-5351 Institutional support: RVO:68378033 Keywords : elephant * Gradual of Sixtus of Ottersdorf * illuminated manuscripts * literati brotherhood at the church of Our Lady before Týn in Prague * court festivities * exotic animals in Renaissance Europe Subject RIV: AL - Art, Architecture, Cultural Heritage

  1. PERILAKU SEKS PRA-NIKAH MAHASISWA PADA SEKOLAH TINGGI MANAJEMEN DAN ILMU KOMPUTER BINA BANGSA KENDARI (STUDI KASUS)

    OpenAIRE

    Israwati; Rachman, Watief A; Ibnu, Indra Fajarwati

    2013-01-01

    Masa remaja merupakan masa transisi dari masa anak-anak menuju dewasa. Jenis penelitian ini adalah penelitian kualitatif dengan rancangan studi kasus. Informan dalam penelitian ini ditentukan dengan menggunakana snowballing yang terdiri dari 9 orang mahasiswa yang pernah melakukan hubungan seks pranikah dan 9 orang mahasiswa yang belum pernah melakukan hubungan seks pranikah. Hasil penelitian menunjukan bahwa pemahaman mahasiswa tentang perilaku seks pranikah yaitu perilaku seks yang dilakuka...

  2. Barokní palác Colloredo-Mansfeldů na Starém Městě pražském

    Czech Academy of Sciences Publication Activity Database

    Vlček, Pavel

    2014-01-01

    Roč. 30, č. 1 (2014), s. 2-24 ISSN 0231-6056 Institutional support: RVO:68378033 Keywords : Prague * high Baroque * Rococo * Giovanni Battista Alliprandi * Colloredo-Mansfeld palace Subject RIV: AL - Art, Architecture, Cultural Heritage

  3. Hudební události pražského kláštera alžbětinek v roce 1776

    Czech Academy of Sciences Publication Activity Database

    Michl, Jakub

    2016-01-01

    Roč. 8, 1-2 (2016), s. 130-148 ISSN 1803-7828 Institutional support: RVO:68378076 Keywords : Sisters of Saint Elizabeth * cantatas * oratorios * Rochus Elinger SJ * Emilián Rickert OCist. * Marie Deodata a Presentatione B. V. Mariae OSE (Anna Justina von Klausniz) * Marie Juliana a Septem SS. Patribus OSE * Prague * music in convents Subject RIV: AL - Art, Architecture, Cultural Heritage

  4. Twenty-second water reactor safety information meeting: Proceedings. Volume 1: Plenary session; Advanced instrumentation and control hardware and software; Human factors research; IPE and PRA

    Energy Technology Data Exchange (ETDEWEB)

    Monteleone, S. [comp.] [Brookhaven National Lab., Upton, NY (United States)

    1995-04-01

    This three-volume report contains papers presented at the Twenty-Second Water Reactor Safety Information Meeting held at the Bethesda Marriott Hotel, Bethesda, Maryland, during the week of October 24--26, 1994. The papers are printed in the order of their presentation in each session and describe progress and results of programs in nuclear safety research conducted in this country and abroad. Foreign participation in the meeting included papers presented by researchers from Finland, France, Italy, Japan, Russia, and United Kingdom. The titles of the papers and the names of the authors have been updated and may differ from those that appeared in the final program of the meeting. Selected papers are indexed separately for inclusion in the Energy Science and Technology Database.

  5. “Quem está preparado pra isso?”... Reflexões sobre a formação docente para as homossexualidades

    Directory of Open Access Journals (Sweden)

    Anderson Ferrari

    2013-06-01

    Full Text Available Using a question asked by a student in a training course about sexualities, this paper aims to problematize this training process, which together with gender and sexuality constructions provoke us to think the individuals’ constitution processes. In order to do so, the methodology employed was observation and analyses of the authors’ experience in three courses for teachers. The discourse produced in such contexts was brought to the text. Such issues favor the authors’ contact with post-structuralism and Foucault studies, whose focus is on discourses and practices which constitute the subject and on power relations. As the main result, the paper points to the need to count on “detachment of the self” which involves training in investment on questioning rather than on answers and “truths”.

  6. Pohřebiště Pražského hradu a možnosti jejich sociální interpretace

    Czech Academy of Sciences Publication Activity Database

    Frolík, Jan; Kaupová, S.

    2016-01-01

    Roč. 41, č. 1 (2016), s. 101-122 ISSN 0231-5823 R&D Projects: GA ČR GB14-36938G Institutional support: RVO:67985912 Keywords : burial ground * Prague Castle * Early Middle Ages * elite * stable isotopes * social differentiation * nutrition Subject RIV: AC - Archeology, Anthropology, Ethnology

  7. Legirani praški za navarjanje z večžično elektrodo: Alloyed fluxes for surfacing with multiple - wire electrode:

    OpenAIRE

    Kejžar, Božena; Kejžar, Rajko

    1997-01-01

    Submerged arc surfacing with alloyed agglomerated fluxes permits unalloyed and low-alloy structural steels to be surfaced in one layer of high-alloyed claddings. Surfacing dilution produced by fusion of the parent metal, and burn-off of alloying elements are substituted by additional alloying by means of a welding flux, which is, in the case of the above-mentioned surfacing processes, the main carrier of alloying elements for surfacing alloying. With alloyed agglomerated fluxes, it is recomme...

  8. WASTE-PRA: a computer package for probabilistic risk assessment of shallow-land burial of low-level radioactive waste

    International Nuclear Information System (INIS)

    Cox, N.D.; Atwood, C.L.

    1985-12-01

    This report is a user's manual for a package of computer programs and data files to be used for probabilistic risk assessment of shallow-land burial of low-level radioactive waste. The nuclide transport pathways modeled are an unsaturated groundwater column, an aquifer, and the atmosphere. An individual or the population receives a dose commitment through shine, inhalation, ingestion, direct exposure, and/or a puncture wound. The methodology of risk assessment is based on the response surface method of uncertainty analysis. The parameters of the model for predicting dose commitment due to a release are treated as statistical variables, in order to compute statistical distributions for various contributions to the dose commitment. The likelihood of a release is similarly treated as a statistical variable. Uncertainty distributions are obtained both for the dose commitment and for the corresponding risk. Plots and printouts are produced to aid in comparing the importance of various release scenarios and in assessing the total risk of a set of scenarios. The entire methodology is illustrated by an example. Information is included on parameter uncertainties, reference site characteristics, and probabilities of release events

  9. Joint application of AI techniques, PRA and disturbance analysis methodology to problems in the maintenance and design of nuclear power plants

    Energy Technology Data Exchange (ETDEWEB)

    Okrent, D.

    1989-03-01

    This final report summarizes the accomplishments of a two year research project entitled Joint Application of Artificial Intelligence Techniques, Probabilistic Risk Analysis, and Disturbance Analysis Methodology to Problems in the Maintenance and Design of Nuclear Power Plants. The objective of this project is to develop and apply appropriate combinations of techniques from artificial intelligence, (AI), reliability and risk analysis and disturbance analysis to well-defined programmatic problems of nuclear power plants. Reactor operations issues were added to those of design and maintenance as the project progressed.

  10. Joint application of AI techniques, PRA and disturbance analysis methodology to problems in the maintenance and design of nuclear power plants. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Okrent, D.

    1989-03-01

    This final report summarizes the accomplishments of a two year research project entitled ``Joint Application of Artificial Intelligence Techniques, Probabilistic Risk Analysis, and Disturbance Analysis Methodology to Problems in the Maintenance and Design of Nuclear Power Plants. The objective of this project is to develop and apply appropriate combinations of techniques from artificial intelligence, (AI), reliability and risk analysis and disturbance analysis to well-defined programmatic problems of nuclear power plants. Reactor operations issues were added to those of design and maintenance as the project progressed.

  11. PENGARUH PENGGUNAAN PUPUK UREA DAN APLIKASI HERBISIDA PRA-TUMBUH TERHADAP PERTUMBUHAN BIBIT KARET (Hevea brasiliensis Muell.Arg. DAN GULMA DI PEMBIBITAN

    Directory of Open Access Journals (Sweden)

    Yakup Parto

    2012-09-01

    Full Text Available A Research was carried out at green house of Agriculture Faculty of Sriwijaya University from October 2010 to January 2011 using split-split plot design. Main plot were pre-emergence herbicides :  H0 = no preemergence herbicide treatment (control, H1 = preemergence herbicide of methyl metsulfuron, and H2 = preemergence herbicide of ametryn. Subplot were dose of urea fertilizers : U0 = no urea fertilizer treatment (control, U1 = 2 gram of urea fertilizer per plant, and U2 = 4 gram of urea fertilizer per plant. Sub-sub plot were preemergence dosages : D0 = 0 liter formulation per ha, D1 = 1,5 liter formulation per ha, and D2 = 3,0 liter formulation per ha. Parameters measured were diameter of sleep eye stum, time of bud emergence, height of bud, number of leaves, percentage of growth seedling, weed growth, and efficiency of weed control. Results showed that kind of preemergence herbicides, urea fertilizer dosages, and preemergence herbicide dosages were no significant effect to weed dry weight due to weed growing were relative small. This supposed because soil which used as growth media no enough contain weed propagule, so the following research are need conducted.

  12. V cizích službách. Život a smrt pražského fundatisty

    Czech Academy of Sciences Publication Activity Database

    Freemanová, Michaela

    2012-01-01

    Roč. 31, - (2012), s. 317-327 ISSN 0231-7443 Institutional support: RVO:68378076 Keywords : Brothers Hospitallers' Hospital * boy Choristers * Prague * 18th Century * boy s and young men Subject RIV: AL - Art, Architecture, Cultural Heritage

  13. "Eu vou pra Maracangalha, eu vou...": JK e a Distopia Brasiliæ na música popular e nas charges da revista Careta (1956-1960

    Directory of Open Access Journals (Sweden)

    Wagner Cabral da Costa

    2013-04-01

    Full Text Available Análise da relação entre música popular e charges satíricas sobre a fundação de Brasília, publicadas na revista humorística Careta. A iniciativa de construção da nova capital pelo governo de Juscelino Kubitschek foi objeto de acesa polêmica, dividindo a opinião pública, além de ser contestada pela União Democrática Nacional – UDN (principal partido de oposição. Inicialmente, investigam-se os usos sociais e apropriações da música popular para fazer a crítica ao projeto de JK. Depois, examinam-se as afinidades entre a revista de humor e a grande imprensa, compartilhando a oposição ao governo federal, bem como a defesa da cultura política liberal. Em seguida, analisa-se a polêmica musical de Brasília, envolvendo diferentes sujeitos, gêneros e práticas sociais. Por fim, através da avaliação da série iconográfica, estudam-se as disputas pelo imaginário social da nova cidade, reinventada como utopia negativa, a distopia Brasiliæ.

  14. A aplicação da teoria da aprendizagem significativa de Ausubel na prática improvisatória

    Directory of Open Access Journals (Sweden)

    César Albino

    2008-12-01

    Full Text Available This article deals with the application of D. P. Ausubel’s Theory of Meaningful Learning in the musical teaching processes, mainly in the improvisational practice. It is sub- divided into three parts: the first one analyses various teaching approaches, especially the traditional and the constructivist; the second one specifically deals with the theory; the third one refers to some theoretical concepts that can be applied in the improvisational practice. Part of the narrative was taken from the Master of Arts dissertation The importance of the teaching of musical improvisation in the interpreter’s development (Institute of Arts – São Paulo State University. In addition to D. P. Ausubel, this study also relied on works by other scholars, among them Vera Jardim, Liliana Bollos, Maria da Graça N. Mizukami and Gilles Deleuze. The use of this theory represents an excellent opportunity of interaction between the musical theory and practice, making use of cognitive processes already in use in the field of education but not so valued by musical education, particularly in matters of musical improvisation teaching.

  15. K nálezu padělku pražského groše na hradě Kozlov (Chlum)

    Czech Academy of Sciences Publication Activity Database

    Durdík, Tomáš

    10, - (2006), s. 335-336 ISSN 1211-6831 R&D Projects: GA MK(CZ) DB06P01OPP004 Institutional research plan: CEZ:AV0Z80020508 Keywords : castle * castellology * Kozlov (Chlum) * coin falsification * medieval archeology * middle age s * Bohemia * numismatics Subject RIV: AC - Archeology, Anthropology, Ethnology

  16. Pražští Židé a první křížová výprava

    Czech Academy of Sciences Publication Activity Database

    Charvát, Petr

    2009-01-01

    Roč. 34, - (2009), s. 835-838 ISSN 0231-5823. [Mezinárodní konference archeologů středověku /40./. Plzeň, 15.09.2008-19.09.2008] R&D Projects: GA AV ČR IAA800020804 Institutional research plan: CEZ:AV0Z80020508 Keywords : medieval history * Prague * Jews Subject RIV: AB - History

  17. Pražský světící biskup? Jiří Ignác Pospíchal (1635–1699)

    Czech Academy of Sciences Publication Activity Database

    Pučalík, Marek

    2015-01-01

    Roč. 30, č. 1 (2015), s. 159-169 ISSN 0231-7494 R&D Projects: GA ČR(CZ) GA14-05167S Institutional support: RVO:67985963 Keywords : Jiří Ignác Pospíchal * the Knights of the Cross with the Red Star * Prague * Polná * bishop * archbishop Subject RIV: AB - History

  18. Joint application of AI techniques, PRA and disturbance analysis methodology to problems in the maintenance and design of nuclear power plants

    International Nuclear Information System (INIS)

    Okrent, D.

    1989-01-01

    This final report summarizes the accomplishments of a two year research project entitled ''Joint Application of Artificial Intelligence Techniques, Probabilistic Risk Analysis, and Disturbance Analysis Methodology to Problems in the Maintenance and Design of Nuclear Power Plants. The objective of this project is to develop and apply appropriate combinations of techniques from artificial intelligence, (AI), reliability and risk analysis and disturbance analysis to well-defined programmatic problems of nuclear power plants. Reactor operations issues were added to those of design and maintenance as the project progressed

  19. Virtuozita a performance maskulinity: Hudební etnografie jednoho pražského neromského gypsy jazzového uskupení

    OpenAIRE

    Kašparová, Žofie

    2015-01-01

    Univerzita Karlova v Praze, Filozofická fakulta Ústav hudební vědy Virtuosity and Performance of Masculinity: Music Ethnography of a Non-Roma Gypsy Jazz Group in Prague Žofie Kašparová 2014 Abstract In this ethnography I examine the gypsy jazz band Sylvanio Orchestra which is based in Prague, Czech Republic. This research consists largely of my observations at their performances, interviews with the band members as well as my personal experience of being a musician and a woman in this predomi...

  20. Využití metody odhadu v podniku Pražské vodovody a kanalizace, a.s.

    OpenAIRE

    Veselá, Ilona

    2010-01-01

    The paper is dedicated to the estimation method in accounting, especially to its basis, representatives and practical use. The paper is written from the theoretical definition of the generally accepted accounting principles, characterizing the accrual basis, the going concern and the prudence principle as a background of the estimation method. Furthermore, this work characterizes accruals and allowances as manifestations of the estimation method. Both expressions are first defined in general,...

  1. PRA for emergency planning: assessing the risk profile of a 3-loop PWR on the basis of US and German risk studies

    International Nuclear Information System (INIS)

    Chakraborty, S.; Fuchs, H.; Gubler, R.; Landolt, J.; Miteff, L.

    1985-01-01

    Emergency planning around nuclear power plants should be based on a realistic assessment of their risk profile. Since the results of the Rasmussen study (WASH-1400) and later of the German risk study (Phase A) were not judged to be fully representative for NPP's in Switzerland, an investigation was started to transfer applicable US and German results to a Swiss 3-loop PWR (Goesgen) and to assess the impact of differences in plant design compared to Surry-1 and Biblis-B. The core melt probability for Goesgen was calculated to be more than a factor of ten smaller than for the US and German studies. This is mainly due to more redundancy/better separation (especially in the emergency feedwater) and to partial automation of cooldown after a small break. The results were instrumental in limiting the release categories to be used as reference cases for emergency planning. Further reduction of postulated accidental releases is expected from the current source term research

  2. “Vou Ficar de Arquibancada pra Sentir mais Emoção” – uma proposta de pesquisa acerca das sonoridades do futebol

    Directory of Open Access Journals (Sweden)

    MARRA, Pedro Silva

    2012-04-01

    Full Text Available This paper aims to investigate the communicative interaction among a soccer competition, the reactions of a crowd present at the stadium and the sonority produced on this kind of sporting event. Following the idea of sonority, it shows the relations among sound, rithm and body and aims to establish working hypotheses from experimental observations made on some Clube Atlético Mineiro’s matches, on some regional and nacional tournaments.

  3. Effect of antigravity suit inflation on cardiovascular, PRA, and PVP responses in humans. [Plasma Renin Activity and Plasma VasoPressin

    Science.gov (United States)

    Kravik, S. E.; Keil, L. C.; Geelen, G.; Wade, C. E.; Barnes, P. R.

    1986-01-01

    The effects of lower body and abdominal pressure, produced by antigravity suit inflation, on blood pressure, pulse rate, fluid and electrolyte shift, plasma vasopressin and plasma renin activity in humans in upright postures were studied. Five men and two women stood upright for 3 hr with the suit being either inflated or uninflated. In the control tests, the suit was inflated only during the latter part of the trials. Monitoring was carried out with a sphygnomanometer, with sensors for pulse rates, and using a photometer and osmometer to measure blood serum characteristics. The tests confirmed earlier findings that the anti-g suit eliminates increases in plasma renin activity. Also, the headward redistribution of blood obtained in the tests commends the anti-g suit as an alternative to water immersion or bed rest for initial weightlessness studies.

  4. Twenty-second water reactor safety information meeting: Proceedings. Volume 1: Plenary session; Advanced instrumentation and control hardware and software; Human factors research; IPE and PRA

    International Nuclear Information System (INIS)

    Monteleone, S.

    1995-04-01

    This three-volume report contains papers presented at the Twenty-Second Water Reactor Safety Information Meeting held at the Bethesda Marriott Hotel, Bethesda, Maryland, during the week of October 24--26, 1994. The papers are printed in the order of their presentation in each session and describe progress and results of programs in nuclear safety research conducted in this country and abroad. Foreign participation in the meeting included papers presented by researchers from Finland, France, Italy, Japan, Russia, and United Kingdom. The titles of the papers and the names of the authors have been updated and may differ from those that appeared in the final program of the meeting. Selected papers are indexed separately for inclusion in the Energy Science and Technology Database

  5. Pražské Jezulátko v tiskařské produkci před rokem 1800

    Czech Academy of Sciences Publication Activity Database

    Baďurová, Anežka

    2012-01-01

    Roč. 57, 1/2 (2012), s. 53-74 ISSN 0036-5351 Institutional research plan: CEZ:AV0Z70830501 Keywords : Bohemica 1500-1800 * Jesus Baby of Prague * Discalced Carmelites * recatholisation Subject RIV: AB - History

  6. K izučeniju kul'tury s keramikoj pražskogo tipa na territorii Moravii: formirovanije i osobennosti

    Czech Academy of Sciences Publication Activity Database

    Jelínková, Dagmar

    -, č. 5 (2015), s. 117-150 ISSN 1608-9057 Institutional support: RVO:68081758 Keywords : Prague-type pottery culture * Moravia * dating * Cultural relations to the east and South-East * Influence of the Merovingian sphere Subject RIV: AC - Archeology, Anthropology, Ethnology

  7. Festival Pražské Quadriennale a jeho marketingové a komunikační návaznosti

    OpenAIRE

    Pavlíková, Lenka

    2011-01-01

    The first chapter of this thesis analyzes the marketing mix of Prague Quadrennial 2011. The following part focuses on marketing communication of this cultural event, reflecting the non-professional public. Based on data obtained from marketing research on the festival's perception and the last year's marketing campaign, the aim of this academic work is to propose possible improvements for the next festival's marketing campaign.

  8. Uji Biologis Konsumsi Pakan, Populasi Bakteri Rumen dan pH Pellet Complete Calf Starter pada Pedet Friesian Holstein Pra Sapih

    Directory of Open Access Journals (Sweden)

    Nadia Maharani

    2015-04-01

    Full Text Available (Biological test feed intake, population rumen bacteria and ph pellet complete calf starter friesian holstein on pre weaning calf  ABSTRACT. The study aims to assess the quality of the formula Complete Calf Starter (CCS with 5% molasses instead of milk to the development of rumen microbial calf Holstein Friesian (HF pre-weaning. The material used is 20 head calf FH pre weaning age of 2 weeks. Feed intake data taken from 20 respondents consisted of 16 females and 4 calf tail male calf. Data rumen bacterial populations and pH were taken from 5 head of cattle slaughtered at the age of 2 weeks (one tail, 4 weeks (2-tailed and 6 weeks (2-tailed. The study was designed as a descriptive non-parametric. Parameters measured were rumen bacterial populations, pH and feed intake. The results showed the average consumption of dry matter (DM and CCS calf milk FH ages 2, 4, 6 weeks respectively at 506, 517, 528 grams. Rumen bacterial populations in calves aged 2, 4, and 6 weeks of 80x106, 45x106 and 19x106 kol/m. ruminal pH in calves aged 2, 4 and 6 weeks was 5.71, 5.36 and 5.55. Biological test showed that the use of complete calf starter (CCS in the form of pellets FH calves at the age of 2 weeks to stimulate the development of the rumen (feed intake, the population of bacteria and pH but not in calves aged 4 and 6 weeks. This is because the number of bacterial populations declined due to impaired absorption is impaired absorption of VFA marked low rumen pH.

  9. Bioremediation system on-line for removal radionuclides in radioactive waters; Sistema de biorremediation on-line pra la eliminacion de radionuclidos en aguas radiactivas

    Energy Technology Data Exchange (ETDEWEB)

    Belinchon, J. A.; Garcia, A. M.; Ruibal, C.; Moreno, D. A.

    2010-07-01

    In previous studies developed in Cofrentes Nuclear Power Plant (Valencia, Spain), has been observed that the microorganisms in the radioactive waters of the spent nuclear fuel pool are capable of colonizing the metallic surfaces of the walls and pipes and perform biofilm. These biofilm retain the nuclides contributing to decontaminate the water. In this project, carried out in Cofrentes Nuclear Power Plant, a pilot plant has been designed for the bio decontamination of the radioactive water. At present, the radioactive water coming from the spent nuclear fuel pools, pass through ionic exchange resins. After, these resins are managed as radioactive waste. In this project, the water passes through a bioreactor with stainless steel balls capable of being colonized by the microorganisms in the water. Inside the bioreactor the water gets in contact with the material of the balls, and a biofilm, which retains the nuclides in the water, is developed. The biofilm is easily removed by any conventional procedure of radiochemical decontamination of materials and the nuclides can be collected in a small volume for recovery final disposition or containment. Later, the material of the bioreactor could be managed as not radioactive material. (Author) 9 refs.

  10. Guía de buenas prácticas para la gestión de escapes en la acuicultura marina. Vol II. Mitigación

    OpenAIRE

    Izquierdo-Gomez, David; Fernandez-Jover, Damian; Sanchez-Jerez, Pablo; Toledo-Guedes, Kilian; Arechavala-Lopez, Pablo; Forcada, Aitor; Valle-Pérez, Carlos

    2014-01-01

    Desde que el cultivo a gran escala de salmón (Salmo salar) en mar abierto comenzó́ en Noruega en el último tercio del siglo pasado, los escapes siempre han supuesto uno de los mayores problemas, tanto para las empresas como para el ecosistema marino. Siendo, en todos los casos, las pérdidas por escapes uno de los principales desafíos en el proceso de producción. Desde un punto de vista medioambiental, una vez que los peces escapan de las jaulas se convierten en un elemento más del ecosistema ...

  11. Analýza motivace diváků pražských profesionálních činoherních divadel

    OpenAIRE

    Hájková, Mariana

    2012-01-01

    This Master Thesis maps the scene of the professional theaters in Prague from the spectators' perspective. Consequently it points out the most important motivation factors for each market segment that leads people to visit the shows. The theoretical part defines the terms theater and drama. It also analysis theater market in the Czech Republic and Prague's professional drama scene. Moreover, it specifies a marketing mix in the context of theaters, introduces the basic principles of marketing ...

  12. A aplicação da teoria da aprendizagem significativa de Ausubel na prática improvisatória

    OpenAIRE

    César Albino; Sônia Albano de Lima

    2008-01-01

    This article deals with the application of D. P. Ausubel’s Theory of Meaningful Learning in the musical teaching processes, mainly in the improvisational practice. It is sub- divided into three parts: the first one analyses various teaching approaches, especially the traditional and the constructivist; the second one specifically deals with the theory; the third one refers to some theoretical concepts that can be applied in the improvisational practice. Part of the narrative was taken from th...

  13. Bioclimatic buildings of 16 houses in Pozuelo de Alarcon (Madrid); Edificio bioclimatico de 16 viviendas de promocion publica pra jovenes en Pozuelo de Alarcon. (Madrid)

    Energy Technology Data Exchange (ETDEWEB)

    Yanez, G.; Yanez-Lopez del Amo, L.

    2004-07-01

    We present in this article a housing building for young people recently built for the Autonomous Administration of Madrid in Pozuelo de Alarcon in which have been applied some bioclimatic and energy efficiency techniques. In this communication are described the main architectural features and are exposed some of the estimated results of energy saving and reduction of Co2. (Author)

  14. Control of Dynamic Aperture for Synchrotron Light Sources

    CERN Document Server

    Bengtsson, Johan

    2005-01-01

    Given the following frameworks: "A Hamiltonian-Free Description of Single Particle Dynamics for Hopelessly Complex Periodic Systems" (Forest, 1990), "Normal Form Methods for Complicated Periodic Systems" (Forest, Berz, Irwin, 1989), "The Correct Local Description for Tracking in Rings" (Forest, 1994), "The C++ Programming Language" (Stroustrup, 1985), we have designed a compact object oriented beam dynamics class by re-using existing FORTRAN libraries for: Truncated Power Series Algebra (Berz, SSC, 1988), and Map Normal Rorm (Forest, CBP, LBNL, 1990). In other words, implemented a numerical- and analytical model for: 6-dim phase space tracking, with classical radiation, and evaluation of equilibrium emittance, driving terms, amplitude dependent tune shifts, chromaticity, momentum compaction, etc., to arbitrary order, with self-consistent treatment of magnet errors. The tool was developed for the lattice design of NSLS-II.

  15. Monitoring the effect of motivation on mastering knowledge and skills in distance learning systems / Влияние мотивации на процессы овладения знаниями, умениями и навыками в системе дистанционного образовани / Praćenje uticaja motivacije na procese apsolviranja znanja i veština u sistemu učenja na daljinu

    Directory of Open Access Journals (Sweden)

    Boža D. Miljković

    2016-10-01

    ыявления основан на наблюдении роста знаний по сравнению с предварительными, так называемыми предзнаниями: 1. профессиональные предзнания и 2. общеобразовательные предзнания, проверенные вступительными тестами и на подготовительных курсах. В результате решения задач по данным вопросам проведен анализ влияния профессиональных предзнаний, общеобразовательных знаний и заинтересованности учащихся на восприятие, понимание и решение задач и достижение результатов. Результаты проведенного анализа показали, что в успешном понимании и решении профессионально-технических задач общеобразовательные предзнания и заинтересованность учащихся играют ключевую роль. / U radu je opisano kako procesi motivacije utiču na slušaoce kursa sa stanovišta apsolviranja znanja, te prenosa i korišćenja znanja i veština u sistemu učenja na daljinu. Istraživanja, u socijalno-kognitivnom okviru, ilustruje prilagodljivost sistema i adekvatno prilagođavanje motivacionih obrazaca. Model motivacionih procesa predstavljen je u funkciji ciljeva učenja slušalaca kursa. Praćenjem uticaja motivacionog faktora na izvršavanje kognitivnih zadatka, te kako se oblikuju reakcije slušalaca kursa, tj. kako motivacioni faktor utiče na uspeh ili neuspeh i kvalitet kognitivnog učinka u procesu učenja, menjan je i prilagođavan metodičko-didaktički pristup nastavi. U ovom radu istraživan je uticaj znanja iz uže stručne oblasti, ali i interesovanja slu

  16. Probabilistic Risk Assessment to Inform Decision Making: Frequently Asked Questions

    Science.gov (United States)

    General concepts and principles of Probabilistic Risk Assessment (PRA), describe how PRA can improve the bases of Agency decisions, and provide illustrations of how PRA has been used in risk estimation and in describing the uncertainty in decision making.

  17. Vzdělávání dětí cizinců na pražských základních školách

    Czech Academy of Sciences Publication Activity Database

    Vojtíšková, Kateřina

    2012-01-01

    Roč. 10, č. 2 (2012), s. 10-19 ISSN 1214-438X Institutional support: RVO:68378025 Keywords : inclusive education * qualitative research * acculturation strategies Subject RIV: AO - Sociology, Demography

  18. Hobojista Arnošt König a jeho působení v pražském hudebním životě

    Czech Academy of Sciences Publication Activity Database

    Kolátorová, Petra

    2012-01-01

    Roč. 49, č. 3 (2012), s. 263-284 ISSN 0018-7003 R&D Projects: GA ČR GA408/08/1020 Institutional support: RVO:68378076 Keywords : Arnošt König * oboist * Prague´s musical life * Antonín Dvořák Subject RIV: AL - Art, Architecture, Cultural Heritage

  19. KESINAMBUNGAN MOTIF HIAS MASA PRA-ISLAM STUDI KASUS PADA MIMBAR MASJID KAJORAN THE CONTINUITY OF ORNAMENTAL MOTIVES IN PRE-ISLAMIC PERIOD A CASE STUDY INTHE PODIUMOF KAJORAN MOSQUE

    Directory of Open Access Journals (Sweden)

    Endang Widyastuti

    2016-06-01

    ABSTRAK             Masuknya agama Islam memberikan warna baru dalam bidang kesenian khususnya seni hias. Dalam agama Islam terdapat larangan untuk menggambar makhluk hidup sehingga dilakukan upaya untuk menyamarkannya. Pada mimbar masjid Kajoran terdapat hiasan dengan motif binatang dan tumbuh-tumbuhan. Berdasarkan pengamatan diketahui bahwa selain motif-motif geometris, pada mimbar tersebut juga terdapat motif-motif berupa gajah, naga, burung, dan bunga teratai. Kemungkinan makna motif-motif hias tersebut masih relevan dengan ajaran Islam. Hal ini menunjukkan besarnya toleransi agama Islam terhadap kebudayaan yang telah ada pada suatu daerah, selama tidak bertentangan dengan ajaran agama Islam.   Kata Kunci: mimbar, motif hias, masjid Kajoran

  20. Rostlinné zbytky ze zaniklé studny. Svědci historie Jiřského náměstí na Pražském hradu ve 13. století

    Czech Academy of Sciences Publication Activity Database

    Čulíková, Věra

    2012-01-01

    Roč. 64, č. 3 (2012), s. 479-502 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : archaeobotany * Middle Ages * Prague Castle * carpological analysis * well Subject RIV: AC - Archeology, Anthropology, Ethnology

  1. Ve službách československé vědy (Přínos ruské emigrace k rozvoji pražské byzantologie a medievistické balkanistiky)

    Czech Academy of Sciences Publication Activity Database

    Havlíková, Lubomíra

    2006-01-01

    Roč. 31, - (2006), s. 17-47 ISSN 0081-007X Institutional research plan: CEZ:AV0Z90920516 Keywords : history * Russian emigration * Balkan studies * Byzantine studies * Middle Ages Subject RIV: AB - History

  2. Pengaruh Citra Merek (Brand Image) dan Harga terhadap Keputusan Pembelian Konsumen (Survei pada Mahasiswa Program Studi Administrasi Bisnis Fakultas Ilmu Administrasi Universitas Brawijaya Malang Tahun Angkatan 2013/2014 dan 2014/2015 Pengguna Kartu Pra-b

    OpenAIRE

    Venessa, Ike; Arifin, Zainul

    2017-01-01

    This study is aim to understand and explain : Significance of the influence of corporate image variable, consumers image variable, product image variable, price variable on consumer purchase decision all together; Significance of the influence of corporate image variable on consumer purchase decision; Significance of the influence of consumers image variable on consumer purchase decision; Significance of the influence of product image variable on consumer purchase decision; Significanc...

  3. Energy, why you want? The human side of rural electrification in a Amazonian community; Energia, pra que te quero? O lado humano da eletrificacao rural em uma comunidade amazonica

    Energy Technology Data Exchange (ETDEWEB)

    Basile, Cecilia Geraldes; Almeida, Arthur C.; Monteiro, Jose H.A.; Rocha, Brigida R.P. [Universidade Federal do Para (ENERBIO/DEEC/UFPA), Belem, PA (Brazil). Dept. de Engenharia Eletrica e Computacao. Grupo de Pesquisa Energia e Meio Ambiente], Emails: cecibasi@ufpa.br, arthur@ufpa.br, jhumberto01@yahoo.com.br, brigida@ufpa.br

    2006-07-01

    The paper presents results of research carried out in an isolated community in the Amazon to gauge the demand for electricity. It was prepared a detailed survey of the social customs, habits of work, leisure, their economy, livelihoods and their relationship with the environment. The search result points to the use of electricity in the community as a factor in improving the income, it is possible to buy equipment to grind and crush cassava, to enable production of fruit pulp, to produce ice for conservation of fish and introduction to fish farming for employment generation.

  4. Soubor renesančních bot ze studny u kostela Všech svatých na Pražském hradě

    Czech Academy of Sciences Publication Activity Database

    Bravermanová, H.; Březinová, Helena; Hlaváček, P.

    1998-01-01

    Roč. 23, - (1998), s. 471-492 ISSN 0231-5823. [Celostátní konference archeologů středověku České republiky a Slovenské republiky k problematice archeologie středověkých komunikací. Prachatice, 06.10.1997-10.10.1997] Subject RIV: AC - Archeology, Anthropology, Ethnology

  5. Ludus calamorum. Husité, Cesarini a Zikmund před bitvou u Domažlic v novém světle zapadlého pražského manifestu

    Czech Academy of Sciences Publication Activity Database

    Coufal, Dušan

    2013-01-01

    Roč. 5, č. 1 (2013), s. 39-73 ISSN 1804-0977 R&D Projects: GA ČR(CZ) GBP405/12/G148 Institutional support: RVO:67985955 Keywords : Hussites * Hussite manifestos * Sigismund of Luxemburg * Giuliano Cesarini * The Battel of Domažlice 1431 * communication Subject RIV: AB - History

  6. Partículas em suspensão na Praça Camões (Bragança), durante a construção do parque de estacionamento

    OpenAIRE

    Feliciano, Manuel; Gonçalves, Artur; Gomes, Paulo; Cardoso, Ana; Araújo, Rui

    2004-01-01

    Os projectos de construção geram frequentemente cenários fortemente perturbadores para as comunidades envolventes às áreas de implementação dos mesmos. Uma das maiores perturbações associadas à construção resulta das emissões de poluentes particulados para a atmosfera, as quais podem causar prejuízos consideráveis na qualidade do ar, com repercussões graves para a saúde do Homem. Neste contexto, no âmbito do Projecto de Acompanhamento Ambiental da Obra do Parque de Estacionamento Subterrâ...

  7. Čeští kantoři a hudba u pražských alžbětinek v 18. a 19. století

    Czech Academy of Sciences Publication Activity Database

    Michl, Jakub

    2015-01-01

    Roč. 6, č. 2 (2015), s. 51-59 ISSN 1804-5367 Institutional support: RVO:68378076 Keywords : Sisters of Saint Elizabeth * convents * cantors * music in convents * music collections * pedagogy of music * Lužec nad Vltavou * Prague * Hořovice * Jan Pavel Slavík * 18th century * 19th century * Zikmund Václav Josef Suchý Subject RIV: AL - Art, Architecture, Cultural Heritage

  8. Digestión anaeróbia de los lodos sedimentados en la bahía interior de Puno - Lago Titicaca, pra la obtención de biogás y biosólido estable

    OpenAIRE

    Villafuerte Prudencio, Nazario

    2014-01-01

    En la presente investigación los trabajos de campo se realizaron en la Bahía Interior de Puno - Lago Titicaca y la parte experimental en el Mega Laboratorio de la Universidad Nacional del Altiplano -Puno (UNA -Puno), desde el año 2011 a 2013. Los objetivos específicos fueron: 1) Determinar el contenido de materia orgánica en los lodos sedimentados, 2) Evaluar los principales parámetros fisicoquímicos del proceso de la digestión anaerobia, 3) Determinar la composición del biogás generado y 4) ...

  9. A configuração da via pública interferindo na apreensão da praça: o caso de conjuntos habitacionais em Teresina

    Directory of Open Access Journals (Sweden)

    Wilza Gomes Reis Lopes

    2007-06-01

    Full Text Available Commerce and spaces of leisure already had been together for much time, in the Average Age the market assumed the role that today fits to the square of collective space of leisure. Today the market acquires the consumption function eminently, more is not lived deeply the environment and the people. The incessant search for the profit, or same for the survival, moves our society and each place that can potentially relieve money is explored to the maximum. Located houses next to moving streets are changedded quickly into commercial points, modifying the configuration of a space created for housing in commerce environment. But these ways are not populated only by private establishments, them also present public spaces, that suffer the consequences of these alterations. The present work presents a study of three squares located in the habitacionais sets Itararé, Piauí Park and Promorar Park, in the city of Teresina, Piauí, observing as the changes in the original function of the streets of entorno, that they had been projected, initially, as surrounding residential, have modified the performance of the public spaces.

  10. Criteria of quality in radio guided surgery for detection and removal of sentinel node in non-palpable lesions; Criterios de calidad en cirugia radioguiada pra deteccion y extirpacion de ganclio centinela en lesiones no palpables

    Energy Technology Data Exchange (ETDEWEB)

    Prieto, D.; Esteve, S.; Sanchez, K.; Rodriguez, P.; Barquero, R.; Ferrer, N.; Arranz, L.

    2013-07-01

    The first objective of this study is to carry out a theoretical study of the dose absorbed in the breast, comparing different types of source used, and according to location of the same. On the other hand, for the location of these nodes, or tumors in the operating room, can be used as well as portable gamma-cameras, intraoperative sensor probes of gamma radiation, facilitating the work the surgeon. Currently there is no protocol at national level describing quality control tests to be carried out on these computers. The second objective of the study is to collect a series of tests that enable to verify the correct operation of an intraoperative probe. These tests are classified according to their frequency, specialist, and test type, and allow you to check if the effectiveness of the operation of the probe is provided in your acquisition. Among the parameters that let you check the performance specifications are sensitivity, angular resolution and spatial resolution. (Author)

  11. Intervenção urbana não urbanística: o teatro de rua e demais personagens que tematizam o urbano na praça Santos Andrade localizada em Curitiba

    Directory of Open Access Journals (Sweden)

    Soraya Sugayama

    2012-12-01

    Full Text Available Através deste artigo pretendemos lançar um olhar sobre as personagens que, assim como arquitetos e engenheiros, também abordam a cidade como tema e atuam na mesma, com a diferença de que não constroem planejadamente infraestruturas urbanas, mas sim, compõem a paisagem urbana como um acontecimento atrativo e inesperado, através de sua arquitetura efêmera e imaginativa. Por meio do teatro de rua o presente artigo reflete sobre a relação entre os aparentemente não-eruditos e a cidade, pensando no conceito de lugar e espaço ligado à urbanidade, mais precisamente ao entorno do prédio histórico da Universidade Federal do Paraná, no centro da cidade de Curitiba e aborda brevemente os subconceitos derivados da cultura: cultura popular e cultura erudita.

  12. O QUE SE VÊ E O QUE SE APRENDE: educação e construção de identidades na Praça Mary de Pinho

    Directory of Open Access Journals (Sweden)

    Jesus Marmanillo Pereira

    2017-03-01

    El propósito de este artículo es colocar la plaza como un espacio central en la construcción del conocimiento ambiental a través de la educación no formal. La investigación tiene como objetivo comprender cómo es la relación entre los procesos de la conciencia ambiental y prácticas socio-espaciales en la construcción de lugares urbanos. Por lo tanto, este estudio investiga la vida cotidiana de un conjunto de actores (niños, ancianos, peatones y jóvenes en la Plaza de Mary dePinho en Imperatriz-MA. La encuesta, etnográfico, incluye la observación, diario de campo, conversaciones, fotos y descripción de las interacciones entre el agente de espacio. Visitas exploratorias se llevaron a cabo entre marzo y junio de 2016 y muestran que es posible acercarse a los roles de las percepciones ambientales y los procesos educativos que se desarrollan en espacios públicos para el ocio. Palabras clave: Plaza Mary de Pinho; Imperatriz; Educación Ambiental.

  13. Diagnóstico da arborização nas praças públicas de Cajazeiras-PB: interferência no mobiliário urbano

    Directory of Open Access Journals (Sweden)

    Dafi Irenice Abreu

    2017-09-01

    Full Text Available Environmental quality in cities is linked to the way building and wooded spaces are related. The disorderly growth of the cities highlights the lack of planning that reconciles the harmonious coexistence between these two spaces. The consequence is that green areas are incompatible with adequate planting and maintenance criteria, resulting in damage to the population. In this sense, the objective of this project was to analyze the afforestation in Cajazeiras - PB and its impacts to the local community, having as object of research the public squares, pointing out the local effects that the squares observed provide to the physical equipment of this city. For this purpose, a simple afforestation guide was developed to assist in the collection and treatment of data obtained from field visits. The aspects observed in the squares were: quantization of the arboreal species; location between trees and in relation to urban equipment. The existence of conflicts between the trees and the urban components was verified: 72.2% have irregular distances of buildings; 39% do not meet the requirements of planting in sidewalk, 15.25% of this total are causing damages; Concerning trees near the electrical wiring, 33.33% cause interference in the electrical network. It was observed that out of the total of trees in the squares, 41.8% did not meet the minimum distance limit suggested. These results suggest that the planting of trees in the squares was carried out without criteria, and that due attention was not given to the damages that this fact might entail. In this sense, it seems clear that the importance of this work is to provide diagnosis of afforestation in the public squares of Cajazeiras, opening a discussion, mainly with the public administration, on the risks of unplanned afforestation

  14. Organizace hudebních akcí v pražských industriálních prostorech a halách

    OpenAIRE

    Jelínková, Lucie

    2015-01-01

    The aim of this work is to map the current development on the Prague cultural scene set in the industrial spaces, it captures in a comprehensive way some common tendencies in the atypical industrial environment. Although there are marginally mentioned various cultural activities, work particularly focuses on the frequent presentation of electronic dance music in abandoned buildings. The work describes the historical development of industrial heritage on the territory of Prague, what kind of c...

  15. Šimon od Bílého lva: den pražského měšťana v době vymknuté z kloubů

    Czech Academy of Sciences Publication Activity Database

    Musílek, Martin

    2016-01-01

    Roč. 32, č. 2 (2016), s. 2-27 ISSN 0231-6056 R&D Projects: GA ČR(CZ) GBP405/12/G148 Institutional support: RVO:67985955 Keywords : Prague-Old Town * Simon of the White Lion * Hussite rebellion * medieval town * rural estates * libraries Subject RIV: AB - History

  16. Příběhy rekonstrukčních řezů historickým nadložím Pražského hradu

    Czech Academy of Sciences Publication Activity Database

    Boháčová, Ivana

    2017-01-01

    Roč. 10, č. 2 (2017), s. 108-124 ISSN 1803-1749. [Archeologie ve městě. Strategie, metodika, metody výzkumu, prezentace a ochrany archeologických památek. Mělník, 01.06.2016-03.06.2016] R&D Projects: GA MK(CZ) DF13P01OVV014 Keywords : archaeology * methodology * central site * Early Middle Ages Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology

  17. Scientific and technological monitoring: international overview on R. and D. related to Pra`s; Veille technologique et scientifique: etat de l`art de la R. et D. dans le domaine des EPS

    Energy Technology Data Exchange (ETDEWEB)

    Llory, M; Stioui, A

    1993-03-01

    In 1989, the R and D Division of Electricite de France launched a programme for a Technological and Scientific Overview (TSO) covering a certain number of topics considered to be important for the future of EDF. Probabilistic approaches to studies related to safety were considered to be strategically important to EDF, and therefore this area was selected for further study. A TSO is a process which can only start on the basis of a structured state-of-the-art organized as a basis of knowledge, together with the highlighting of a certain number of scientific and strategic ``set of references{sup .} The state-of-the-art of R and D related to Probabilistic Safety Assessment (PSA) was carried out in collaboration between the EDF R and D Division (SR branch) and SRI International. The approach chosen included: segmentation of the wide field of PSAs into subject areas, topics and sensitive points to be monitored; conception of a grid for the interviews; approximately thirty in-depth interviews of organizations and experts representative of the domain; analysis leading to identify certain problems areas or particularly important features. Emerging themes for research and further consideration in relation to PSAs, their application and their limits were also identified. Based on this state-of-the-art, various themes of monitoring were defined (living PSAs, limits of PSAs,...) and an organizational structure for monitoring was set up in the branch. The state of the art is not static, it is the reason why an in-depth extension of the study was undertaken on issues of special interest for EDF. (authors). 2 figs., 2 refs.

  18. Simulace a řízení větrání tunelů pražského vnitřního okruhu

    Czech Academy of Sciences Publication Activity Database

    Ferkl, Lukáš; Sládek, O.

    2006-01-01

    Roč. 15, č. 2 (2006), s. 101-103 ISSN 1210-1389 R&D Projects: GA MŠk(CZ) 1M0567 Institutional research plan: CEZ:AV0Z10750506 Keywords : ventilation * highway tunnels * control * simulation * optimalization Subject RIV: BC - Control Systems Theory

  19. K nestandardním projevům pohřebních aktivit na předpolí Pražského hradu

    Czech Academy of Sciences Publication Activity Database

    Tomková, Kateřina; Stránská, Petra

    2011-01-01

    Roč. 15, č. 1 (2011), s. 553-561 ISSN 1214-3553 R&D Projects: GA ČR GA404/09/1135 Institutional research plan: CEZ:AV0Z80020508 Keywords : Early Middle Ages * postmedieval time * Prague * burial customs Subject RIV: AC - Archeology, Anthropology, Ethnology

  20. Pyloanalytické výsledky ze zaniklé studny Jiřského náměstí Pražského hradu

    Czech Academy of Sciences Publication Activity Database

    Jankovská, Vlasta

    2012-01-01

    Roč. 64, č. 3 (2012), s. 503-507 ISSN 0323-1267 Institutional support: RVO:67985939 Keywords : pollen analysis and non-pollen-palynomorphs analysis * Prague castle * Middle Ages Subject RIV: EF - Botanics

  1. "É melhor pra você!": normatização social da infância e da família no Brasil "It will be in your favor!": social regulation of childhood and family in Brazil

    Directory of Open Access Journals (Sweden)

    Nelson Gomes de Sant'Ana e Silva Júnior

    2007-12-01

    Full Text Available O trabalho analisa os discursos/práticas especialistas, em funcionamento desde fins do século XIX, como mecanismos de normatização de valores e comportamentos da infância/família brasileira. Utilizou-se a abordagem genealógica para pesquisar conteúdos veiculados nos Arquivos Brasileiros de Higiene Mental. Objetivou-se promover visibilidade de especialistas do conhecimento, fomentando uma desnaturalização de práticas/saberes considerados verdades universais. Identificaram-se fundamentos políticos, ideológicos e morais que sustentam discursos/práticas contemporâneos supostamente neutros e, frequentemente, acrescidos de assistencialismo e/ou militância. Aponta-se para necessidade de reavaliações das implicações políticas, éticas e sociais presentes tanto na formação como nas práticas psi.This report analyzes specialist speeches/practices which have acted as mechanisms for Brazilian children/families since the end of the 19 century. A genealogic approach was used to carry out a study on the contents published in the Brazilian Mental Hygiene Archives. It also aims at enhancing the experts of the knowledge which make unnatural practices/opinions considered as universal truths. This analysis has identified political, ideological and moral bases supporting contemporaneous speeches/practices disguised as neutrality, which are often increased by "assistentialism" and/or militancy. It shows the need for revaluation of political and social consequences in the graduation and in the psychology practice.

  2. Revize mladších stavebních fází kostela Panny Marie na Pražském hradě/Hradčanech

    Czech Academy of Sciences Publication Activity Database

    Maříková-Kubková, Jana; Herichová, Iva

    2017-01-01

    Roč. 33, č. 2 (2017), s. 74-93 ISSN 0231-6056 Institutional support: RVO:67985912 Keywords : Early Middle Ages * Prague Castle * Church of the Virgin Mary Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology

  3. Správa a každodenní provoz koleje Českého národa na pražské univerzitě v 16. století

    Czech Academy of Sciences Publication Activity Database

    Holá, M.; Holý, Martin

    2014-01-01

    Roč. 22, č. 2 (2014), s. 115-123 ISSN 1211-9768 R&D Projects: GA ČR GPP405/12/P422 Institutional support: RVO:67985963 Keywords : educational patronage * Prague University * students colleges Subject RIV: AB - History

  4. Využití vybraných sociálních sítí v marketingu pražských restauračních zařízení

    OpenAIRE

    Gregorová, Leona

    2016-01-01

    Bachelor thesis deals with the phenomenon of social sites and their use in restaurant marketing. It focuses on the description of opportunities, which individual social sites Facebook, Twitter and Instagram offer for the restaurant promotion. The main part of this work is quantitative research amongst Prague restaurants. The goal of the analysis is to find out, how is the phenomenon spread amongst them, which sites they use and how effectively. There were used methods of description, comparis...

  5. EFFECT OF PRETREATMENTS ON CHEMICAL AND ANTIOXIDANT PROPERTIES OF SKY FRUIT (Swietenia macrophylla SEED OIL [Pengaruh Pra-perlakuan Terhadap Sifat Kimia dan Antioksidan Minyak Biji Buah Tunjuk Langit (Swietenia macrophylla

    Directory of Open Access Journals (Sweden)

    Hayati Mohd Yusof

    2012-12-01

    Full Text Available The objective of this study was to investigate the effect of pretreatments on chemical and antioxidant properties of sky fruit (Swietenia macrohylla seed oil. The seeds were treated with different heat pretreatments (roasting, steaming, and microwaving and subsequently subjected to oil extraction by using a Bligh and Dyer method. It was found that different pretreatments significantly (p<0.05 affected yield and peroxide value of the extracted oils. However, no significant effect of pretreatment was observed on free fatty acid content of the seed oils. The oils exhibited significantly different levels of 1, 1-diphenyl-2-picrylhydrazyl (DPPH scavenging activity due to different heat pretreatments. The results revealed that the mean percentages of DPPH scavenging activity of untreated (control seed oil (87.69% and steamed seed oil (83.40% were significantly higher than those of roasted seed oil (75.71% as well as the microwaved one (63.98%. In contrast, the pretreatments did not significantly affect total phenolic content (TPC of the seed oils with the TPC mean values ranging from 0.016 to 0.022 mg/g (as gallic acid. Data gained from this study provided valuable information for edible oil industries in searching for alternative source of edible oil with medicinal benefits.

  6. Application of probabilistic risk assessment in the operation of Koeberg nuclear power station

    International Nuclear Information System (INIS)

    Nicholls, D.R.

    1991-01-01

    Probabilistic risk assessment (PRA) calculates the probability that a set of multiple failures could occur, the frequency with which the safety circuits will be required and the consequences of the failure of the safety systems. In this way the frequency with which major accident situations can be expected to happen, can be derived. The world history of PRA is presented, together with the South African history of PRA. The theory of PRA is explained and the application of PRA studies is described. In the last twenty years, PRA has gone from being a theoretical idea to a practical tool for assisting in plant management. 2 figs., 1 ill

  7. Development of infrastructure for the regulatory authority to implement risk-informed regulation

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-08-15

    It is important to assure the technical adequacy of probabilistic risk assessment (PRA) to implement risk-informed regulation of nuclear power plants (NPPs). JNES has been conducting various activities, such as development of PRA model, method, and data base, in order to assure the technical adequacy of PRA as development of the infrastructure for the regulatory authority to implement risk-informed regulation. In 2012, JNES updated the reliability data base used in PRA and improved PRA models to enhance the technical bases of PRA. In addition, JNES has been establishing the PRA model for fuel damage in the spent fuel storage pool in NPPs. As for improvement of PRA model for core damage in reactor, JNES conducted the study including feasibility of a simplified reliability model for digital I and C system developed by the digital I and C task group of OECD/NEA CSNI WGRISK by reproducing the sample calculation, and improvement of PRA models of individual NPPs in Japan. JNES is making effort to develop the procedures of internal fire PRA and internal flooding PRA. To improve the internal fire PRA, JNES is participating in OECD/NEA FIRE project to obtain the latest information and to validate and improve the fire propagation analysis codes and the parameters. JNES is establishing a method for analyzing internal influence due to flooding in NPPs, and this method is the base to develop the procedure of internal flooding PRA. (author)

  8. Recommendations for a proposed standard for performing systems analysis

    International Nuclear Information System (INIS)

    LaChance, J.; Whitehead, D.; Drouin, M.

    1998-01-01

    In August 1995, the Nuclear Regulatory Commission (NRC) issued a policy statement proposing improved regulatory decisionmaking by increasing the use of PRA [probabilistic risk assessment] in all regulatory matters to the extent supported by the state-of-the-art in PRA methods and data. A key aspect in using PRA in risk-informed regulatory activities is establishing the appropriate scope and attributes of the PRA. In this regard, ASME decided to develop a consensus PRA Standard. The objective is to develop a PRA Standard such that the technical quality of nuclear plant PRAs will be sufficient to support risk-informed regulatory applications. This paper presents examples recommendations for the systems analysis element of a PRA for incorporation into the ASME PRA Standard

  9. Real-time risk assessment of operational events

    International Nuclear Information System (INIS)

    Perryman, L.J.; Foster, N.A.S.; Nicholls, D.R.; Grobbelaar, J.F.

    1996-01-01

    Probabilistic risk assessment (PRA) has always been fundamental to the licensing process of Koeberg nuclear power station. Furthermore, over the past 8 years PRA has assisted in many areas of operation. One of these areas is the real-time assessment of abnormal operating events. Over the years, considerable experience has been gained in using PRA to improve plant safety and performance. This paper presents some of the insights obtained in using PRA in such a dynamic role and demonstrates that, by developing and using the plant-specific 'living' PRA, considerable safety and financial gains can be obtained. These insights specifically concern the prerequisites before optimal use of a plant-specific 'living' PRA can be made. Finally, examples are presented of occurrences when PRA was used to improve plant safety and performance. These examples serve to demonstrate the advantages that can be obtained if sufficient resources are placed at the disposal of the PRA team. (orig.)

  10. Evidence from Student-Community Engagement in Ghana

    African Journals Online (AJOL)

    2017-05-01

    TTFPP), where .... Participatory Rural Appraisal (PRA) which was developed in the 1980s. PRA gives local people the opportunity "to share, enhance and analyse their ... Then, cognitive engagement draws on the idea of ...

  11. Correlative study between myopia and ocular relative accommodation

    Directory of Open Access Journals (Sweden)

    Qiao-Ya Lin

    2015-07-01

    Full Text Available AIM: To research the characteristics of positive relative accommodation(PRA, negative relative accommodation(NRAand PRA/NRA ratio in myopes. To analyze the relationship among PRA, NRA, PRA/NRA ratio, spherical equivalent degree, years and habbits of wearing glasses, myopia development, and pupil diameter.METHODS: Aretrospective study of ninety eyes in the 180th Hospital of Quanzhou from August 2014 to December 2014. PRA, NRA and PRA/NRA ratio were compared among low, moderate, high myopes and emmetropes. The correlation were analyzed among PRA, NRA, PRA/NRA ratio, spherical equivalent degree, years and habbits of wearing glasses, myopia development and pupil diameter. PRA, NRA, PRA/NRA ratio, years and habbits of wearing glasses and pupil diameter were compared between progress group and non-progress group.RESULTS:(1Without statistical differences in age, sex and intraocular pressure, PRA and PRA/NRA ratio of myopes were lower than emmetropes, while NRA was higher.(2Without statistical differences in age, sex and intraocular pressure, PRA, PRA/NRA ratio and NRA had no statistical differences while years and habbits of wearing glasses had statistical differences among low, moderate, high myopes.(3With longer years of wearing glasses, PRA, PRA/NRA ratio were larger and NRA, pupils were smaller.(4Without statistical differences in age, diopter and intraocular pressure, one group which were not easy to deepen degree had more often-wear-glasses myopia patiens and longer years of wearing glasses, the other group which were easy to deepen degree had more seldom-wear-glasses myopia patiens and shorter years of wearing glasses.CONCLUSION: PRA and PRA/NRA ratio of myopes were lower than emmetropes, while NRA was higher. No correlated relation was detected among PRA, NRA, PRA/NRA ratio, spherical equivalent degree and myopia development. It suggests the onset and progress of myopia are related to many factors. Wearing-glass timely and accurately can

  12. Design of a fifth-order achromat

    CERN Document Server

    Wan, W

    1999-01-01

    A repetitive system free of all aberrations up to the fifth order was designed based on a recently developed analytical theory that, in principle, allows the design of such achromats to an arbitrary order (Wan and Berz, Phys. Rev. E, 54 (1996) 2870; Wan, Ph.D. Thesis, Michigan State University, 1995). It serves as an example to show that complete correction of aberrations is possible beyond order three, which is the highest order achieved before (Dragt, Nucl. Instr. and Meth. A 258 (1987) 339; F. Neri, in: Berz, McIntyre (Eds.), Proc. Workshop on High Order Effects). Instead of repetition of identical cells, which is widely used in achromat design based on normal form theory, we utilize cells which are obtained from the original ones through mirror imaging about the x-y plane, which corresponds to a reversion. In our design, the second half of the ring is the reversion of the first one, and two turns make a fifth-order achromat. A possible application of repetitive high-order achromats being time-of-flight sp...

  13. Design of a fifth-order achromat

    International Nuclear Information System (INIS)

    Wan, Weishi; Berz, Martin

    1999-01-01

    A repetitive system free of all aberrations up to the fifth order was designed based on a recently developed analytical theory that, in principle, allows the design of such achromats to an arbitrary order (Wan and Berz, Phys. Rev. E, 54 (1996) 2870; Wan, Ph.D. Thesis, Michigan State University, 1995). It serves as an example to show that complete correction of aberrations is possible beyond order three, which is the highest order achieved before (Dragt, Nucl. Instr. and Meth. A 258 (1987) 339; F. Neri, in: Berz, McIntyre (Eds.), Proc. Workshop on High Order Effects). Instead of repetition of identical cells, which is widely used in achromat design based on normal form theory, we utilize cells which are obtained from the original ones through mirror imaging about the x-y plane, which corresponds to a reversion. In our design, the second half of the ring is the reversion of the first one, and two turns make a fifth-order achromat. A possible application of repetitive high-order achromats being time-of-flight spectroscopy, the resulting ring was analyzed with respect to dynamic aperture and energy resolution using maps of orders nine and higher

  14. The roles of NRC research in risk-informed, performance-based regulation

    International Nuclear Information System (INIS)

    Morrison, D.L.; Murphy, J.A.; Hodges, M.W.; Cunningham, M.A.; Drouin, M.T.; Ramey-Smith, A.M.; VanderMolen, H.

    1997-01-01

    The NRC is expanding the use of probabilistic risk analysis (PRA) throughout the spectrum of its regulatory activities. The NRC's research program in PRA supports this expansion in a number of ways, from performing basic research to developing guidance for regulatory applications. The author provides an overview of the NRC's PRA research program, then focuses on two key activities - the review of individual plant examinations, and the development of guidance for use of PRA in reactor regulation

  15. The 10,000-year debate

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, J.R.

    1996-08-01

    Probabilistic Risk Assessment (PRA) has developed into a respected tool within the reactor community. Now, this PRA technique is being applied to a new arena, the distant future of the nuclear waste repository. Problems are already testing the credibility of PRA.

  16. Innovative probabilistic risk assessment applications: barrier impairments and fracture toughness. Panel Discussion

    International Nuclear Information System (INIS)

    Osterman, Michael; Root, Steven; Li, F.; Modarres, Mohammad; Reinhart, F. Mark; Bradley, Biff; Calhoun, David J.

    2001-01-01

    Full text of publication follows: New probabilistic risk assessment (PRA) applications promise to improve the overall safety and efficiency of nuclear plant operations. This discussion will explore the use of PRA in evaluating barrier integrity with respect to the consequences of natural phenomena such as tornadoes, floods, and harsh environments. Additionally, the session will explore proposals to improve fracture toughness techniques using PRA. (authors)

  17. The 10,000-year debate

    International Nuclear Information System (INIS)

    Wilson, J.R.

    1996-01-01

    Probabilistic Risk Assessment (PRA) has developed into a respected tool within the reactor community. Now, this PRA technique is being applied to a new arena, the distant future of the nuclear waste repository. Problems are already testing the credibility of PRA

  18. Overview of the probabilistic risk assessment approach

    International Nuclear Information System (INIS)

    Reed, J.W.

    1985-01-01

    The techniques of probabilistic risk assessment (PRA) are applicable to Department of Energy facilities. The background and techniques of PRA are given with special attention to seismic, wind and flooding external events. A specific application to seismic events is provided to demonstrate the method. However, the PRA framework is applicable also to wind and external flooding. 3 references, 8 figures, 1 table

  19. Uses of human reliability analysis probabilistic risk assessment results to resolve personnel performance issues that could affect safety

    International Nuclear Information System (INIS)

    O'Brien, J.N.; Spettell, C.M.

    1985-10-01

    This report is the first in a series which documents research aimed at improving the usefulness of Probabilistic Risk Assessment (PRA) results in addressing human risk issues. This first report describes the results of an assessment of how well currently available PRA data addresses human risk issues of current concern to NRC. Findings indicate that PRA data could be far more useful in addressing human risk issues with modification of the development process and documentation structure of PRAs. In addition, information from non-PRA sources could be integrated with PRA data to address many other issues. 12 tabs

  20. Probabilistic risk assessment: A look at the role of artificial intelligence

    International Nuclear Information System (INIS)

    Wang, J.; Modarres, M.; Hunt, R.N.M.

    1988-01-01

    A review of traditional Probabilistic Risk Assessment (PRA) methods used in the nuclear power industry is presented. The shortcomings of the current PRA methods are pointed out. A method of performing a PRA is proposed and is computerized. The role of artificial intelligence in developing and performing the proposed PRA approach is discussed. The proposed PRA approach is verified by comparing the results to previously performed PRAs. The comparisons have supported the adequacy and completeness of the results of the proposed model. A discussion of how the proposed method can be used as an expert system to verify plant status following loss of plant hardware is also presented. (orig.)

  1. Current status and future expectation concerning probabilistic risk assessment of NPPs. 1. Features and issues of probabilistic risk assessment methodology

    International Nuclear Information System (INIS)

    Yamashita, Masahiro

    2012-01-01

    Probabilistic risk assessment (PRA) of Nuclear Power Plants (NPPs) could play an important role in assuring safety of NPPs. However PRA had not always effectively used, which was indicated in Japanese government's report on Fukushima Daiichi NPP accident. At the Risk Technical Committee (RTC) of Standards Committee of Atomic Energy Society of Japan, preparation of standards (implementing criteria) focusing on PRA methodology and investigation on basic philosophy for use of PRA had been in progress. Based on activities of RTC, a serial in three articles including this described current status and future expectation concerning probabilistic risk assessment of NPPs. This article introduced features and issues of PRA methodology related to the use of PRA. Features of PRA methodology could be shown as (1) systematic and comprehensive understanding of risk, (2) support of grading approach, (3) identification of effective safety upgrade measures and (4) quantitative understanding of effects of uncertainty. Issues of PRA methodology were (1) extension of PRA application area, (2) upgrade of PRA methodology, (3) quality assurance of PRA, (4) treatment of uncertainty and (5) quantitative evaluation criteria. (T. Tanaka)

  2. Probabilistic commentary: the rise and fall, and rise again, of risk assessment

    International Nuclear Information System (INIS)

    Hendrie, J.M.

    1985-02-01

    Probabilistic risk assessment is mainly concerned with assessing the risks of nuclear power plants. Historically, the field of PRA began with a Senate request for a report on the safety of nuclear reactors in 1972. A quantitative report called WASH-1400 was eventually prepared and published in 1975, and in summary, it stated that nuclear reactors warranted only a low-grade concern in modern society. Criticism of this report and public perception of its results were highly visible subjects in the media, and the criticism led to the fact that PRA fell into disfavor. After Three Mile Island, it was recognized that PRA was a valuable tool for understanding such accidents, and PRA became a bit more popular again by the end of 1979. The usefulness of PRA was also supported by a German study in 1979. PRA played a significant role in the hearings on the Indian Point reactor. The present NRC regards PRA as an important tool in regulatory practice

  3. Prioritization of motor operated valves based on risk importances

    International Nuclear Information System (INIS)

    Vesely, W.E.; Weidenhamer, G.H.

    1994-01-01

    The plant Probabilistic Risk Assessment (PRA) can be a potentially useful and powerful tool for helping to define an effective response to GL 89-10. The plant PRA can be used to prioritize the Motor Operated Valves (MOV) dynamic test. The plant PRA can also be used to determine test schedules for the MOVs. In order for the PRA to be validly used to respond to GL 89-10, various issues need to be validly addressed. Eleven issues are specifically identified and responses to these issues are outlined. The issues of joint MOV importance, PRA truncation, and validation of the proposed approach are specifically highlighted and more detailed response considerations are described. As in all PRA applications, sensitivity studies and uncertainty considerations should be incorporated in the PRA evaluations. 4 refs, 3 tabs

  4. Survival and bioactivities of selected probiotic lactobacilli in yogurt fermentation and cold storage: New insights for developing a bi-functional dairy food.

    Science.gov (United States)

    Rutella, Giuseppina Sefora; Tagliazucchi, Davide; Solieri, Lisa

    2016-12-01

    In previous work, we demonstrated that two probiotic strains, namely Lactobacillus casei PRA205 and Lactobacillus rhamnosus PRA331, produce fermented milks with potent angiotensin-converting enzyme (ACE)-inhibitory and antioxidant activities. Here, we tested these strains for the survivability and the release of antihypertensive and antioxidant peptides in yogurt fermentation and cold storage. For these purposes three yogurt batches were compared: one prepared using yogurt starters alone (Lactobacillus delbrueckii subspecies bulgaricus 1932 and Streptococcus thermophilus 99), and the remaining two containing either PRA205 or PRA331 in addition to yogurt starters. Despite the lower viable counts at the fermentation end compared to PRA331, PRA205 overcame PRA331 in survivability during refrigerated storage for 28 days, leading to viable counts (>10(8) CFU/g) higher than the minimum therapeutic threshold (10(6) CFU/g). Analyses of in vitro ACE-inhibitory and antioxidant activities of peptide fractions revealed that yogurt supplemented with PRA205 displays higher amounts of antihypertensive and antioxidant peptides than that produced with PRA331 at the end of fermentation and over storage. Two ACE-inhibitory peptides, Valine-Proline-Proline (VPP) and Isoleucine-Proline-Proline (IPP), were identified and quantified. This study demonstrated that L. casei PRA205 could be used as adjunct culture for producing bi-functional yogurt enriched in bioactive peptides and in viable cells, which bring health benefits to the host as probiotics. Copyright © 2016 Elsevier Ltd. All rights reserved.

  5. Nuclear power plant risk assembly and decomposition for risk management

    International Nuclear Information System (INIS)

    Iden, D.C.

    1985-01-01

    The state-of-the-art method for analyzing the risk from nuclear power plants is probabilistic risk assessment (PRA). The intermediate results of a PRA are first assembled to quantify the risk from operating a nuclear power plant in the form of (1) core damage (or core melt) frequency, (2) plant damage state frequencies, (3) release category frequencies, and (4) the frequency of exceeding specific levels of offsite consequences. Once the overall PRA results have been quantified, the next step is to decompose those results into the individual contributors to each of the four forms of risk in some rank order. The way in which the PRA model is set up to assemble and decompose the plant risk determines the ease and usefulness of the PRA model as a risk management tool for evaluating perturbations to the PRA model. These perturbations can take the form of technical specification changes, hardware modifications, procedural changes, etc. The matrix formalism developed by Dr. Stan Kaplan for risk assembly and decomposition represents a significant breakthrough in making the PRA model an effective risk management tool. The key to understanding the matrix formalism and making it a useful tool for managing nuclear power plant risk is the structure of the PRA model. PRA risk model structure and decomposition of the risk results are discussed with the Seabrook PRA as an example

  6. A review of NRC staff uses of probabilistic risk assessment

    Energy Technology Data Exchange (ETDEWEB)

    1994-03-01

    The NRC staff uses probabilistic risk assessment (PRA) and risk management as important elements its licensing and regulatory processes. In October 1991, the NRC`s Executive Director for Operations established the PRA Working Group to address concerns identified by the Advisory Committee on Reactor Safeguards with respect to unevenness and inconsistency in the staff`s current uses of PRA. After surveying current staff uses of PRA and identifying needed improvements, the Working Group defined a set of basic principles for staff PRA use and identified three areas for improvements: guidance development, training enhancements, and PRA methods development. For each area of improvement, the Working Group took certain actions and recommended additional work. The Working Group recommended integrating its work with other recent PRA-related activities the staff completed and improving staff interactions with PRA users in the nuclear industry. The Working Group took two key actions by developing general guidance for two uses of PRA within the NRC (that is, screening or prioritizing reactor safety issues and analyzing such issues in detail) and developing guidance on basic terms and methods important to the staff`s uses of PRA.

  7. Control plasma renin activity and changes in sympathetic tone as determinants of minoxidil-induced increase in plasma renin activity.

    Science.gov (United States)

    O'Malley, K; Velasco, M; Wells, J; McNay, J L

    1975-01-01

    A study was made of the possible mechanism(s) underlying minoxidil-induced increase in plasma renin activity (PRA). 10 patients with essential hypertension were treated with minoxidil and subsequently with a combination of minoxidil plus propranolol. Minoxidil lowered mean arterial pressure 31.6 plus or minus 3.3 mm Hg, mean plus or minus SEM. There was an associated increase in both PRA, 6.26 plus or minus 2.43 NG/ML/H, and heart rate, 21.4 plus or minus 2.7 beats/min. The changes in PRA and heart rate were positively correlated, r, 0.79. Addition of propranolol reduced mean arterial pressure by a further 10.1 plus or minus 1.5 mm Hg and returned heart rate to control levels. Propranolol reduced PRA significantly but not to control levels. Control PRA positively correlated with PRA on minoxidil, r, 0.97, and with PRA on minoxidil plus propranolol, r, 0.98. We conclude that control PRA is a major determinant of change in PRA with minoxidil. Minoxidil increased PRA by at least two mechanisms: (a) an adrenergic mechanism closely related to change in heart rate and blocked by propranolol, and (b) a mechanism(s) not sensitive to propranolol and possibly related to decrease in renal perfusion pressure. PMID:1127099

  8. A review of NRC staff uses of probabilistic risk assessment

    International Nuclear Information System (INIS)

    1994-03-01

    The NRC staff uses probabilistic risk assessment (PRA) and risk management as important elements its licensing and regulatory processes. In October 1991, the NRC's Executive Director for Operations established the PRA Working Group to address concerns identified by the Advisory Committee on Reactor Safeguards with respect to unevenness and inconsistency in the staff's current uses of PRA. After surveying current staff uses of PRA and identifying needed improvements, the Working Group defined a set of basic principles for staff PRA use and identified three areas for improvements: guidance development, training enhancements, and PRA methods development. For each area of improvement, the Working Group took certain actions and recommended additional work. The Working Group recommended integrating its work with other recent PRA-related activities the staff completed and improving staff interactions with PRA users in the nuclear industry. The Working Group took two key actions by developing general guidance for two uses of PRA within the NRC (that is, screening or prioritizing reactor safety issues and analyzing such issues in detail) and developing guidance on basic terms and methods important to the staff's uses of PRA

  9. A Study on Plasma Renin Activity in Korean Hemorrhagic Fever

    International Nuclear Information System (INIS)

    Kim, Suhng Gwon; Cho, Bo Yun; Lee, Jung Sang; Koh, Won Soon; Lee, Mun Ho; Kim, Won Dong; Yun, Hong Jin

    1976-01-01

    To evaluate the possible pathophysiologic role of renin in acute renal failure observed in Korean hemorrhagic fever (KHF), the author measured the basal plasma renin activity (PRA) and the stimulated PRA by radioimmunoassay for angiotensin I in 15 normal controls and 42 KHF patients who are admitted in Seoul National University Hospital and Nation Army Hospital from Jan. 1975 to Jan. 1976. The results obtained were as follows:The mean basal PRA in normal control group was 2.9±2.16 ng/ml/hr in the patients during the oliguric phase of KHF, the mean basal PRA was 4.7±2.13 ng/ml/hr, and there was statistically significant increase compared to the normal control. In the patients during the diuretic phase of KHF, the mean basal PRA was 3.4±2.09 ng/ml/hr, and there was statistically significant decrease compared to the oliguric phase of KHF. In normal control group, the mean basal PRA was 2.9±2.16 ng/ml/hr. And the PRA 1 hour after the administration of Lasix 40 mg intravenously (stimulated PRA) was 5.3±2.20 ng/ml/hr and there was statistically significant increase compared to basal level. In oliguric phase of KHF, the mean basal PRA was 4.6±2.01 ng/ml/hr. And stimulated PRA was 4.4±2.34 ng/ml/hr and there was no significant changes. In diuretic phase of KHF, the mean basal PR was 3.3±1.86 ng/ml/hr. And stimulated PRA was 5.2±2.58 ng/ml/hr and there was statistically significant increase compared to basal level. There were statistically no significant correlations between basal PRA and stimulated PRA and serum creatinine. BUN, urine volume and peritoneal dialysis.

  10. Apatykáři na Starém Městě pražském ve středověku. Příspěvek k možnostem sociotopografické analýzy v areálu pražského souměstí na příkladě osob zabývajících se vykonáváním lékárnického povolání

    Czech Academy of Sciences Publication Activity Database

    Musílek, Martin

    2009-01-01

    Roč. 12, č. 1 (2009), s. 97-137 ISSN 0862-979X Grant - others:AV ČR(CZ) M300090903 Institutional research plan: CEZ:AV0Z90090514 Keywords : Bohemia * Prague * Old Town of Prague * pharmacy * apothecary Subject RIV: AB - History

  11. Differential algebras without differentials: An easy C++ implementation

    Energy Technology Data Exchange (ETDEWEB)

    Michelotti, L.

    1989-03-01

    Automated differentiation can be motivated and explained rather plainly without any reference to infinitesimals or differentials whatsoever. We shall describe one possible approach in this paper. The method which we shall use will suggest its own implementation. However, FORTRAN is not the most natural language in which to carry it out. In the second section we shall describe an almost trivial implementation using C++. (Indeed, one of the motivations for writing this paper is to persuade militant FORTRAN extremists to invest the four or five days necessary to learn this powerful and easy language.) Take heed, however, that what we describe below is only a stripped-down implementation, written in three days, of differential algebra's most essential features; it is not as robust as and does not contain the battery of tools available in Berz's DA package, the product of a significant amount of work. 10 refs.

  12. Differential algebras without differentials: An easy C++ implementation

    International Nuclear Information System (INIS)

    Michelotti, L.

    1989-03-01

    Automated differentiation can be motivated and explained rather plainly without any reference to infinitesimals or differentials whatsoever. We shall describe one possible approach in this paper. The method which we shall use will suggest its own implementation. However, FORTRAN is not the most natural language in which to carry it out. In the second section we shall describe an almost trivial implementation using C++. (Indeed, one of the motivations for writing this paper is to persuade militant FORTRAN extremists to invest the four or five days necessary to learn this powerful and easy language.) Take heed, however, that what we describe below is only a stripped-down implementation, written in three days, of differential algebra's most essential features; it is not as robust as and does not contain the battery of tools available in Berz's DA package, the product of a significant amount of work. 10 refs

  13. Electrostatic potential map modelling with COSY Infinity

    International Nuclear Information System (INIS)

    Maloney, J.A.; Baartman, R.; Planche, T.; Saminathan, S.

    2016-01-01

    COSY Infinity (Makino and Berz, 2005) is a differential-algebra based simulation code which allows accurate calculation of transfer maps to arbitrary order. COSY’s existing internal procedures were modified to allow electrostatic elements to be specified using an array of field potential data from the midplane. Additionally, a new procedure was created allowing electrostatic elements and their fringe fields to be specified by an analytic function. This allows greater flexibility in accurately modelling electrostatic elements and their fringe fields. Applied examples of these new procedures are presented including the modelling of a shunted electrostatic multipole designed with OPERA, a spherical electrostatic bender, and the effects of different shaped apertures in an electrostatic beam line.

  14. Use of probabilistic risk assessment in fuel cycle facilities

    International Nuclear Information System (INIS)

    Gonzalez, Felix; Gonzalez, Michelle; Wagner, Brian

    2013-01-01

    As expressed in its Policy Statement on the Use of Probabilistic Risk Assessment (PRA) Methods in Nuclear Regulatory Activities, the U.S Nuclear Regulatory Commission has been working for decades to increase the use of PRA technology in its regulatory activities. Since the policy statement was issued in 1995, PRA has become a core component of the nuclear power plant (NPP) licensing and oversight processes. In the last several years, interest has increased in PRA technologies and their possible application to other areas including, but not limited to, spent fuel handling, fuel cycle facilities, reprocessing facilities, and advanced reactors. This paper describes the application of PRA technology currently used in NPPs and its application in other areas such as fuel cycle facilities and advanced reactors. It describes major challenges that are being faced in the application of PRA into new technical areas and possible ways to resolve them. (authors)

  15. Probabilistic Risk Assessment Process for High-Power Laser Operations in Outdoor Environments

    Science.gov (United States)

    2016-01-01

    the NOHD/NSHD or its derivatives. Only those issued with an appropriate level of protection (such as protective eyewear or clothing) would be...developed in the emerging nuclear industry as well as in the established transport, petrochemical, and aerospace sectors, which were expanding...emergence of the PRA technique as an effective means of risk assessment. The origins of PRA lie in the aerospace industry .11,12 PRA is described by the

  16. Probabilistic safety assessment applications and insights

    International Nuclear Information System (INIS)

    Hitchler, M.J.; Burns, N.L.; Liparulo, N.J.; Mink, F.J.

    1987-01-01

    The insights gained through a comparison of seven PRA studies (Italian PUN, Sizewell B, Ringhals 2, Millstone 3, Zion 1 and 2, Oconee 3, and Seabrook) included insights regarding the adequacy of the PRA technology utilized in the studies and the potential areas for improvement and insights regarding the adequacy of plant designs and how PRA has been utilized to enhance the design and operation of nuclear power plants. (orig.)

  17. Insights gained through probabilistic risk assessments

    International Nuclear Information System (INIS)

    Hitchler, M.J.; Burns, N.L.; Liparulo, N.J.; Mink, F.J.

    1987-01-01

    The insights gained through a comparison of seven probabilistic risk assessments (PRA) studies (Italian PUN, Sizewell B, Ringhals 2, Millstone 3, Zion 1 and 2, Oconee 3, and Seabrook) included insights regarding the adequacy of the PRA technology utilized in the studies and the potential areas for improvement and insights regarding the adequacy of plant designs and how PRA has been utilized to enhance the design and operation of nuclear power plants

  18. Progressive Retinal Atrophy in the Border Collie: A new XLPRA

    OpenAIRE

    Vilboux, Thierry; Chaudieu, Gilles; Jeannin, Patricia; Delattre, Delphine; Hedan, Benoit; Bourgain, Catherine; Queney, Guillaume; Galibert, Francis; Thomas, Anne; André, Catherine

    2008-01-01

    Abstract Background Several forms of progressive retinal atrophy (PRA) segregate in more than 100 breeds of dog with each PRA segregating in one or a few breeds. This breed specificity may be accounted for by founder effects and genetic drift, which have reduced the genetic heterogeneity of each breed, thereby facilitating the identification of causal mutations. We report here a new form of PRA segregating in the Border Collie breed. The clinical signs, including the loss of night vision and ...

  19. Overview of seismic probabilistic risk assessment for structural analysis in nuclear facilities

    International Nuclear Information System (INIS)

    Reed, J.W.

    1989-01-01

    Probabilistic Risk Assessment (PRA) for seismic events is currently being performed for nuclear and DOE facilities. The background on seismic PRA is presented along with a basic description of the method. The seismic PRA technique is applicable to other critical facilities besides nuclear plants. The different approaches for obtained structure fragility curves are discussed and their applications to structures and equipment, in general, are addressed. It is concluded that seismic PRA is a useful technique for conducting probability analysis for a wide range of classes of structures and equipment

  20. Risk-informed design of IRIS using a level-1 probabilistic risk assessment from its conceptual design phase

    International Nuclear Information System (INIS)

    Mizuno, Yuko; Ninokata, Hisashi; Finnicum, David J.

    2005-01-01

    In this study, a probabilistic risk assessment (PRA) for the International Reactor Innovative and Secure (IRIS) has been generated to address two key areas as a part of the effort for the pre-application licensing of the IRIS design. First, the IRIS PRA is supporting the evaluation of IRIS design by providing design insights as well as a solid risk basis for the pre-licensing evaluation of the IRIS design. Second, the current PRA task is beginning the preparation of the more complete PRA analyses and documentation that will be required for Design Certification. The initial IRIS PRA is an at-power, Level-1 PRA for internal events that focuses on the evaluation of the IRIS design features to support the risk-informed design of IRIS by application of the PRA insights and the risk information to the design. To accomplish the evaluation, a reasonably complete Level-1 PRA model has been developed. The use of PRA in the early stages of the design has allowed a selection of design and performance features and an optimization of the design of several systems to reduce the potential for events that could lead to core damage via both enhanced prevention and mitigation of challenges. As a result, the total core damage frequency for internal events for the IRIS design has been calculated as 1.2x10 -8 per year

  1. Overview of methods for uncertainty analysis and sensitivity analysis in probabilistic risk assessment

    International Nuclear Information System (INIS)

    Iman, R.L.; Helton, J.C.

    1985-01-01

    Probabilistic Risk Assessment (PRA) is playing an increasingly important role in the nuclear reactor regulatory process. The assessment of uncertainties associated with PRA results is widely recognized as an important part of the analysis process. One of the major criticisms of the Reactor Safety Study was that its representation of uncertainty was inadequate. The desire for the capability to treat uncertainties with the MELCOR risk code being developed at Sandia National Laboratories is indicative of the current interest in this topic. However, as yet, uncertainty analysis and sensitivity analysis in the context of PRA is a relatively immature field. In this paper, available methods for uncertainty analysis and sensitivity analysis in a PRA are reviewed. This review first treats methods for use with individual components of a PRA and then considers how these methods could be combined in the performance of a complete PRA. In the context of this paper, the goal of uncertainty analysis is to measure the imprecision in PRA outcomes of interest, and the goal of sensitivity analysis is to identify the major contributors to this imprecision. There are a number of areas that must be considered in uncertainty analysis and sensitivity analysis for a PRA: (1) information, (2) systems analysis, (3) thermal-hydraulic phenomena/fission product behavior, (4) health and economic consequences, and (5) display of results. Each of these areas and the synthesis of them into a complete PRA are discussed

  2. Review process and quality assurance in the EBR-II probabilistic risk assessment

    International Nuclear Information System (INIS)

    Roglans, J.; Hill, D.J.; Ragland, W.A.

    1992-01-01

    A Probabilistic Risk Assessment (PRA) of the Experimental Breeder Reactor II (EBR-II), a Department of Energy (DOE) Category A reactor, has recently been completed at Argonne National Laboratory (ANL). Within the scope of the ANL QA Programs, a QA Plan specifically for the EBR-II PRA was developed. The QA Plan covered all aspects of the PRA development, with emphasis on the procedures for document and software control, and the internal and external review process. The effort spent in the quality assurance tasks for the EBR-II PRA has reciprocated by providing acceptance of the work and confidence in the quality of the results

  3. ORF Alignment: NC_002663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available IAQKVGEEGVETALAATVKDKAETICEAA 171 ... LSKLERLIASRKGADPESSYTAQLYAKGTKRIAQKVGEEGVETALAATVKDKAETICEAA Sbjct: 1 ... LSKLERLIASRKGADPESSYTAQLYAKGTKRIAQKVGEEGVETALAATVKDKAETICEAA 60 ... ...sphoribosyl-ATP pyrophosphatase (PRA-PH)] ... Length = 84 ... Query: 112 LSKLERLIASRKGADPESSYTAQLYAKGTKR

  4. Saccharomyces cerevisiae proteinase A excretion and wine making.

    Science.gov (United States)

    Song, Lulu; Chen, Yefu; Du, Yongjing; Wang, Xibin; Guo, Xuewu; Dong, Jian; Xiao, Dongguang

    2017-11-09

    Proteinase A (PrA), the major protease in Saccharomyces cerevisiae, plays an essential role in zymogen activation, sporulation, and other physiological processes in vivo. The extracellular secretion of PrA often occurs during alcoholic fermentation, especially in the later stages when the yeast cells are under stress conditions, and affects the quality and safety of fermented products. Thus, the mechanism underlying PrA excretion must be explored to improve the quality and safety of fermented products. This paper briefly introduces the structure and physiological function of PrA. Two transport routes of PrA, namely, the Golgi-to-vacuole pathway and the constitutive Golgi-to-plasma membrane pathway, are also discussed. Moreover, the research history and developments on the mechanism of extracellular PrA secretion are described. In addition, it is briefly discussed that calcium homeostasis plays an important role in the secretory pathway of proteins, implying that the regulation of PrA delivery to the plasma membrane requires the involvement of calcium ion. Finally, this review focuses on the effects of PrA excretion on wine making (including Chinese rice wine, grape wine, and beer brewage) and presents strategies to control PrA excretion.

  5. Three Philosophical Pillars That Support Collaborative Learning.

    Science.gov (United States)

    Maltese, Ralph

    1991-01-01

    Discusses three philosophical pillars that support collaborative learning: "spaces of appearance," active engagement, and ownership. Describes classroom experiences with collaborative learning supported by these pillars. (PRA)

  6. 76 FR 66756 - Agency Information Collection Activities; Submission for OMB Review; Comment Request...

    Science.gov (United States)

    2011-10-27

    ... necessary to substantiate their compliance with nondiscrimination and affirmative action contractual obligations. This information collection is subject to the PRA. A Federal agency generally cannot conduct or...

  7. A gente vive pra cuidar da população: estratégias de cuidado e sentidos para a saúde, doença e cura em terreiros de candomblé We live to take care of the population: health care strategies and meanings for health, disease and healing in candomblé temples

    Directory of Open Access Journals (Sweden)

    Clarice Santos Mota

    2011-06-01

    Full Text Available Os estudos que exploram a interface entre religião e saúde demonstram que, entre as motivações que orientam a filiação religiosa, figura de modo destacado a busca de soluções para aflições e enfermidades. A terapêutica religiosa constitui assim uma das alternativas de cura, cuja adesão por parte de seus seguidores é influenciada, entre outros fatores, por experiências individuais ou coletivas de sua eficácia e/ou pela fidelidade a uma religião que regulam a vida em geral, incluindo as condutas relativas ao cuidado com o corpo, com a saúde etc. Este estudo explora as inter-relações entre saúde, religiosidade e identidade étnica em um bairro popular de Salvador, marcado pelo pluralismo religioso. Ao investigar as narrativas de famílias afrodescendentes membros do candomblé, busca-se compreender a relação entre a cosmologia religiosa do candomblé e as concepções e práticas de saúde e doença e cuidado. Para atingir essa compreensão, é preciso também apreender modos de organização social, crenças, visão de mundo e práticas no universo do candomblé, detendo-se especialmente nos aspectos associados com o complexo saúde-doença-cuidado. Trata-se de um estudo etnográfico desenvolvido através da observação participante e de entrevistas semi-estruturadas.Studies which explore the relations between religion and health have been showing that one of the main reasons for joining a religious institution is the quest for health care. Therefore, the choice of religious healing is influenced by previous experiences of success or by the bond with a system of beliefs that regulates social life, including health care practices. This study explores the connections between religiousness and ethnic identity in a popular neighborhood in Salvador that is characterized by its religious plurality. The main goal of the research was to investigate the relations between the cosmology of Candomblé and the conceptions and practices of health care. To accomplish this goal, it was also important to understand the social organization of Candomblé and the worldview shared by its members. It is an ethnographic study developed through participant observation and semi-structured interviews.

  8. Kafkův parabolický text Návrat domů. Odraz autorova soukromí a pražských událostí roku 1920 // Kafka’s parabolic text Home-coming. Kafka’s personal life and Prague events of 1920 reflected in a short parabolic story

    Directory of Open Access Journals (Sweden)

    Jaroslav Březina

    2017-10-01

    Full Text Available The article focuses on one of Kafka’s short proses of the second half of 1920 — “Home-Coming”. This short parabolic story was created approximately two years after Kafka’s literary pause in the newly established Czechoslovak Republic. The present analysis is based on hypothesis, that Kafka “only” takes up and subverts a traditional mythological theme — in this instance the biblical story of the prodigal son. In this article the text is confronted with contemporary events, the specific situation of the German Jews in Prague and especially episodes of Kafka’s life in order so as to reach for identity the causes and motives of his origin.

  9. Considerations on a regulatory framework for environmental management of produced water resulting from the extraction of petroleum in the state of Bahia; Consideracoes acerca de um modelo regulatorio pra o gerenciamento ambiental da agua produzida resultante da extracao de petroleo do estado da Bahia

    Energy Technology Data Exchange (ETDEWEB)

    Fraser, Roberta Tourinho Dantas [Instituto do Meio Ambiente e Recursos Hidricos (INEMA), Salvador, BA (Brazil); Vieira, Victor Menezes [Geo Innova Ltda., Lauro de Freitas, BA (Brazil); Ferreira, Doneivan Fernandes [Universidade Federal da Bahia (UFBA), Salvador, BA (Brazil)

    2012-07-01

    Produced water is the main byproduct associated to oil and gas extraction process. This water, considered by regulation as a residue, has the potential to cause adverse impact on environment. As extraction progresses and reservoirs mature increasing volumes of water are produced and need to be wisely managed. Due to Reconcavo Basin advanced stage of maturity, the state of Bahia has become a very large producer of water in the country. Remarkably, no state environmental regulation is in place to provide management guidelines and proper disposal rules for this waste. The present study intends to argue the need for a regulatory framework involving the management of water produced in state onshore sedimentary basins, identifying and discussing critical variables involved in this process. The following methodological instruments were used in the study: literature and normative survey, interaction with key stakeholders and field work. Environmental regulation has, as its main purpose, protection and preservation of the environment against potential polluting activities, while recognizing the importance of socioeconomic development. In this sense, implementing specific rules for management of produced water not only serves to harmonize productive activities such as oil and gas extraction with protective policies, but also brings institutional benefits that could represent a significant reduction in operating costs associated with inadequate management of this waste. It also tends to improve industry image as perceived by society. However, success of regulatory compliance is dependent of a number of variables, which, in the case of produced water management includes: physicochemical characterization; establishment of benchmark studies to guide application of proper techniques for injection and disposal; the choice of efficient regulatory instruments; expertise and experienced human resources within regulatory agencies responsible for monitoring activities and enforcing regulations; awareness of risks of over regulation and its damaging consequences to socioeconomic activities; and ample access to information. (author)

  10. PENGARUH PERENDAMAN DAGING PRA KYURING DALAM JUS DAUN SIRIH TERHADAP KETENGIKAN DAN SIFAT ORGANOLEPTIK DENDENG SAPI SELAMA PENYIMPANAN [The Effect of Soaking of Beef in Betle (Piper betle L Leaf Juice Prior to Curing on Rancidity and Sensory Characteristics of Beef “Dendeng” During Storage

    Directory of Open Access Journals (Sweden)

    Yuli Rohidayah 2

    2002-04-01

    Full Text Available The research was carried out to determine the effect of soaking of beef in betle (Piper betle L leaf juice prior to curing on peroxide level, thiobarbituric acid (TBA score, and sensory characteristics of beef “dendeng” during 1-3 months storage. The result in showed that soaking in 10% of betle leaf juice resulted in “dendeng” with peroxide level of 8.69 meq/kg which was significantly lower than that of “dendeng” without soaking. TBA scores of “dendeng” soaked in 10% betle leaf juice after 1, 2, and 3 months storage were 0.0131, 0.0159, and 0.0168 μ mole MA/kg, respectively. These scores were lower than that of threshold score of food rancidity (18 μ mole MA/kg. Sensory characteristics (color, taste, and aroma of “dendeng” during storage were accepted well by the panellists.

  11. Vladislavský sál Pražského hradu ve světle nových nálezů. Příspěvek k dějinám každodennosti pozdního středověku a raného novověku

    Czech Academy of Sciences Publication Activity Database

    Blažková, Gabriela; Frolík, Jan; Matiášek, Josef

    2016-01-01

    Roč. 19, č. 2 (2016), s. 27-50 ISSN 0862-979X R&D Projects: GA ČR GP13-34374P Institutional support: RVO:67985912 Keywords : Prague * Early Modern Age * Vladislaus Hall * plant macro-remains * paper playing card Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology

  12. "Fui lá no posto e o doutor me mandou foi pra cá": processo de medicamentalização e (descaminhos para o cuidado em saúde mental na Atenção Primária

    Directory of Open Access Journals (Sweden)

    Indara Cavalcante Bezerra

    2014-01-01

    Full Text Available Buscou-se compreender como o cuidado em saúde mental vem sendo produzido na Atenção Primária, com base nas experiências de profissionais, usuários e familiares. As informações obtidas foram categorizadas pelos aspectos observados na efetivação da interface entre Atenção Primária e saúde mental, descritos como: medicamentalização dos problemas de saúde mental apresentados pela população; dificuldades no acesso dos usuários do Centro de Atenção Psicossocial (CAPS à Unidade de Saúde da Família, e formação em saúde mental para os profissionais da Atenção Primária. O processo de medicamentalização perpassa as práticas dos profissionais e configura-se como a principal demanda dos usuários do CAPS, indicando a necessidade de ações desmedicalizantes, que encontram potência na incorporação de novas relações e dinâmicas sociais no território, maior articulação das equipes e estímulo à participação social da comunidade neste processo.

  13. Latinské a české verše o pražském pogromu roku 1389. Ke dvěma pozapomenutým žákovským skladbám

    Czech Academy of Sciences Publication Activity Database

    Soukup, Daniel

    2012-01-01

    Roč. 60, č. 5 (2012), s. 711-726 ISSN 0009-0468 Institutional support: RVO:68378068 Keywords : medieval student poetry * medieval parody * medieval and humanist historiography * Jews * 1389 pogrom * Passion of the Prague Jews * Matyáš/Matěj of Lehnice Subject RIV: AJ - Letters, Mass-media, Audiovision

  14. Zlomek knihy vydání, v níž jsou jména Židů. “Nově objevený” rukopisný zlomek kupeckého rejstříku a jeho výpověď pro pražský obchod ve středověku

    Czech Academy of Sciences Publication Activity Database

    Musílek, Martin

    -, č. 44 (2016), s. 141-166 ISSN 0555-0238 R&D Projects: GA ČR(CZ) GBP405/12/G148 Institutional support: RVO:67985955 Keywords : Prague * Prague’s Old Town * business and trade * merchant books * merchant registers * manuscript fragment * Jews * Jewish Town * collateral * urban elites Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  15. Unikátní millefiori korálek z Jiřské ulice na Pražském hradě. Podíl konzervátora-restaurátora při procesu analýzy předmětu

    Czech Academy of Sciences Publication Activity Database

    Součková Daňková, A.; Cílová, Z.; Matiášek, Josef; Tomková, Kateřina; Vavřík, Daniel

    2011-01-01

    Roč. 1, č. 1 (2011), s. 49-54 ISSN 1805-0050 R&D Projects: GA AV ČR IAA800020903 Institutional research plan: CEZ:AV0Z80020508; CEZ:AV0Z20710524 Keywords : glass bead * millefiori * Early Middle Ages * chemical composition * conservation Subject RIV: AC - Archeology, Anthropology, Ethnology

  16. "Pra tá no DC tem que ser meio doido. Se tu não és, vai ficar": a saúde mental dos servidores do Departamento de Criminalística do Instituto-Geral de Perícias do Rio Grande do Sul [doi: 10.5329/RECADM.20121102006

    Directory of Open Access Journals (Sweden)

    Neusa Rolita Cavedon

    2012-11-01

    Full Text Available O objetivo deste artigo é mostrar como se dá o cotidiano daqueles que trabalham com locais de crime, de violência, buscando verificar como isso afeta a saúde mental do trabalhador. A pesquisa etnográfica foi realizada com os servidores que exercem suas atividades no Departamento de Criminalística do Instituto-Geral de Perícias do Rio Grande do Sul. O sofrimento se dá em face das vivências dramáticas que envolvem entrar em contato com corpos dilacerados, em estado de putrefação, com familiares desesperados, diferentes contextos sociais, reviver a cena do crime mediante a elaboração do laudo, presenciar a violência impetrada contra crianças. A satisfação no trabalho se dá através do laudo bem montado, da ciência do resultado da perícia no âmbito do judiciário. O servidor do DC precisa enfrentar a morte violenta fazendo uso de mecanismos de defesa que privilegiem a vida, daí a ênfase no discurso que coloca a atividade como “apaixonante” por auxiliar na absolvição ou condenação das pessoas sob suspeita. Absolver ou condenar implica preservar a vida, absolver salvaria a vida de um inocente que poderia ficar na prisão injustamente, condenar significa garantir a vida dos integrantes da sociedade de onde o indivíduo emerge, posto que ele, em liberdade, poderia reincidir no crime.   Palavras-chave Perícia, saúde mental, sofrimento, prazer, etnografia.     "YOU’VE GOT TO BE CRAZY TO BE IN THE DC. IF YOU’RE NOT, YOU’RE GONNA BE": THE MENTAL HEALTH OF EMPLOYEES IN THE DEPARTMENT OF CRIMINALISTICS OF THE GENERAL INSTITUTE OF FORENSICS OF RIO GRANDE DO SUL   ABSTRACT This article’s goal is disclose the daily routine of people who work with crime and violence related places, in an attempt to reveal how the mental health of the servants is affected. The ethnographic research was conducted with employees at the Department of Criminalistics of the General Institute of Forensics of Rio Grande do Sul. The suffering occurs as a consequence of dramatic experiences such as the contact with torn and decomposing bodies, the despair of the families, different social contexts, to relive the crime scene through report writing, and to witness the violence against children. The job satisfaction derives from the well-written report, and from the knowledge of the forensics results in the judiciary’s ambit. The DC’s servant has to deal with violent death by using life-oriented defense mechanisms, which leads to emphasis on a discourse that qualifies this activity as “captivating” for helping the acquittal or conviction of suspected people. To absolve or convict someone implies life preservation; to absolve means to save the life of an innocent individual who could be undeservedly in prison; to convict means to protect the life of members of society from where the guilty individual came from, because in freedom he or she could return to crime.   Keywords Forensics, mental health, suffering, pleasure, ethnography. 

  17. K otázce datování počátků kultury s keramikou pražského typu na Moravě. Příspěvek pro 15. mezinárodní sjezd slavistů v Minsku

    Czech Academy of Sciences Publication Activity Database

    Jelínková, Dagmar

    2012-01-01

    Roč. 53, č. 2 (2012), s. 7-21 ISSN 1211-7250 R&D Projects: GA ČR GA404/07/1629 Institutional support: RVO:68081758 Keywords : Prague-type-pottery culture * Southern Moravia * inhumation grave * sax * settlement * dating C14 Subject RIV: AC - Archeology, Anthropology, Ethnology http://dino.iabrno.cz/dokumenty/pv/PV53_2_studie/PV53_2_studie_1.pdf

  18. Kostel sv. Anny na Starém Městě pražském – středověké řešení jeho interiéru ve světle řádových statut dominikánek

    Czech Academy of Sciences Publication Activity Database

    Mezihoráková, Klára

    2012-01-01

    Roč. 72, č. 3 (2012), s. 170-175 ISSN 1210-5538 Institutional research plan: CEZ:AV0Z80330511 Keywords : Prague * Church of St. Anne * medieval architecture * Dominicans * enclosure * order statutes Subject RIV: AL - Art, Architecture, Cultural Heritage

  19. „Bez Havránka si nikdo ani neškrtl.” Poválečné vztahy katedry českého jazyka pražské filozofické fakulty a akademického Ústavu pro jazyk český

    Czech Academy of Sciences Publication Activity Database

    Dvořáčková, Věra

    2017-01-01

    Roč. 57, č. 1 (2017), s. 105-122 ISSN 0323-0562 R&D Projects: GA ČR GA13-09541S Institutional support: RVO:67985921 Keywords : Czechoslovak Academy of Sciences * Faculty of Arts, Charles University * Bohuslav Havránek Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  20. Nález pivovarského sladu v kontextu předlokačního sídelního horizontu v prostoru Spálené ulice na Novém Městě pražském. Výsledky mezioborové spolupráce

    Czech Academy of Sciences Publication Activity Database

    Cymbalak, T.; Kočár, Petr; Matějková, K.; Sůvová, Z.

    2013-01-01

    Roč. 38, č. 2 (2013), s. 675-704 ISSN 0231-5823 Institutional support: RVO:67985912 Keywords : Prague-New Town * early Middle Ages * archaeological research * brewer's malt * pottery * archaeobotany * zooarchaeology Subject RIV: AC - Archeology, Anthropology, Ethnology

  1. Vývoj raně novověké kuchyňské a stolní keramiky v Čechách na základě souborů z Pražského hradu

    Czech Academy of Sciences Publication Activity Database

    Blažková, Gabriela

    2013-01-01

    Roč. 104, prosinec (2013), s. 183-230 ISSN 0031-0506 R&D Projects: GA ČR GP13-34374P Institutional support: RVO:67985912 Keywords : Early Modern period * pottery * Prague Castle * Prague Subject RIV: AC - Archeology, Anthropology, Ethnology

  2. Aspekty efektivnosti při volbě profese a školy: přizpůsobují se pražské střední školy potřebám podniků?

    Czech Academy of Sciences Publication Activity Database

    Benáček, Vladimír

    2010-01-01

    Roč. 12, č. 3 (2010), s. 499-523 ISSN 1212-8112 R&D Projects: GA AV ČR(CZ) IAA700280803; GA ČR GA403/08/1369 Institutional research plan: CEZ:AV0Z70280505 Keywords : education * human capital * employment Subject RIV: AO - Sociology, Demography

  3. Longitudinální studium lidského vývoje: historie, výsledky a perspektivy pražské a brněnské studie celoživotního vývoje člověka

    Czech Academy of Sciences Publication Activity Database

    Blatný, Marek; Kebza, V.

    2011-01-01

    Roč. 55, č. 5 (2011), s. 422-432 ISSN 0009-062X R&D Project s: GA ČR GAP407/10/2410 Institutional research plan: CEZ:AV0Z70250504 Keywords : life -span development * longitudinal study * optimal development * personality * well-being * human strenghts Subject RIV: AN - Psychology Impact factor: 0.087, year: 2011

  4. Prezentace archeologických památek v Čechách. Archeologické areály in situ - příklady z Pražského hradu a Vyšehradu

    Czech Academy of Sciences Publication Activity Database

    Boháčová, Ivana

    2015-01-01

    Roč. 40, č. 2 (2015), s. 331-351 ISSN 0231-5823 R&D Projects: GA MK(CZ) DF13P01OVV014 Keywords : archaeology * Prague * heritage * early Middle Ages * stone architecture * wooden buildings Subject RIV: AC - Archeology, Anthropology, Ethnology

  5. Risk assessment of CST-7 proposed waste treatment and storage facilities Volume I: Limited-scope probabilistic risk assessment (PRA) of proposed CST-7 waste treatment ampersand storage facilities. Volume II: Preliminary hazards analysis of proposed CST-7 waste storage ampersand treatment facilities

    International Nuclear Information System (INIS)

    Sasser, K.

    1994-06-01

    In FY 1993, the Los Alamos National Laboratory Waste Management Group [CST-7 (formerly EM-7)] requested the Probabilistic Risk and Hazards Analysis Group [TSA-11 (formerly N-6)] to conduct a study of the hazards associated with several CST-7 facilities. Among these facilities are the Hazardous Waste Treatment Facility (HWTF), the HWTF Drum Storage Building (DSB), and the Mixed Waste Receiving and Storage Facility (MWRSF), which are proposed for construction beginning in 1996. These facilities are needed to upgrade the Laboratory's storage capability for hazardous and mixed wastes and to provide treatment capabilities for wastes in cases where offsite treatment is not available or desirable. These facilities will assist Los Alamos in complying with federal and state requlations

  6. Participatory Rapid Appraisal (PRA) approach in cases of relationship between the oil industries with fishing communities: the case of El Paso in the Basin of Camamu, Almada, Bahia, Brazil; Abordagem do Diagnostico Rapido Participativo (DRP) em processos de relacionamento entre a industria petrolifera e as comunidades pesqueiras: o caso da El Paso na Bacia de Camamu, Almada, Bahia, Brasil

    Energy Technology Data Exchange (ETDEWEB)

    Diogo, Hugo; Figueira, Luciara; Prysthon, Adriano; Pinho, Milena; Link, Monica [SOMA Solucoes em Meio Ambiente Ltda., Curitiba, PR (Brazil); Ribeiro, Fatima [El Paso Oleo e Gas do Brasil Ltda., Natal, RN (Brazil); Ortiz, Marcos [Com Junto Ltda. (Brazil)

    2008-07-01

    This article is based on an assessment that indicates the low effectiveness of the actions and programmes of social responsibility to the less impact than in business and should not build the value they expected. Focussing on this issue in cases of relationship between oil and gas companies with fishing communities, the scene of conflict is chronic and there is a fragile relationship in terms of confidence. It has been further that the approaches and methods commonly used are not properly aligned to the realities and characteristics of artisanal fisheries. In this context, we present an innovative process of relationship between the company El Paso Oil and Gas of Brazil and fishing communities in the region of Baixo-Sul, Bahia. The strategy used effectively consolidated the relationship of confidence between the company and the fishing communities around the area of exploration, rescuing the self-esteem, alleviate the marginalisation and making visible a productive sector of extreme importance. Furthermore, the capabilities and skills, both communities as the government and other companies to take more solid and ongoing commitments in the process of co-management require specific efforts in the strengthening of an institutional arrangement and the formation of social capital to continue advancing in concept work. (author)

  7. Risk assessment of CST-7 proposed waste treatment and storage facilities Volume I: Limited-scope probabilistic risk assessment (PRA) of proposed CST-7 waste treatment & storage facilities. Volume II: Preliminary hazards analysis of proposed CST-7 waste storage & treatment facilities

    Energy Technology Data Exchange (ETDEWEB)

    Sasser, K.

    1994-06-01

    In FY 1993, the Los Alamos National Laboratory Waste Management Group [CST-7 (formerly EM-7)] requested the Probabilistic Risk and Hazards Analysis Group [TSA-11 (formerly N-6)] to conduct a study of the hazards associated with several CST-7 facilities. Among these facilities are the Hazardous Waste Treatment Facility (HWTF), the HWTF Drum Storage Building (DSB), and the Mixed Waste Receiving and Storage Facility (MWRSF), which are proposed for construction beginning in 1996. These facilities are needed to upgrade the Laboratory`s storage capability for hazardous and mixed wastes and to provide treatment capabilities for wastes in cases where offsite treatment is not available or desirable. These facilities will assist Los Alamos in complying with federal and state requlations.

  8. Matthaeus Collinus a jeho Specimen studii ac laborum (1557). Excerptové a moralizující čtení antických textů v literárním poli pražské univerzity

    Czech Academy of Sciences Publication Activity Database

    Storchová, Lucie

    2014-01-01

    Roč. 34, Supplementum 1 (2014), s. 315-333 ISSN 1803-9561 R&D Projects: GA ČR GB14-37038G Institutional support: RVO:67985955 Keywords : Renaissance humanism * Neo-Latin literature * Czech Lands * intertextuality * moral philosophy * Philipp Melanchthon * Homer * Vergil Subject RIV: AB - History

  9. Odpadní vrstvy a objekty jako pramen poznání stratifikace středověké společnosti - výpověď mocného smetištního souvrství z Nového Města pražského

    Czech Academy of Sciences Publication Activity Database

    Březinová, Helena; Selmi-Wallisová, M.

    2016-01-01

    Roč. 41, č. 1 (2016), s. 179-191 ISSN 0231-5823 R&D Projects: GA ČR(CZ) GA14-06451S Institutional support: RVO:67985912 Keywords : New Town, Prague * waste layers * fragments of fabrics Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. Protetické v- mezi statistikou a rétorikou: K článku Vliv jazykových faktorů na užívání protetického v- v pražské mluvě

    Czech Academy of Sciences Publication Activity Database

    Homoláč, Jiří; Mrázková, Kamila; Veroňková, J.

    2016-01-01

    Roč. 77, č. 2 (2016), s. 143-154 ISSN 0037-7031 Institutional support: RVO:68378092 Keywords : variationist sociolinguistics * prothetic v- * apparent time hypothesis * gender * Prague vernacular Subject RIV: AI - Linguistics Impact factor: 0.625, year: 2016

  11. International status of application of probabilistic risk analysis

    International Nuclear Information System (INIS)

    Cullingford, M.C.

    1984-01-01

    Probabilistic Risk Assessment (PRA) having been practised for about ten years and with more than twenty studies completed has reached a level of maturity such that the insights and other products derived from specific studies may be assessed. The first full-scale PRA studies were designed to develop the methodology and assess the overall risk from nuclear power. At present PRA is performed mostly for individual plants to identify core damage accident sequences and significant contributors to such sequences. More than 25 countries are utilizing insights from PRA, some from full-scale PRA studies and other countries by performing reliability analyses on safety systems identified as important contributors to one or more core melt sequences. Many Member States of the IAEA fall into one of three groups: those having (a) a large, (b) a medium number of reactor-years of operating experience and (c) those countries in the planning or feasibility study stages of a nuclear power programme. Of the many potential uses of PRA the decision areas of safety improvement by backfitting, development of operating procedures and as the basis of standards are felt to be important by countries of all three groups. The use of PRA in showing compliance with safety goals and for plant availability studies is held to be important only by those countries which have operating experience. The evolution of the PRA methodology has led to increased attention to quantification of uncertainties both in the probabilities and consequences. Although many products from performing a PRA do not rely upon overall risk numbers, increasing emphasis is being placed on the interpretation of uncertainties in risk numbers for use in decisions. International co-operation through exchange of information regarding experience with PRA methodology and its application to nuclear safety decisions will greatly enhance the widespread use of PRA. (author)

  12. Long-Term Effects of Antibodies Against Human Leukocyte Antigens Detected by Flow Cytometry in the First Year After Renal Transplantation

    Directory of Open Access Journals (Sweden)

    Tülay Kılıçaslan Ayna

    2013-03-01

    Full Text Available Objective: In this study, we aimed to investigate the incidence, dynamics and profiles of human leukocyte antigen (HLA-directed antibodies developed after transplantation and their impact on graft rejection and outcome in kidney recipients. Study Design: Prospective follow-up study. Material and Methods: A total of 56 kidney recipients were monitored at 1st, 6th and 12th months for the development of anti-HLA antibodies using bead based flow-cytometry assays (Flow PRA tests. Results: In 21 (37.5% patients, panel reactive antibodies (PRA was positive after transplantation, however, in 35 (62.5% patients PRA was found negative. Twelve (57.1% patients with post-transplantation HLA-reactive antibodies [PRA (+] and 8 (22.9% patients with no detectable alloantibodies [PRA (-] were developed allograft rejection (p=0.010. In the PRA positive patient group the rates of early period infection and delayed graft function (DGF were higher than the PRA negative patient group. Serum creatinine levels of PRA positive group at 6. and 12. months after transplantation were significantly higher than the PRA negative group (p=0.015 and p=0.048, respectively. The rejection rates of patients who had class I and II HLA antibodies were significantly higher than the patients who had either class I or II HLA antibodies (p=0.011. Acute rejection rates were significantly higher in patients who had class I and II HLA antibodies at the first month (p=0.007. Conclusion: Higher occurrence of rejection episodes in PRA positive group may show the importance of anti-HLA antibody monitoring using Flow-PRA after renal transplantation as a prognostic marker in terms of graft survival.

  13. 77 FR 24181 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2012-04-23

    ... (Attention: PRA Office), 1700 G Street NW., Washington, DC 20552: (202) 435-7741: [email protected], (Attention: Joseph Durbala, PRA Office) 1700 G Street NW., Washington, DC 20552, or through the internet at... practices that occur in the mortgage advertising area. To gauge whether covered persons are complying with...

  14. AAS Nov 07 Cover.indd

    African Journals Online (AJOL)

    Hsu from Taipei published a case series of PRA for colonic obstructions performed by a single surgeon where the mortality and anastomotic leak were basically equivalent comparing right and left-sided lesions (5). Patriti from Italy and. Villar et al. from Spain published similar papers advocating PRA in emergency surgery of ...

  15. Participatory Rural Appraisal as an Approach to Environmental Education in Urban Community Gardens.

    Science.gov (United States)

    Doyle, Rebekah; Krasny, Marianne

    2003-01-01

    Describes the Cornell University Garden Mosaics program in which youth learn about ethnic gardening practices in urban community gardens using research methods adapted from the Participatory Rural Appraisal (PRA). Conducts a study to determine whether youth could effectively facilitate PRA activities with gardeners and to document any social and…

  16. 76 FR 58565 - Proposed Information Collection (Exam for Housebound Status or Permanent Need for Regular Aid and...

    Science.gov (United States)

    2011-09-21

    ... DEPARTMENT OF VETERANS AFFAIRS [OMB Control No. 2900-0721] Proposed Information Collection (Exam... PRA of 1995 (Pub. L. 104-13; 44 U.S.C. 3501-3521), Federal agencies must obtain approval from the... request for comment is being made pursuant to Section 3506(c)(2)(A) of the PRA. With respect to the...

  17. Case study on the use of PSA methods: Backfitting decisions

    International Nuclear Information System (INIS)

    1991-04-01

    This case study illustrates the process of using probabilistic risk assessment (PRA) method to evaluate proposed backfits of nuclear power plants (NPP), which are intended to enhance the plant safety by improving equipment operability. Some examples of situations in which PRA techniques have been used to address backfit issues at operating NPPs are summarized. 2 refs, 5 figs, 4 tabs

  18. Economic impact assessment in pest risk analysis

    NARCIS (Netherlands)

    Soliman, T.A.A.; Mourits, M.C.M.; Oude Lansink, A.G.J.M.; Werf, van der W.

    2010-01-01

    According to international treaties, phytosanitary measures against introduction and spread of invasive plant pests must be justified by a science-based pest risk analysis (PRA). Part of the PRA consists of an assessment of potential economic consequences. This paper evaluates the main available

  19. seed flour

    African Journals Online (AJOL)

    ONOS

    2010-09-06

    Sep 6, 2010 ... and with a nice taste, used for cooking or as lamp oil. The fatty acid ... Pra seeds were obtained from a local market in Nakhon Si Thammarat. Page 2. Table 1. Proximate composition of pra seed flour. Constituent. Percentage ...

  20. HTGR accident and risk assessment

    International Nuclear Information System (INIS)

    Silady, F.A.; Everline, C.J.; Houghton, W.J.

    1982-01-01

    This paper is a synopsis of the high-temperature gas-cooled reactor probabilistic risk assessments (PRAs) performed by General Atomic Company. Principal topics presented include: HTGR safety assessments, peer interfaces, safety research, process gas explosions, quantitative safety goals, licensing applications of PRA, enhanced safety, investment risk assessments, and PRA design integration

  1. Probabilistic Reversible Automata and Quantum Automata

    OpenAIRE

    Golovkins, Marats; Kravtsev, Maksim

    2002-01-01

    To study relationship between quantum finite automata and probabilistic finite automata, we introduce a notion of probabilistic reversible automata (PRA, or doubly stochastic automata). We find that there is a strong relationship between different possible models of PRA and corresponding models of quantum finite automata. We also propose a classification of reversible finite 1-way automata.

  2. 77 FR 10786 - Advisory Committee on Reactor Safeguards (ACRS) Meeting of the ACRS Subcommittee on Reliability...

    Science.gov (United States)

    2012-02-23

    ... NUCLEAR REGULATORY COMMISSION Advisory Committee on Reactor Safeguards (ACRS) Meeting of the ACRS Subcommittee on Reliability and PRA; Notice of Meeting The ACRS Subcommittee on Reliability and PRA will hold a... Modeling Application Guide.'' The Subcommittee will hear presentations by and hold discussions with the NRC...

  3. Augmenting Probabilistic Risk Assesment with Malevolent Initiators

    International Nuclear Information System (INIS)

    Smith, Curtis; Schwieder, David

    2011-01-01

    As commonly practiced, the use of probabilistic risk assessment (PRA) in nuclear power plants only considers accident initiators such as natural hazards, equipment failures, and human error. Malevolent initiators are ignored in PRA, but are considered the domain of physical security, which uses vulnerability assessment based on an officially specified threat (design basis threat). This paper explores the implications of augmenting and extending existing PRA models by considering new and modified scenarios resulting from malevolent initiators. Teaming the augmented PRA models with conventional vulnerability assessments can cost-effectively enhance security of a nuclear power plant. This methodology is useful for operating plants, as well as in the design of new plants. For the methodology, we have proposed an approach that builds on and extends the practice of PRA for nuclear power plants for security-related issues. Rather than only considering 'random' failures, we demonstrated a framework that is able to represent and model malevolent initiating events and associated plant impacts.

  4. The effect of postural changes on plasma renin activity during normal and pathologic pregnancies.

    Science.gov (United States)

    Brandes, J M; Abramovici, H; Katz, M; Diengott, D; Spindel, A; Kahana, L

    1978-11-01

    A study of the effect of posture on plasma renin activity (PRA) in the third trimester in 27 gravidas revealed a significantly greater increase in PRA in the supine position, compared to the left lateral. The women were classified into 3 groups: normal pregnancy, preeclampsia, intrauterine fetal death. There was no statistical difference in PRA among the 3 groups. It is assumed that the increase of PRA in the supine position was due mainly to mechanical pressure by the gravid uterus on the great vessels (regardless of whether the fetus was dead or alive) and that effective circulatory volume was thus reduced. However, low PRA in the left lateral position in women with preeclampsia seemed to correlate with more severe disease in these women.

  5. Risk Management at NASA and Its Applicability to the Oil and Gas Industry

    Science.gov (United States)

    Kaplan, David

    2018-01-01

    NASA has a world-class capability for quantitatively assessing the risk of highly-complex, isolated engineering structures operated in extremely hostile environments. In particular, the International Space Station (ISS) represents a reasonable risk analog for High Pressure, High Temperature drilling and production operations on deepwater rigs. Through a long-term U.S. Government Interagency Agreement, BSEE has partnered with NASA to modify NASA's Probabilistic Risk Assessment (PRA) capabilities for application to deepwater drilling and production operations. The immediate focus of the activity will be to modify NASA PRA Procedure Guides and Methodology Documents to make them applicable to the Oil &Gas Industry. The next step will be for NASA to produce a PRA for a critical drilling system component, such as a Blowout Preventer (BOP). Subsequent activities will be for NASA and industry partners to jointly develop increasingly complex PRA's that analyze other critical drilling and production system components, including both hardware and human reliability. In the presentation, NASA will provide the objectives, schedule, and current status of its PRA activities for BSEE. Additionally, NASA has a Space Act Agreement with Anadarko Petroleum Corporation to develop a PRA for a generic 20K BOP. NASA will summarize some of the preliminary insights gained to date from that 20K BOP PRA as an example of the distinction between quantitative versus qualitative risk assessment.

  6. Proposal of methodology of tsunami accident sequence analysis induced by earthquake using DQFM methodology

    International Nuclear Information System (INIS)

    Muta, Hitoshi; Muramatsu, Ken

    2017-01-01

    Since the Fukushima-Daiichi nuclear power station accident, the Japanese regulatory body has improved and upgraded the regulation of nuclear power plants, and continuous effort is required to enhance risk management in the mid- to long term. Earthquakes and tsunamis are considered as the most important risks, and the establishment of probabilistic risk assessment (PRA) methodologies for these events is a major issue of current PRA. The Nuclear Regulation Authority (NRA) addressed the PRA methodology for tsunamis induced by earthquakes, which is one of the methodologies that should be enhanced step by step for the improvement and maturity of PRA techniques. The AESJ standard for the procedure of seismic PRA for nuclear power plants in 2015 provides the basic concept of the methodology; however, details of the application to the actual plant PRA model have not been sufficiently provided. This study proposes a detailed PRA methodology for tsunamis induced by earthquakes using the DQFM methodology, which contributes to improving the safety of nuclear power plants. Furthermore, this study also states the issues which need more research. (author)

  7. Effect of implementing anti-HLA antibody detection by Luminex in the kidney transplant program in Chile.

    Science.gov (United States)

    Elgueta, S; Fuentes, C; López, M; Hernández, J; Arenas, A; Jiménez, M; Gajardo, J G; Rodríguez, H; Labraña, C

    2011-11-01

    The development of new highly sensitive, specific technologies to detect HLA antibodies has allowed a better definition of the profile of non-permitted antigens for patients awaiting kidney transplantation. The use of calculated or virtual panel reactive antibodies (CPRA or vPRA) seeks to improve the prediction of positive crossmatches (XM), but increases the proportion of sensitized patients on the waiting list. In 2008-2009, we implemented detection of antibodies using Luminex technology and applied vPRA since 2009. The objective of this study was to evaluate the impact of these innovations in defecting patient sensitization on kidney transplant waiting lists for deceased donors and among transplanted patients. We analyzed the waiting list for 2007 through 2009 and the first semester of 2010, including the patients transplanted in these periods and the XM with deceased donors. We observed an increase in the mean peak PRA of transplanted patients from 7.2% in 2007 to 17.1% in 2010 (P = .001), and in the proportion of patients transplanted with a peak PRA > 50% from 2.8% in 2007 to 15.7% in 2010 (P = .0001), with no increase in the proportion of this population on the waiting lists. There was a concurrent decrease in positive XM among patients with a peak PRA > 50%. The use of vPRA and Luminex permitted a greater number of transplants of patients with peak PRA > 50% and was a good predictor of a positive XM. Published by Elsevier Inc.

  8. ATHEANA: open-quotes a technique for human error analysisclose quotes entering the implementation phase

    International Nuclear Information System (INIS)

    Taylor, J.; O'Hara, J.; Luckas, W.

    1997-01-01

    Probabilistic Risk Assessment (PRA) has become an increasingly important tool in the nuclear power industry, both for the Nuclear Regulatory Commission (NRC) and the operating utilities. The NRC recently published a final policy statement, SECY-95-126, encouraging the use of PRA in regulatory activities. Human reliability analysis (HRA), while a critical element of PRA, has limitations in the analysis of human actions in PRAs that have long been recognized as a constraint when using PRA. In fact, better integration of HRA into the PRA process has long been a NRC issue. Of particular concern, has been the omission of errors of commission - those errors that are associated with inappropriate interventions by operators with operating systems. To address these concerns, the NRC identified the need to develop an improved HRA method, so that human reliability can be better represented and integrated into PRA modeling and quantification. The purpose of the Brookhaven National Laboratory (BNL) project, entitled 'Improved HRA Method Based on Operating Experience' is to develop a new method for HRA which is supported by the analysis of risk-significant operating experience. This approach will allow a more realistic assessment and representation of the human contribution to plant risk, and thereby increase the utility of PRA. The project's completed, ongoing, and future efforts fall into four phases: (1) Assessment phase (FY 92/93); (2) Analysis and Characterization phase (FY 93/94); (3) Development phase (FY 95/96); and (4) Implementation phase (FY 96/97 ongoing)

  9. The implications of probabilistic risk assessment for safety policy

    International Nuclear Information System (INIS)

    Hayns, M.R.

    1987-01-01

    The use of PRA results in decision making requires a level of understanding on the part of the decision maker which is higher than that obtaining previously. The most important application of PRA lies not in the final results but in the intermediate results which refer to specific systems and operations. Such intermediate results are of great value either at the design stage or later during operation. One of the most 'visible' uses of PRA results is in comparing calculated plant risks with either proposed acceptability criteria, or with other plant, or even natural events. The capability to perform PRA has been established. Only the incorporation of PRA into the licensing process is lacking. The principal conclusions on the implications of PRA for safety policy are as follows: regardless of its state of development, PRA is the only means available for calculating public risk, being able to quantify risk is important in policy related to risk acceptability and to national energy policy. PRAs will be used to establish research and development priorities. Any hazardous plant can be treated using the same methods. More sophisticated methods will be used for solving engineering problems. (author)

  10. Relationship between mechanical properties and crystal structure in cocrystals and salt of paracetamol.

    Science.gov (United States)

    Ahmed, Hamzah; Shimpi, Manishkumar R; Velaga, Sitaram P

    2017-01-01

    Objectives were to study mechanical properties of various solid forms of paracetamol and relate to their crystal structures. Paracetamol form I (PRA), its cocrystals with oxalic acid (PRA-OXA) and 4,4-bipyridine (PRA-BPY) and hydrochloride salt (PRA-HCL) were selected. Cocrystals and salt were scaled-up using rational crystallization methods. The resulting materials were subjected to different solid-state characterizations. The powders were sieved and 90-360 µm sieve fraction was considered. These powders were examined by scanning electron microscopy (SEM) and densities were determined. Tablets were made at applied pressures of 35-180 MPa under controlled conditions and the tablet height, diameter and hardness were measured. Tensile strength and porosity of the tablets were estimated using well known models. Crystal structures of these systems were visualized and slip planes were identified. Cocrystal and salt of PRA were physically pure. Sieved powders had comparable morphologies and particle size. The apparent and theoretical densities of powders were similar, but no clear trends were observed. The tensile strengths of these compacts were increased with increasing pressure whereas tabletability decreased in the order oxalic acid > PRA-HCL ≈ PRA-OXA > BPY > PRA-BPY. Tablet tensile strength decreases exponentially with increasing porosity with the exception of PRY-BPY and BPY. Slip plane prediction based on attachment energies may not be independently considered. However, it was possible to explain the improved mechanical properties of powders based on the crystal structure. Cocrystallization and salt formation have introduced structural features that are responsible for improved tableting properties of PRA.

  11. Loss of co-ordinate expression of progesterone receptors A and B is an early event in breast carcinogenesis.

    Science.gov (United States)

    Mote, P A; Bartow, S; Tran, N; Clarke, C L

    2002-03-01

    Progesterone receptor (PR) mediates the effects of progesterone in mammary tissues and plays a crucial role in normal breast development and in breast cancer. PR proteins are expressed as two isoforms, PRA and PRB, that have different capacities to activate target genes, yet it is unknown whether progesterone action in normal and malignant breast is mediated by PRA and/or PRB. This study determines the relative expression of PRA and PRB in normal breast and in benign, premalignant and malignant archival breast lesions by dual immunofluorescent histochemistry. In normal breast and in proliferative disease without atypia (PDWA) PRA and PRB were co-expressed within the same cells in comparable amounts, implicating both isoforms in progesterone action. In atypical lesions, however, there was a significant increase in predominant expression of PRA or PRB, with lesion progression from the normal state to malignancy. PR isoform predominance, especially PRA predominance, was evident in a high proportion of ductal carcinomas in situ (DCIS) and invasive breast lesions. In the normal breast and in PDWA, the relative expression of PRA and PRB in adjacent cells was homogenous. There was a significant increase in cell-to-cell heterogeneity of PR isoform expression in ADH and DCIS lesions and in the majority of breast cancers. Heterogeneous cell-to-cell expression of PR isoforms occurred prior to overall predominant expression of one isoform in premalignant breast lesions, demonstrating that loss of control of relative PRA:PRB expression is an early event in the development of breast cancer. PRA:PRB ratios within a breast lesion are likely to be important as both markers and effectors of tumor growth and development, and progressively aberrant PR isoform expression may play a role in the etiology of breast cancer.

  12. Establishment of calculated panel reactive antibody and its potential benefits in improving the kidney allocation strategy in Taiwan

    Directory of Open Access Journals (Sweden)

    Ssu-Wen Shen

    2017-12-01

    Full Text Available Background/Purpose: Renal transplant candidates who are highly sensitized to human leukocyte antigens (HLAs tend to wait longer to find a matched donor and have poor outcomes. Most organ-sharing programs prioritize highly sensitized patients in the allocation scoring system. The HLA sensitization status is traditionally evaluated by the panel-reactive antibody (PRA assay. However, this assay is method dependent and does not consider the ethnic differences in HLA frequencies. A calculated PRA (cPRA, based on a population's HLA frequency and patients' unacceptable antigens (UAs, correctly estimates the percentage of donors suitable for candidates. The Taiwan Organ Registry and Sharing Center does not prioritize sensitized patients. We propose that the incorporation of the cPRA and UAs into the renal allocation program will improve the local kidney allocation policy. Methods: We established a cPRA calculator using 6146 Taiwanese HLA-A, -B, -C, -DR, and -DQ phenotypes. We performed simulated allocation based on the concept of acceptable mismatch for 76 candidates with cPRA values exceeding 80%. Results: We analyzed 138 waitlisted renal transplant candidates at our hospital, and we determined that the concordance rate of the cPRA and PRA for highly sensitized (%PRA > 80% candidates was 92.5%, which decreased to 20% for those with %PRA < 80%. We matched 76 highly sensitized patients based on acceptable mismatch with the HLA phenotypes of 93 cadaver donors. Forty-six patients (61% found at least one suitable donor. Conclusion: The application of the cPRA and acceptable mismatch can benefit highly sensitized patients and reduce positive lymphocyte cytotoxicity crossmatch. Keywords: Kidney transplantation, Human leukocyte antigen, CPRA

  13. Progressive retinal atrophy in the Polski Owczarek Nizinny dog: a clinical and genetic study.

    Science.gov (United States)

    Svensson, Marika; Olsén, Lena; Winkler, Paige A; Petersen-Jones, Simon M; Bergström, Tomas; Garncarz, Yacek; Narfström, Kristina

    2016-05-01

    To describe ophthalmic, functional, structural, and genetical characteristics of progressive retinal atrophy (PRA) in the polski owczarek nizinny (PON) breed of dog. Client-owned PON dogs (n = 82) from Sweden. Routine examination for presumed inherited eye disease was performed in all dogs. Bilateral full-field electroretinography (ERG) was performed in 11 affected and 4 control dogs. Eyes from one affected dog were studied with light microscopy. DNA samples from 34 Swedish and 30 PON dogs collected by Michigan State University (MSU) were tested for the mutations causing the rcd4 and prcd forms of PRA. Sixteen of the eighty-two Swedish dogs were diagnosed with PRA. Slight vascular attenuation, first seen at 4.5 years of age, preceded changes in tapetal reflectivity. The initial ERG changes in affected dogs showed markedly diminished rod responses, while cone responses were barely affected. Eventually, cone responses were also reduced. Retinal morphology showed approximately a 50% reduction of photoreceptor nuclei in the outer nuclear layer. Fourteen of fifteen PRA-affected Swedish dogs and eighteen of twenty of the MSU PRA-affected dogs tested genetically were positive for the rcd4 mutation. All tested dogs were negative for the mutation causing prcd-PRA. PRA of PON dogs is a late-onset degenerative disease with slow progression. There is early loss of rod function, while the cone system deteriorates later. The rcd4 mutation in the C2ORF71 gene was associated with the majority of the PRA cases tested. The possibility of additional forms of PRA in the breed cannot be excluded. © 2015 American College of Veterinary Ophthalmologists.

  14. Probabilistic accident sequence recovery analysis

    International Nuclear Information System (INIS)

    Stutzke, Martin A.; Cooper, Susan E.

    2004-01-01

    Recovery analysis is a method that considers alternative strategies for preventing accidents in nuclear power plants during probabilistic risk assessment (PRA). Consideration of possible recovery actions in PRAs has been controversial, and there seems to be a widely held belief among PRA practitioners, utility staff, plant operators, and regulators that the results of recovery analysis should be skeptically viewed. This paper provides a framework for discussing recovery strategies, thus lending credibility to the process and enhancing regulatory acceptance of PRA results and conclusions. (author)

  15. Application engineering for process computer systems

    International Nuclear Information System (INIS)

    Mueller, K.

    1975-01-01

    The variety of tasks for process computers in nuclear power stations necessitates the centralization of all production stages from the planning stage to the delivery of the finished process computer system (PRA) to the user. This so-called 'application engineering' comprises all of the activities connected with the application of the PRA: a) establishment of the PRA concept, b) project counselling, c) handling of offers, d) handling of orders, e) internal handling of orders, f) technical counselling, g) establishing of parameters, h) monitoring deadlines, i) training of customers, j) compiling an operation manual. (orig./AK) [de

  16. An Approach to On-line Risk Assessment in NPP

    International Nuclear Information System (INIS)

    Simic, Z.; Mikulicic, V.; O'Brien, J.

    1996-01-01

    Probabilistic Risk Assessment (PRA) can provide safety status information for a plant during different configurations; additional effort is needed to do this in real time for on-line operation. This paper describes an approach to use PRA to achieve these goals. A Risk Assessment On-Line (RAOL) application was developed to monitor maintenance (on-line and planned) activities. RAOL is based on the results from a full-scope PRA, engineering/operational judgment and incorporates a user friendly program interface approach. Results from RAOL can be used by planners or operations to effectively manage the level of risk by controlling the actual plant configuration. (author)

  17. Simplified approach for estimating large early release frequency

    International Nuclear Information System (INIS)

    Pratt, W.T.; Mubayi, V.; Nourbakhsh, H.; Brown, T.; Gregory, J.

    1998-04-01

    The US Nuclear Regulatory Commission (NRC) Policy Statement related to Probabilistic Risk Analysis (PRA) encourages greater use of PRA techniques to improve safety decision-making and enhance regulatory efficiency. One activity in response to this policy statement is the use of PRA in support of decisions related to modifying a plant's current licensing basis (CLB). Risk metrics such as core damage frequency (CDF) and Large Early Release Frequency (LERF) are recommended for use in making risk-informed regulatory decisions and also for establishing acceptance guidelines. This paper describes a simplified approach for estimating LERF, and changes in LERF resulting from changes to a plant's CLB

  18. Operational phase of inspection prioritization

    International Nuclear Information System (INIS)

    Campbell, D.J.; Guthrie, V.H.; Flanagan, G.F.

    1986-01-01

    Inspectors must make many decisions on the allocation of their efforts. To date, these decisions have been made based upon their own judgment and guidance from inspection procedures. Our goal is to provide probabilistic risk assessment (PRA) information as an additional aid to inspectors. A structured approach for relating PRA information to specific inspection decisions has been developed. The use of PRA information as an aid in optimal decision making: (1) in response to the current plant status and (2) in the scheduling of effort over an extended period of time is considered

  19. Risk assessment application to NRC inspection

    International Nuclear Information System (INIS)

    Campbell, D.J.; Guthrie, V.H.; Flanagan, G.F.

    1987-01-01

    Inspectors must make many decisions on the allocation of their efforts. To date, these decisions have been made based upon their own judgment and guidance from inspection procedures. The program described in this paper provides PRA information as an additional aid to inspectors. A structured approach for relating PRA information to specific inspection decisions has been developed. The use of PRA information as an aid in optimal decision making (1) in response to the current plant status and (2) in the scheduling of effort over an extended period of time is considered. (orig.)

  20. Bayesian parameter estimation in probabilistic risk assessment

    International Nuclear Information System (INIS)

    Siu, Nathan O.; Kelly, Dana L.

    1998-01-01

    Bayesian statistical methods are widely used in probabilistic risk assessment (PRA) because of their ability to provide useful estimates of model parameters when data are sparse and because the subjective probability framework, from which these methods are derived, is a natural framework to address the decision problems motivating PRA. This paper presents a tutorial on Bayesian parameter estimation especially relevant to PRA. It summarizes the philosophy behind these methods, approaches for constructing likelihood functions and prior distributions, some simple but realistic examples, and a variety of cautions and lessons regarding practical applications. References are also provided for more in-depth coverage of various topics

  1. Structural Health Monitoring Analysis for the Orbiter Wing Leading Edge

    Science.gov (United States)

    Yap, Keng C.

    2010-01-01

    This viewgraph presentation reviews Structural Health Monitoring Analysis for the Orbiter Wing Leading Edge. The Wing Leading Edge Impact Detection System (WLE IDS) and the Impact Analysis Process are also described to monitor WLE debris threats. The contents include: 1) Risk Management via SHM; 2) Hardware Overview; 3) Instrumentation; 4) Sensor Configuration; 5) Debris Hazard Monitoring; 6) Ascent Response Summary; 7) Response Signal; 8) Distribution of Flight Indications; 9) Probabilistic Risk Analysis (PRA); 10) Model Correlation; 11) Impact Tests; 12) Wing Leading Edge Modeling; 13) Ascent Debris PRA Results; and 14) MM/OD PRA Results.

  2. Documentation design for probabilistic risk assessment

    International Nuclear Information System (INIS)

    Parkinson, W.J.; von Herrmann, J.L.

    1985-01-01

    This paper describes a framework for documentation design of probabilistic risk assessment (PRA) and is based on the EPRI document NP-3470 ''Documentation Design for Probabilistic Risk Assessment''. The goals for PRA documentation are stated. Four audiences are identified which PRA documentation must satisfy, and the documentation consistent with the needs of the various audiences are discussed, i.e., the Summary Report, the Executive Summary, the Main Report, and Appendices. The authors recommend the documentation specifications discussed herein as guides rather than rigid definitions

  3. Pět tisíc hřiven stříbra Ebruše Poplinova. Několik zamyšlení nad velikostí majetku pražských a kutnohorských městských elit ve 14. století na základě písemných pramenů

    Czech Academy of Sciences Publication Activity Database

    Musílek, Martin

    Roč. 26, č. 1 ( 2011 ), s. 117-135 ISSN 0546-9414 R&D Projects: GA ČR(CZ) GAP405/11/1982 Institutional research plan: CEZ:AV0Z90090514 Institutional support: RVO:67985955 Keywords : town elites * Prague * Kuttenberg * form books Subject RIV: AB - History

  4. 90 let systematického archeologického studia historického jádra Prahy a 50. výročí založení specializovaného pracoviště pražské archeologické památkové péče v kontextu stavu a možností poznání počátků Prahy

    Czech Academy of Sciences Publication Activity Database

    Boháčová, Ivana

    2015-01-01

    Roč. 31, č. 2 (2015), s. 95-111 ISSN 0231-6056 R&D Projects: GA MK(CZ) DF13P01OVV014 Keywords : archaeology * heritage care * Middle Ages * Prague * history Subject RIV: AC - Archeology, Anthropology, Ethnology

  5. 75 FR 8335 - Agency Information Collection Activities; Proposed Renewal of Several Currently Approved...

    Science.gov (United States)

    2010-02-24

    ... website is an ``anonymous access'' system, which means EPA will not know your identity or contact... Federal Register citation. III. What Do I Need to Know About PRA? An Agency may not conduct or sponsor...

  6. Citadels of the Arts: A Couple of Rude Questions about Arts Schools.

    Science.gov (United States)

    Corathers, Don

    1990-01-01

    Asks why the United States is training artists that it does not intend to employ, and why (when it seems that arts education is good for everyone) are all the resources concentrated only on "talented" children. (PRA)

  7. 78 FR 28204 - Agency Information Collection Activities; Comment Request

    Science.gov (United States)

    2013-05-14

    ... Delivery/Courier: Consumer Financial Protection Bureau (Attention: PRA Office), 1700 G Street NW... for additional information should be directed to the Consumer Financial Protection Bureau, (Attention.... They also contain rules about advertising deposit accounts and overdraft services. Regulation DD...

  8. The contribution of bank and surface sediments to fluvial sediment ...

    African Journals Online (AJOL)

    The contribution of bank and surface sediments to fluvial sediment transport of the Pra River. ... the relative contribution of surface and bank sediments to the fluvial sediment transport. ... EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  9. Transplant Options When You Don't Have a 'Good Match'

    Science.gov (United States)

    ... for an organ? Because waiting times for deceased donor organs can be long, transplant teams are working to ... are therefore more like- ly to reject a donor organ than a recipient who has zero percent PRA ...

  10. Video Pedagogy as Political Activity.

    Science.gov (United States)

    Higgins, John W.

    1991-01-01

    Asserts that the education of students in the technology of video and audio production is a political act. Discusses the structure and style of production, and the ideologies and values contained therein. Offers alternative approaches to critical video pedagogy. (PRA)

  11. 76 FR 60030 - Information Collections Being Reviewed by the Federal Communications Commission

    Science.gov (United States)

    2011-09-28

    ... with a collection of information subject to the PRA that does not display a valid Office of Management... franchising authority. Section 76.923 records are kept by cable operators in order to demonstrate that charges...

  12. "The Heart That Trusts Another Is Stronger than Anything."

    Science.gov (United States)

    Witkin, Mitzi

    1992-01-01

    Describes how an English teacher incorporates the native languages of her internationally born students into her English lessons. Relates how these activities helped foreign students feel accepted into the class and their new environment. (PRA)

  13. 76 FR 2754 - Agency Information Collection (Matured Endowment Notification) Activity Under OMB Review

    Science.gov (United States)

    2011-01-14

    ... Management and Budget (OMB) for review and comment. The PRA submission describes the nature of the... receive the proceeds in monthly installment or in a combination of cash and monthly installment and to...

  14. Quality assurance of human error modelling in a major probabilistic risk assessment programme

    International Nuclear Information System (INIS)

    Rycraft, H.S.

    1990-01-01

    A method of incorporating the consideration of operator error within a major PRA exercise is described along with the quality assurance procedures employed to ensure a quality product. The exercise was undertaken at the Sellafield Reprocessing Plant. (author)

  15. 77 FR 1486 - Information Collections Being Reviewed by the Federal Communications Commission

    Science.gov (United States)

    2012-01-10

    ... with a collection of information subject to the PRA that does not display a valid Office of Management... pending Form 301 application not be immediately processed, the Tribal Allotment will be placed in a queue...

  16. Mark Twain, Fenimore Cooper, and Batman.

    Science.gov (United States)

    Crick, Robert Alan

    1992-01-01

    Describes how Mark Twain's essay "Fenimore Cooper's Literary Offenses" helped students to get interested in writing and inspired them to write a similar essay critiquing the movie "Batman." Provides excerpts from students' essays. (PRA)

  17. Applications of the EBR-II Probabilistic Risk Assessment

    International Nuclear Information System (INIS)

    Roglans, J.: Ragland, W.A.; Hill, D.J.

    1993-01-01

    A Probabilistic Risk Assessment (PRA) of the Experimental Breeder Reactor 11 (EBR-11), a Department of Energy (DOE) Category A research reactor, has recently been completed at Argonne National Laboratory (ANL), and has been performed with close collaboration between PRA analysts and engineering and operations staff. A product of this Involvement of plant personnel has been a excellent acceptance of the PRA as a tool, which has already resulted In a variety of applications of the EBR-11 PRA. The EBR-11 has been used in support of plant hardware and procedure modifications and In new system design work. A new application in support of the refueling safety analysis will be completed in the near future

  18. 77 FR 71461 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2012-11-30

    ... the public accountant file with the Commission a Form ADV-E and accompanying statement within four... PRA that does not display a valid OMB control number. The public may view the background documentation...

  19. 77 FR 13127 - Agency Information Collection Activities; Proposed Collection; Comment Request; Extension

    Science.gov (United States)

    2012-03-05

    ... electronics, small appliances, furniture, and other transactions. (Only consumer leases for more than four... transactions reflect a net decrease from prior FTC estimates, given current market conditions and the new PRA...

  20. Isocrates and Plato on Rhetoric and Rhetorical Education.

    Science.gov (United States)

    Benoit, William L.

    1991-01-01

    Compares the views of Isocrates and Plato on rhetoric and rhetorical education. Elucidates their criticisms of the sophists, their general assumptions about the nature and function of rhetoric, and their views on rhetorical education. (PRA)

  1. 78 FR 7463 - Information Collection

    Science.gov (United States)

    2013-02-01

    ... addressed to Fran Teel, National Aeronautics and Space Administration, Washington, DC 20546-0001. FOR... instrument(s) and instructions should be directed to Fran Teel, NASA PRA Officer, NASA Headquarters, 300 E...

  2. Should You Know How to Do Marketing, Advertising, & Public Relations Writing?

    Science.gov (United States)

    Sides, Charles H.

    1992-01-01

    Argues that technical writers who develop broader writing skills prove to be more valuable to their employers during periods of economic downturn. Offers an overview of the basic skills needed to write marketing, advertising, and public relations documents. (PRA)

  3. 76 FR 49479 - Franchise Rule Information Collection Activities; Proposed Collection; Comment Request

    Science.gov (United States)

    2011-08-10

    ... FEDERAL TRADE COMMISSION Franchise Rule Information Collection Activities; Proposed Collection... Concerning Franchising (``Franchise Rule''). That clearance expires on December 31, 2011. DATES: Comments... INFORMATION section below. Write ``Franchise Rule, PRA Comment, FTC File No. P094400'' on your comment, and...

  4. West African Journal of Applied Ecology - Vol 25, No 1 (2017)

    African Journals Online (AJOL)

    The contribution of bank and surface sediments to fluvial sediment transport of the Pra River · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. J.M. Kusimi, 69-85 ...

  5. Advanced Test Reactor probabilistic risk assessment

    International Nuclear Information System (INIS)

    Atkinson, S.A.; Eide, S.A.; Khericha, S.T.; Thatcher, T.A.

    1993-01-01

    This report discusses Level 1 probabilistic risk assessment (PRA) incorporating a full-scope external events analysis which has been completed for the Advanced Test Reactor (ATR) located at the Idaho National Engineering Laboratory

  6. Minimalist Theater and the Classroom: Some Experiments with Shakespeare and Beckett.

    Science.gov (United States)

    Homan, Sidney

    1990-01-01

    Argues in favor of using minimalist theater when teaching literature. Describes how minimalist theater was used to teach works by William Shakespeare and Samuel Beckett to undergraduate students. (PRA)

  7. 76 FR 37813 - Agency Information Collection Activities: Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-06-28

    ... are being included with this revised PRA submission, and with completing the Prima Facie Evidence... completing the Prima Facie Evidence cover sheet, was included in the burden estimate for submitting a...

  8. Development of a methodology for post closure radiological risk analysis of underground waste repositories. Illustrative assessment of the Harwell site. V.1

    International Nuclear Information System (INIS)

    Gralewski, Z.A.; Kane, P.; Nicholls, D.B.

    1987-06-01

    A probabilistic risk analysis (pra) is demonstrated for a number of ground water mediated release scenarios at the Harwell Site for a hypothetical repository at a depth of about 150 metres. This is the second stage of development of an overall risk assessment methodology. A procedure for carrying out multi-scenario assessment using available probabilistic risk assessment (pra) models is presented and a general methodology for combining risk contributions is outlined. Appropriate levels of model complexity in pra are discussed. Modelling requirements for the treatment of multiple simultaneous pathways and of site evolution are outlined. Further developments of pra systems are required to increase the realism of both the models and their mode of application, and hence to improve estimates of risk. (author)

  9. Response to "Language, Politics, and Composition: A Conversation with Noam Chomsky."

    Science.gov (United States)

    Sledd, James

    1991-01-01

    Responds to the conversation of two eminent compositionists with Noam Chomsky. Discusses the alleged literary crisis, sensible prescriptivism versus linguistic permissiveness, police and thought control, intellectually interesting versus humanly significant topics, and rhetorical theory. (PRA)

  10. Review insights on the probabilistic risk assessment for the Limerick Generating Station

    International Nuclear Information System (INIS)

    1984-08-01

    In recognition of the high population density around the Limerick Generating Station site and the proposed power level, the Philadelphia Electric Company, in response to NRC staff requests, conducted and submitted between March 1981 and November 1983 a probabilistic risk assessment (PRA) on internal event contributors and a severe accident risk assessment on external event contributors to assess risks posed by operation of the plant. The applicant has developed perspectives using PRA models on the safety profile of the Limerick plant and has altered the plant design to reduce accident vulnerabilities identified in these PRAs. The staff's review of the Limerick PRA has particularly emphasized the dominant accident sequences and the resulting insights into demonstration of compliance with regulatory requirments, unique design features and major plant vulnerabilities to assess the need for any additional measures to further improve the safety of the LGS. The staff's review insights and PRA safety review conclusions are presented in this report

  11. Probabilistic risk assessment and its role in plant modifications

    International Nuclear Information System (INIS)

    Diederich, A.R.; McElroy, W.F.

    1986-01-01

    Electric Utilities today have a tool available to improve management's ability to evaluate nuclear power plant modifications (MODS). Probabilistic Risk Assessment (PRA), is a tool of choice since it can be applied to a specific situation such as MOD request review, bringing the perspectives of reliability, financial risk and consequences to the public in addition to the more rigid requirements like those associated with Quality Assurance or licensing criteria. The techniques used in the PRA process revolve about the creation and manipulation of Fault Trees and Event Trees, which are used to quantify the event sequences and reliability of plant systems in a logical framework. It is through these methods that chains of sequences, or events, are understood. The degree to which plant systems are modelled in the PRA can vary depending on resources and purpose. Philadelphia Elecrtric Company's PRA modelled ten (10) major systems but this number may increase during the application and updating process

  12. Local Knowledge and Community–Based Assessment of ...

    African Journals Online (AJOL)

    Although much scientific knowledge exists about global environmental ... to an understanding of local knowledge on environmental change through Community Risk ... Rural Appraisal (PRA) methods were employed for data collection and ...

  13. 76 FR 44087 - Agency Information Collection (Supplement to VA Forms 21-526, 21-534, and 21-535 (For Philippine...

    Science.gov (United States)

    2011-07-22

    ... information abstracted below to the Office of Management and Budget (OMB) for review and comment. The PRA... of service, and whether the applicant was a member of pro-Japanese, pro-German, or anti- American...

  14. Knowledge, Choice and Consequence: Reading and Teaching "Hamlet."

    Science.gov (United States)

    Baumlin, James S.; Baumlin, Tita French

    1990-01-01

    Offers a Pyrrhonist reading of "Hamlet." Describes an experiment in teaching that attempts to reconstruct for literature students the prudential-ethical context of human rhetoric, placing "prudentia," or practical wisdom, at the center of their own imaginative involvement. (PRA)

  15. Changes of RAAS in maternal and placental blood during caesarean operation

    International Nuclear Information System (INIS)

    Huang Daihua; Cui Bangping; Hu Wei; Zhou Wei

    2006-01-01

    To study changes of renin-angiotensin-aldosterone system (RAAS) and influence of anesthetic effect on it during caesarean operation, PRA, AT II and ALD in maternal and placental blood were determined by RIA for 30 healthy women scheduled for caesarean operation. Blood was taken before anesthesia(T 0 group) and just at the end of surgery (T 1 group) for comparison. Results showed that there were significant differences in PRA(P 0 and T 1 group, but there were no significant differences in ALD, PRA and AT II between placental blood, umbilical arteria and vein blood. The data suggest that there was obvious relationship between anesthetic effect and the secretion of RAAS. The levels of AT II, ALD and PRA in patients of partial block anesthesia were significantly than those in patients of complete block anesthesia. (authors)

  16. Code development incorporating environmental, safety, and economic aspects of fusion reactors (FY 89--91)

    International Nuclear Information System (INIS)

    Ho, S.K.; Fowler, T.K.; Holdren, J.P.

    1991-11-01

    This report discusses the following aspects of Fusion reactors.: Activation Analysis; Tritium Inventory; Environmental and Safety Indices and Their Graphical Representation; Probabilistic Risk Assessment (PRA) and Decision Analysis; Plasma Burn Control -- Application to ITER; and Other Applications

  17. 77 FR 2760 - Proposed Information Collection Request (ICR) for the Mining Voice in the Workplace Survey...

    Science.gov (United States)

    2012-01-19

    ... by the Office of Management and Budget (OMB) under the PRA and the related materials display a... use of radio and paper advertisements, and (3) a mail or phone survey. DOL is currently assessing the...

  18. 76 FR 40844 - Changes to Move Update Standards

    Science.gov (United States)

    2011-07-12

    ... under the previous regulatory framework (the Postal Reorganization Act or PRA), in which a markup factor... percentages cannot exceed the CPI price-cap even if the attributable cost per piece has risen faster than the...

  19. A Unit on "Fahrenheit 451" That Uses Cooperative Learning (Resources and Reviews).

    Science.gov (United States)

    Ebbers, Frances A.

    1991-01-01

    Provides a curriculum unit using the novel "Fahrenheit 451" to provide student-centered activities based on solid pedagogical methodology. Emphasizes value-centered analysis of the novel, comparison of alternative arguments, and integration of cooperative learning activities. (PRA)

  20. Innovations in pricing of transportation systems : theory and practice.

    Science.gov (United States)

    2011-08-15

    This report summarizes results from the conference titled Innovations in Pricing of : Transportation Systems on May 12 14, 2010 at the Royal Plaza Hotel in Orlando, Florida. : The primary objective of the conference is to bring together pra...