WorldWideScience

Sample records for brasilense tarrand krieg

  1. brasilense nativa de Tamaulipas, México

    Directory of Open Access Journals (Sweden)

    J. L. Hernández-Mendoza

    2008-01-01

    Full Text Available La bacteria Azospirillum brasilense [Tarrand et al., 1979] metaboliza el triptófano y produce diversos metabolitos; entre ellos, el ácido indolacético. En este trabajo se utilizó la cepa CBG 497 de A. brasilense aislada de maíz para identificar los metabolitos producidos a partir de triptófano en laboratorio. Entre los metabolitos identificados destacan los ácidos antranílico e indolacético. El ácido antranílico es un compuesto intermediario en la síntesis y degradación del triptófano y, junto con el ácido indolacético, estaría involucrado en la capacidad promotora del crecimiento vegetal de A. brasilense

  2. Krieg denken : Grundfragen zur politischen Theorie des Krieges im Anschluss an Carl von Clausewitz

    OpenAIRE

    Frodermann, Tim

    2007-01-01

    "Politische" Theorie des Krieges mag manchem als Widerspruch in sich erscheinen. So wird der Krieg heute auch in der Forschung gerade als das Scheitern aller politischen Bemühungen empfunden. Als etwas, das "nach" der Politik kommt. In Deutschland wird sich dem Thema Krieg daher meist von einem rechtstheoretischen oder einem ethisch-moralischen Standpunkt aus genähert. Ein rechtstheoretischer Ansatz kann jedoch nur darüber Auskunft geben, wann ein Krieg legal ist, der moraltheoretische, wann ...

  3. Krieg und Literatur War and Literature

    Directory of Open Access Journals (Sweden)

    Elfi N. Theis

    2007-03-01

    Full Text Available Schreiben gegen Krieg und Gewalt heißt der Band 19 der Schriften-Reihe des Erich-Maria-Remarque-Archivs, in dem es um Ingeborg Bachmann und die deutschsprachige Literatur 1945-1980 geht. Der Band enthält die Beiträge zu einem Symposion, das am 14.-15. Januar 2005 an der Universität Nottingham stattgefunden hat. Im Mittelpunkt stand die Frage, welche Strategien im Umgang mit Nationalsozialismus, Holocaust, zweitem Weltkrieg, Kaltem Krieg oder Vietnamkrieg und auch dem deutschen Kolonialismus bei Bachmann und anderen deutschsprachigen Autoren zu finden sind. Anlass zur Tagung war die in Wien und Salzburg konzipierte Ausstellung Schreiben gegen den Krieg: Ingeborg Bachmann, 1926-1973. In insgesamt dreizehn Beiträgen wird im vorliegenden Band die literarische Auseinandersetzung mit dem Thema Gewalt und Krieg beleuchtet.Volume 19 of the series published by the Erich-Maria-Remarque Archive is entitled “Writing against War and Violence” (“Schreiben gegen Krieg und Gewalt” and approaches Ingeborg Bachmann and German language literature from 1945 to 1980. The volume contains contributions based on a symposium that took place at the University of Nottingham on January 14-15, 2005. Central to the symposium was the question as to which strategies Bachmann and other German language authors utilized in their approach to National Socialism, the Holocaust, the Second World War, the Cold War, or the Vietnam War, as well as German colonialism. The impetus for the conference was the exhibition Writing Against the War: Ingeborg Bachmann, 1926-1973 conceived in Vienna and Salzburg. In the volume at hand, thirteen contributions in total illuminate literary confrontations with the themes of war and violence.

  4. Der Krieg als eine besondere Form des Konflikts

    Directory of Open Access Journals (Sweden)

    Sebastian Schneider

    2011-12-01

    Full Text Available Comme le montrent les débats politiques et scientifiques actuels, la notion de guerre ne décrit pas uniquement une condition, mais a des implications normatives larges. Dans les situations de guerre, l’interdiction générale de tuer est en partie levée ou limitée. Afin d’éviter toute instrumentalisation politique et arbitraire de la notion de guerre, il faut repenser les critères de distinction entre la notion de guerre et les autres formes de conflit. Cet article se propose d’évoquer les réflexions philosophiques ainsi que politiques sur le thème de la guerre et critique le manque de réflexion sur la distinction entre la notion de guerre et les autres formes de conflits.Wie sich an aktuellen politischen und wissenschaftlichen Debatten zeigen lässt, ist der Begriff des Krieges nicht nur eine reine Zustandsbeschreibung, sondern hat auch weitreichende normative Implikationen. Im Krieg ist das ansonsten generelle Tötungsverbot partiell aufgehoben oder eingeschränkt. Um den Begriff nicht einer willkürlichen politischen Instrumentalisierung zu übergeben, muss über Kriterien zur Abgrenzung von Krieg und anderen Formen des Konflikts nachgedacht werden. Der Artikel wirft einen Blick auf die Beschäftigung der Philosophie und Politikwissenschaft mit dem Thema Krieg und kritisiert die mangelnde Abgrenzung des Krieges zu anderen Konfliktformen.

  5. Aerotactic response of Azospirillum brasilense.

    OpenAIRE

    Barak, R.; I. Nur; Okon, Y.; Henis, Y.

    1982-01-01

    Five strains of Azospirillum brasilense and two of Azospirillum spp., from Israel, responded to self-created and preformed oxygen gradients by forming aerotactic bands in capillary tubes and actively moving toward a specific zone with low dissolved oxygen. Increasing the oxygen concentration in capillaries containing phosphate buffer increased the number of attracted bacteria and decreased band velocity. High O2 concentrations and H2O2 temporarily repulsed the bacteria, causing the formation ...

  6. Vertical movement of Azospirillum brasilense in soil

    International Nuclear Information System (INIS)

    Plant growth promoting rhizobacteria like Azospirillum brasilense have considerable potential in increasing crop productivity. The success of bacterial inoculation in fields however, depends on their root colonizing ability. These bacteria, applied either through seed pelleting or directly to the soil are distributed along roots through active or passive movements. 32P labelled A.brasilense has been used to study their movements in sandy loam soils. (author). 5 refs., 2 figs

  7. 10 Jahre danach: Der Irak-Krieg 2003 und das (Medien- Schlachtfeld II

    Directory of Open Access Journals (Sweden)

    Karl H. Stingeder

    2013-06-01

    Full Text Available Hinsichtlich der Informationsstrategie der US-Administration von George W. Bush und des US-–Militärs im Zuge des Irak-Krieges 2003, lässt sich eine gut geplante und organisierte PR feststellen. Die eingebetteten Journalisten waren dabei ein wichtiges Mittel zum Zweck. Sie sorgten für eine Bilderhoheit im Krieg. Auch waren sie als Quelle für „unverfängliche Berichte“ geplant. – Eine vordergründig „neutrale Berichterstattung“, die von negativen Aspekten des Krieges ablenken sollte. Dabei war die Medienlandschaft der USA nach dem 11. September 2001 durch weitgehende Konformität geprägt. Kritik am Präsidenten oder an der Regierung wurde häufig als unpatriotisch gewertet. Somit wurde ein idealer Nährboden für Propaganda geschaffen.Der Irak-Krieg 2003 stellt einen politisch gewollten und inszenierten Krieg dar. Im Zuge der Anschuldigungen gegen Saddam Hussein sowie infolge der medialen Inszenierung des Kriegs kristallisierte sich heraus, dass Politik und Militär den Sprung ins moderne Informationszeitalter geschafft haben. Beim modernen Informationskrieg findet der Krieg auf einer weiteren, virtuellen Ebene statt. Information, Nichtinformation und Desinformation sind die effizienten Waffen dieses Krieges. Dabei wird die Desinformation der Öffentlichkeit bewusst in Kauf genommen und JournalistInnen werden als Vermittler politischer Propaganda instrumentalisiert.

  8. Alice Krieg-Planque, Analyser les discours institutionnels

    OpenAIRE

    Simon, Justine

    2012-01-01

    Comment amener des étudiants d’origines disciplinaires diverses à pratiquer l’analyse de discours et à s’en approprier les notions et concepts principaux, au service de l’analyse des productions discursives institutionnelles ? Telle est l’ambition centrale de l’ouvrage d’Alice Krieg-Planque, récemment paru chez Armand Colin. A la fois « guide pour l’analyse » et manuel visant à tisser un ensemble de compétences en matière d’approches discursives pour des étudiants au sein de formations plurid...

  9. [Biosynthesis of gold nanoparticles by Azospirillum brasilense].

    Science.gov (United States)

    Kupriashina, M A; Vetchinkina, E P; Burov, A M; Ponomareva, E G; Nikitina, V E

    2014-01-01

    Plant-associated nitrogen-fixing soil bacteria Azospirillum brasilense were shown to reduce the gold of chloroauric acid to elemental gold, resulting in formation of gold nanoparicles. Extracellular phenoloxidizing enzymes (laccases and Mn peroxidases) were shown to participate in reduction of Au+3 (HAuCl4) to Au(0). Transmission electron microscopy revealed accumulation of colloidal gold nanoparticles of diverse shape in the culture liquid of A. brasilense strains Sp245 and Sp7. The size of the electron-dense nanospheres was 5 to 50 nm, and the size of nanoprisms varied from 5 to 300 nm. The tentative mechanism responsible for formation of gold nanoparticles is discussed. PMID:25423733

  10. Hydrogen oxidation in Azospirillum brasilense

    Energy Technology Data Exchange (ETDEWEB)

    Tibelius, K.

    1984-01-01

    Hydrogen oxidation by Azospirillum brasilense Sp7 was studied in N/sub 2/-fixing and NH/sub 4//sup +/-grown batch cultures. The K/sub m/ for H/sub 2/ of O/sub 2/-dependent H/sup 3/H oxidation in whole cells was 9 uM. The rates of H/sup 3/H and H/sub 2/ oxidation were very similar, indicating that the initial H/sub 2/ activation step in the overall H/sub 2/ oxidation reaction was not rate-limiting and that H/sup 3/H oxidation was a valid measure of H/sub 2/-oxidation activity. Hydrogen-oxidation activity was inhibited irreversibly by air. In N-free cultures the O/sub 2/ optima for O/sub 2/-dependent H/sub 2/ oxidation, ranging from 0.5-1.25% O/sub 2/ depending on the phase of growth, were significantly higher than those of C/sub 2/H/sub 2/ reduction, 0.15-0.35%, suggesting that the H/sub 2/-oxidation system may have a limited ability to aid in the protection of nitrogenase against inactivation by O/sub 2/. Oxygen-dependent H/sub 2/ oxidation was inhibited by NO/sub 2//sup +/, NO, CO, and C/sub 2/H/sub 2/ with apparent K/sub 1/ values of 20, 0.4, 28, and 88 uM, respectively. Hydrogen-oxidation activity was 50 to 100 times higher in denitrifying cultures when the terminal electron acceptor for growth was N/sub 2/O rather than NO/sub 3//sup -/, possibly due to the irreversible inhibition of hydrogenase by NO/sub 2//sup -/ and NO in NO/sub 3//sup -/-grown cultures.

  11. Network Analysis of Plasmidomes: The Azospirillum brasilense Sp245 Case

    OpenAIRE

    Valerio Orlandini; Giovanni Emiliani; Marco Fondi; Isabel Maida; Elena Perrin; Renato Fani

    2014-01-01

    Azospirillum brasilense is a nitrogen-fixing bacterium living in association with plant roots. The genome of the strain Sp245, isolated in Brazil from wheat roots, consists of one chromosome and six plasmids. In this work, the A. brasilense Sp245 plasmids were analyzed in order to shed some light on the evolutionary pathways they followed over time. To this purpose, a similarity network approach was applied in order to identify the evolutionary relationships among all the A. brasilense plasmi...

  12. Biofilm formation by Azospirillum brasilense: microbial socialization in the rhizosphere

    OpenAIRE

    Cerqueira, Francisco Diogo de Almeida, 1990-

    2015-01-01

    Tese de mestrado. Biologia (Microbiologia Aplicada). Universidade de Lisboa, Faculdade de Ciências, 2014 Azospirillum brasilense is a remarkable Plant-Growth Promoting Rhizobacteria (PGPR), with great potential as agricultural inoculant for several crops. Several isolates of this species have been produced as inoculant by some companies and applied in the agriculture as a biofertilizer. Therefore, there is a great interest in gathering more scientific knowledge that improves A. brasilense ...

  13. Review: Larissa Förster, Postkoloniale Erinnerungslandschaften. Wie Deutsche und Herero in Namibia des Kriegs von 1904 gedenken (2010 Buchbesprechung: Larissa Förster, Postkoloniale Erinnerungslandschaften. Wie Deutsche und Herero in Namibia des Kriegs von 1904 gedenken (2010

    Directory of Open Access Journals (Sweden)

    Reinhart Kößler

    2010-01-01

    Full Text Available Review of the Monograph: Larissa Förster (2010, Postkoloniale Erinnerungslandschaften. Wie Deutsche und Herero in Namibia des Kriegs von 1904 gedenken, Frankfurt am Main & New York: Campus, ISBN 978-3-593-39160-1, 391 pages. Besprechung der Monographie: Larissa Förster (2010, Postkoloniale Erinnerungslandschaften. Wie Deutsche und Herero in Namibia des Kriegs von 1904 gedenken, Frankfurt am Main & New York: Campus, ISBN 978-3-593-39160-1, 391 Seiten.

  14. [Jörg Zägel (in Zusammenarbeit mit Reiner Steinweg). Vergangenheitsdiskurse in der Ostseeregion. Bd. 1. Auseinandersetzungen in den nordischen Staaten über Krieg. Völkermord, Diktatur, Besatzung und Vertreibung; B. 2 : Die Sicht auf Krieg, Diktat

    Index Scriptorium Estoniae

    Hecker-Stampehl, Jan

    2011-01-01

    Arvustus : Jörg Zägel (in Zusammenarbeit mit Reiner Steinweg). Vergangenheitsdiskurse in der Ostseeregion. Bd. 1. Auseinandersetzungen in den nordischen Staaten über Krieg. Völkermord, Diktatur, Besatzung und Vertreibung. Berlin : LIT Verlag, 2007. (Kieler Schriften zur Friedenswissenschaft. 14); Bd. 2 : Die Sicht auf Krieg, Diktatur, Völkermord, Besatsung und Vertreibung in Russland, Polen und den baltischen Staaten. Berlin: Lit Verlag, 2007. (Kieler Schriften zur Friedenswissenschaft. 15)

  15. Und es gibt sie doch: Frauen, die Krieg und Frieden theoretisieren

    Directory of Open Access Journals (Sweden)

    Ellen Krause

    2001-11-01

    Full Text Available Sandra Hedinger liest Bertha von Suttner, Rosa Luxemburg, Hannah Arendt, Betty Reardon, Ann J. Tickner und Jean Bethke Elshtain auf Aussagen zum Geschlechterverhältnis, zu Kriegsursachen und zur Kriegsüberwindung. Dabei zeigt sie den engen Zusammenhang dieser Pole im Denken der behandelten Theoretikerinnen. Hedingers Buch ist eine überzeugende Aufforderung an die wissenschaftliche Beschäftigung mit den Internationalen Beziehungen, den herkömmlichen, männlichen Textkorpus um bisher ignorierte Überlegungen und Autorinnen zu erweitern.

  16. "Allso hiebe der innere krieg schon an, der vil Erger dann der eüssere war."

    OpenAIRE

    Demura, Shin

    2008-01-01

    Die Stadt als Zufluchtsort für Flüchtlinge. Erfahrungsformen des Dreißigjährigen Krieges in der Reichsstadt Ulm und ihrer Region. (Dissertationsprojekt, betreut von Prof. Dr. Anton Schindling, Universität Tübingen)

  17. Fructose catabolism in Azospirillum brasilense and Azospirillum lipoferum.

    OpenAIRE

    1984-01-01

    The pathways for catabolism of fructose were investigated in the type strains of Azospirillum lipoferum and Azospirillum brasilense grown aerobically with (NH4)2SO4 as the nitrogen source. When grown on fructose, the former species possessed a complete Entner-Doudoroff pathway, whereas the latter species lacked activity for glucose-6-phosphate dehydrogenase. Both species possessed a complete catabolic Embden-Meyerhof-Parnas pathway. Neither species possessed the key enzyme of the hexose monop...

  18. Temperature inhibition of siderophore production in Azospirillum brasilense.

    OpenAIRE

    Bachhawat, A K; Ghosh, S.

    1989-01-01

    The effect of growth at 42 degrees C on the different components of the siderophore-mediated iron transport that are induced by iron limitation in Azospirillum brasilense was examined. Biosynthesis of the siderophore spirilobactin was strongly inhibited (20-fold) by growth at 42 degrees C, whereas the transport of iron by the ferric-spirilobactin transport system and the induction of the iron-regulated outer membrane proteins were unaffected.

  19. Metabolism of various carbon sources by Azospirillum brasilense.

    OpenAIRE

    Westby, C A; Cutshall, D S; Vigil, G V

    1983-01-01

    Azospirillum brasilense Sp7 and two mutants were examined for 19 carbon metabolism enzymes. The results indicate that this nitrogen fixer uses the Entner-Doudoroff pathway for gluconate dissimilation, lacks a catabolic but has an anabolic Embden-Meyerhof-Parnas hexosephosphate pathway, has amphibolic triosephosphate enzymes, lacks a hexose monophosphate shunt, and has lactate dehydrogenase, malate dehydrogenase, and glycerokinase. The mutants are severely deficient in phosphoglycerate and pyr...

  20. Azospirillum brasilense siderophores with antifungal activity against Colletotrichum acutatum.

    Science.gov (United States)

    Tortora, María L; Díaz-Ricci, Juan C; Pedraza, Raúl O

    2011-04-01

    Anthracnose, caused by the fungus Colletotrichum acutatum is one of the most important diseases in strawberry crop. Due to environmental pollution and resistance produced by chemical fungicides, nowadays biological control is considered a good alternative for crop protection. Among biocontrol agents, there are plant growth-promoting bacteria, such as members of the genus Azospirillum. In this work, we demonstrate that under iron limiting conditions different strains of A. brasilense produce siderophores, exhibiting different yields and rates of production according to their origin. Chemical assays revealed that strains REC2 and REC3 secrete catechol type siderophores, including salicylic acid, detected by thin layer chromatography coupled with fluorescence spectroscopy and gas chromatography-mass spectrometry analysis. Siderophores produced by them showed in vitro antifungal activity against C. acutatum M11. Furthermore, this latter coincided with results obtained from phytopathological tests performed in planta, where a reduction of anthracnose symptoms on strawberry plants previously inoculated with A. brasilense was observed. These outcomes suggest that some strains of A. brasilense could act as biocontrol agent preventing anthracnose disease in strawberry. PMID:21234749

  1. Directed mutagenesis affects recombination in Azospirillum brasilense nif genes

    Directory of Open Access Journals (Sweden)

    C.P. Nunes

    2000-12-01

    Full Text Available In order to improve the gene transfer/mutagenesis system for Azospirillum brasilense, gene-cartridge mutagenesis was used to replace the nifD gene with the Tn5 kanamycin resistance gene. The construct was transferred to A. brasilense by electrotransformation. Of the 12 colonies isolated using the suicide plasmid pSUP202 as vector, only four did not show vector integration into the chromosome. Nevertheless, all 12 colonies were deficient in acetylene reduction, indicating an Nif- phenotype. Four Nif- mutants were analyzed by Southern blot, using six different probes spanning the nif and Km r genes and the plasmid vector. Apparently, several recombination events occurred in the mutant genomes, probably caused mainly by gene disruption owing to the mutagenesis technique used: resistance gene-cartridge mutagenesis combined with electrotransformation.Com o objetivo de melhorar os sistemas de transferência gênica e mutagênese para Azospirillum brasilense, a técnica de mutagênese através do uso de um gene marcador ("gene-cartridge mutagenesis" foi utilizada para substituir a região genômica de A. brasilense correspondente ao gene nifD por um segmento de DNA do transposon Tn5 contendo o gene que confere resistência ao antibiótico canamicina. A construção foi transferida para a linhagem de A. brasilense por eletrotransformação. Doze colônias transformantes foram isoladas com o plasmídeo suicida pSUP202 servindo como vetor. Dessas, somente quatro não possuíam o vetor integrado no cromossomo da bactéria. Independentemente da integração ou não do vetor, as 12 colônias foram deficientes na redução do gás acetileno, evidenciando o fenótipo Nif -. Quatro mutantes Nif - foram analisados através da técnica de Southern blot, utilizando-se seis diferentes fragmentos contendo genes nif, de resistência à canamicina e do vetor como sondas. Os resultados sugerem a ocorrência de eventos recombinacionais variados no genoma dos mutantes. A

  2. Insa Eschebach, Regina Mühlhäuser (Hg.: Krieg und Geschlecht. Sexuelle Gewalt im Krieg und Sex-Zwangsarbeit in NS-Konzentrationslagern. Berlin: Metropol Verlag 2008.

    Directory of Open Access Journals (Sweden)

    Veronika Springmann

    2009-11-01

    Full Text Available In den letzten Jahren sind die Auseinandersetzung mit den Akteuren und Funktionen von Gewalt und auch die Forschungen und Deutungsweisen zu sexueller Gewalt forciert worden. Der Tagungsband versammelt neue Forschungsbeiträge und Interpretationsmuster zu sexueller Gewalt im Krieg und Sex-Zwangsarbeit in NS-Konzentrationslagern, um erstens den aktuellen Stand der Forschung aufzuzeigen und zweitens nach künftigen Perspektiven zu fragen. Die Aufsätze informieren hervorragend über aktuelle Fragen und Debatten zu diesen Themen.In recent years, the conflict with protagonists of and functions of violence has accelerated, as has research on and interpretation of sexual violence. The conference volume collects new contributions to research on and interpretive patterns of sexual violence in war and in sexual forced labor in National Socialist concentration camps, in order first to depict the current state of research and second to look for future perspectives. The brilliant essays inform readers on the current questions and debates on these topics.

  3. 10 Jahre danach: Der Irak-Krieg 2003 und das (Medien- Schlachtfeld I - Der Medien-Golfkrieg im Spannungsfeld zwischen PR und Propaganda

    Directory of Open Access Journals (Sweden)

    Karl Stinged

    2013-03-01

    Full Text Available Hinsichtlich der Informationsstrategie der US-Administration von George W. Bush und des US-Militärs im Zuge des Irak-Krieges 2003, lässt sich eine gut geplante und organisierte PR feststellen. Die eingebetteten Journalisten waren dabei ein wichtiges Mittel zum Zweck. Sie sorgten für eine Bilderhoheit im Krieg. Auch waren sie als Quelle für "unverfängliche Berichte" geplant. Eine vordergründig "neutrale Berichterstattung", die von negativen Aspekten des Krieges ablenken sollte.Die Medienlandschaft der USA nach dem 11. September 2001 war durch eine weitgehende Konformität geprägt. Kritik am Präsidenten oder an der Regierung wurde häufig als unpatriotisch gewertet. Somit wurde ein idealer Nährboden für Propaganda geschaffen. Propaganda ist systematische, persuasive Public Relations, die mit manipulativen Mitteln arbeitet. Die eigentliche politische Agenda, welche von den Propagandisten verfolgt wird, soll verschleiert werden.Der Irak-Krieg 2003 ist ein politisch gewollter und inszenierter Krieg. Im Zuge der Anschuldigungen gegen Saddam Hussein sowie in Folge der medialen Inszenierung des Kriegs, kristallisierte sich heraus, dass Politik und Militär den Sprung ins moderne Informationszeitalter geschafft haben. Beim modernen Informationskrieg findet der Krieg auf einer weiteren, virtuellen Ebene statt. Information, Nichtinformation und Desinformation sind die effizienten Waffen dieses Krieges. Dabei wird die Desinformation der Öffentlichkeit bewusst in Kauf genommen. JournalistInnen werden dabei als Vermittler politischer Propaganda instrumentalisiert.Die amerikanische Bevölkerung wurde durch die gezielte Manipulation der Medien zu einer Pro-Kriegs-Haltung verleitet. Die Behauptungen, die im Zuge der Anschuldigungen gegen das irakische Regime, aufgestellt wurden, erwiesen sich größtenteils als falsch und manipulativ. Die im Zuge der Vorbereitungen sowie während des Irak-Kriegs 2003 verwendete PR-Strategien können daher als

  4. Der allerschönste Krieg : [aus "Kõige ilusam sõda"¡ ("Der allerschönste Krieg")] : [luuletused] / Asko Künnap ; tlk. Irja Grönholm ja Gisbert Jänicke

    Index Scriptorium Estoniae

    Künnap, Asko

    2006-01-01

    Sisu: Der allerschönste Krieg : Ich suchte mein nichtgelebtes Leben ; Wie fühlt sich's Seite an Seite ; So toll, dass wir kommen konnten ; Wie kommt man lebend aus Schweden zurück? ; Im Schlaf vereint ; Ruft die Spinnen - dass sie die Nacht weben ; Du hältst die Welt von mir fern ; Ruder mich zur Insel ; In den Augen des Mädchens aus dem Norden ; Der allerschönste Krieg ; Der Teufel im Sakko zu sechshundert Kronen. Orig.: Kõige ilusam sõda : Otsisin oma elamata jäänud elu ; Kuidas on kõrvuti olla ; Nii tore, et tulla saime ; Kuidas tulla elusana tagasi Rootsist? ; Unes ühes ; Kutsuge ämblikud - las punuvad öö ; Sina hoiad maailma minust ära ; Sõua mind saareni ; Ühe põhjamaa tüdruku silmades ; Kõige ilusam sõda ; Kurat kuuesajakroonises pintsakus

  5. Oxidative and antioxidative responses in the wheat-Azospirillum brasilense interaction.

    Science.gov (United States)

    Méndez-Gómez, Manuel; Castro-Mercado, Elda; Alexandre, Gladys; García-Pineda, Ernesto

    2016-03-01

    Azospirillum is a plant growth-promoting rhizobacteria (PGPR) able to enhance the growth of wheat. The aim of this study was to test the effect of Azospirillum brasilense cell wall components on superoxide (O2·(-)) production in wheat roots and the effect of oxidative stress on A. brasilense viability. We found that inoculation with A. brasilense reduced O2·(-) levels by approx. 30 % in wheat roots. Inoculation of wheat with papain-treated A. brasilense, a Cys protease, notably increased O2·(-) production in all root tissues, as was observed by the nitro blue tetrazolium (NBT) reduction. However, a 24-h treatment with rhizobacteria lipopolysaccharides (50 and 100 μg/mL) alone did not affect the pattern of O2·(-) production. Analysis of the effect of plant cell wall components on A. brasilense oxidative enzyme activity showed no changes in catalase activity but a decrease in superoxide dismutase activity in response to polygalacturonic acid treatment. Furthermore, A. brasilense growth was only affected by high concentrations of H2O2 or paraquat, but not by sodium nitroprusside. Our results suggest that rhizobacterial cell wall components play an important role in controlling plant cell responses and developing tolerance of A. brasilense to oxidative stress produced by the plant. PMID:25952083

  6. Survival of Azospirillum brasilense in the Bulk Soil and Rhizosphere of 23 Soil Types

    OpenAIRE

    Bashan, Y.; Puente, M. E.; Rodriguez-Mendoza, M. N.; Toledo, G.; Holguin, G.; Ferrera-Cerrato, R.; Pedrin, S.

    1995-01-01

    The survival of Azospirillum brasilense Cd and Sp-245 in the rhizosphere of wheat and tomato plants and in 23 types of plant-free sterilized soils obtained from a wide range of environments in Israel and Mexico was evaluated. Large numbers of A. brasilense cells were detected in all the rhizospheres tested, regardless of soil type, bacterial strain, the origin of the soil, or the amount of rainfall each soil type received prior to sampling. Survival of A. brasilense in soils without plants di...

  7. Isolation of behavioral mutants of Azospirillum brasilense by using Tn5 lacZ.

    OpenAIRE

    van Rhijn, P; Vanstockem, M; Vanderleyden, J.; De Mot, R

    1990-01-01

    Tn5 lacZ mutants were generated with Azospirillum brasilense 7030 by mating that strain with Escherichia coli strains carrying suicide plasmid pCIB100 or pCIB110. Kanamycin-resistant Azospirillum colonies were obtained with a maximum frequency of 10(-6) per recipient cell. The potential of Tn5 lacZ for random transposon mutagenesis coupled to transcription analysis in A. brasilense 7030 was demonstrated. Sixty percent of all Kmr A. brasilense 7030 mutants expressed beta-galactosidase activity...

  8. Inoculation of maize with Azospirillum brasilense in the seed furrow

    Directory of Open Access Journals (Sweden)

    Tâmara Prado de Morais

    2016-06-01

    Full Text Available ABSTRACT Several studies addressing the inoculation of cereals with diazotrophic microorganisms can be found in the literature. However, in many experiments, investigators have overlooked the feasibility of applying these microorganisms to the furrow together with the seed, and the effect of bacterial concentration on phytostimulation. The aim of this work was to evaluate the effect of doses of an inoculant based on Azospirillum brasilense, applied to the seed furrow when planting maize, combined with different doses of nitrogen fertiliser. The experiment was carried out in the field, in soil of the cerrado region of Brazil. An experimental design of randomised blocks in bands was adopted, comprising nitrogen (40, 100, 200 and 300 kg ha-1 and doses of an A. brasilense-based liquid inoculant applied to the seed furrow (0, 100, 200, 300 and 400 mL ha-1. The dose of 200 mL ha-1Azospirillum was noteworthy for grain production. This is the first report of the effective application of Azospirillum in the seed furrow when planting maize in the cerrado region of Brazil.

  9. Application of the Indirect Immunoperoxidase Stain Technique to the Flagella of Azospirillum brasilense

    OpenAIRE

    Hall, Patrick G.; Krieg, Noel R.

    1984-01-01

    An indirect immunoperoxidase stain was used to demonstrate by electron microscopy that an antigenic difference exists between the polar flagellum and the lateral flagella of Azospirillum brasilense ATCC 29145.

  10. Metabolic Adaptations of Azospirillum brasilense to Oxygen Stress by Cell-to-Cell Clumping and Flocculation

    OpenAIRE

    Bible, Amber N.; Khalsa-Moyers, Gurusahai K.; Mukherjee, Tanmoy; Green, Calvin S.; Mishra, Priyanka; Purcell, Alicia; Aksenova, Anastasia; Gregory B Hurst; Alexandre, Gladys

    2015-01-01

    The ability of bacteria to monitor their metabolism and adjust their behavior accordingly is critical to maintain competitiveness in the environment. The motile microaerophilic bacterium Azospirillum brasilense navigates oxygen gradients by aerotaxis in order to locate low oxygen concentrations that can support metabolism. When cells are exposed to elevated levels of oxygen in their surroundings, motile A. brasilense cells implement an alternative response to aerotaxis and form transient clum...

  11. Interaction of Azospirillum brasilense and Glomus intrarradix in Sugar Cane Roots

    OpenAIRE

    Bellone, Carlos H.; de Bellone Silvia, Carrizo

    2011-01-01

    Fifteen-day-old variety NA 56-79 sugar cane seedlings were inoculated with Azospirillum brasilense and Glomus intrarradix. This article aims at examining changes in sugar cane root seedlings inoculated with Glomus intrarradix and Azospirillum brasilense, the increase in microbial biomass and the acetylene reduction process as well. The internal root colonization was studied 20 days after inoculation using scanning and a transmission electron microscope. Both microorganisms entered the sugar c...

  12. Enhancement of Wheat Root Colonization and Plant Development by Azospirillum brasilense Cd. Following Temporary Depression of Rhizosphere Microflora

    OpenAIRE

    Bashan, Yoav

    1986-01-01

    Inoculation of wheat with Azospirillum brasilense, combined with the application of four fungal and bacterium-inhibiting substances to which A. brasilense is resistant in the soil, decreased the rhizosphere population, while it increased wheat root colonization by A. brasilense, even in cases of poor inoculation. The inoculation significantly increased the following wheat plant parameters as well: plant dry weight, number of tillers per plant, spikelet fertility, harvest index, and grain yiel...

  13. Purification and binding analysis of the nitrogen fixation regulatory NifA protein from Azospirillum brasilense

    Directory of Open Access Journals (Sweden)

    L.M.P. Passaglia

    1998-11-01

    Full Text Available NifA protein activates transcription of nitrogen fixation operons by the alternative sigma54 holoenzyme form of RNA polymerase. This protein binds to a well-defined upstream activator sequence (UAS located at the -200/-100 position of nif promoters with the consensus motif TGT-N10-ACA. NifA of Azospirillum brasilense was purified in the form of a glutathione-S-transferase (GST-NifA fusion protein and proteolytic release of GST yielded inactive and partially soluble NifA. However, the purified NifA was able to induce the production of specific anti-A. brasilense NifA-antiserum that recognized NifA from A. brasilense but not from K. pneumoniae. Both GST-NifA and NifA expressed from the E. coli tac promoter are able to activate transcription from the nifHDK promoter but only in an A. brasilense background. In order to investigate the mechanism that regulates NifA binding capacity we have used E. coli total protein extracts expressing A. brasilense nifA in mobility shift assays. DNA fragments carrying the two overlapping, wild-type or mutated UAS motifs present in the nifH promoter region revealed a retarded band of related size. These data show that the binding activity present in the C-terminal domain of A. brasilense NifA protein is still functional even in the presence of oxygen.

  14. Eumenes II. als persona non grata: Pergamon, Rom und der 3. Makedonische Krieg

    Directory of Open Access Journals (Sweden)

    Christoph Kenkel

    2012-11-01

    Full Text Available Christoph Kenkel treads on difficult terrain with his Bachelor Thesis Eumenes II als persona non grata: Pergamon, Rom und der 3. Makedonische Krieg ( Eumenes II as persona non grata: Pergamon, Rome and the Third Macedonian War, but manages to develop his own convincing interpretation of a research topic subjected to strong discourse.Starting with the deprecatory demeanor of the Roman Senate towards Eumenes II Sotor (197-159 in 167 B.C., the author begins a search for this unusual rejection, facing the challenge of a confusing array of sources and the many diverging opinions of researchers. Further complications arise from the complex political situation at the eve of the Third Macedonian War that raises a variety of new issues.Nevertheless Kenkel manages to see through the machinations and rumors of Roman politics by applying logical thought, and explains plausibly why Eumenes, who unjustly got caught in the crossfire, has always been an ally of Rome, despite of many contemporary rumors and keen allegations.

  15. Cold War in Southern Africa Kalter Krieg im Südlichen Afrika

    Directory of Open Access Journals (Sweden)

    Matthew Graham

    2010-01-01

    Full Text Available Review Article: Cold War in Southern Africa Gary Baines, Peter Vale (eds. (2008, Beyond the Border War: New Perspectives on Southern Africa’s Late-Cold War Conflicts, Pretoria: Unisa Press, ISBN 978 1 86888 456 8, xix + 342 pp. Sue Onslow (ed. (2009, Cold War in Southern Africa: White Power, Black Liberation, Abingdon: Routledge, ISBN 978 0 415 47420 7, 253 pp. Vladimir Shubin (2008, The Hot “Cold War”: The USSR in Southern Africa, London: Pluto Press, ISBN 978 0745324722, 320 pp. Review Article: Kalter Krieg im Südlichen Afrika Gary Baines, Peter Vale (eds. (2008, Beyond the Border War: New Perspectives on Southern Africa’s Late-Cold War Conflicts, Pretoria: Unisa Press, ISBN 978 1 86888 456 8, xix + 342 S. Sue Onslow (ed. (2009, Cold War in Southern Africa: White Power, Black Liberation, Abingdon: Routledge, ISBN 978 0 415 47420 7, 253 S. Vladimir Shubin (2008, The Hot “Cold War”: The USSR in Southern Africa, London: Pluto Press, ISBN 978 0745324722, 320 S.

  16. Accessing inoculation methods of maize and wheat with Azospirillum brasilense.

    Science.gov (United States)

    Fukami, Josiane; Nogueira, Marco Antonio; Araujo, Ricardo Silva; Hungria, Mariangela

    2016-03-01

    The utilization of inoculants containing Azospirillum is becoming more popular due to increasing reports of expressive gains in grain yields. However, incompatibility with pesticides used in seed treatments represents a main limitation for a successful inoculation. Therefore, in this study we searched for alternatives methods for seed inoculation of maize and wheat, aiming to avoid the direct contact of bacteria with pesticides. Different doses of inoculants containing Azospirillum brasilense were employed to perform inoculation in-furrow, via soil spray at sowing and via leaf spray after seedlings had emerged, in comparison to seed inoculation. Experiments were conducted first under greenhouse controlled conditions and then confirmed in the field at different locations in Brazil. In the greenhouse, most parameters measured responded positively to the largest inoculant dose used in foliar sprays, but benefits could also be observed from both in-furrow and soil spray inoculation. However, our results present evidence that field inoculation with plant-growth promoting bacteria must consider inoculant doses, and point to the need of fine adjustments to avoid crossing the threshold of growth stimulation and inhibition. All inoculation techniques increased the abundance of diazotrophic bacteria in plant tissues, and foliar spray improved colonization of leaves, while soil inoculations favored root and rhizosphere colonization. In field experiments, inoculation with A. brasilense allowed for a 25 % reduction in the need for N fertilizers. Our results have identified alternative methods of inoculation that were as effective as the standard seed inoculation that may represent an important strategy to avoid the incompatibility between inoculant bacteria and pesticides employed for seed treatment. PMID:26759120

  17. Israelkritik und Antisemitismus? Eine vergleichende Analyse der deutschen Presseberichterstattung über 2. Intifada und Gaza-Krieg

    Directory of Open Access Journals (Sweden)

    Markus Maurer

    2011-10-01

    Full Text Available Die deutsche Medienberichterstattung über den Nahost-Konflikt wurde verschiedentlich dahingehend kritisiert, einen anti-israelische Bias zu haben, der die alten, gebräuchlichen Vorurteile und Stereotype gegenüber Juden stärke und die Anschuldigung unterstütze, die Juden würden die Tragik des Holocaust missbrauchen um die israelische Palästina-Politik zu rechtfertigen: Insbesondere während des Gaza-Krieges sei Israel als Aggressor dargestellt, der palästinensische Terrorismus dagegen heruntergespielt worden. Bisher gibt es kaum systematische Forschung zu dieser Frage. Die vorliegende Studie soll diese Lücke zu füllen helfen, indem sie eine vergleichende Inhaltsanalyse der Berichterstattung über die 2. Intifada und den Gaza-Krieg in Die Welt, Frankfurter Allgemeine Zeitung, Süddeutsche Zeitung, Frankfurter Rundschau und Tageszeitung vornimmt. Eine repräsentative Stichprobe von 396 Artikeln aus diesen Zeitungen, die das gesamte politische Spektrum von rechts nach links abdecken, wurde entlang der drei Dimensionen (1 Darstellung des Verhaltens der Konfliktparteien, (2 Bewertung ihrer Intentionen und Handlungen, und (3 Interpunktion des Konfliktes & Darstellung seiner Opfer analysiert. Die Ergebnisse der Studie zeigen, dass die Darstellung beider Konflikte weit differenzierter war als von ihren Kritikern angenommen. Auch während des Gaza-Krieges hat die deutsche Qualitätspresse ihr Bestes getan, sich nicht auf die Seite der Palästinenser zu schlagen. Falls sie tatsächlich zur Stärkung anti-israelischer oder sogar antisemitischer Einstellungen beigetragen hat, so war dies eher der Erzeugung von Reaktanz geschuldet als einem anti-israelischen Bias der Berichterstattung.

  18. Analyser les discours institutionnels, Alice Krieg-Planque, série Discours et Communication, Armand Colin, 2012

    OpenAIRE

    Hutin, Séverine Equoy; Schepens, Philippe

    2015-01-01

    L’ouvrage d’Alice Krieg-Planque s’adresse initialement aux étudiants en sciences humaines et sociales (journalisme, management, communication, gestion, sociologie, sciences de l’éducation, histoire…) qui sont confrontés à des objets discursifs institutionnels. L’auteure vise à rassembler et à expliciter des savoir-faire en analyse du discours, retrouvant et développant un geste déjà amorcé dans une contribution de 2007 . Le cadre d’analyse mobilisé, l’analyse du discours, repose sur la lingui...

  19. [Biofilm Formation by the Nonflagellated flhB1 Mutant of Azospirillum brasilense Sp245].

    Science.gov (United States)

    Shelud'ko, A V; Filip'echeva, Yu A; Shumiliva, E M; Khlebtsov, B N; Burov, A M; Petrova, L P; Katsy, E I

    2015-01-01

    Azospirillum brasilense Sp245 with mixed flagellation are able to form biofilms on various surfaces. A nonflagellated mutant of this strain with inactivated chromosomal copy of the flhB gene (flhB1) was shown to exhibit specific traits at the later stages of biofilm formation on a hydrophilic (glass) surface. Mature biofilms of the flhB1::Omegon-Km mutant Sp245.1063 were considerably thinner than those of the parent strain Sp245. The biofilms of the mutant were more susceptible to the forces of hydrodynamic shear. A. brasilense Sp245 cells in biofilms were not found to possess lateral flagella. Cells with polar flagella were, however, revealed by atomic force microscopy of mature native biofilms of strain Sp245. Preservation of a polar flagellum (probably nonmotile) on the cells of A. brasilense Sp245 may enhance the biofilm stability. PMID:26263623

  20. Quantification of Azospirillum brasilense FP2 Bacteria in Wheat Roots by Strain-Specific Quantitative PCR.

    Science.gov (United States)

    Stets, Maria Isabel; Alqueres, Sylvia Maria Campbell; Souza, Emanuel Maltempi; Pedrosa, Fábio de Oliveira; Schmid, Michael; Hartmann, Anton; Cruz, Leonardo Magalhães

    2015-10-01

    Azospirillum is a rhizobacterial genus containing plant growth-promoting species associated with different crops worldwide. Azospirillum brasilense strains exhibit a growth-promoting effect by means of phytohormone production and possibly by N2 fixation. However, one of the most important factors for achieving an increase in crop yield by plant growth-promoting rhizobacteria is the survival of the inoculant in the rhizosphere, which is not always achieved. The objective of this study was to develop quantitative PCR protocols for the strain-specific quantification of A. brasilense FP2. A novel approach was applied to identify strain-specific DNA sequences based on a comparison of the genomic sequences within the same species. The draft genome sequences of A. brasilense FP2 and Sp245 were aligned, and FP2-specific regions were filtered and checked for other possible matches in public databases. Strain-specific regions were then selected to design and evaluate strain-specific primer pairs. The primer pairs AzoR2.1, AzoR2.2, AzoR5.1, AzoR5.2, and AzoR5.3 were specific for the A. brasilense FP2 strain. These primer pairs were used to monitor quantitatively the population of A. brasilense in wheat roots under sterile and nonsterile growth conditions. In addition, coinoculations with other plant growth-promoting bacteria in wheat were performed under nonsterile conditions. The results showed that A. brasilense FP2 inoculated into wheat roots is highly competitive and achieves high cell numbers (∼10(7) CFU/g [fresh weight] of root) in the rhizosphere even under nonsterile conditions and when coinoculated with other rhizobacteria, maintaining the population at rather stable levels for at least up to 13 days after inoculation. The strategy used here can be applied to other organisms whose genome sequences are available. PMID:26187960

  1. Regulation of fructose uptake and catabolism by succinate in Azospirillum brasilense.

    OpenAIRE

    Mukherjee, A; S. Ghosh

    1987-01-01

    Fructose uptake and catabolism in Azospirillum brasilense is dependent on three fructose-inducible enzymes (fru-enzymes): (i) enzyme I and (ii) enzyme II of the phosphoenolpyruvate:fructose phosphotransferase system and (iii) 1-phosphofructokinase. In minimal medium containing 3.7 mM succinate and 22 mM fructose as sources of carbon, growth of A. brasilense was diauxic, succinate being utilized in the first phase of growth and fructose in the second phase with a lag period between the two gro...

  2. Structure of the polysaccharides from the lipopolysaccharide of Azospirillum brasilense Jm125A2.

    Science.gov (United States)

    Sigida, Elena N; Fedonenko, Yuliya P; Shashkov, Alexander S; Zdorovenko, Evelina L; Konnova, Svetlana A; Ignatov, Vladimir V; Knirel, Yuriy A

    2015-10-30

    Two polysaccharides were obtained by mild acid degradation of the lipopolysaccharide of associative nitrogen-fixing bacteria Azospirillum brasilense Jm125A2 isolated from the rhizosphere of a pearl millet. The following structures of the polysaccharides were established by sugar and methylation analyses, Smith degradation, and (1)H and (13)C NMR spectroscopy: [Formula: see text] Structure 1 has been reported earlier for a polysaccharide from A. brasilense S17 (Fedonenko YP, Konnova ON, Zdorovenko EL, Konnova SA, Zatonsky GV, Shaskov AS, Ignatov VV, Knirel YA. Carbohydr Res 2008;343:810-6), whereas to our knowledge structure 2 has not been hitherto found in bacterial polysaccharides. PMID:26343325

  3. Repressor Mutant Forms of the Azospirillum brasilense NtrC Protein

    OpenAIRE

    Huergo, Luciano F.; Assumpção, Marcelo C.; Emanuel M. Souza; Steffens, M. Berenice R.; Yates, M. Geoffrey; Chubatsu, Leda S; Pedrosa, Fábio O.

    2004-01-01

    The Azospirillum brasilense mutant strains FP8 and FP9, after treatment with nitrosoguanidine, showed a null Nif phenotype and were unable to use nitrate as their sole nitrogen source. Sequencing of the ntrC genes revealed single nucleotide mutations in the NtrC nucleotide-binding site. The phenotypes of these strains are discussed in relation to their genotypes.

  4. Complete Genome Sequence of the Model Rhizosphere Strain Azospirillum brasilense Az39, Successfully Applied in Agriculture.

    Science.gov (United States)

    Rivera, Diego; Revale, Santiago; Molina, Romina; Gualpa, José; Puente, Mariana; Maroniche, Guillermo; Paris, Gastón; Baker, David; Clavijo, Bernardo; McLay, Kirsten; Spaepen, Stijn; Perticari, Alejandro; Vazquez, Martín; Wisniewski-Dyé, Florence; Watkins, Chris; Martínez-Abarca, Francisco; Vanderleyden, Jos; Cassán, Fabricio

    2014-01-01

    We present the complete genome sequence of Azospirillum brasilense Az39, isolated from wheat roots in the central region of Argentina and used as inoculant in extensive and intensive agriculture during the last four decades. The genome consists of 7.39 Mb, distributed in six replicons: one chromosome, three chromids, and two plasmids. PMID:25059863

  5. Control of Nitrogenase Reactivation by the GlnZ Protein in Azospirillum brasilense

    OpenAIRE

    Klassen, Giseli; Emanuel M. Souza; Yates, M. Geoffrey; Rigo, Liu Un; Inaba, Juliana; de Oliveira Pedrosa, Fábio

    2001-01-01

    The glnZ mutant of Azospirillum brasilense (strain 7611) showed only partial recovery (20 to 40%) after 80 min of ammonia-induced nitrogenase switch-off, whereas the wild type recovered totally within 10 min. In contrast, the two strains showed identical anoxic-induced switch-on/switch-off, indicating no cross talk between the two reactivation mechanisms.

  6. Residual effect of nitrogen fertilization and Azospirillum brasilense inoculation in the maize culture
    Efeito residual da adubação nitrogenada e inoculação de Azospirillum brasilense na cultura do milho

    OpenAIRE

    Jackson Huzar Novakowiski; Aníbal de Moraes; Margarete Kimie Falbo; Itacir Eloi Sandini; Jaqueline Huzar Novakowiski; Nicole Colombari Cheng

    2011-01-01

    The diazotrophic bacteria Azospirillum brasilense is an organism able to fix nitrogen of atmosphere and produce plant hormones. Nevertheless, there is lack of information with regard to use in field conditions, especially in production systems that have presence of animals in a determined year period. The objective of paper was to evaluate the association of the nitrogen residual effect of fertilization in pasture winter and the inoculation with A. brasilense in the maize culture. Were carrie...

  7. Analysis of Indole-3-Acetic Acid and Related Indoles in Culture Medium from Azospirillum lipoferum and Azospirillum brasilense

    OpenAIRE

    Crozier, Alan; Arruda, Paulo; Janie M Jasmim; Monteiro, Ana Maria; Sandberg, Göran

    1988-01-01

    Analysis of neutral and acidic ethyl acetate extracts from culture medium of Azospirillum brasilense 703Ebc by high-performance liquid chromatography (HPLC) and combined gas chromatography-mass spectrometry demonstrated the presence of indole-3-acetic acid (IAA), indole-3-ethanol, indole-3-methanol, and indole-3-lactic acid. IAA in media of 20 strains of A. brasilense and Azospirillum lipoferum was analyzed quantitatively by both the colorimetric Salkowski assay and HPLC-based isotopic diluti...

  8. Tryptophan, thiamine and indole-3-acetic acid exchange between Chlorella sorokiniana and the plant growth-promoting bacterium Azospirillum brasilense.

    Science.gov (United States)

    Palacios, Oskar A; Gomez-Anduro, Gracia; Bashan, Yoav; de-Bashan, Luz E

    2016-06-01

    During synthetic mutualistic interactions between the microalga Chlorella sorokiniana and the plant growth-promoting bacterium (PGPB) Azospirillum brasilense, mutual exchange of resources involved in producing and releasing the phytohormone indole-3-acetic acid (IAA) by the bacterium, using tryptophan and thiamine released by the microalga, were measured. Although increased activities of tryptophan synthase in C. sorokiniana and indole pyruvate decarboxylase (IPDC) in A. brasilense were observed, we could not detect tryptophan or IAA in the culture medium when both organisms were co-immobilized. This indicates that no extra tryptophan or IAA is produced, apart from the quantities required to sustain the interaction. Over-expression of the ipdC gene occurs at different incubation times: after 48 h, when A. brasilense was immobilized alone and grown in exudates of C. sorokiniana and at 96 h, when A. brasilense was co-immobilized with the microalga. When A. brasilense was cultured in exudates of C. sorokiniana, increased expression of the ipdC gene, corresponding increase in activity of IPDC encoded by the ipdC gene, and increase in IAA production were measured during the first 48 h of incubation. IAA production and release by A. brasilense was found only when tryptophan and thiamine were present in a synthetic growth medium (SGM). The absence of thiamine in SGM yielded no detectable IAA. In summary, this study demonstrates that C. sorokiniana can exude sufficient tryptophan and thiamine to allow IAA production by a PGPB during their interaction. Thiamine is essential for IAA production by A. brasilense and these three metabolites are part of a communication between the two microorganisms. PMID:27090758

  9. Identification of a phosphoenolpyruvate:fructose 1-phosphotransferase system in Azospirillum brasilense.

    OpenAIRE

    Gupta, K. D.; S. Ghosh

    1984-01-01

    An inducible phosphoenolpyruvate:fructose phosphotransferase system has been detected in Azospirillum brasilense, which requires a minimum of two components of the crude extracts for activity: (i) a soluble fraction (enzyme I) and (ii) a membrane fraction (enzyme II). The uninduced cells neither show any uptake of fructose nor express activity of either of these two enzyme fractions. C-1 of fructose is the site of phosphorylation. This phosphotransferase system does not accept glucose as a su...

  10. Growth and yield of corn hybrids in response to association with Azospirillum brasilense and nitrogen fertilization

    OpenAIRE

    2015-01-01

    There is a growing interest in optimizing the positive effects of the association between Azospirillum bacteria and corn crop in order to reduce the use of nitrogen fertilizers. This study aimed to evaluate the inoculation efficiency of an A. brasilense-based commercial product in association with different rates of nitrogen fertilization in two corn genotypes. The experiment was arranged in a 2 x 2 x 5 factorial randomized block design, with four replications. The treatments consisted of two...

  11. Regulatory mutation that controls nif expression and histidine transport in Azospirillum brasilense.

    OpenAIRE

    Fischer, M.; Levy, E; Geller, T

    1986-01-01

    Mutagenesis of Azospirillum brasilense with nitrosoguanidine and selection on ethylenediamine yielded prototrophs which fixed nitrogen in the presence of ammonia. Nitrogenase activity in mutant strains exceeded that of the wild type three- to sixfold. The same mutants were also constitutive for histidine transport. Enzyme activities involved in ammonia assimilation were not affected by the mutation. The data suggest that the mutation occurred at a site which regulates nif and histidine transp...

  12. Fourier transform infrared spectroscopic study of intact cells of the nitrogen-fixing bacterium Azospirillum brasilense

    Science.gov (United States)

    Kamnev, A. A.; Ristić, M.; Antonyuk, L. P.; Chernyshev, A. V.; Ignatov, V. V.

    1997-06-01

    The data of Fourier transform infrared (FTIR) spectroscopic measurements performed on intact cells of the soil nitrogen-fixing bacterium Azospirillum brasilense grown in a standard medium and under the conditions of an increased metal uptake are compared and discussed. The structural FTIR information obtained is considered together with atomic absorption spectrometry (AAS) data on the content of metal cations in the bacterial cells. Some methodological aspects concerning preparation of bacterial cell samples for FTIR measurements are also discussed.

  13. Cloning and expression in Escherichia coli of the Azospirillum brasilense Sp7 gene encoding ampicillin resistance.

    OpenAIRE

    Verreth, C; Cammue, B; Swinnen, P; Crombez, D; Michielsen, A; Michiels, K.; Gool, A. van; Vanderleyden, J.

    1989-01-01

    The Azospirillum brasilense ATCC 29145 gene coding for beta-lactamase was cloned in Escherichia coli. The gene was expressed in E. coli from its own promoter as a 30-kilodalton protein, conferring resistance to high levels of beta-lactam antibiotics. The DNA sequence containing the beta-lactamase gene was found to be highly amplified in the Azospirillum genome, scattered in the chromosomal as well as in the plasmidic DNA.

  14. Mutational analysis of GlnB residues critical for NifA activation in Azospirillum brasilense.

    Science.gov (United States)

    Inaba, Juliana; Thornton, Jeremy; Huergo, Luciano Fernandes; Monteiro, Rose Adele; Klassen, Giseli; Pedrosa, Fábio de Oliveira; Merrick, Mike; de Souza, Emanuel Maltempi

    2015-02-01

    PII proteins are signal transduction that sense cellular nitrogen status and relay this signals to other targets. Azospirillum brasilense is a nitrogen fixing bacterium, which associates with grasses and cereals promoting beneficial effects on plant growth and crop yields. A. brasilense contains two PII encoding genes, named glnB and glnZ. In this paper, glnB was mutagenised in order to identify amino acid residues involved in GlnB signaling. Two variants were obtained by random mutagenesis, GlnBL13P and GlnBV100A and a site directed mutant, GlnBY51F, was obtained. Their ability to complement nitrogenase activity of glnB mutant strains of A. brasilense were determined. The variant proteins were also overexpressed in Escherichia coli, purified and characterized biochemically. None of the GlnB variant forms was able to restore nitrogenase activity in glnB mutant strains of A. brasilense LFH3 and 7628. The purified GlnBY51F and GlnBL13P proteins could not be uridylylated by GlnD, whereas GlnBV100A was uridylylated but at only 20% of the rate for wild type GlnB. Biochemical and computational analyses suggest that residue Leu13, located in the α helix 1 of GlnB, is important to maintain GlnB trimeric structure and function. The substitution V100A led to a lower affinity for ATP binding. Together the results suggest that NifA activation requires uridylylated GlnB bound to ATP. PMID:25644954

  15. Cellular Responses during Morphological Transformation in Azospirillum brasilense and Its flcA Knockout Mutant

    OpenAIRE

    Hou, Xingsheng; McMillan, Mary; Joëlle V. F. Coumans; Poljak, Anne; Raftery, Mark J.; Pereg, Lily

    2014-01-01

    FlcA is a response regulator controlling flocculation and the morphological transformation of Azospirillum cells from vegetative to cyst-like forms. To understand the cellular responses of Azospirillum to conditions that cause morphological transformation, proteins differentially expressed under flocculation conditions in A. brasilense Sp7 and its flcA knockout mutant were investigated. Comparison of 2-DE protein profiles of wild-type (Sp7) and a flcA deletion mutant (Sp7-flcAΔ) revealed a to...

  16. Metabolic Adaptations of Azospirillum brasilense to Oxygen Stress by Cell-to-Cell Clumping and Flocculation

    Science.gov (United States)

    Bible, Amber N.; Khalsa-Moyers, Gurusahai K.; Mukherjee, Tanmoy; Green, Calvin S.; Mishra, Priyanka; Purcell, Alicia; Aksenova, Anastasia; Hurst, Gregory B.

    2015-01-01

    The ability of bacteria to monitor their metabolism and adjust their behavior accordingly is critical to maintain competitiveness in the environment. The motile microaerophilic bacterium Azospirillum brasilense navigates oxygen gradients by aerotaxis in order to locate low oxygen concentrations that can support metabolism. When cells are exposed to elevated levels of oxygen in their surroundings, motile A. brasilense cells implement an alternative response to aerotaxis and form transient clumps by cell-to-cell interactions. Clumping was suggested to represent a behavior protecting motile cells from transiently elevated levels of aeration. Using the proteomics of wild-type and mutant strains affected in the extent of their clumping abilities, we show that cell-to-cell clumping represents a metabolic scavenging strategy that likely prepares the cells for further metabolic stresses. Analysis of mutants affected in carbon or nitrogen metabolism confirmed this assumption. The metabolic changes experienced as clumping progresses prime cells for flocculation, a morphological and metabolic shift of cells triggered under elevated-aeration conditions and nitrogen limitation. The analysis of various mutants during clumping and flocculation characterized an ordered set of changes in cell envelope properties accompanying the metabolic changes. These data also identify clumping and early flocculation to be behaviors compatible with the expression of nitrogen fixation genes, despite the elevated-aeration conditions. Cell-to-cell clumping may thus license diazotrophy to microaerophilic A. brasilense cells under elevated oxygen conditions and prime them for long-term survival via flocculation if metabolic stress persists. PMID:26407887

  17. [Localization of denitrification genes in plasmid DNA of bacteria Azospirillum brasilense].

    Science.gov (United States)

    Petrova, L P; Varshalomidze, O É; Shelud'ko, A V; Katsy, E I

    2010-07-01

    In 85-Mda plasmid (p85) of plant-associated bacteria Azospirillum brasilense Sp245 model strain, the genes encoding copper-containing nitrite reductase (nirK); heterodimeric NO-reductase (norCB); NorQ and NorD proteins affecting synthesis and (or) activation of NirK and (or) NO-reductase (norQD); catalytic subunit I ofcytochrom c oxidase (CccoN); presumable NO sensor carrying two hemeerythrine domains (orf181); and an enzyme required for synthesis of presumable NO antagonist, homocystein (metC) were identified. In the same region of p85, orf293 encoding transcriptional regulator of LysR type, orf208 whose protein product carries a formylmethanofuran dehydrogenase subunit E domain, and an orf164-encoding conservative secretory protein with unknown function were also found. Localization of a set of denitrification genes in the plasmid DNA A. brasilense Sp245 adjacent to IS elements ISAzba1 and ISAzba2 indicates potential mobility of these genes and high probability of their horizontal transfer among populations of rhizospheric bacteria. A site homologous to p85 nirK-orf208-orf181 genes was detected in the 115 kb plasmid of A. brasilense Sp7 type strain. PMID:20795494

  18. Sequencing and complementation analysis of the nifUSV genes from Azospirillum brasilense.

    Science.gov (United States)

    Frazzon, J; Schrank, I S

    1998-02-15

    The functionality of nitrogenase in diazotrophic bacteria is dependent upon nif genes other than the structural nifH, D, and K genes which encode the enzyme subunit proteins. Such genes are involved in the activation of nif gene expression, maturation of subunit proteins, cofactor biosynthesis, and electron transport. In this work, approximately 5500 base pairs located within the major nif gene cluster of Azospirillum brasilense Sp7 have been sequenced. The deduced open reading frames were compared to the nif gene products of Azotobacter vinelandii and other diazotrophs. This analysis indicates the presence of five ORFs encoding ORF2, nifU, nifS, nifV, and ORF4 in the same sequential organization as found in other organisms. Consensus sigma 54 and NifA binding sites are present in the putative promoter region upstream of ORF2 in the A. brasilense sequence. The nifV gene of A. brasilense but not nifU or nifS complemented corresponding mutants strains of A. vinelandii. PMID:9503607

  19. Reduction of selenite by Azospirillum brasilense with the formation of selenium nanoparticles.

    Science.gov (United States)

    Tugarova, Anna V; Vetchinkina, Elena P; Loshchinina, Ekaterina A; Burov, Andrei M; Nikitina, Valentina E; Kamnev, Alexander A

    2014-10-01

    The ability to reduce selenite (SeO(3)(2-)) ions with the formation of selenium nanoparticles was demonstrated in Azospirillum brasilense for the first time. The influence of selenite ions on the growth of A. brasilense Sp7 and Sp245, two widely studied wild-type strains, was investigated. Growth of cultures on both liquid and solid (2 % agar) media in the presence of SeO(3)(2-) was found to be accompanied by the appearance of the typical red colouration. By means of transmission electron microscopy (TEM), electron energy loss spectroscopy (EELS) and X-ray fluorescence analysis (XFA), intracellular accumulation of elementary selenium in the form of nanoparticles (50 to 400 nm in diameter) was demonstrated for both strains. The proposed mechanism of selenite-to-selenium (0) reduction could involve SeO(3)(2-) in the denitrification process, which has been well studied in azospirilla, rather than a selenite detoxification strategy. The results obtained point to the possibility of using Azospirillum strains as endophytic or rhizospheric bacteria to assist phytoremediation of, and cereal cultivation on, selenium-contaminated soils. The ability of A. brasilense to synthesise selenium nanoparticles may be of interest to nanobiotechnology for "green synthesis" of bioavailable amorphous red selenium nanostructures. PMID:24863127

  20. Growth and yield of corn hybrids in response to association with Azospirillum brasilense and nitrogen fertilization

    Directory of Open Access Journals (Sweden)

    Deniele Marini

    2015-02-01

    Full Text Available There is a growing interest in optimizing the positive effects of the association between Azospirillum bacteria and corn crop in order to reduce the use of nitrogen fertilizers. This study aimed to evaluate the inoculation efficiency of an A. brasilense-based commercial product in association with different rates of nitrogen fertilization in two corn genotypes. The experiment was arranged in a 2 x 2 x 5 factorial randomized block design, with four replications. The treatments consisted of two corn hybrids (30F53 and CD386; with and without inoculation with a commercial product based on A. brasilense and five nitrogen rates (0, 40, 80, 120 and 160 kg ha-1. The variables plant height, basal stem diameter, leaf area, shoot dry matter, leaf nitrogen content, length and diameter of the cob, weight of 100 grains and grain yield were evaluated. Inoculation with A. brasilense provided increases of 11 and 12% in leaf area and shoot dry matter, respectively. There were differences in the response of the corn hybrids for most variables and the increase in nitrogen supply provided increments in the growth and yield of corn.

  1. Metabolic adaptations of Azospirillum brasilense to oxygen stress by cell-to-cell clumping and flocculation.

    Science.gov (United States)

    Bible, Amber N; Khalsa-Moyers, Gurusahai K; Mukherjee, Tanmoy; Green, Calvin S; Mishra, Priyanka; Purcell, Alicia; Aksenova, Anastasia; Hurst, Gregory B; Alexandre, Gladys

    2015-12-01

    The ability of bacteria to monitor their metabolism and adjust their behavior accordingly is critical to maintain competitiveness in the environment. The motile microaerophilic bacterium Azospirillum brasilense navigates oxygen gradients by aerotaxis in order to locate low oxygen concentrations that can support metabolism. When cells are exposed to elevated levels of oxygen in their surroundings, motile A. brasilense cells implement an alternative response to aerotaxis and form transient clumps by cell-to-cell interactions. Clumping was suggested to represent a behavior protecting motile cells from transiently elevated levels of aeration. Using the proteomics of wild-type and mutant strains affected in the extent of their clumping abilities, we show that cell-to-cell clumping represents a metabolic scavenging strategy that likely prepares the cells for further metabolic stresses. Analysis of mutants affected in carbon or nitrogen metabolism confirmed this assumption. The metabolic changes experienced as clumping progresses prime cells for flocculation, a morphological and metabolic shift of cells triggered under elevated-aeration conditions and nitrogen limitation. The analysis of various mutants during clumping and flocculation characterized an ordered set of changes in cell envelope properties accompanying the metabolic changes. These data also identify clumping and early flocculation to be behaviors compatible with the expression of nitrogen fixation genes, despite the elevated-aeration conditions. Cell-to-cell clumping may thus license diazotrophy to microaerophilic A. brasilense cells under elevated oxygen conditions and prime them for long-term survival via flocculation if metabolic stress persists. PMID:26407887

  2. Azospirillum brasilense ameliorates the response of Arabidopsis thaliana to drought mainly via enhancement of ABA levels.

    Science.gov (United States)

    Cohen, Ana C; Bottini, Rubén; Pontin, Mariela; Berli, Federico J; Moreno, Daniela; Boccanlandro, Hernán; Travaglia, Claudia N; Piccoli, Patricia N

    2015-01-01

    Production of phytohormones is one of the main mechanisms to explain the beneficial effects of plant growth-promoting rhizobacteria (PGPR) such as Azospirillum sp. The PGPRs induce plant growth and development, and reduce stress susceptibility. However, little is known regarding the stress-related phytohormone abscisic acid (ABA) produced by bacteria. We investigated the effects of Azospirillum brasilense Sp 245 strain on Arabidopsis thaliana Col-0 and aba2-1 mutant plants, evaluating the morphophysiological and biochemical responses when watered and in drought. We used an in vitro-grown system to study changes in the root volume and architecture after inoculation with Azospirillum in Arabidopsis wild-type Col-0 and on the mutant aba2-1, during early growth. To examine Arabidopsis development and reproductive success as affected by the bacteria, ABA and drought, a pot experiment using Arabidopsis Col-0 plants was also carried out. Azospirillum brasilense augmented plant biomass, altered root architecture by increasing lateral roots number, stimulated photosynthetic and photoprotective pigments and retarded water loss in correlation with incremented ABA levels. As well, inoculation improved plants seed yield, plants survival, proline levels and relative leaf water content; it also decreased stomatal conductance, malondialdehyde and relative soil water content in plants submitted to drought. Arabidopsis inoculation with A. brasilense improved plants performance, especially in drought. PMID:24796562

  3. [Determination of Azospirillum Brasilense Cells With Bacteriophages via Electrooptical Analysis of Microbial Suspensions].

    Science.gov (United States)

    Gulii, O I; Karavayeva, O A; Pavlii, S A; Sokolov, O I; Bunin, V D; Ignatov, O V

    2015-01-01

    The dependence-of changes in the electrooptical properties of Azospirillum brasilense cell suspension Sp7 during interaction with bacteriophage ΦAb-Sp7 on the number and time of interactions was studied. Incubation of cells with bacteriophage significantly changed the electrooptical signal within one minute. The selective effect of bacteriophage ΦAb on 18 strains of bacteria of the genus Azospirillum was studied: A. amazonense Ami4, A. brasilense Sp7, Cd, Sp107, Sp245, Jm6B2, Brl4, KR77, S17, S27, SR55, SR75, A. halopraeferans Au4, A. irakense KBC1, K A3, A. lipoferum Sp59b, SR65 and RG20a. We determined the limit of reliable determination of microbial cells infected with bacteriophage: - 10(4) cells/mL. The presence of foreign cell cultures of E. coli B-878 and E. coli XL-1 did not complicate the detection of A brasilense Sp7 cells with the use of bacteriophage ΦAb-Sp7. The results demonstrated that bacteriophage (ΦAb-Sp7 can be used for the detection of Azospirillum microbial cells via t electrooptical analysis of cell suspensions. PMID:26204775

  4. Nitrogen uptake by Azospirillum brasilense inoculated barley (Hordeum vulgare L.) as influenced by N and P fertilization

    International Nuclear Information System (INIS)

    Response of barley (Hordeum vulgare L.) in a sandy-loam soil under potted conditions revealed that application of nitrogen and phosphorus increased the population of Azospirillium in the barley rhizosphere. A two fold increase was observed in the Azospirillium population at 80 days compared to that at 40 days of plant growth. The unsterilized inoculated roots had more population than the surface sterilized inoculated roots. Increased drymatter production of barley was obtained in A. brasilense inoculated N0P1 (0 kg N and 30 kg P2O5 ha-1) treatment than uninoculated control. Also N and P uptake was higher in A. brasilense inoculated plants in the presence of both N and P fertilizers. The 15N data revealed that at harvest nearly 36 per cent of the total N uptake was from the nitrogen fixed by A. brasilense irrespective of P treatment. (author). 16 refs., 4 tabs

  5. Co{sup 2 + } interaction with Azospirillum brasilense Sp7 cells: a {sup 57}Co emission Moessbauer spectroscopic study

    Energy Technology Data Exchange (ETDEWEB)

    Kamnev, Alexander A.; Tugarova, Anna V. [Russian Academy of Sciences, Institute of Biochemistry and Physiology of Plants and Microorganisms (Russian Federation); Biro, Borbala [Hungarian Academy of Sciences, Research Institute for Soil Science and Agricultural Chemistry (Hungary); Kovacs, Krisztina, E-mail: kkriszti@chem.elte.hu; Homonnay, Zoltan; Kuzmann, Erno; Vertes, Attila [Eoetvoes Lorand University, Institute of Chemistry (Hungary)

    2012-03-15

    Preliminary {sup 57}Co emission Moessbauer spectroscopic data were obtained for the soil bacterium Azospirillum brasilense Sp7 (T = 80 K) in frozen {sup 57}Co{sup 2 + }-containing suspensions and in their dried residues. The Moessbauer parameters were compared with those for A. brasilense strain Sp245 differing from strain Sp7 by ecological behaviour. Live cells of both strains showed metabolic transformations of {sup 57}Co{sup 2 + } within an hour. Differences in the parameters observed for the two strains under similar conditions suggest dissimilarities in their metabolic response to Co{sup 2 + }.

  6. Structural studies of the polysaccharides from the lipopolysaccharides of Azospirillum brasilense Sp246 and SpBr14.

    Science.gov (United States)

    Sigida, Elena N; Fedonenko, Yuliya P; Shashkov, Alexander S; Grinev, Vyacheslav S; Zdorovenko, Evelina L; Konnova, Svetlana A; Ignatov, Vladimir V; Knirel, Yuriy A

    2014-10-29

    Lipopolysaccharides from closely related Azospirillum brasilense strains, Sp246 and SpBr14, were obtained by phenol-water extraction. Mild acid hydrolysis of the lipopolysaccharides followed by GPC on Sephadex G-50 resulted in polysaccharide mixtures. On the basis of sugar and methylation analyses, Smith degradation and (1)H and (13)C NMR spectroscopy data, it was concluded that both bacteria possess the same two distinct polysaccharides having structures 1 and 2: [structure: see text]. Structure 1 has been reported earlier for a polysaccharide of A. brasilense 54 [Fedonenko et al., 2011] whereas to our knowledge structure 2 has not been hitherto found in bacterial polysaccharides. PMID:25240180

  7. Co2 + interaction with Azospirillum brasilense Sp7 cells: a 57Co emission Mössbauer spectroscopic study

    Science.gov (United States)

    Kamnev, Alexander A.; Tugarova, Anna V.; Biró, Borbála; Kovács, Krisztina; Homonnay, Zoltán; Kuzmann, Ernő; Vértes, Attila

    2012-03-01

    Preliminary 57Co emission Mössbauer spectroscopic data were obtained for the soil bacterium Azospirillum brasilense Sp7 ( T = 80 K) in frozen 57Co2 + -containing suspensions and in their dried residues. The Mössbauer parameters were compared with those for A. brasilense strain Sp245 differing from strain Sp7 by ecological behaviour. Live cells of both strains showed metabolic transformations of 57Co2 + within an hour. Differences in the parameters observed for the two strains under similar conditions suggest dissimilarities in their metabolic response to Co2 + .

  8. Toxicidade de herbicidas utilizados na cultura da cana-de-açúcar à bactéria diazotrófica Azospirillum brasilense Toxicity of herbicides applied on sugarcane to the diazotrophic bacterium Azospirillum brasilense

    Directory of Open Access Journals (Sweden)

    S.O Procópio

    2011-01-01

    Full Text Available Objetivou-se neste trabalho identificar herbicidas utilizados na cultura da cana-de-açúcar que não alteram o crescimento ou a capacidade de fixação biológica de nitrogênio (FBN da bactéria diazotrófica Azospirillum brasi lense. Dezoito herbicidas - paraquat, ametryn, amicarbazone, diuron, metribuzin, [hexazinone + diuron], [hexazinone + clomazone], clomazone, isoxaflutole, sulfentrazone, oxyfluorfen, imazapic, imazapyr, [trifloxysulfuron-sodium + ametryn], S-metolachlor, glyphosate, MSMA e 2,4-D - foram testados em suas doses comerciais quanto ao impacto sobre o crescimento da bactéria em meio líquido DIGs. As variáveis capacidade de suporte de crescimento (carrying capacity do meio de cultura, duração da fase lag e tempo de geração de A. brasilense foram calculadas a partir de dados de densidade ótica obtidos, em intervalos regulares, durante a incubação de culturas por 55 h. O impacto dos herbicidas na atividade da nitrogenase de A. brasilense foi avaliado em meio semissólido NFb, sem N, pela técnica da atividade de redução do acetileno (ARA. Os efeitos dos herbicidas sobre as variáveis de crescimento e ARA foram comparados ao controle pelo teste de Dunnett. Paraquat, oxyfluorfen, [trifloxysulfuron-sodium + ametryn] e glyphosate reduziram a capacidade do meio DIGs em suportar o crescimento de A. brasilense. Esse efeito foi associado ao aumento da duração da fase lag e do tempo de geração para [trifloxysulfuron-sodium + ametryn] e ao aumento no tempo de geração para glyphosate. MSMA, paraquat e amicarbazone reduzem a FBN in vitro de A. brasilense, porém essa redução é mais severa na presença do paraquat. Os demais herbicidas não alteram o crescimento e a FBN de A. brasilense.The objective of this work was to identify the herbicides applied on sugarcane that do not affect the growth nor the process of biological nitrogen fixation (BNF of the diazotrophic bacterium Azospirillum brasilense. Commercial doses of

  9. [Isolation and purification of Mn-peroxidase from Azospirillum brasilense Sp245].

    Science.gov (United States)

    Kupriashina, M A; Selivanov, N Iu; Nikitina, V E

    2012-01-01

    Homogenous Mn-peroxidase of a 26-fold purity grade was isolated from a culture of Azospirillum brasilense Sp245 cultivated on a medium containing 0.1 mM pyrocatechol. The molecular weight of the enzyme is 43 kD as revealed by electrophoresis in SDS-PAAG. It was shown that the use of pyrocatechol and 2,2'-azino-bis(3-ethylbenzotiazoline-6-sulfonate) at concentrations of 0.1 and I mM as inductors increased the Mn-peroxidase activity by a factor of 3. PMID:22567881

  10. Aggregation of the rhizospheric bacterium Azospirillum brasilense in response to oxygen

    Science.gov (United States)

    Abdoun, Hamid; McMillan, Mary; Pereg, Lily

    2016-04-01

    Azospirillum brasilense spp. have ecological, scientific and agricultural importance. As model plant growth promoting rhizobacteria they interact with a large variety of plants, including important food and cash crops. Azospirillum strains are known for their production of plant growth hormones that enhance root systems and for their ability to fix nitrogen. Azospirillum cells transform in response to environmental cues. The production of exopolysaccharides and cell aggregation during cellular transformation are important steps in the attachment of Azospirillum to roots. We investigate signals that induce cellular transformation and aggregation in the Azospirillum and report on the importance of oxygen to the process of aggregation in this rhizospheric bacterium.

  11. Mutants with Enhanced Nitrogenase Activity in Hydroponic Azospirillum brasilense-Wheat Associations

    OpenAIRE

    Pereg Gerk, Lily; Gilchrist, Kate; Kennedy, Ivan R.

    2000-01-01

    The effect of a mutation affecting flocculation, differentiation into cyst-like forms, and root colonization on nitrogenase expression by Azospirillum brasilense is described. The gene flcA of strain Sp7 restored these phenotypes in spontaneous mutants of both strains Sp7 and Sp245. Employing both constitutive pLA-lacZ and nifH-lacZ reporter fusions expressed in situ, the colony morphology, colonization pattern, and potential for nitrogenase activity of spontaneous mutants and flcA Tn5-induce...

  12. Increased acidification in the rhizosphere of cactus seedlings induced by Azospirillum brasilense

    Science.gov (United States)

    Carrillo, Angel; Li, Ching; Bashan, Yoav

    2002-08-01

    Acidification of the rhizosphere of cactus seedlings (giant cardon, Pachycereus pringlei) after inoculation with the plant growth-promoting bacterium Azospirillum brasilense Cd, in the presence or absence of ammonium and nitrate, was studied to understand how to increase growth of cardon seedlings in poor desert soils. While ammonium enhanced rhizosphere and liquid culture acidification, inoculation with the bacteria enhanced it further. On the other hand, nitrate increased pH of the rhizosphere, but combined with the bacterial inoculation, increase in pH was significantly smaller. Bacterial inoculation with ammonium enhanced plant growth.

  13. Azospirillum brasilense locus coding for phosphoenolpyruvate:fructose phosphotransferase system and global regulation of carbohydrate metabolism.

    OpenAIRE

    Chattopadhyay, S; Mukherjee, A.; Ghosh, S.

    1993-01-01

    Mutants of Azospirillum brasilense unable to grow on fructose include ones affected only on fructose (Fru-) and others impaired on many or all carbohydrates through interference with induction of their specific pathways (Car-). Both types of mutants could be complemented by a cosmid in broad-host-range vector pLAFR1 containing a 27.5-kb genomic insert, Car(-)-complementing activity depending on a 2.2-kb fragment, and Fru(-)-complementing activity depending on an overlapping 9.6-kb fragment.

  14. Phenotypic Changes Resulting from Distinct Point Mutations in the Azospirillum brasilense glnA Gene, Encoding Glutamine Synthetase

    OpenAIRE

    Van Dommelen, Anne; Keijers, Veerle; Wollebrants, An; Vanderleyden, Jozef

    2003-01-01

    Sequencing the glnA genes of two chemically induced Azospirillum brasilense glutamine synthetase mutants revealed an Arg→Cys mutation, corresponding to the glutamate binding site, in one mutant and an Asp→Asn mutation, corresponding to the ammonium binding site, in the second mutant. The phenotypic changes in these mutants are discussed in relation to their genotypes.

  15. Enhanced activity of ADP glucose pyrophosphorylase and formation of starch induced by Azospirillum brasilense in Chlorella vulgaris.

    Science.gov (United States)

    Choix, Francisco J; Bashan, Yoav; Mendoza, Alberto; de-Bashan, Luz E

    2014-05-10

    ADP-glucose pyrophosphorylase (AGPase) regulates starch biosynthesis in higher plants and microalgae. This study measured the effect of the bacterium Azospirillum brasilense on AGPase activity in the freshwater microalga Chlorella vulgaris and formation of starch. This was done by immobilizing both microorganisms in alginate beads, either replete with or deprived of nitrogen or phosphorus and all under heterotrophic conditions, using d-glucose or Na-acetate as the carbon source. AGPase activity during the first 72h of incubation was higher in C. vulgaris when immobilized with A. brasilense. This happened simultaneously with higher starch accumulation and higher carbon uptake by the microalgae. Either carbon source had similar effects on enzyme activity and starch accumulation. Starvation either by N or P had the same pattern on AGPase activity and starch accumulation. Under replete conditions, the population of C. vulgaris immobilized alone was higher than when immobilized together, but under starvation conditions A. brasilense induced a larger population of C. vulgaris. In summary, adding A. brasilense enhanced AGPase activity, starch formation, and mitigation of stress in C. vulgaris. PMID:24576433

  16. INOCULAÇÃO DE Azospirillum brasilense NA QUALIDADE FISIOLÓGICA DE SEMENTES DE MILHO DOCE

    Directory of Open Access Journals (Sweden)

    SOUZA, Epitácio José de

    2014-06-01

    Full Text Available The aimed of this study was to survey the physiological quality of sweet corn seeds submitted to inoculation of Azospirillum brasilense in different periods and dilutions in water. The experiment was conducted on the entirely randomized design with four replications in a factorial (4 x 4 more a witness without inoculation of A. brasilense. Were evaluated four periods between the inoculation and installation of the tests (0, 24, 48 and 72 hours and four dilutions of the inoculant in water (1:0, 1:1, 1:2 and 1:3. Were utilized seeds of sweet corn evaluated Tropical Plus hybrids and commercial strains of A. brasilense Ab-Ab-V5 and V6, in the dose of the commercial product 4 mL kg-1 seed. The parameters evaluated were germination, first count of germination, percentage of abnormal seeds, emergency, emergency speed index, length of epicotyl and of root, mass of the dry matter of shoots and of root. The dilution of A. brasilense in water did not affect no one parameter evaluated on the seeds of sweet corn, and the increase in the time between inoculation and the installation of the tests provide reduction on the first count of germination, speed emergency index and mass of dry matter of roots. It is concluded that, under laboratory conditions, inoculation of A. brasilense not benefits to germination and seed vigor of sweet corn. Objetivou-se avaliar a qualidade fisiológica de sementes de milho doce submetidas à inoculação de Azospirillum brasilense em diferentes períodos e diluições em água. O experimento foi conduzido no delineamento inteiramente casualizado, com quatro repetições em esquema fatorial (4 x 4, mais uma testemunha que não recebeu inoculação de A. brasilense. Foram avaliados quatro períodos entre a inoculação e a instalação dos testes (0, 24, 48 e 72 horas e quatro diluições do inoculante em água (1:0, 1:1, 1:2 e 1:3. Foram utilizadas sementes de milho doce híbrido comercial Tropical Plus e as estirpes de A

  17. Electro-optical study of the exposure of Azospirillum brasilense carbohydrate epitopes.

    Science.gov (United States)

    Guliy, Olga I; Matora, Larisa Yu; Dykman, Lev A; Staroverov, Sergey A; Burygin, Gennady L; Bunin, Viktor D; Burov, Andrei M; Ignatov, Oleg V

    2015-01-01

    The exposure of Azospirillum brasilense carbohydrate epitopes was investigated by electro-optical analysis of bacterial cell suspensions. To study changes in the electro-optical (EO) properties of the suspensions, we used antibodies generated to the complete lipopolysaccharide of A. brasilense type strain Sp7 and also antibodies to the smooth and rough O polysaccharides of Sp7. After 18 hr of culture growth, the EO signal of the suspension treated with antibodies to smooth O polysaccharide was approximately 20% lower than that of the suspension treated with antibodies to complete lipopolysaccharide (control). After 72 hr of culture growth, the strongest EO signal was observed for the cells treated with antibodies to rough O polysaccharide (approximately 46% greater than the control), whereas for the cells treated with antibodies to smooth O polysaccharide, it was much lower (approximately 23% of the control). These data were confirmed by electron microscopy. The results of the study may have importance for the rapid evaluation of changes in lipopolysaccharide form in microbial biotechnology, when the antigenic composition of the bacterial surface requires close control. PMID:25273383

  18. Physiological and biochemical characterization of Azospirillum brasilense strains commonly used as plant growth-promoting rhizobacteria.

    Science.gov (United States)

    Di Salvo, Luciana P; Silva, Esdras; Teixeira, Kátia R S; Cote, Rosalba Esquivel; Pereyra, M Alejandra; García de Salamone, Inés E

    2014-12-01

    Azospirillum is a plant growth-promoting rhizobacteria (PGPR) genus vastly studied and utilized as agriculture inoculants. Isolation of new strains under different environmental conditions allows the access to the genetic diversity and improves the success of inoculation procedures. Historically, the isolation of this genus has been performed by the use of some traditional culture media. In this work we characterized the physiology and biochemistry of five different A. brasilense strains, commonly used as cereal inoculants. The aim of this work is to contribute to pose into revision some concepts concerning the most used protocols to isolate and characterize this bacterium. We characterized their growth in different traditional and non-traditional culture media, evaluated some PGPR mechanisms and characterized their profiles of fatty acid methyl esters and carbon-source utilization. This work shows, for the first time, differences in both profiles, and ACC deaminase activity of A. brasilense strains. Also, we show unexpected results obtained in some of the evaluated culture media. Results obtained here and an exhaustive knowledge revision revealed that it is not appropriate to conclude about bacterial species without analyzing several strains. Also, it is necessary to continue developing studies and laboratory techniques to improve the isolation and characterization protocols. PMID:25138314

  19. Nitric oxide metabolism and indole acetic acid biosynthesis cross-talk in Azospirillum brasilense SM.

    Science.gov (United States)

    Koul, Vatsala; Tripathi, Chandrakant; Adholeya, Alok; Kochar, Mandira

    2015-04-01

    Production of nitric oxide (NO) and the presence of NO metabolism genes, nitrous oxide reductase (nosZ), nitrous oxide reductase regulator (nosR) and nitric oxide reductase (norB) were identified in the plant-associated bacterium (PAB) Azospirillum brasilense SM. NO presence was confirmed in all overexpressing strains, while improvement in the plant growth response of these strains was mediated by increased NO and indole-3-acetic acid (IAA) levels in the strains. Electron microscopy showed random distribution to biofilm, with surface colonization of pleiomorphic Azospirilla. Quantitative IAA estimation highlighted a crucial role of nosR and norBC in regulating IAA biosynthesis. The NO quencher and donor reduced/blocked IAA biosynthesis by all strains, indicating their common regulatory role in IAA biosynthesis. Tryptophan (Trp) and l-Arginine (Arg) showed higher expression of NO genes tested, while in the case of ipdC, only Trp and IAA increased expression, while Arg had no significant effect. The highest nosR expression in SMnosR in the presence of IAA and Trp, along with its 2-fold IAA level, confirmed the relationship of nosR overexpression with Trp in increasing IAA. These results indicate a strong correlation between IAA and NO in A. brasilense SM and suggest the existence of cross-talk or shared signaling mechanisms in these two growth regulators. PMID:25700632

  20. Rezension von: Martina Thiele, Tanja Thomas, Fabian Virchow (Hg.: Medien – Krieg – Geschlecht. Affirmationen und Irritationen sozialer Ordnungen. Wiesbaden: VS Verlag für Sozialwissenschaften 2010.

    Directory of Open Access Journals (Sweden)

    Ricarda Drüeke

    2010-10-01

    Full Text Available Die Autor/-innen des Sammelbandes geben einen Überblick über wichtige Fragestellungen zu Medien, Militär und Krieg sowie Geschlecht auf der Grundlage unterschiedlicher methodischer und theoretischer Zugänge. Ziel der Beiträge ist eine Analyse der Verschränkungen und Interaktionen zwischen diesen Bereichen aus gender- und gesellschaftstheoretischer Sicht. Im Zentrum stehen die Affirmationen und Irritationen sozialer Ordnungen, insbesondere der Geschlechterordnungen, etwa in der medialen Berichterstattung über Soldatinnen und Selbstmordattentäterinnen, in Darstellungen von Frauen und Männern in Kriegsfilmen und in Theaterstücken zur Zeit des Ersten Weltkriegs sowie historische Blicke auf frühe Kriegsberichterstatterinnen. Ergänzt werden diese Auseinandersetzungen durch die Perspektive von Journalistinnen, die aus ihrer eigenen Erfahrung berichten.

  1. Krieg-Planque, Alice. 2012. Analyser les discours institutionnels (Paris : Colin, coll., ICOM. Série Discours et communication)

    OpenAIRE

    RAUS, Rachele

    2013-01-01

    Ce livre se veut un manuel d’analyse du discours (désormais AD) dite à la française (Maingueneau 1996 : 43) qui analyse notamment des discours institutionnels (désormais DI). Alice Krieg-Planque en cerne dès le premier chapitre la visée, la portée et les limites éventuelles. Cependant, la démarche adoptée, réellement discursive, contribue à faire de ce livre plus qu’un simple manuel, et tout d’abord dans la mesure où il permet de mieux situer l’AD par rapport aux autres disciplines linguistiq...

  2. Alice Krieg-Planque, La notion de « formule » en analyse du discours. Cadre théorique et méthodologique

    OpenAIRE

    Lecolle, Michelle

    2012-01-01

    Après « Purification ethnique ». Une formule et son histoire, paru en 2003, Alice Krieg-Planque expose, avec La notion de « formule » en analyse du discours. Cadre théorique et méthodologique, le second volet – une partie – d’un travail de recherche considérable ayant donné lieu à une thèse de doctorat en sciences du langage soutenue en 2000 (Émergence et emplois de la formule « purification ethnique » dans la presse française (1980-1994). Une analyse de discours, université Paris 13). Si le ...

  3. Residual effect of nitrogen fertilization and Azospirillum brasilense inoculation in the maize cultureEfeito residual da adubação nitrogenada e inoculação de Azospirillum brasilense na cultura do milho

    Directory of Open Access Journals (Sweden)

    Jackson Huzar Novakowiski

    2011-12-01

    Full Text Available The diazotrophic bacteria Azospirillum brasilense is an organism able to fix nitrogen of atmosphere and produce plant hormones. Nevertheless, there is lack of information with regard to use in field conditions, especially in production systems that have presence of animals in a determined year period. The objective of paper was to evaluate the association of the nitrogen residual effect of fertilization in pasture winter and the inoculation with A. brasilense in the maize culture. Were carried two experiments in Guarapuava (PR in season 2008/09 with randomized block design with split plots in three replication. The main parcel consisted of application 5 levels of N (0, 75, 150, 225 e 300 kg ha-1 in pasture of black oat and ryegrass occupied by bovines and 4 treatments in the maize (T1 = control; T2 = inoculation of A. brasilense; T3 = 75 kg ha-1 of N; T4 = 150 kg ha-1 of N. Were evaluated: plants population, ears per plant, productivity, mass thousand grains, damage grains, row per ear and grains per row. There was residual effect of nitrogen applied in the pasture on maize culture. The mass thousand grains and the number of rows per ear of maize presented quadratic response for increase of nitrogen level in the pasture. The inoculation of A. brasilense provided higher productivity than control same with increase the nitrogen level applied in the pasture, with quadratic response in the experiment 1 and linear in the experiment 2.A bactéria diazotrófica Azospirillum brasilense é um organismo capaz de fixar nitrogênio da atmosfera e produzir hormônios vegetais. No entanto, há carência de informações a respeito de seu uso em condições de campo, sobretudo em sistemas de produção que tem a presença de animais em um determinado período do ano. O objetivo do trabalho foi avaliar a associação do efeito residual da adubação nitrogenada na pastagem de inverno e a inoculação de A. brasilense na cultura do milho. Foram conduzidos dois

  4. Characterization of two trpE genes encoding anthranilate synthase α-subunit in Azospirillum brasilense

    International Nuclear Information System (INIS)

    The previous report from our laboratory has recently identified a new trpE gene (termed trpE 2) which exists independently in Azospirillum brasilense Yu62. In this study, amplification of trpE(G) (termed trpE 1(G) here) confirmed that there are two copies of trpE gene, one trpE being fused into trpG while the other trpE existed independently. This is First report to suggest that two copies of the trpE gene exist in this bacterium. Comparison of the nucleotide sequence demonstrated that putative leader peptide, terminator, and anti-terminator were found upstream of trpE 1(G) while these sequence features did not exist in front of trpE 2. The β-galactosidase activity of an A. brasilense strain carrying a trpE 2-lacZ fusion remained constant at different tryptophan concentrations, but the β-galactosidase activity of the same strain carrying a trpE 1(G)-lacZ fusion decreased as the tryptophan concentration increased. These data suggest that the expression of trpE 1(G) is regulated at the transcriptional level by attenuation while trpE 2 is constantly expressed. The anthranilate synthase assays with trpE 1(G)- and trpE 2- mutants demonstrated that TrpE1(G) fusion protein is feedback inhibited by tryptophan while TrpE2 protein is not. We also found that both trpE 1(G) and trpE 2 gene products were involved in IAA synthesis

  5. Hydrogenase activity in Azospirillum brasilense is inhibited by nitrite, nitric oxide, carbon monoxide, and acetylene

    Energy Technology Data Exchange (ETDEWEB)

    Tibelius, K.H.; Knowles, R.

    1984-10-01

    Nitrite, NO, CO, and C/sub 2/H/sub 2/ inhibited O/sub 2/-dependent H/sub 2/ uptake (H/sup 3/H oxidation) in denitrifying Azospirillum brasilense Sp7 grown anaerobically on N/sub 2/O or NO/sub 3//sup -/. The apparent K/sub i/ values for inhibition of O/sub 2/-dependent H/sub 2/ uptake were 20 ..mu..M for NO/sub 2//sup -/, 0.4 ..mu..M for NO, 28 ..mu..M for CO, and 88 ..mu..M for C/sub 2/H/sub 2/. These inhibitors also affected methylene blue-dependent H/sub 2/ uptake, presumably by acting directly on the hydrogenase. Nitrite and NO inhibited H/sub 2/ uptake irreversibly, whereas inhibition due to CO was easily reversed by repeatedly evacuating and backfilling with N/sub 2/. The C/sub 2/H/sub 2/ inhibition was not readily reversed, partly due to difficulty in removing the last traces of this gas from solution. The NO/sub 2//sup -/ inhibition of malate-dependent respiration was readily reversed by repeatedly washing the cells, in contrast to the effect of NO/sub 2//sup -/ on H/sub 2/-dependent respiration. These results suggest that the low hydrogenase activities observed in NO/sub 3//sup -/-grown cultures of A. brasilense may be due to the irreversible inhibition of hydrogenase by NO/sub 2//sup -/ and NO produced by NO/sub 3//sup -/ reduction.

  6. Expression of the structural gene, laf1, encoding the flagellin of the lateral flagella in Azospirillum brasilense Sp7.

    OpenAIRE

    Moens, S.; M. Schloter; Vanderleyden, J.

    1996-01-01

    The induction of the lateral flagella of Azospirillum brasilense Sp7 was studied by using a translational fusion between the laf1 promoter and gusA. The fusion was induced when cells were grown on solid media but not when they were grown in broth. The fusion was also induced by incubation of liquid-grown cells with an anti-polar flagellum polyclonal antiserum. Hindrance of polar-flagellum rotation is suggested to be the signal for this induction.

  7. Involvement of indole-3-acetic acid produced by Azospirillum brasilense in accumulating intracellular ammonium in Chlorella vulgaris.

    Science.gov (United States)

    Meza, Beatriz; de-Bashan, Luz E; Bashan, Yoav

    2015-01-01

    Accumulation of intracellular ammonium and activities of the enzymes glutamine synthetase (GS) and glutamate dehydrogenase (GDH) were measured when the microalgae Chlorella vulgaris was immobilized in alginate with either of two wild type strains of Azospirillum brasilense or their corresponding indole-3-acetic acid (IAA)-attenuated mutants. After 48 h of immobilization, both wild types induced higher levels of intracellular ammonium in the microalgae than their respective mutants; the more IAA produced, the higher the intracellular ammonium accumulated. Accumulation of intracellular ammonium in the cells of C. vulgaris followed application of four levels of exogenous IAA reported for A. brasilense and its IAA-attenuated mutants, which had a similar pattern for the first 24 h. This effect was transient and disappeared after 48 h of incubation. Immobilization of C. vulgaris with any bacteria strain induced higher GS activity. The bacterial strains also had GS activity, comparable to the activity detected in C. vulgaris, but weaker than when immobilized with the bacteria. When net activity was calculated, the wild type always induced higher GS activity than IAA-attenuated mutants. GDH activity in most microalgae/bacteria interactions resembled GS activity. When complementing IAA-attenuated mutants with exogenous IAA, GS activity in co-immobilized cultures matched those of the wild type A. brasilense immobilized with the microalga. Similarity occurred when the net GS activity was measured, and was higher with greater quantities of exogenous IAA. It is proposed that IAA produced by A. brasilense is involved in ammonium uptake and later assimilation by C. vulgaris. PMID:25554489

  8. Optimization of biofloc production in Azospirillum brasilense (MTCC-125) and evaluation of its adherence with the roots of certain crops

    OpenAIRE

    Joe, Melvin; Karthikeyan, M. B.; Sekar, C.; Deiveekasundaram, M.

    2010-01-01

    The phenomenon of flocculation in Azospirillum brasilense (MTCC-125) was studied under different combinations of carbon and nitrogen sources. Fructose and Potassium nitrate at a pH of 6.4 in the cultural medium favour a higher bio-floc production. The biofloc was studied for root adhesion and its survival efficiency in the rhizoplane and rhizosphere of certain crops such as sorghum and sunflower under dryland condition. It has been demonstrated that the flocculated cultures of Azospirillum we...

  9. [INFLUENCE OF AZOSPIRILLUM BRASILENSE 10/1 ON ASSOCIATIVE NITROGEN FIXATION AND INTRAVARIETAL POLYMORPHISM OF SPRING TRITICALE].

    Science.gov (United States)

    Patika, V P; Nadkernichna, O V; Shahovnina, O O

    2015-01-01

    It is shown, that the perspective Ukrainian sorts of spring triticale characterizes by considerable polymorphism by associative N2-fixing ability in root zone of plants. Application of active strain Azospirillum brasilense 10/1 promotes the decline of variability of this sign within the limits of sort, increase potential nitrogen activity is on the average in 3,2-4,7 times and also distributing normalizations in the selections of the inoculated plants. PMID:26638482

  10. Enzyme-Linked Immunosorbent Assay for Specific Identification and Enumeration of Azospirillum brasilense Cd. in Cereal Roots †

    OpenAIRE

    Levanony, Hanna; Bashan, Yoav; Kahana, Zvi E.

    1987-01-01

    The enzyme-linked immunosorbent assay is suggested as a reliable, sensitive, and highly specific method for the identification and enumeration of Azospirillum brasilense Cd. As few as 105 CFU/ml can be practically identified by this method. At higher bacterial numbers, sensitivity increased linearly up to 5 × 108 CFU/ml, yielding useful standard curves. No cross-reaction was found either with different closely related Azospirillum strains or with other rhizosphere bacteria. The method allows ...

  11. Comparison of two Cellulomonas strains and their interaction with Azospirillum brasilense in degradation of wheat straw and associated nitrogen fixation

    Energy Technology Data Exchange (ETDEWEB)

    Halsall, D.M.; Gibson, A.H.

    1986-04-01

    A mutant strain of Cellulomonas sp. CS1-17 was compared with Cellulomonas gelida 2480 as the cellulolytic component of a mixed culture which was responsible for the breakdown of wheat straw to support asymbiotic nitrogen fixation by Azospirillum brasilense Sp7 (ATCC 29145). Cellulomonas sp. strain CS1-17 was more efficient than was C. gelida in cellulose breakdown at lower oxygen concentrations and, in mixed culture with A. brasilense, it supported higher nitrogenase activity(C/sub 2/H/sub 2/ reduction) and nitrogen fixation with straw as the carbon source. Based on gravimetric determinations of straw breakdown and total N determinations, the efficiency of nitrogen fixation was 72 and 63 mg of N per g of straw utilized for the mixtures containing Cellulomonas sp. and C. gelida, respectively. Both Cellulomonas spp. and Azospirillum spp. exhibited a wide range of pH tolerance. When introduced into sterilized soil, the Cellulomonas sp.-Azospirillum brasilense association was more effective in nitrogen fixation at a pH of 7.0 than at the native soil pH (5.6). This was also true of the indigenous diazotrophic microflora of this soil. The potential implications of this work to the field situation are discussed. 16 references.

  12. Nach dem Krieg?

    Directory of Open Access Journals (Sweden)

    Wolfgang Fach / Yana Milev

    2010-04-01

    Full Text Available The idea of a „war to end all wars“ is nothing but fiction and swindle. This we had to learn the hard way. Hence experience has given rise to hope for another kind of final turn to the better – a peace to end all wars. It was Immanuel Kant who transformed this vague idea of „eternal peace“ into a coherent concept. According to him, peaceful infinity is possible only in a world of republican states. If people all over the world had a say in the decision to wage war, military encounters would have to disappear for the simple reason that those who opted for war would to bear its costs. Hobbes and Hegel thought differently. According to them, wars have to be reckoned with as long as societies come in the form of states. In states, any number of reasons can serve for governments to attack each other. To put it differently, warmongering is logically contingent on state sovereignty. But what about the victims of this logic, the very men who are supposed not to be tricked into bearing arms? From hindsight we can say they have been a disappointment – war after war, governments have succeeded in fabricating widespread support. Hence Herbert Spencer’s radical idea to reduce state power to a war-disabling minimum could not come as a surprise. No state, no war – this equation has fuelled pacifism ever since. As it turned out, weak states are not only too weak to wage war abroad, but also to secure peace at home. „Failing states“ beget „new wars“. It is Hobbes – in reverse.

  13. Nach dem Krieg?

    OpenAIRE

    Wolfgang Fach / Yana Milev

    2010-01-01

    The idea of a „war to end all wars“ is nothing but fiction and swindle. This we had to learn the hard way. Hence experience has given rise to hope for another kind of final turn to the better – a peace to end all wars. It was Immanuel Kant who transformed this vague idea of „eternal peace“ into a coherent concept. According to him, peaceful infinity is possible only in a world of republican states. If people all over the world had a say in the decision to wage war, military encounters would h...

  14. [Genome Rearrangements in Azospirillum brasilense Sp7 with the Involvement of the Plasmid pRhico and the Prophage phiAb-Cd].

    Science.gov (United States)

    Katsy, E I; Petrova, L P

    2015-12-01

    Alphaproteobacteria of the species Azospirillum brasilense have a multicomponent genome that undergoes frequent spontaneous rearrangements, yielding changes in the plasmid profiles of strains. Specifically, variants (Cd, Sp7.K2, Sp7.1, Sp7.4, Sp7.8, etc.) of the type strainA. brasilense Sp7 that had lost a 115-MDa plasmid were previously selected. In many of them, the molecular weight of a 90-MDa plasmid (p90 or pRhico), which is a kind of "depot" for glycopolymer biosynthesis genes, increased. In this study, a collection of primers was designed to the plasmid pRhico and to the DNA of prophage phiAb-Cd integrated in it. The use ofthese primers in polymerase chain reactions allowed the detection of the probable excision of phiAb-Cd phage from the DNA of A. brasilense variants Sp7.4 and Sp7.8 and other alterations of the pRhico structure in A. brasilense strains Cd, Sp7.K2, and Sp7.8. The developed primers and PCR conditions may be recoin mended for primary analysis of spontaneous plasmid rearrangements in A. brasilense Sp7 and related strains. PMID:27055294

  15. Gold(III) reduction by the rhizobacterium Azospirillum brasilense with the formation of gold nanoparticles.

    Science.gov (United States)

    Tugarova, Anna V; Burov, Andrei M; Burashnikova, Marina M; Kamnev, Alexander A

    2014-01-01

    For the soil nitrogen-fixing bacterium Azospirillum brasilense, the ability to reduce [AuCl4](-) and to form gold nanoparticles (GNPs) has been demonstrated, with the appearance of a mauve tint of the culture. To validate the shapes and chemical nature of nanoparticles, transmission electron microscopy (TEM) and X-ray fluorescence analysis were used. For the widely studied agriculturally important wild-type strains A. brasilense Sp7 and Sp245, GNPs formed after 10 days of incubation of cell biomass with 0.25 mM [AuCl4](-) were shown (using TEM) to be mainly of spherical form (5 to 20 nm in diameter), with rare occasional triangles. In the course of cultivation with [AuCl4](-), after 5 days, a mauve tint was already visible for cells of strain Sp245.5, after 6 days for Sp245 and after 10 days for Sp7. Thus, for the mutant strain Sp245.5 (which has significant differences in the structure and composition of cell-surface polysaccharides as compared with Sp245), a more rapid formation of GNPs was observed. Moreover, their TEM images (also obtained after 10 days) showed different shapes: nano-sized spheres, triangles, hexagons and rods, as well as larger round-shaped flower-like nanoparticles about 100 nm in size. Since by the time of GNP formation in our experiments the cells were found to be already not viable, this confirms the dominating role of cell surface structure and chemical composition in shaping the GNPs formed in the course of [AuCl4](-) reduction to Au(0). This finding may be useful for understanding the natural biogeochemical mechanisms of gold reduction and formation of GNPs involving microorganisms. The data obtained may also help in developing protocols for environmentally friendly synthesis of nanoparticles and possible use of bacterial cells with modified surface structure and composition for their fabrication. PMID:24276540

  16. Accumulation fatty acids of in Chlorella vulgaris under heterotrophic conditions in relation to activity of acetyl-CoA carboxylase, temperature, and co-immobilization with Azospirillum brasilense

    Science.gov (United States)

    Leyva, Luis A.; Bashan, Yoav; Mendoza, Alberto; de-Bashan, Luz E.

    2014-10-01

    The relation between fatty acid accumulation, activity of acetyl-CoA carboxylase (ACC), and consequently lipid accumulation was studied in the microalgae Chlorella vulgaris co-immobilized with the plant growth-promoting bacterium Azospirillum brasilense under dark heterotrophic conditions with Na acetate as a carbon source. In C. vulgaris immobilized alone, cultivation experiments for 6 days showed that ACC activity is directly related to fatty acid accumulation, especially in the last 3 days. In co-immobilization experiments, A. brasilense exerted a significant positive effect over ACC activity, increased the quantity in all nine main fatty acids, increased total lipid accumulation in C. vulgaris, and mitigated negative effects of nonoptimal temperature for growth. No correlation between ACC activity and lipid accumulation in the cells was established for three different temperatures. This study demonstrated that the interaction between A. brasilense and C. vulgaris has a significant effect on fatty acid and lipid accumulation in the microalgae.

  17. Accumulation of fatty acids in Chlorella vulgaris under heterotrophic conditions in relation to activity of acetyl-CoAcarboxylase, temperature, and co-immobilization with Azospirillum brasilense [corrected].

    Science.gov (United States)

    Leyva, Luis A; Bashan, Yoav; Mendoza, Alberto; de-Bashan, Luz E

    2014-10-01

    The relation between fatty acid accumulation, activity of acetyl-CoA carboxylase (ACC), and consequently lipid accumulation was studied in the microalgae Chlorella vulgaris co-immobilized with the plant growth-promoting bacterium Azospirillum brasilense under dark heterotrophic conditions with Na acetate as a carbon source. In C. vulgaris immobilized alone, cultivation experiments for 6 days showed that ACC activity is directly related to fatty acid accumulation, especially in the last 3 days. In co-immobilization experiments, A. brasilense exerted a significant positive effect over ACC activity, increased the quantity in all nine main fatty acids, increased total lipid accumulation in C. vulgaris, and mitigated negative effects of nonoptimal temperature for growth. No correlation between ACC activity and lipid accumulation in the cells was established for three different temperatures. This study demonstrated that the interaction between A. brasilense and C. vulgaris has a significant effect on fatty acid and lipid accumulation in the microalgae. PMID:25129521

  18. [A STUDY OF THE ISOLATED BACTERIOPHAGE ΦAB-SP7 ADSORPTION ON THE CELL SURFACE OF THE AZOSPIRILLUM BRASILENSE SP7].

    Science.gov (United States)

    Guliy, O I; Karavaeva, O A; Velikov, V A; Sokolov, O I; Pavily, S A; Larionova, O S; Burov, A M; Ignatov, O V

    2016-01-01

    The bacteriophage ΦAb-Sp7 was isolated from the cells of the Azospirillum brasilense Sp7. The morphology, size of the gram-negative colonies, and range of lytic activity against other strains and species of the genus Azospirillum was tested. The isolated phage DNA was examined using electrophoretic and restriction analysis, and the size of the genome were established. The electron microscopy. resuIts show that the phage (capsid) has a strand-like form. The electron microscopy study of the bacteriophage ΦAb-Sp7 adsorption on the A. brasilense Sp7 bacterial surface was performed. PMID:27145602

  19. Co2 +  interaction with Azospirillum brasilense Sp7 cells: a 57Co emission Mössbauer spectroscopic study

    International Nuclear Information System (INIS)

    Preliminary 57Co emission Mössbauer spectroscopic data were obtained for the soil bacterium Azospirillum brasilense Sp7 (T = 80 K) in frozen 57Co2 + -containing suspensions and in their dried residues. The Mössbauer parameters were compared with those for A. brasilense strain Sp245 differing from strain Sp7 by ecological behaviour. Live cells of both strains showed metabolic transformations of 57Co2 +  within an hour. Differences in the parameters observed for the two strains under similar conditions suggest dissimilarities in their metabolic response to Co2 + .

  20. Combination of inoculation methods of Azospirilum brasilense with broadcasting of nitrogen fertilizer increases corn yield

    Directory of Open Access Journals (Sweden)

    Tânia Maria Müller

    2015-01-01

    Full Text Available Nitrogen (N is the most limiting nutrient for corn production. Thereby, the goal of the paper was to evaluate inoculation methods of Azospirillum brasilense in order to partially supply N required by the crop. The experiment was carried out in Guarapuava, PR, Brasil, in 2011/2012 growing season. Randomized blocks with factorial 3 inoculation methods (seed treatment, planting furrow and non-inoculated control x 5 doses of nitrogen (0, 75, 150, 225 and 300kg ha-1 x 8 replications was used as the experimental design. Leaf are index, foliar nitrogen content, total chlorophyll, grains per ear and yield were evaluated. There was significant interaction between inoculation methods and nitrogen fertilization to leaf area index, but not for yield. Inoculation with the diazotrophic bacteria provided yield increase of 702kg ha-1 for inoculation in seeding furrow and 432kg ha-1 for inoculation in seed treatment compared to the control, but both treatments did not differ between each other. Furthermore, total chlorophyll, grains per ear and yield were positively affected, with quadratic response, by the nitrogen fertilization in broadcasting

  1. Cellular responses during morphological transformation in Azospirillum brasilense and Its flcA knockout mutant.

    Directory of Open Access Journals (Sweden)

    Xingsheng Hou

    Full Text Available FlcA is a response regulator controlling flocculation and the morphological transformation of Azospirillum cells from vegetative to cyst-like forms. To understand the cellular responses of Azospirillum to conditions that cause morphological transformation, proteins differentially expressed under flocculation conditions in A. brasilense Sp7 and its flcA knockout mutant were investigated. Comparison of 2-DE protein profiles of wild-type (Sp7 and a flcA deletion mutant (Sp7-flcAΔ revealed a total of 33 differentially expressed 2-DE gel spots, with 22 of these spots confidently separated to allow protein identification. Analysis of these spots by liquid chromatography-tandem mass spectrometry (LC-MS/MS and MASCOT database searching identified 48 proteins (≥10% emPAI in each spot. The functional characteristics of these proteins included carbon metabolism (beta-ketothiolase and citrate synthase, nitrogen metabolism (Glutamine synthetase and nitric oxide synthase, stress tolerance (superoxide dismutase, Alkyl hydroperoxidase and ATP-dependent Clp protease proteolytic subunit and morphological transformation (transducer coupling protein. The observed differences between Sp7 wild-type and flcA- strains enhance our understanding of the morphological transformation process and help to explain previous phenotypical observations. This work is a step forward in connecting the Azospirillum phenome and genome.

  2. Crecimiento de Azospirillum brasilense en presencia de disacáridos: sacarosa y lactosa

    Directory of Open Access Journals (Sweden)

    Yudyt Díaz-Saez

    2013-01-01

    Full Text Available La obtención de biopolímeros a partir de fermentaciones bacterianas requiere de la selección adecuada de las condiciones del proceso. Se evaluó el crecimiento de la cepa Azospirillum brasilense 8-INICA en medio líquido suplementado con disacáridos. Las mediciones se realizaron a las 23 h de incubación con la determinación de la densidad óptica, la concentración de azúcares reductores y concentración de carbohidratos totales, así como la determinación del pH del sobrenadante. Se confirmó el máximo desarrollo de la biomasa para 33 oC y 7,2 g.L-1 de sal con sacarosa, y 40 oC y 3,5 g.L-1 de sal con lactosa. Se estableció que las condiciones más favorables para la producción de exopolisacáridos se encuentran a temperaturas y concentraciones elevadas de sal para un medio con lactosa; y bajas temperaturas a concentraciones elevadas de sal en presencia de sacarosa. Se constató la marcada influencia de la temperatura en el crecimiento, y la acción positiva de la concentración salina en los mecanismos de supervivencia del micro- organismo.

  3. Effect of Azospirillum brasilense inoculation on urease activity in soil and gamma-sterilized soil

    International Nuclear Information System (INIS)

    Azospirillum spp. is considered a PGPR (plant growth promoting rhyzobacteria) bacterium, besides this interest, there is little information about its effects on other functional microbial groups or on soil enzymes. In this paper, the impact that Azospirillum brasilense 7001 inoculation has on urease activity expression in a Typic Argiudoll was studied. Evolution of urease activity of soil and of gamma irradiation (25 KGy) sterilized soil, and the inoculated strain survival were tested. The relation between soil urease activity and soil NH4+-N was also determined. In γ-sterilized soil, urease activity of inoculated soil increased with time, showing significant differences with regard to the control soil without inoculum at day 15. In non-sterile soil, urease activity decreased during the studied period in all treatments; in inoculated soil, it showed higher or lower values than the control depending on sampling time. Azospirillum survival was important and different according to soil condition conditions. The negative relation between NH4+-N concentration and soil urease activity (r2 = 0.62) was observed in inoculated soil. The role of the addition of autoclaved inoculum in the urease activity expression is discussed. The research proves that in both studied situations Azospirillum modified soil urease activity, and that the competition with native microorganisms and soil NH4+-N may affect this bacterium capacity. (author)

  4. Biofertilization with Azospirillum brasilense improves in vitro culture of Handroanthus ochraceus, a forestry, ornamental and medicinal plant.

    Science.gov (United States)

    Llorente, Berta E; Alasia, María A; Larraburu, Ezequiel E

    2016-01-25

    Biofertilization with plant growth-promoting rhizobacteria is a potential alternative to plant productivity. Here, in vitro propagation of Handroanthus ochraceus (yellow lapacho), a forest crop with high economic and environmental value, was developed using the Azospirillum brasilense strains Cd and Az39 during rhizogenesis. Epicotiles of in vitro plantlets were multiplied in Woody Plant Medium (WPM). For rooting, elongated shoots were transferred to auxin-free Murashige-Skoog medium with Gamborg's vitamins and WPM, both at half salt concentration (½MSG and ½WPM), and inoculated with Cd or Az39 at the base of each shoot. Anatomical studies were performed using leaves cleared and stained with safranin for optical microscopy and leaves and roots metalized with gold-palladium for scanning electron microscopy (SEM). In ½WPM auxin-free medium, A. brasilense Cd inoculation produced 55% of rooting, increased root fresh and dry weight (45% and 77%, respectively), and led to lower stomata size and density with similar proportion of open and closed stomata. Both strains selectively increased the size or density of glandular trichomes in ½MSG. Moreover, bacteria were detected on the root surface by SEM. In conclusion, the difference in H. ochraceus response to A. brasilense inoculation depends on the strain and the plant culture media. Cd strain enhanced rooting in auxin-free ½WPM and produced plantlets with features similar to those expected in ex vitro plants. This work presents an innovative in vitro approach using beneficial plant-microorganism interaction as an ecologically compatible strategy in plant biotechnology. PMID:26255131

  5. Transposon Mutagenesis of Azospirillum brasilense and Azospirillum lipoferum: Physical Analysis of Tn5 and Tn5-Mob Insertion Mutants

    OpenAIRE

    Vanstockem, Mark; Michiels, Kris; Vanderleyden, Jos; Van Gool, August P.

    1987-01-01

    Tn5-induced insertion mutants were generated in Azospirillum brasilense Sp7 and A. lipoferum SpBr17 by mating with Escherichia coli strains carrying suicide plasmid vectors. The sources of Tn5 were the suicide plasmids pGS9 and pSUP2021. Kanamycin-resistant Azospirillum colonies appeared from crosses with E. coli at maximum frequencies of 10−7 per recipient cell. Transposon Tn5 also conferred streptomycin resistance on Azospirillum colonies as was observed earlier for Rhizobium sp. Eight Tn5-...

  6. Chemical synthesis of the tetrasaccharide repeating unit of the O-polysaccharide isolated from Azospirillum brasilense SR80.

    Science.gov (United States)

    Sarkar, Vikramjit; Mukhopadhyay, Balaram

    2015-04-10

    A linear strategy has been developed for the synthesis of the tetrasaccharide repeating unit of the O-polysaccharide from Azospirillum brasilense SR80. Stepwise glycosylation of the rationally protected thioglycoside donors activated by NIS in the presence of La(OTf)3 furnished the target tetrasaccharide. The glycosylation reactions resulted in the formation of the desired linkage with absolute stereoselectivity and afforded the required derivatives in good to excellent yields. The phthalimido group has been used as the precursor of the desired acetamido group to meet the requirement of 1,2-trans glycosidic linkage. PMID:25681691

  7. Assessing the efficacy of co-inoculation of wheat seedlings with the associative bacteria Paenibacillus polymyxa 1465 and Azospirillum brasilense Sp245.

    Science.gov (United States)

    Yegorenkova, Irina V; Tregubova, Kristina V; Burygin, Gennady L; Matora, Larisa Y; Ignatov, Vladimir V

    2016-03-01

    Co-inoculation of associative bacteria, which have high nitrogen-fixing activity, tolerance for environmental conditions, and the ability to compete with the natural microflora, is used widely to enhance the growth and yields of agricultural plants. We evaluated the ability of 2 co-inoculated plant-growth-promoting rhizobacteria, Paenibacillus polymyxa 1465 and Azospirillum brasilense Sp245, to colonize roots of wheat (Triticum aestivum L. 'Saratovskaya 29') seedlings, and we assessed the morphometric parameters of wheat early in its development. Analysis by ELISA with polyclonal antibodies raised against the exopolysaccharide of P. polymyxa 1465 and the lipopolysaccharide of A. brasilense Sp245 demonstrated that the root-colonizing activity of A. brasilense was higher when the bacterium was co-inoculated with P. polymyxa than when it was inoculated singly. Immunofluorescence microscopy with Alexa Fluor 532-labeled antibodies revealed sites of attachment of co-inoculated P. polymyxa and A. brasilense and showed that the 2 bacteria colonized similar regions of the roots. Co-inoculation exerted a negative effect on wheat seedling development, inhibiting root length by 17.6%, total root weight by 11%, and total shoot weight by 12%. Under certain conditions, dual inoculation of wheat may prove ineffective, apparently owing to the competition between the rhizobacteria for colonization sites on the plant roots. The findings from this study may aid in developing techniques for mixed bacterial inoculation of cultivated plants. PMID:26863134

  8. Convergent synthesis of a tetrasaccharide repeating unit of the O-specific polysaccharide from the cell wall lipopolysaccharide of Azospirillum brasilense strain Sp7

    OpenAIRE

    Mandal, Pintu Kumar; Dhara, Debashis; Misra, Anup Kumar

    2014-01-01

    A straightforward convergent synthesis has been carried out for the tetrasaccharide repeating unit of the O-specific cell wall lipopolysaccharide of the strain Sp7 of Azospirillum brasilense. The target tetrasaccharide has been synthesized from suitably protected monosaccharide intermediates in 42% overall yield in seven steps by using a [2 + 2] block glycosylation approach.

  9. Convergent synthesis of a tetrasaccharide repeating unit of the O-specific polysaccharide from the cell wall lipopolysaccharide of Azospirillum brasilense strain Sp7

    Directory of Open Access Journals (Sweden)

    Pintu Kumar Mandal

    2014-01-01

    Full Text Available A straightforward convergent synthesis has been carried out for the tetrasaccharide repeating unit of the O-specific cell wall lipopolysaccharide of the strain Sp7 of Azospirillum brasilense. The target tetrasaccharide has been synthesized from suitably protected monosaccharide intermediates in 42% overall yield in seven steps by using a [2 + 2] block glycosylation approach.

  10. Accumulation of intra-cellular polyphosphate in Chlorella vulgaris cells is related to indole-3-acetic acid produced by Azospirillum brasilense.

    Science.gov (United States)

    Meza, Beatriz; de-Bashan, Luz E; Hernandez, Juan-Pablo; Bashan, Yoav

    2015-06-01

    Accumulation of intra-cellular phosphate, as polyphosphate, was measured when the microalga Chlorella vulgaris was immobilized in alginate with either of two wild-type strains of the microalgae growth-promoting bacterium Azospirillum brasilense or their corresponding IAA-attenuated mutants. Wild type strains of A. brasilense induced higher amounts of intra-cellular phosphate in Chlorella than their respective mutants. Calculations comparing intra-cellular phosphate accumulation by culture or net accumulation by the cell and the amount of IAA that was produced by each of these strains revealed that higher IAA was linked to higher accumulations of intra-cellular phosphate. Application of four levels of exogenous IAA reported for A. brasilense and their IAA-attenuated mutants to cultures of C. vulgaris enhanced accumulation of intra-cellular phosphate; the higher the content of IAA per culture or per single cell, the higher was the amount of accumulated phosphate. When an IAA-attenuated mutant was complemented with exogenous IAA, accumulation of intra-cellular phosphate at the culture level was even higher than phosphate accumulation with the respective wild type strains. When calculating the net accumulation of intra-cellular phosphate in the complementation experiment, net intra-cellular phosphate induced by the IAA-attenuated mutant was completely restored and was similar to the wild strains. We propose that IAA produced by A. brasilense is linked to polyphosphate accumulation in C. vulgaris. PMID:25797155

  11. Mutants with enhanced nitrogenase activity in hydroponic Azospirillum brasilense-wheat associations.

    Science.gov (United States)

    Pereg Gerk, L; Gilchrist, K; Kennedy, I R

    2000-05-01

    The effect of a mutation affecting flocculation, differentiation into cyst-like forms, and root colonization on nitrogenase expression by Azospirillum brasilense is described. The gene flcA of strain Sp7 restored these phenotypes in spontaneous mutants of both strains Sp7 and Sp245. Employing both constitutive pLA-lacZ and nifH-lacZ reporter fusions expressed in situ, the colony morphology, colonization pattern, and potential for nitrogenase activity of spontaneous mutants and flcA Tn5-induced mutants were established. The results of this study show that the ability of Sp7 and Sp245 mutant strains to remain in a vegetative form improved their ability to express nitrogenase activity in association with wheat in a hydroponic system. Restoring the cyst formation and colonization pattern to the spontaneous mutant Sp7-S reduced nitrogenase activity rates in association with plants to that of the wild-type Sp7. Although Tn5-induced flcA mutants showed higher potentials for nitrogenase expression than Sp7, their potentials were lower than that of Sp7-S, indicating that other factors in this strain contribute to its exceptional nitrogenase activity rates on plants. The lack of lateral flagella is not one of these factors, as Sp7-PM23, a spontaneous mutant impaired in swarming and lateral-flagellum production but not in flocculation, showed wild-type nitrogenase activity and expression. The results also suggest factors of importance in evolving an effective symbiosis between Azospirillum and wheat, such as increasing the availability of microaerobic niches along the root, increased supply of carbon sources by the plant, and the retention of the bacterial cells in vegetative form for faster metabolism. PMID:10788397

  12. ESTUDIO DEL EFECTO QUIMIOTÁCTICO DE LOS EXUDADOS RADICALES DEL ARROZ SOBRE Azospirillum brasilense Sp7 Y A. brasilense R5(15. PRODUCCIÓN DE AUXINAS POR AMBAS CEPAS

    Directory of Open Access Journals (Sweden)

    Mabel Pazos

    2003-01-01

    Full Text Available El género Azospirillum agrupa bacterias diazotróficas de vida libre, ampliamente encontradas en suelos tropicales y subtropicales, en asociación con raíces de cultivos de importancia económica como arroz, trigo y diversas especies vegetales. La gran mayoría de los estudios realizados con este género han demostrado su distribución prácticamente universal y sus numerosos efectos sobre el crecimiento de las plantas que coloniza. En este trabajo se demuestra el efecto quimiotáctico que ejercen los exudados radicales del arroz variedad J-104 sobre dos cepas de A. brasilense (R5(15 y Sp7, así como la capacidad de ambas de producir auxinas 16.60 mg.mL-1 y 11.82 mg.mL-1 respectivamente.

  13. Effect of Azospirillum brasilense and Burkholderia unamae Bacteria on Maize Photosynthetic Activity Evaluated Using the Photoacoustic Technique

    Science.gov (United States)

    Gordillo-Delgado, F.; Marín, E.; Calderón, A.

    2016-09-01

    In this work, the photosynthetic process of maize plants ( Zea mays), which were grown using seeds inoculated with plant growth promoting bacteria Azospirillum brasilense and Burkholderia unamae, was monitored. Photothermal and photobaric signals obtained by a time-resolved photoacoustic measurement configuration were used for measuring the oxygen evolution rate in situ. A frequency-resolved configuration of the method was utilized to determine the oxygen diffusion coefficient and the thermal diffusivity of the maize leaves. The latter parameters, which can be used as indicators of the photosynthetic activity of maize, are found to vary according to the plant-microbe interaction. Treatment with plant growth promoting bacteria induced a decrease in the oxygen diffusion coefficient of about 20 %.

  14. Mössbauer spectroscopic study of 57Fe metabolic transformations in the rhizobacterium Azospirillum brasilense Sp245

    Science.gov (United States)

    Kamnev, Alexander A.; Tugarova, Anna V.; Kovács, Krisztina; Biró, Borbála; Homonnay, Zoltán; Kuzmann, Ernő

    2014-04-01

    Preliminary 57Fe transmission Mössbauer spectroscopic data were obtained for the first time for live cells of the plant-growth-promoting rhizobacterium Azospirillum brasilense (wild-type strain Sp245) grown aerobically with 57FeIII-nitrilotriacetate (NTA) complex as a sole source of iron. The results obtained have shown that live cells actively reduce part of the assimilated iron(III) to iron(II), the latter amounting up to 33 % of total cellular iron after 18 h of growth, and 48 % after additional 3 days of storage of the dense wet cell suspension in nutrient-free saline solution in air at room temperature (measured at 80 K). The cellular iron(II) was found to be represented by two quadrupole doublets of different high-spin forms, while the parameters of the cellular iron(III) were close to those typical for bacterioferritins.

  15. Spectroscopic characterization of cell membranes and their constituents of the plant-associated soil bacterium Azospirillum brasilense

    Science.gov (United States)

    Kamnev, A. A.; Antonyuk, L. P.; Matora, L. Yu.; Serebrennikova, O. B.; Sumaroka, M. V.; Colina, M.; Renou-Gonnord, M.-F.; Ignatov, V. V.

    1999-05-01

    Structural and compositional features of bacterial membranes and some of their isolated constituents (cell surface lipopolysaccharide, phospholipids) of the plant-growth-promoting diazotrophic rhizobacterium Azospirillum brasilense (wild-type strain Sp245) were characterized using Fourier transform infrared (FTIR) spectroscopy and some other techniques. FTIR spectra of the cell membranes were shown to comprise the main vibration modes of the relevant lipopolysaccharide and protein components which are believed to be involved in associative plant-bacterium interactions, as well as of phospholipid constituents. The role and functions of metal cations in the structural organization and physicochemical properties of bacterial cell membranes are also discussed considering their accumulation in the membranes from the culture medium.

  16. Fourier transform Raman spectroscopic characterisation of cells of the plant-associated soil bacterium Azospirillum brasilense Sp7

    Science.gov (United States)

    Kamnev, A. A.; Tarantilis, P. A.; Antonyuk, L. P.; Bespalova, L. A.; Polissiou, M. G.; Colina, M.; Gardiner, P. H. E.; Ignatov, V. V.

    2001-05-01

    Structural and compositional features of bacterial cell samples and of lipopolysaccharide-protein complex isolated from the cell surface of the plant-growth-promoting rhizobacterium Azospirillum brasilense (wild-type strain Sp7) were characterised using Fourier transform (FT) Raman spectroscopy. The structural spectroscopic information obtained is analysed and considered together with analytical data on the content of metal cations (Co 2+, Cu 2+ and Zn 2+) in the bacterial cells grown in a standard medium as well as in the presence of each of the cations (0.2 mM). The latter, being taken up by bacterial cells from the culture medium in significant amounts, were shown to induce certain metabolic changes in the bacterium revealed in FT-Raman spectra, which is discussed from the viewpoint of bacterial response to environmental stresses.

  17. Expression and characterization of an N-truncated form of the NifA protein of Azospirillum brasilense

    Directory of Open Access Journals (Sweden)

    C.Y. Nishikawa

    2012-02-01

    Full Text Available Azospirillum brasilense is a nitrogen-fixing bacterium associated with important agricultural crops such as rice, wheat and maize. The expression of genes responsible for nitrogen fixation (nif genes in this bacterium is dependent on the transcriptional activator NifA. This protein contains three structural domains: the N-terminal domain is responsible for the negative control by fixed nitrogen; the central domain interacts with the RNA polymerase σ54 co-factor and the C-terminal domain is involved in DNA binding. The central and C-terminal domains are linked by the interdomain linker (IDL. A conserved four-cysteine motif encompassing the end of the central domain and the IDL is probably involved in the oxygen-sensitivity of NifA. In the present study, we have expressed, purified and characterized an N-truncated form of A. brasilense NifA. The protein expression was carried out in Escherichia coli and the N-truncated NifA protein was purified by chromatography using an affinity metal-chelating resin followed by a heparin-bound resin. Protein homogeneity was determined by densitometric analysis. The N-truncated protein activated in vivo nifH::lacZ transcription regardless of fixed nitrogen concentration (absence or presence of 20 mM NH4Cl but only under low oxygen levels. On the other hand, the aerobically purified N-truncated NifA protein bound to the nifB promoter, as demonstrated by an electrophoretic mobility shift assay, implying that DNA-binding activity is not strictly controlled by oxygen levels. Our data show that, while the N-truncated NifA is inactive in vivo under aerobic conditions, it still retains DNA-binding activity, suggesting that the oxidized form of NifA bound to DNA is not competent to activate transcription.

  18. Expression and characterization of an N-truncated form of the NifA protein of Azospirillum brasilense

    Energy Technology Data Exchange (ETDEWEB)

    Nishikawa, C.Y.; Araújo, L.M.; Kadowaki, M.A.S.; Monteiro, R.A.; Steffens, M.B.R.; Pedrosa, F.O.; Souza, E.M.; Chubatsu, L.S. [Departamento de Bioquímica e Biologia Molecular, Universidade Federal do Paraná, Curitiba, PR (Brazil)

    2012-01-27

    Azospirillum brasilense is a nitrogen-fixing bacterium associated with important agricultural crops such as rice, wheat and maize. The expression of genes responsible for nitrogen fixation (nif genes) in this bacterium is dependent on the transcriptional activator NifA. This protein contains three structural domains: the N-terminal domain is responsible for the negative control by fixed nitrogen; the central domain interacts with the RNA polymerase σ{sup 54} factor and the C-terminal domain is involved in DNA binding. The central and C-terminal domains are linked by the interdomain linker (IDL). A conserved four-cysteine motif encompassing the end of the central domain and the IDL is probably involved in the oxygen-sensitivity of NifA. In the present study, we have expressed, purified and characterized an N-truncated form of A. brasilense NifA. The protein expression was carried out in Escherichia coli and the N-truncated NifA protein was purified by chromatography using an affinity metal-chelating resin followed by a heparin-bound resin. Protein homogeneity was determined by densitometric analysis. The N-truncated protein activated in vivo nifH::lacZ transcription regardless of fixed nitrogen concentration (absence or presence of 20 mM NH{sub 4}Cl) but only under low oxygen levels. On the other hand, the aerobically purified N-truncated NifA protein bound to the nifB promoter, as demonstrated by an electrophoretic mobility shift assay, implying that DNA-binding activity is not strictly controlled by oxygen levels. Our data show that, while the N-truncated NifA is inactive in vivo under aerobic conditions, it still retains DNA-binding activity, suggesting that the oxidized form of NifA bound to DNA is not competent to activate transcription.

  19. Expression and characterization of an N-truncated form of the NifA protein of Azospirillum brasilense

    International Nuclear Information System (INIS)

    Azospirillum brasilense is a nitrogen-fixing bacterium associated with important agricultural crops such as rice, wheat and maize. The expression of genes responsible for nitrogen fixation (nif genes) in this bacterium is dependent on the transcriptional activator NifA. This protein contains three structural domains: the N-terminal domain is responsible for the negative control by fixed nitrogen; the central domain interacts with the RNA polymerase σ54 factor and the C-terminal domain is involved in DNA binding. The central and C-terminal domains are linked by the interdomain linker (IDL). A conserved four-cysteine motif encompassing the end of the central domain and the IDL is probably involved in the oxygen-sensitivity of NifA. In the present study, we have expressed, purified and characterized an N-truncated form of A. brasilense NifA. The protein expression was carried out in Escherichia coli and the N-truncated NifA protein was purified by chromatography using an affinity metal-chelating resin followed by a heparin-bound resin. Protein homogeneity was determined by densitometric analysis. The N-truncated protein activated in vivo nifH::lacZ transcription regardless of fixed nitrogen concentration (absence or presence of 20 mM NH4Cl) but only under low oxygen levels. On the other hand, the aerobically purified N-truncated NifA protein bound to the nifB promoter, as demonstrated by an electrophoretic mobility shift assay, implying that DNA-binding activity is not strictly controlled by oxygen levels. Our data show that, while the N-truncated NifA is inactive in vivo under aerobic conditions, it still retains DNA-binding activity, suggesting that the oxidized form of NifA bound to DNA is not competent to activate transcription

  20. Respuesta de tres cultivares de maíz a la inoculación con Azospirillum brasilense bajo cuatro diferentes dosis de nitrógeno

    OpenAIRE

    Andrés González Huerta; Delfina de Jesús Pérez López; Omar Franco Mora; Artemio Balbuena Melgarejo; Francisco Gutiérrez Rodríguez; Heladio Romero Salas

    2011-01-01

    En el municipio de Huamuxtitlán, estado de Guerrero, México, se evaluó la respuesta de los materiales de maíz VS-535, H-507 y criollo veracruzano en las dosis de 0, 30, 60 y 90 kg de nitrógeno ha-1, con y sin Azospirillum brasilense. En el sintético VS- 535 se registró el mayor rendimiento de grano (5.23 t ha-1). En las dosis de 0, 30, 60 y 90 kg de N ha-1 se registraron 4.38, 4.36, 4.81 y 4.93 t ha-1, respectivamente. La diferencia entre aplicar o no Azospirillum brasilense (promedio sobre l...

  1. Study of the rhizobacterium Azospirillum brasilense Sp245 using Mössbauer spectroscopy with a high velocity resolution: Implication for the analysis of ferritin-like iron cores

    Science.gov (United States)

    Alenkina, I. V.; Oshtrakh, M. I.; Tugarova, A. V.; Biró, B.; Semionkin, V. A.; Kamnev, A. A.

    2014-09-01

    The results of a comparative study of two samples of the rhizobacterium Azospirillum brasilense (strain Sp245) prepared in different conditions and of human liver ferritin using Mössbauer spectroscopy with a high velocity resolution demonstrated the presence of ferritin-like iron (i.e. iron similar to that found in ferritin-like proteins) in the bacterium. Mössbauer spectra of these samples were fitted in two ways: as a rough approximation using a one quadrupole doublet fit (the homogeneous iron core model) and using a superposition of quadrupole doublets (the heterogeneous iron core model). Both results demonstrated differences in the Mössbauer parameters for mammalian ferritin and for bacterial ferritin-like iron. Moreover, some differences in the Mössbauer parameters were observed between the two samples of A. brasilense Sp245 related to the differences in their preparation conditions.

  2. PRODUTIVIDADE DO TRIGO IRRIGADO SUBMETIDO À APLICAÇÃO DE NITROGÊNIO E À INOCULAÇÃO COM AZOSPIRILLUM BRASILENSE

    Directory of Open Access Journals (Sweden)

    Pedro Henrique Marques Paula Nunes

    2015-02-01

    Full Text Available Inocular sementes de trigo com Azospirillum brasilense pode ser benéfico à cultura do trigo, bem como reduzir a necessidade de aplicação de N. No entanto, são escassos trabalhos que mensurem o benefício dessa prática no trigo irrigado com expectativa de alta produtividade e demanda de N. Objetivou-se com este trabalho avaliar a produtividade e o conteúdo de N na planta do trigo irrigado, submetido a doses de N, com ou sem a inoculação com A. brasilense. Foram conduzidos dois experimentos em 2011 e repetidos em 2012. Em cada ano de cultivo, instalou-se um experimento na área considerada de baixa disponibilidade de N no solo (cultivo em sucessão ao milho e outro na com alta disponibilidade (cultivo em sucessão à soja ou cenoura. Os tratamentos consistiram de cinco doses de N e da inoculação ou não com A. brasilense. As doses de N testadas foram 20, 60, 100, 140 e 180 kg ha-1 na área com baixa disponibilidade de N e 20, 50, 80, 110 e 140 kg ha-1 na com alta disponibilidade. O teor de N na folha índice foi aumentado pela inoculação com A. brasilense. Entretanto, o N absorvido não foi influenciado pela inoculação da bactéria. As doses de N aumentaram a produtividade do trigo e esse aumento foi mais evidente no cultivo na área com baixa disponibilidade de N no solo.

  3. Genome Sequence of Azospirillum brasilense CBG497 and Comparative Analyses of Azospirillum Core and Accessory Genomes provide Insight into Niche Adaptation

    OpenAIRE

    Victor González; Alberto Mendoza Herrera; Valérie Barbe; Zoé Rouy; Claire Prigent-Combaret; Benoît Drogue; Stéphanie Borland; Erika Acosta-Cruz; Luis Lozano; Florence Wisniewski-Dyé; Patrick Mavingui

    2012-01-01

    Bacteria of the genus Azospirillum colonize roots of important cereals and grasses, and promote plant growth by several mechanisms, notably phytohormone synthesis. The genomes of several Azospirillum strains belonging to different species, isolated from various host plants and locations, were recently sequenced and published. In this study, an additional genome of an A. brasilense strain, isolated from maize grown on an alkaline soil in the northeast of Mexico, strain CBG497, was obtained. Co...

  4. Evidence for ferritin as dominant iron-bearing species in the rhizobacterium Azospirillum brasilense Sp7 provided by low-temperature/in-field Mössbauer spectroscopy.

    Science.gov (United States)

    Kovács, Krisztina; Kamnev, Alexander A; Pechoušek, Jiří; Tugarova, Anna V; Kuzmann, Ernő; Machala, Libor; Zbořil, Radek; Homonnay, Zoltán; Lázár, Károly

    2016-02-01

    For the ubiquitous diazotrophic rhizobacterium Azospirillum brasilense, which has been attracting the attention of researchers worldwide for the last 35 years owing to its significant agrobiotechnological and phytostimulating potential, the data on iron acquisition and its chemical speciation in cells are scarce. In this work, for the first time for azospirilla, low-temperature (at 80 K, 5 K, as well as at 2 K without and with an external magnetic field of 5 T) transmission Mössbauer spectroscopic studies were performed for lyophilised biomass of A. brasilense (wild-type strain Sp7 grown with (57)Fe(III) nitrilotriacetate complex as the sole source of iron) to enable quantitative chemical speciation analysis of the intracellular iron. In the Mössbauer spectrum at 80 K, a broadened quadrupole doublet of high-spin iron(III) was observed with a few percent of a high-spin iron(II) contribution. In the spectrum measured at 5 K, a dominant magnetically split component appeared with the parameters typical of ferritin species from other bacteria, together with a quadrupole doublet of a superparamagnetic iron(III) component and a similarly small contribution from the high-spin iron(II) component. The Mössbauer spectra recorded at 2 K (with or without a 5 T external field) confirmed the assignment of ferritin species. About 20 % of total Fe in the dry cells of A. brasilense strain Sp7 were present in iron(III) forms superparamagnetic at both 5 and 2 K, i.e. either different from ferritin cores or as ferritin components with very small particle sizes. Graphical abstract Low-temperature Mössbauer spectroscopic data for lyophilised biomass of the rhizobacterium Azospirillum brasilense Sp7 provide quantitative information on various cellular FeIII and FeII chemical species. PMID:26769130

  5. The ipdC, hisC1 and hisC2 genes involved in indole-3-acetic production used as alternative phylogenetic markers in Azospirillum brasilense.

    Science.gov (United States)

    Jijón-Moreno, Saúl; Marcos-Jiménez, Cynthia; Pedraza, Raúl O; Ramírez-Mata, Alberto; de Salamone, I García; Fernández-Scavino, Ana; Vásquez-Hernández, Claudia A; Soto-Urzúa, Lucia; Baca, Beatriz E

    2015-06-01

    Plant growth-promoting bacteria of the genus Azospirillum are present in the rhizosphere and as endophytes of many crops. In this research we studied 40 Azospirillum strains isolated from different plants and geographic regions. They were first characterized by 16S rDNA restriction analysis, and their phylogenetic position was established by sequencing the genes 16S rDNA, ipdC, hisC1, and hisC2. The latter three genes are involved in the indole-3-pyruvic acid (IPyA) biosynthesis pathway of indole-3-acetic acid (IAA). Furthermore, the suitability of the 16S-23S rDNA intergenic spacer sequence (IGS) for the differentiation of closely related Azospirillum taxa and development of PCR protocols allows for specific detection of strains. The IGS-RFLP analysis enabled intraspecies differentiation, particularly of Azospirillum brasilense and Azospirillum lipoferum strains. Results demonstrated that the ipdC, hisC1, and hisC2 genes are highly conserved in all the assessed A. brasilense isolates, suggesting that these genes can be used as an alternative phylogenetic marker. In addition, IAA production determined by HPLC ranged from 0.17 to 98.2 μg mg(-1) protein. Southern hybridization with the A. brasilense ipdC gene probe did not show, a hybridization signal with A. lipoferum, Azospirillum amazonense, Azospirillum halopreferans and Azospirillum irakense genomic DNA. This suggests that these species produce IAA by other pathways. Because IAA is mainly synthesized via the IPyA pathway in A. brasilense strains, a species that is used worldwide in agriculture, the identification of ipdC, hisC1, and hisC2 genes by PCR may be suitable for selecting exploitable strains. PMID:25842039

  6. Characterization of Cell Surface and EPS Remodeling of Azospirillum brasilense Chemotaxis-like 1 Signal Transduction Pathway mutants by Atomic Force Microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Billings, Amanda N [ORNL; Siuti, Piro [ORNL; Bible, Amber [University of Tennessee, Knoxville (UTK); Alexandre, Gladys [University of Tennessee, Knoxville (UTK); Retterer, Scott T [ORNL; Doktycz, Mitchel John [ORNL; Morrell-Falvey, Jennifer L [ORNL

    2011-01-01

    To compete in complex microbial communities, bacteria must quickly sense environmental changes and adjust cellular functions for optimal growth. Chemotaxis-like signal transduction pathways are implicated in the modulation of multiple cellular responses, including motility, EPS production, and cell-to-cell interactions. Recently, the Che1 chemotaxis-like pathway from Azospirillum brasilense was shown to modulate flocculation. In A. brasilense, cell surface properties, including EPS production, are thought to play a direct role in promoting flocculation. Using atomic force microscopy (AFM), we have detected distinct changes in the surface morphology of flocculating A. brasilense Che1 mutant strains that are absent in the wild type strain. Whereas the wild type strain produces a smooth mucosal extracellular matrix, the flocculating Che1 mutant strains produce distinctive extracellular fibril structures. Further analyses using flocculation inhibition and lectin-binding assays suggest that the composition of EPS components in the extracellular matrix differs between the cheA1 and cheY1 mutants, despite an apparent similarity in the macroscopic floc structures. Collectively, these data indicate that mutations in the Che1 pathway that result in increased flocculation are correlated with distinctive changes in the extracellular matrix structure produced by the mutants, including likely changes in the EPS structure and/or composition.

  7. Characterization of cell surface and extracellular matrix remodeling of Azospirillum brasilense chemotaxis-like 1 signal transduction pathway mutants by atomic force microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Doktycz, Mitchel John [ORNL; Morrell-Falvey, Jennifer L [ORNL

    2011-01-01

    To compete in complex microbial communities, bacteria must sense environmental changes and adjust cellular functions for optimal growth. Chemotaxis-like signal transduction pathways are implicated in the regulation of multiple behaviors in response to changes in the environment, including motility patterns, exopolysaccharide production, and cell-to-cell interactions. In Azospirillum brasilense, cell surface properties, including exopolysaccharide production, are thought to play a direct role in promoting flocculation. Recently, the Che1 chemotaxis-like pathway from A. brasilense was shown to modulate flocculation, suggesting an associated modulation of cell surface properties. Using atomic force microscopy, distinct changes in the surface morphology of flocculating A. brasilense Che1 mutant strains were detected. Whereas the wild-type strain produces a smooth mucosal extracellular matrix after 24 h, the flocculating Che1 mutant strains produce distinctive extracellular fibril structures. Further analyses using flocculation inhibition, lectin-binding assays, and comparison of lipopolysaccharides profiles suggest that the extracellular matrix differs between the cheA1 and the cheY1 mutants, despite an apparent similarity in the macroscopic floc structures. Collectively, these data indicate that disruption of the Che1 pathway is correlated with distinctive changes in the extracellular matrix, which likely result from changes in surface polysaccharides structure and/or composition.

  8. Effect of ATP and 2-oxoglutarate on the in vitro interaction between the NifA GAF domain and the GlnB protein of Azospirillum brasilense

    Energy Technology Data Exchange (ETDEWEB)

    Sotomaior, P.; Araújo, L.M.; Nishikawa, C.Y.; Huergo, L.F.; Monteiro, R.A.; Pedrosa, F.O.; Chubatsu, L.S.; Souza, E.M. [Departamento de Bioquímica e Biologia Molecular, Universidade Federal do Paraná, Curitiba, PR (Brazil)

    2012-09-21

    Azospirillum brasilense is a diazotroph that associates with important agricultural crops and thus has potential to be a nitrogen biofertilizer. The A. brasilense transcription regulator NifA, which seems to be constitutively expressed, activates the transcription of nitrogen fixation genes. It has been suggested that the nitrogen status-signaling protein GlnB regulates NifA activity by direct interaction with the NifA N-terminal GAF domain, preventing the inhibitory effect of this domain under conditions of nitrogen fixation. In the present study, we show that an N-terminal truncated form of NifA no longer required GlnB for activity and lost regulation by ammonium. On the other hand, in trans co-expression of the N-terminal GAF domain inhibited the N-truncated protein in response to fixed nitrogen levels. We also used pull-down assays to show in vitro interaction between the purified N-terminal GAF domain of NifA and the GlnB protein. The results showed that A. brasilense GlnB interacts directly with the NifA N-terminal domain and this interaction is dependent on the presence of ATP and 2-oxoglutarate.

  9. Nitrogen fixation associated with development and localization of mixed populations of Cellulomonas species and Azospirillium brasilense grown on cellulose or wheat straw

    Energy Technology Data Exchange (ETDEWEB)

    Halsall, D.M.; Goodchild, D.J.

    1986-04-01

    Mixed cultures of Cellulomonas sp. and Azospirillum brasilense were grown with straw or cellulose as the carbon source under conditions favoring the fixation of atmospheric nitrogen. Rapid increases in cell numbers, up to 10/sup 9/ cells per g of substrate, were evident after 4 and 5 days of incubation at 30 degrees C for cellulose and straw, respectively. Nitrogen fixation (detected by acetylene reduction measured on parallel cultures) commenced after 2 and 4 days of incubation for straw and cellulose, respectively, and continued for the duration of the experiment. Pure cultures of Cellulomonas sp. showed an increase in cell numbers, but CO/sub 2/ production was low, and acetylene reduction was not detected on either cellulose or straw. Pure cultures of A. brasilense on cellulose showed an inital increase in cell numbers (10/sup 7/ cells per g of substrate) over 4 days, followed by a decline presumably caused by the exhaustion of available carbon substrate. On straw, A. brasilense increased to 10/sup 9/ cells per g of substrate over 5 days and then declined slowly; this growth was accompanied by acetylene reduction. Scanning electron micrographs of straw incubated with a mixture under the above conditions for 8 days showed cells of both species in close proximity to each other. Evidence was furnished that the close spatial relatioship of cells from the two species facilitated the mutally beneficial association between them and thus increased the efficiency with which the products of straw breakdown were used for nitrogen fixation. 17 references.

  10. Effect of ATP and 2-oxoglutarate on the in vitro interaction between the NifA GAF domain and the GlnB protein of Azospirillum brasilense

    International Nuclear Information System (INIS)

    Azospirillum brasilense is a diazotroph that associates with important agricultural crops and thus has potential to be a nitrogen biofertilizer. The A. brasilense transcription regulator NifA, which seems to be constitutively expressed, activates the transcription of nitrogen fixation genes. It has been suggested that the nitrogen status-signaling protein GlnB regulates NifA activity by direct interaction with the NifA N-terminal GAF domain, preventing the inhibitory effect of this domain under conditions of nitrogen fixation. In the present study, we show that an N-terminal truncated form of NifA no longer required GlnB for activity and lost regulation by ammonium. On the other hand, in trans co-expression of the N-terminal GAF domain inhibited the N-truncated protein in response to fixed nitrogen levels. We also used pull-down assays to show in vitro interaction between the purified N-terminal GAF domain of NifA and the GlnB protein. The results showed that A. brasilense GlnB interacts directly with the NifA N-terminal domain and this interaction is dependent on the presence of ATP and 2-oxoglutarate

  11. Europe has good options. War in Kosovo will nearly have no consequence at all on the evolution of the crude oil price; Europa besitzt gute Optionen. Der Krieg im Kosovo wird die Rohoelpreisentwicklung kaum beeinflussen

    Energy Technology Data Exchange (ETDEWEB)

    Hoehn, J

    1999-07-01

    War in the Balkan has implications also in energy matters. The crude oil price on the spot markets suddenly and massively increased. In addition, Germany plans to abandon nuclear energy at mid term. However, according to Tatsuo Masuda, Director of the Oil Markets and Crisis Management Division of the International Energy Agency (IEA) since 1996, there is no reason for immediate anxiety. (author) [German] Der Krieg im Balkan ist auch im Energiebereich nicht ohne Folgen geblieben: Die Rohoelpreise an den Spotmaerkten haben kurzfristig kraeftig angezogen. Zudem beabsichtigt Deutschland mittelfristig den Ausstieg aus der Atomenergie. Trotzdem besteht fuer Tatsuo Masuda, seit 1996 Direktor der Abteilung Oel-Maerkte und Krisenmanagement bei der Internationalen Energieagentur (IEA), kein Grund zur unmittelbaren Sorge. (author)

  12. „Das ist ein Traum, der fast zwanzig Jahre dauert“. Über die Suche nach individuellen Erinnerungsformen bosnisch-herzegowinischer Frauen und Männer in Berlin zum Umgang mit den Erfahrungen von Krieg, Flucht und Unsicherheit

    Directory of Open Access Journals (Sweden)

    Heyken, Edda

    2014-08-01

    Full Text Available Die Erinnerungen an Krieg und Flucht wiegen besonders schwer und verlangen nicht nur Energie, Behutsamkeit und Sensibilität im Umgang mit den Betroffenen, sondern beeinflussen auch ihren Tagesablauf. Teilweise ist die Schwere der Vergangenheit so erdrückend, dass das Individuum ganz davon vereinnahmt wird und von einem normalen Alltag nicht mehr die Rede sein kann. Unscheinbar wirkende Impulse versetzen die Betroffenen zurück in einen Zustand aus Angst, Unsicherheit und Misstrauen. Auf die Frauen und Männer, die vor der unvorstellbaren Gewalt und Bedrohung des Bosnienkrieges nach Berlin geflohen sind, trifft diese Beschreibung sehr häufig zu. Doch nicht nur die Erinnerungen an den Krieg belasten die Männer und Frauen, auch die Situation nach der Ankunft in Berlin brachte viel Leid mit sich. Durch den langjährigen unsicheren Aufenthaltsstatus als ‚Geduldeter‘ wurden die bereits bestehenden Probleme auf sozialer und wirtschaftlicher Ebene intensiviert und für die Betroffenen wurde es nahezu unmöglich, die psychischen Wunden heilen lassen zu können. Dieser Artikel veranschaulicht die unterschiedlichen Formen der Vergangenheitsannäherung bosnischer Flüchtlinge in Berlin, ihre Beeinflussung durch bestimmte Alltagssituationen bzw. Stressoren, sowie ihre Relation zu biografischen Hintergründen, Generation und Geschlecht. Die Art der Erinnerung lässt dabei Rückschlüsse auf den individuellen Umgang mit der Vergangenheit zu. Anhand verschiedener Narrationen kristallisiert sich der unterschiedliche Umgang mit der Vergangenheit auf einerseits reflektiert-distanzierter und andererseits wiedererlebend-emotionaler Ebene heraus.

  13. Características agronômicas do trigo em função de Azospirillum brasilense, ácidos húmicos e nitrogênio em casa de vegetação

    OpenAIRE

    Luan F. O. S. Rodrigues; Vandeir F. Guimarães; Mônica B. da Silva; Artur S. Pinto Junior; Jeferson Klein; Andreia C. P. R. da Costa

    2014-01-01

    Objetivou-se, neste estudo, verificar o efeito do uso combinado de Azospirillum brasilense, ácidos húmicos e diferentes doses de nitrogênio nas características agronômicas do trigo. Os experimentos foram instalados no dia 21 de maio de 2011 e a colheita foi procedida no dia 13 de setembro de 2011. O delineamento experimental adotado foi o de blocos casualizados em esquema fatorial 4 x 4, com quatro repetições. O primeiro fator se refere à combinação da estirpe Ab-V5 de A. brasilense com os ác...

  14. Maize growth promotion by inoculation with Azospirillum brasilense and metabolites of Rhizobium tropici enriched on lipo-chitooligosaccharides (LCOs).

    Science.gov (United States)

    Marks, Bettina Berquó; Megías, Manuel; Ollero, Francisco Javier; Nogueira, Marco Antonio; Araujo, Ricardo Silva; Hungria, Mariangela

    2015-12-01

    There is an increasing interest in the development and use of inoculants carrying plant growth-promoting bacteria (PGPB) in crops of agronomic interest. The great majority of the inoculants commercialized worldwide contain rhizobia for legume crops, but the use of PGPB as Azospirillum spp. for non-legume is expanding, as well as of inoculants combining microorganisms and microbial metabolites. In this study we evaluated the effects of inoculants containing Azospirillum brasilense with or without metabolites of Rhizobium tropici strain CIAT 899 highly enriched in lipo-chitooligosaccharides (LCOs) in six field experiments performed for three summer crop seasons in Brazil with maize (Zea mays L.). Inoculants and metabolites were applied either at sowing by seed inoculation, or by leaf spray at the V3 stage of plant growth. Improvement in shoot dry weight (SDW) and total N accumulated in shoots (TNS) by single, but especially by dual inoculation was observed in some of the experiments. Statistically significant increases in grain yield in relation to the non-inoculated control were observed in five out of six experiments when maize was inoculated with Azospirillum supplied with enriched metabolites of R. tropici applied by seed or leaf spray inoculation. The results give strength to the development of a new generation of inoculants carrying microorganisms and microbial molecules. PMID:26567001

  15. Structure and thermodynamics of effector molecule binding to the nitrogen signal transduction PII protein GlnZ from Azospirillum brasilense.

    Science.gov (United States)

    Truan, Daphné; Bjelić, Saša; Li, Xiao-Dan; Winkler, Fritz K

    2014-07-29

    The trimeric PII signal transduction proteins regulate the function of a variety of target proteins predominantly involved in nitrogen metabolism. ATP, ADP and 2-oxoglutarate (2-OG) are key effector molecules influencing PII binding to targets. Studies of PII proteins have established that the 20-residue T-loop plays a central role in effector sensing and target binding. However, the specific effects of effector binding on T-loop conformation have remained poorly documented. We present eight crystal structures of the Azospirillum brasilense PII protein GlnZ, six of which are cocrystallized and liganded with ADP or ATP. We find that interaction with the diphosphate moiety of bound ADP constrains the N-terminal part of the T-loop in a characteristic way that is maintained in ADP-promoted complexes with target proteins. In contrast, the interactions with the triphosphate moiety in ATP complexes are much more variable and no single predominant interaction mode is apparent except for the ternary MgATP/2-OG complex. These conclusions can be extended to most investigated PII proteins of the GlnB/GlnK subfamily. Unlike reported for other PII proteins, microcalorimetry reveals no cooperativity between the three binding sites of GlnZ trimers for any of the three effectors under carefully controlled experimental conditions. PMID:24846646

  16. Physiological, structural and molecular traits activated in strawberry plants after inoculation with the plant growth-promoting bacterium Azospirillum brasilense REC3.

    Science.gov (United States)

    Guerrero-Molina, M F; Lovaisa, N C; Salazar, S M; Martínez-Zamora, M G; Díaz-Ricci, J C; Pedraza, R O

    2015-05-01

    The plant growth-promoting strain REC3 of Azospirillum brasilense, isolated from strawberry roots, prompts growth promotion and systemic protection against anthracnose disease in this crop. Hence, we hypothesised that A. brasilense REC3 can induce different physiological, structural and molecular responses in strawberry plants. Therefore, the aim of this work was to study these traits activated in Azospirillum-colonised strawberry plants, which have not been assessed until now. Healthy, in vitro micropropagated plants were root-inoculated with REC3 under hydroponic conditions; root and leaf tissues were sampled at different times, and oxidative burst, phenolic compound content, malondialdehyde (MDA) concentration, callose deposition, cell wall fortification and gene expression were evaluated. Azospirillum inoculation enhanced levels of soluble phenolic compounds after 12 h post-inoculation (hpi), while amounts of cell wall bound phenolics were similar in inoculated and control plants. Other early responses activated by REC3 (at 24 hpi) were a decline of lipid peroxidation and up-regulation of strawberry genes involved in defence (FaPR1), bacterial recognition (FaFLS2) and H₂O₂ depuration (FaCAT and FaAPXc). The last may explain the apparent absence of oxidative burst in leaves after bacterial inoculation. Also, REC3 inoculation induced delayed structural responses such as callose deposition and cell wall fortification (at 72 hpi). Results showed that A. brasilense REC3 is capable of exerting beneficial effects on strawberry plants, reinforcing their physiological and cellular characteristics, which in turns contribute to improve plant performance. PMID:25280241

  17. Gene encoding γ-carbonic anhydrase is cotranscribed with argC and induced in response to stationary phase and high CO2 in Azospirillum brasilense Sp7

    Directory of Open Access Journals (Sweden)

    Mishra Mukti N

    2010-07-01

    Full Text Available Abstract Background Carbonic anhydrase (CA is a ubiquitous enzyme catalyzing the reversible hydration of CO2 to bicarbonate, a reaction underlying diverse biochemical and physiological processes. Gamma class carbonic anhydrases (γ-CAs are widespread in prokaryotes but their physiological roles remain elusive. At present, only γ-CA of Methanosarcina thermophila (Cam has been shown to have CA activity. Genome analysis of a rhizobacterium Azospirillum brasilense, revealed occurrence of ORFs encoding one β-CA and two γ-CAs. Results One of the putative γ-CA encoding genes of A. brasilense was cloned and overexpressed in E. coli. Electrometric assays for CA activity of the whole cell extracts overexpressing recombinant GCA1 did not show CO2 hydration activity. Reverse transcription-PCR analysis indicated that gca1 in A. brasilense is co-transcribed with its upstream gene annotated as argC, which encodes a putative N-acetyl-γ-glutamate-phosphate reductase. 5'-RACE also demonstrated that there was no transcription start site between argC and gca1, and the transcription start site located upstream of argC transcribed both the genes (argC-gca1. Using transcriptional fusions of argC-gca1 upstream region with promoterless lacZ, we further demonstrated that gca1 upstream region did not have any promoter and its transcription occurred from a promoter located in the argC upstream region. The transcription of argC-gca1 operon was upregulated in stationary phase and at elevated CO2 atmosphere. Conclusions This study shows lack of CO2 hydration activity in a recombinant protein expressed from a gene predicted to encode a γ-carbonic anhydrase in A. brasilense although it cross reacts with anti-Cam antibody raised against a well characterized γ-CA. The organization and regulation of this gene along with the putative argC gene suggests its involvement in arginine biosynthetic pathway instead of the predicted CO2 hydration.

  18. Convergent synthesis of a tetrasaccharide repeating unit of the O-specific polysaccharide from the cell wall lipopolysaccharide of Azospirillum brasilense strain Sp7

    OpenAIRE

    Pintu Kumar Mandal; Debashis Dhara; Anup Kumar Misra

    2014-01-01

    A straightforward convergent synthesis has been carried out for the tetrasaccharide repeating unit of the O-specific cell wall lipopolysaccharide of the strain Sp7 of Azospirillum brasilense. The target tetrasaccharide has been synthesized from suitably protected monosaccharide intermediates in 42% overall yield in seven steps by using a [2 + 2] block glycosylation approach.

  19. Genome Sequence of Azospirillum brasilense CBG497 and Comparative Analyses of Azospirillum Core and Accessory Genomes provide Insight into Niche Adaptation

    Directory of Open Access Journals (Sweden)

    Victor González

    2012-09-01

    Full Text Available Bacteria of the genus Azospirillum colonize roots of important cereals and grasses, and promote plant growth by several mechanisms, notably phytohormone synthesis. The genomes of several Azospirillum strains belonging to different species, isolated from various host plants and locations, were recently sequenced and published. In this study, an additional genome of an A. brasilense strain, isolated from maize grown on an alkaline soil in the northeast of Mexico, strain CBG497, was obtained. Comparative genomic analyses were performed on this new genome and three other genomes (A. brasilense Sp245, A. lipoferum 4B and Azospirillum sp. B510. The Azospirillum core genome was established and consists of 2,328 proteins, representing between 30% to 38% of the total encoded proteins within a genome. It is mainly chromosomally-encoded and contains 74% of genes of ancestral origin shared with some aquatic relatives. The non-ancestral part of the core genome is enriched in genes involved in signal transduction, in transport and in metabolism of carbohydrates and amino-acids, and in surface properties features linked to adaptation in fluctuating environments, such as soil and rhizosphere. Many genes involved in colonization of plant roots, plant-growth promotion (such as those involved in phytohormone biosynthesis, and properties involved in rhizosphere adaptation (such as catabolism of phenolic compounds, uptake of iron are restricted to a particular strain and/or species, strongly suggesting niche-specific adaptation.

  20. The cyclic-di-GMP diguanylate cyclase CdgA has a role in biofilm formation and exopolysaccharide production in Azospirillum brasilense.

    Science.gov (United States)

    Ramírez-Mata, Alberto; López-Lara, Lilia I; Xiqui-Vázquez, Ma Luisa; Jijón-Moreno, Saúl; Romero-Osorio, Angelica; Baca, Beatriz E

    2016-04-01

    In bacteria, proteins containing GGDEF domains are involved in production of the second messenger c-di-GMP. Here we report that the cdgA gene encoding diguanylate cyclase A (CdgA) is involved in biofilm formation and exopolysaccharide (EPS) production in Azospirillum brasilense Sp7. Biofilm quantification using crystal violet staining revealed that inactivation of cdgA decreased biofilm formation. In addition, confocal laser scanning microscopy analysis of green-fluorescent protein-labeled bacteria showed that, during static growth, the biofilms had differential levels of development: bacteria harboring a cdgA mutation exhibited biofilms with considerably reduced thickness compared with those of the wild-type Sp7 strain. Moreover, DNA-specific staining and treatment with DNase I, and epifluorescence studies demonstrated that extracellular DNA and EPS are components of the biofilm matrix in Azospirillum. After expression and purification of the CdgA protein, diguanylate cyclase activity was detected. The enzymatic activity of CdgA-producing cyclic c-di-GMP was determined using GTP as a substrate and flavin adenine dinucleotide (FAD(+)) and Mg(2)(+) as cofactors. Together, our results revealed that A. brasilense possesses a functional c-di-GMP biosynthesis pathway. PMID:26708984

  1. A SAM-dependent methyltransferase cotranscribed with arsenate reductase alters resistance to peptidyl transferase center-binding antibiotics in Azospirillum brasilense Sp7.

    Science.gov (United States)

    Singh, Sudhir; Singh, Chhaya; Tripathi, Anil Kumar

    2014-05-01

    The genome of Azospirillum brasilense harbors a gene encoding S-adenosylmethionine-dependent methyltransferase, which is located downstream of an arsenate reductase gene. Both genes are cotranscribed and translationally coupled. When they were cloned and expressed individually in an arsenate-sensitive strain of Escherichia coli, arsenate reductase conferred tolerance to arsenate; however, methyltransferase failed to do so. Sequence analysis revealed that methyltransferase was more closely related to a PrmB-type N5-glutamine methyltransferase than to the arsenate detoxifying methyltransferase ArsM. Insertional inactivation of prmB gene in A. brasilense resulted in an increased sensitivity to chloramphenicol and resistance to tiamulin and clindamycin, which are known to bind at the peptidyl transferase center (PTC) in the ribosome. These observations suggested that the inability of prmB:km mutant to methylate L3 protein might alter hydrophobicity in the antibiotic-binding pocket of the PTC, which might affect the binding of chloramphenicol, clindamycin, and tiamulin differentially. This is the first report showing the role of PrmB-type N5-glutamine methyltransferases in conferring resistance to tiamulin and clindamycin in any bacterium. PMID:24573606

  2. Chemical composition and deoxynivalenol in wheat of Central- Southern Paraná: nitrogen fertilization in top dressing associated with Azospirillum brasilense

    Directory of Open Access Journals (Sweden)

    Thiago Montagner Souza

    2014-02-01

    Full Text Available The impact of agricultural management practices on the quality of grain was evaluated in wheat (Triticum aestivum L. BRS Tangará from the South Central region of Paraná State (Ponta Grossa in the crop years of 2010 and 2011. The field trial was carried out in succession with soybean (2010 and corn (2011. The treatments included inoculation of seeds with Azospirillum brasilense and increasing levels of nitrogen application in top dressing (0, 30, 60, 90 and 120 kg ha-1. The experimental design was in randomized block, factorial 2 x 5 (inoculation x N levels, with four replications. The parameters evaluated were water activity, moisture, protein, and grain contamination by deoxynivalenol (DON. The data were subjected to analysis of variance, comparison of means by Tukey’s test (p<0.05 and regression for nitrogen levels. The inoculation of seeds with A. brasilense increased the protein content in grain in 2010 (+1.6%; 16.9 g 100g-1 and 2011 (+1.7%, 15.7 g 100g-1, independently of the nitrogen level (p<0.01. Levels of nitrogen in 2010 presented a positive linear response with protein content, increasing by 14.2% using non-inoculated seeds (p<0.01, R2=0.955 and 14.4% for those inoculated with A. brasilense (p<0.01, R2=0.906. However, in 2011 a quadratic response was observed between nitrogen levels and protein content (p<0.01, R2=0.99, with stabilization or reduction in protein content using high levels of nitrogen (?120 kg ha-1. The contamination by DON was greater using high levels of nitrogen (3574 ?g kg-1, 120 kg ha-1; non-inoculated seeds in 2011, with a quadratic response between nitrogen levels and contamination of grains (p<0.05, R2=0.772. Furthermore, 37.5% of the samples presented contamination by DON higher than the maximum tolerated limit established by Brazilian legislation (2000 ?g kg-1; whole-wheat grain. The data demonstrates that proper management of nitrogen enhances intrinsic effects arising from plant breeding.

  3. Synthesis of the tetrasaccharide repeating unit of the O-glycan from the polar flagellum flagellin of Azospirillum brasilense Sp7.

    Science.gov (United States)

    Pal, Kumar Bhaskar; Mukhopadhyay, Balaram

    2014-12-01

    Chemical synthesis of the tetrasaccharide repeating unit of the O-glycan from the polar flagellum flagellin of Azospirillum brasilense Sp7 in the form of its p-methoxyphenyl glycoside is reported. The required glycosidic linkages have been accomplished by activation of thioglycosides with N-iodosuccinimide in the presence of H2SO4-silica. H2SO4-silica was found to be an effective alternative to the classical acid promoters like TfOH or TMSOTf and it can lead to the formation of both 1,2-cis and 1,2-trans glycosidic linkages depending on the protecting group manipulation and control of the reaction condition. PMID:25299938

  4. Adubação nitrogenada associada à inoculação com Azospirillum brasilense e Herbaspirillum seropedicae na cultura do milho

    Directory of Open Access Journals (Sweden)

    Janaína Dartora

    2013-10-01

    Full Text Available Bactérias dos gêneros Azospirillum e Herbaspirillum são fixadoras de nitrogênio (N atmosférico e consideradas promotoras do crescimento vegetal. Desta forma, desenvolveu-se o presente trabalho com o objetivo de avaliar o desenvolvimento e a produtividade do milho em resposta à inoculação de A. brasilense e H. seropedicae associada à adubação nitrogenada. O experimento foi conduzido em delineamento experimental de blocos ao acaso em esquema fatorial 4 x 5, com quatro repetições. Os tratamentos foram constituídos da inoculação de sementes (testemunha, estirpe de A. brasilense - Ab-V5, estirpe de H. seropedicae - SmR1 e combinação Ab-V5 + SmR1 e doses de N (0, 40, 80, 120 e 160 kg ha-1 de N. Foram avaliados: diâmetro basal do colmo, altura de planta, matéria seca de parte aérea e área foliar, nas fases vegetativa e reprodutiva, e produtividade. A adubação nitrogenada favoreceu o desenvolvimento da cultura até a máxima dose estudada. A inoculação combinada das estirpes proporcionou incrementos de 12% na matéria seca de parte aérea e 7% na produtividade em relação à testemunha indicando benefícios da combinação de bactérias diazotróficas que interagem de forma diferenciada com a planta.

  5. [Insertional mutation in the AZOBR_p60120 gene is accompanied by defects in the synthesis of lipopolysaccharide and calcofluor-binding polysaccharides in the bacterium Azospirillum brasilense Sp245].

    Science.gov (United States)

    Katsy, E I; Prilipov, A G

    2015-03-01

    In the bacterium Azospirillum brasilense Sp245, extracellular calcofluor-binding polysaccharides (Cal+ phenotype) and two types of lipopolysaccharides, LPSI and LPSII, were previously identified. These lipopolysaccharides share the same repeating O-polysaccharide unit but have different antigenic structures and different charges of their O-polysaccharides and/or core oligosaccharides. Several dozens of predicted genes involved in the biosynthesis of polysaccharides have been localized in the AZOBR_p6 plasmid of strain Sp245 (GenBank accession no. HE577333). In the present work, it was demonstrated that an artificial transposon Omegon-Km had inserted into the central region of the AZOBR_p60120 gene in the A. brasilense Sp245 LPSI- Cal- KM252 mutant. In A. brasilense strain Sp245, this plasmid gene encodes a putative glycosyltransferase containing conserved domains characteristic of the enzymes participating in the synthesis of O-polysaccharides and capsular polysaccharides (accession no. YP004987664). In mutant KM252, a respective predicted protein is expected to be completely inactivated. As a result of the analysis of the EcoRI fragment of the AZOBR_p6 plasmid, encompassing the AZOBR_p60120 gene and a number of other loci, novel data on the structure of AZOBR_p6 were obtained: an approximately 5-kb gap (GenBank accession no. KM189439) was closed in the nucleotide sequence of this plasmid. PMID:26027369

  6. Coberturas vegetais, doses de nitrogênio e inoculação de sementes com Azospirillum brasilense em arroz de terras altas no sistema plantio direto

    Directory of Open Access Journals (Sweden)

    Douglas de Castilho Gitti

    2012-01-01

    Full Text Available O arroz é importante fonte de energia e proteínas para a população mundial, principalmente na Ásia e Oceania. No Brasil, juntamente com o feijão, constitui a base da alimentação. Tecnologias sustentáveis que reduzam custos da produção e aumentem a produtividade do arroz podem garantir seu suprimento em períodos de alta demanda. O objetivo deste trabalho foi avaliar diferentes coberturas vegetais antecessoras (milheto [Pennisetum americanum], crotalária [Crotalaria juncea], guandu [Cajanus cajan], braquiária [Brachiaria ruziziensis], milheto + crotalária e milheto + guandu, doses de nitrogênio (N em cobertura (0, 40, 80 e 120 kg ha-1 e o efeito da inoculação de sementes com Azospirillum brasilense no arroz de terras altas em sistema plantio direto no desenvolvimento e na produtividade. Utilizou-se o delineamento experimental em blocos casualizados em esquema fatorial 6x4x2 com quatro repetições. O estudo foi desenvolvido em um Latossolo Vermelho, em Selvíria, Estado do Mato Grosso do Sul, Brasil, em 2011/2012. O cultivo do guandu antecedendo o arroz proporcionou maior produtividade do arroz somente em comparação a B. ruziziensi. A produtividade do arroz em função das doses de N em cobertura se ajustou a uma função quadrática. Não houve influência da inoculação de sementes com A. brasilense sobre a produtividade do arroz, porém houve interação entre a inoculação e as coberturas vegetais sobre o teor de N foliar, número de panículas por m², matéria seca de plantas de arroz e a massa de cem grãos.

  7. Coberturas vegetais, doses de nitrogênio e inoculação de sementes com Azospirillum brasilense em arroz de terras altas no sistema plantio direto Cover crops, nitrogen rates and seeds inoculation with Azospirillum brasilense in upland rice under no-tillage

    Directory of Open Access Journals (Sweden)

    Douglas de Castilho Gitti

    2013-01-01

    Full Text Available O arroz é importante fonte de energia e proteínas para a população mundial, principalmente na Ásia e Oceania. No Brasil, juntamente com o feijão, constitui a base da alimentação. Tecnologias sustentáveis que reduzam custos da produção e aumentem a produtividade do arroz podem garantir seu suprimento em períodos de alta demanda. O objetivo deste trabalho foi avaliar diferentes coberturas vegetais antecessoras (milheto [Pennisetum americanum], crotalária [Crotalaria juncea], guandu [Cajanus cajan], braquiária [Brachiaria ruziziensis], milheto + crotalária e milheto + guandu, doses de nitrogênio (N em cobertura (0, 40, 80 e 120 kg ha-1 e o efeito da inoculação de sementes com Azospirillum brasilense no arroz de terras altas em sistema plantio direto no desenvolvimento e na produtividade. Utilizou-se o delineamento experimental em blocos casualizados em esquema fatorial 6x4x2 com quatro repetições. O estudo foi desenvolvido em um Latossolo Vermelho, em Selvíria, Estado do Mato Grosso do Sul, Brasil, em 2011/2012. O cultivo do guandu antecedendo o arroz proporcionou maior produtividade do arroz somente em comparação a B. ruziziensi. A produtividade do arroz em função das doses de N em cobertura se ajustou a uma função quadrática. Não houve influência da inoculação de sementes com A. brasilense sobre a produtividade do arroz, porém houve interação entre a inoculação e as coberturas vegetais sobre o teor de N foliar, número de panículas por m², matéria seca de plantas de arroz e a massa de cem grãos.Rice is an important source of energy and protein for the world population, mainly in Asia and Oceania. In Brazil, together with common beans, it is the population's basic food. Sustainable technologies that reduce rice production costs and increase productivity can warrant its supply on period of high demand. The objective of this study was to evaluate different preceding cover crops (millet [Pennisetum americanum

  8. Coberturas vegetais, doses de nitrogênio e inoculação de sementes com Azospirillum brasilense em arroz de terras altas no sistema plantio direto Cover crops, nitrogen rates and seeds inoculation with Azospirillum brasilense in upland rice under no-tillage

    Directory of Open Access Journals (Sweden)

    Douglas de Castilho Gitti

    2012-01-01

    Full Text Available O arroz é importante fonte de energia e proteínas para a população mundial, principalmente na Ásia e Oceania. No Brasil, juntamente com o feijão, constitui a base da alimentação. Tecnologias sustentáveis que reduzam custos da produção e aumentem a produtividade do arroz podem garantir seu suprimento em períodos de alta demanda. O objetivo deste trabalho foi avaliar diferentes coberturas vegetais antecessoras (milheto [Pennisetum americanum], crotalária [Crotalaria juncea], guandu [Cajanus cajan], braquiária [Brachiaria ruziziensis], milheto + crotalária e milheto + guandu, doses de nitrogênio (N em cobertura (0, 40, 80 e 120 kg ha-1 e o efeito da inoculação de sementes com Azospirillum brasilense no arroz de terras altas em sistema plantio direto no desenvolvimento e na produtividade. Utilizou-se o delineamento experimental em blocos casualizados em esquema fatorial 6x4x2 com quatro repetições. O estudo foi desenvolvido em um Latossolo Vermelho, em Selvíria, Estado do Mato Grosso do Sul, Brasil, em 2011/2012. O cultivo do guandu antecedendo o arroz proporcionou maior produtividade do arroz somente em comparação a B. ruziziensi. A produtividade do arroz em função das doses de N em cobertura se ajustou a uma função quadrática. Não houve influência da inoculação de sementes com A. brasilense sobre a produtividade do arroz, porém houve interação entre a inoculação e as coberturas vegetais sobre o teor de N foliar, número de panículas por m², matéria seca de plantas de arroz e a massa de cem grãos.Rice is an important source of energy and protein for the world population, mainly in Asia and Oceania. In Brazil, together with common beans, it is the population's basic food. Sustainable technologies that reduce rice production costs and increase productivity can warrant its supply on period of high demand. The objective of this study was to evaluate different preceding cover crops (millet [Pennisetum americanum

  9. Alice Krieg, Émergence et emplois de la formule « purification ethnique » dans la presse française (1980-1994). Une analyse de discours, thèse de doctorat en sciences du langage, Université de Paris-Nord - Paris 13, novembre 2000, 3 volum

    OpenAIRE

    Fiala, Pierre

    2008-01-01

    Le sous-titre de cette thèse est des plus sobres : « une analyse de discours », mais quelle analyse de discours ! A. Krieg a présenté, au terme d’une démarche patiente et sans relâche, un travail exemplaire qui illustre la place originale et productive que ce domaine peut prendre à l’articulation des sciences du langage, de la communication et de l’histoire du temps présent. Le résultat est dense, précis, volumineux et passionnant à lire. L’ouvrage explore, dans le détail, l’apparition, le dé...

  10. Fourier transform infrared spectroscopic characterisation of heavy metal-induced metabolic changes in the plant-associated soil bacterium Azospirillum brasilense Sp7

    Science.gov (United States)

    Kamnev, A. A.; Antonyuk, L. P.; Tugarova, A. V.; Tarantilis, P. A.; Polissiou, M. G.; Gardiner, P. H. E.

    2002-06-01

    Structural and compositional features of whole cells of the plant-growth-promoting rhizobacterium Azospirillum brasilense Sp7 under standard and heavy metal-stressed conditions are analysed using Fourier transform infrared (FTIR) spectroscopy and compared with the FT-Raman spectroscopic data obtained previously [J. Mol. Struct. 563-564 (2001) 199]. The structural spectroscopic information is considered together with inductively coupled plasma-mass spectrometric (ICP-MS) analytical data on the content of the heavy metal cations (Co 2+, Cu 2+ and Zn 2+) in the bacterial cells. As a bacterial response to heavy metal stress, all the three metals, being taken up by bacterial cells from the culture medium (0.2 mM) in significant amounts (ca. 0.12, 0.48 and 4.2 mg per gram of dry biomass for Co, Cu and Zn, respectively), are shown to induce essential metabolic changes in the bacterium revealed in the spectra, including the accumulation of polyester compounds in bacterial cells and their enhanced hydration affecting certain IR vibrational modes of functional groups involved.

  11. Sequencing and promoter analysis of the nifENXorf3orf5fdxAnifQ operon from Azospirillum brasilense Sp7

    Directory of Open Access Journals (Sweden)

    Potrich D.P.

    2001-01-01

    Full Text Available A 40-kb DNA region containing the major cluster of nif genes has been isolated from the Azospirillum brasilense Sp7 genome. In this region three nif operons have been identified: nifHDKorf1Y, nifENXorf3orf5fdxAnifQ and orf2nifUSVorf4. The operons containing nifENX and nifUSV genes are separated from the structural nifHDKorf1Y operon by about 5 kb and 10 kb, respectively. The present study shows the sequence analysis of the 6045-bp DNA region containing the nifENX genes. The deduced amino acid sequences from the open reading frames were compared to the nif gene products of other diazotrophic bacteria and indicate the presence of seven ORFs, all reading in the same direction as that of the nifHDKorf1Y operon. Consensus sigma54 and NifA-binding sites are present only in the promoter region upstream of the nifE gene. This promoter is activated by NifA protein and is approximately two-times less active than the nifH promoter, as indicated by the ß-galactosidase assays. This result suggests the differential expression of the nif genes and their respective products in Azospirillum.

  12. Positive effect of reduced aeration rate on growth and stereospecificity of DL-malic acid consumption by Azospirillum brasilense: improving the shelf life of a liquid inoculant formulation.

    Science.gov (United States)

    Carrasco-Espinosa, Karen; García-Cabrera, Ramsés I; Bedoya-López, Andrea; Trujillo-Roldán, Mauricio A; Valdez-Cruz, Norma A

    2015-02-10

    Azospirillum brasilense has significance as a growth promoter in plants of commercial interest. Two industrial native strains (Start and Calf), used as a part of an inoculant formulation in Mexico during the last 15 years, were incubated in laboratory-scale pneumatic bioreactors at different aeration rates. In both strains, the positive effect of decreased aeration was observed. At the lowest (0.1 vvm, air volume/liquid volume×minute), the highest biomass were obtained for Calf (7.8 × 10(10)CFU/ml), and Start (2.9 × 10(9)CFU/ml). These were higher in one magnitude order compared to cultures carried out at 0.5 vvm, and two compared to those at 1.0 vvm. At lower aeration, both stereoisomeric forms of malic acid were consumed, but at higher aeration, just L-malate was consumed. A reduction in aeration allows an increase of the shelf life and the microorganism saved higher concentrations of polyhydroxybutyrate. The selected fermentation conditions are closely related to those prevalent in large-scale bioreactors and offer the possibility of achieving high biomass titles with high shelf life at a reduced costs, due to the complete use of a carbon source at low aeration of a low cost raw material as DL-malic acid mixture in comparison with the L-malic acid stereoisomer. PMID:25556026

  13. Promoter-trap identification of wheat seed extract-induced genes in the plant-growth-promoting rhizobacterium Azospirillum brasilense Sp245.

    Science.gov (United States)

    Pothier, Joël F; Wisniewski-Dyé, Florence; Weiss-Gayet, Michèle; Moënne-Loccoz, Yvan; Prigent-Combaret, Claire

    2007-10-01

    Azospirillum strains have been used as plant-growth-promoting rhizobacteria (PGPR) of cereal crops, but their adaptation to the root remains poorly understood. Here, we used a global approach based on differential fluorescence induction (DFI) promoter trapping to identify genes of the wheat isolate Azospirillum brasilense Sp245 that are induced in the presence of spring wheat seed extracts. Fluorescence-based flow cytometry sorting of Sp245 cells was validated using PlacZ, PsbpA and PnifH promoters and egfp. A random promoter library was constructed by cloning 1-3 kb Sp245 fragments upstream of a promoterless version of egfp in the promoter-trap plasmid pOT1e (genome coverage estimated at threefold). Exposure to spring wheat seed extracts obtained using a methanol solution led to the detection of 300 induced DFI clones, and upregulation by seed extracts was confirmed in vitro for 46 clones. Sequencing of 21 clones enabled identification of seven promoter regions. Five of them displayed upregulation once inoculated onto spring wheat seedlings. Their downstream sequence was similar to (i) a predicted transcriptional regulator, (ii) a serine/threonine protein kinase, (iii) two conserved hypothetical proteins, or (iv) the copper-containing dissimilatory nitrite reductase NirK. Two of them were also upregulated when inoculated on winter wheat and pea but not on maize, whereas the three others (including PnirK) were upregulated on the three hosts. The amounts of nitrate and/or nitrite present in spring wheat seed extracts were sufficient for PnirK upregulation. Overall, DFI promoter trapping was useful to reveal Azospirillum genes involved in the interaction with the plant. PMID:17906157

  14. Growth of Quailbush in Acidic, Metalliferous Desert Mine Tailings: Effect of Azospirillum brasilense Sp6 on Biomass Production and Rhizosphere Community Structure

    Science.gov (United States)

    de-Bashan, Luz E.; Hernandez, Juan-Pablo; Nelson, Karis N.; Bashan, Yoav

    2010-01-01

    Mine tailing deposits in semiarid and arid environments frequently remain devoid of vegetation due to the toxicity of the substrate and the absence of a diverse soil microbial community capable of supporting seed germination and plant growth. The contribution of the plant growth promoting bacterium (PGPB) Azospirillum brasilense Sp6 to the growth of quailbush in compost-amended, moderately acidic, high-metal content mine tailings using an irrigation-based reclamation strategy was examined along with its influence on the rhizosphere bacterial community. Sp6 inoculation resulted in a significant (2.2-fold) increase in plant biomass production. The data suggest that the inoculum successfully colonized the root surface and persisted throughout the 60-day experiment in both the rhizosphere, as demonstrated by excision and sequencing of the appropriate denaturing gradient gel electrophoresis (DGGE) band, and the rhizoplane, as indicated by fluorescent in situ hybridization of root surfaces. Changes in rhizosphere community structure in response to Sp6 inoculation were evaluated after 15, 30, and 60 days using DGGE analysis of 16S rRNA polymerase chain reaction amplicons. A comparison of DGGE profiles using canonical correspondence analysis revealed a significant treatment effect (Sp6-inoculated vs. uninoculated plants vs. unplanted) on bacterial community structure at 15, 30, and 60 days (p<0.05). These data indicate that in an extremely stressed environment such as acid mine tailings, an inoculated plant growth promoting bacterium not only can persist and stimulate plant growth but also can directly or indirectly influence rhizobacterial community development. PMID:20632001

  15. Elemental composition of strawberry plants inoculated with the plant growth-promoting bacterium Azospirillum brasilense REC3, assessed with scanning electron microscopy and energy dispersive X-ray analysis.

    Science.gov (United States)

    Guerrero-Molina, M F; Lovaisa, N C; Salazar, S M; Díaz-Ricci, J C; Pedraza, R O

    2014-07-01

    The elemental composition of strawberry plants (Fragaria ananassa cv. Macarena) inoculated with the plant growth-promoting bacterium Azospirillum brasilense REC3, and non-inoculated controls, was studied using scanning electron microscopy (SEM) and energy dispersive X-ray (EDS) analysis. This allowed simultaneous semi-quantification of different elements in a small, solid sample. Plants were inoculated and grown hydroponically in 50% or 100% Hoagland solution, corresponding to limited or optimum nutrient medium, respectively. Bacteria-inoculated plants increased the growth index 45% and 80% compared to controls when grown in 100% and 50% Hoagland solution, respectively. Thus, inoculation with A. brasilense REC3 in a nutrient-limited medium had the strongest effect in terms of increasing both shoot and root biomass and growth index, as already described for Azospirillum inoculated into nutrient-poor soils. SEM-EDS spectra and maps showed the elemental composition and relative distribution of nutrients in strawberry tissues. Leaves contained C, O, N, Na, P, K, Ca and Cu, while roots also had Si and Cl. The organic fraction (C, O and N) accounted for over 96.3% of the total chemical composition; of the mineral fraction, Na had higher accumulation in both leaves and roots. Azospirillum-inoculated and control plants had similar elemental quantities; however, in bacteria-inoculated roots, P was significantly increased (34.33%), which constitutes a major benefit for plant nutrition, while Cu content decreased (35.16%). PMID:24148195

  16. Dänemark: Der Gute Krieg

    DEFF Research Database (Denmark)

    Jakobsen, Peter Viggo

    2015-01-01

    Danish foreign and security policy is that Denmark had a good war. Denmark did not go to war in Afghanistan to win. Denmark went to war to support the right causes (anti-terrorism, human rights and democracy) and the right allies (United States, United Kingdom and NATO) in order to generate pride at home...

  17. Kalter Krieg im Südlichen Afrika

    OpenAIRE

    Matthew Graham

    2010-01-01

    Review Article: Cold War in Southern Africa Gary Baines, Peter Vale (eds.) (2008), Beyond the Border War: New Perspectives on Southern Africa’s Late-Cold War Conflicts, Pretoria: Unisa Press, ISBN 978 1 86888 456 8, xix + 342 pp. Sue Onslow (ed.) (2009), Cold War in Southern Africa: White Power, Black Liberation, Abingdon: Routledge, ISBN 978 0 415 47420 7, 253 pp. Vladimir Shubin (2008), The Hot “Cold War”: The USSR in Southern Africa, London: Pluto Press, ISBN 978 0745324722, 320 pp. Review...

  18. Aspectos morfofisiológicos de plantas de milho e bioquímico do solo em resposta à adubação nitrogenada e à inoculação com Azospirillum brasilense

    Directory of Open Access Journals (Sweden)

    Tâmara Prado de Morais

    2015-12-01

    Full Text Available RESUMO O nitrogênio (N é um macronutriente que aumenta a produção de grãos na cultura do milho e o seu manejo adequado torna-se indispensável como proposta de uma agricultura sustentável, incluindo o uso de fontes alternativas como bactérias fixadoras de N2. Os objetivos deste trabalho foram avaliar a resposta morfofisiológica de plantas de milho e a atividade de enzimas no solo (urease e fosfatase decorrente da adubação N mineral e da inoculação com Azospirillum brasilense. Dois ensaios foram realizados em condições de casa de vegetação com solo de cerrado. O delineamento estatístico adotado foi o de blocos ao acaso com os tratamentos distribuídos em esquema fatorial 3 x 3, sendo o primeiro fator correspondente a doses de N (0; 100 e 200 kg ha-1 e o segundo, a doses de um inoculante líquido à base de A. brasilense aplicado via sementes (0; 100 e 200 mL ha-1. Ao final desse experimento, outro ensaio foi realizado para verificar o possível efeito residual da inoculação e da adubação nitrogenada. A adição de fertilizantes nitrogenados promoveu maior desenvolvimento das plantas de milho, elevou os teores de clorofila e de nutrientes. Houve aumento da atividade das enzimas relacionadas à disponibilização de amônio e fósforo inorgânico na rizosfera. Além disso, o nitrogênio apresentou efeito residual no desenvolvimento das plantas na semeadura subsequente. A dose de 200 mL ha-1 de A. brasilense associada à dose de 200 kg ha-1 de N aumentou a resposta fisiológica da cultura.

  19. Montagem e anotação parcial da sequência genômica da Bactéria Diazotrófica Azospirillum Brasilense FP2

    OpenAIRE

    Silveira, Leviston da

    2012-01-01

    Resumo: Bactérias fixadoras de nitrogênio ou diazotróficas são organismos capazes de reduzir o dinitrogênio atmosférico em amônia, um processo chamado fixação biológica de nitrogênio que é catalisado pela enzima nitrogenase. Azospirillum brasilense é uma bactéria fixadora capaz de se associar a raízes de gramíneas como trigo e arroz, e promover o crescimento do vegetal e aumento de produtividade. Neste trabalho utilizamos 5.768.466 milhões de seqüência de nucleotídeos obtidas em seqüenciador ...

  20. Características agronômicas do trigo em função de Azospirillum brasilense, ácidos húmicos e nitrogênio em casa de vegetação

    Directory of Open Access Journals (Sweden)

    Luan F. O. S. Rodrigues

    2014-01-01

    Full Text Available Objetivou-se, neste estudo, verificar o efeito do uso combinado de Azospirillum brasilense, ácidos húmicos e diferentes doses de nitrogênio nas características agronômicas do trigo. Os experimentos foram instalados no dia 21 de maio de 2011 e a colheita foi procedida no dia 13 de setembro de 2011. O delineamento experimental adotado foi o de blocos casualizados em esquema fatorial 4 x 4, com quatro repetições. O primeiro fator se refere à combinação da estirpe Ab-V5 de A. brasilense com os ácidos húmicos, sendo utilizados os seguintes tratamentos: controle; Ab-V5; ácido húmico e Ab-V5+ácido húmico e o segundo fator se refere às doses de nitrogênio (0, 30, 60 e 90 kg ha-1 N. A maioria das variáveis em análise apresentou efeito linear positivo dos tratamentos em função da adubação nitrogenada sendo que apenas para a variável massa de cem grãos este efeito foi linear negativo. Não houve diferença significativa entre as variâncias, na produção de grãos. Pôde-se concluir que o uso combinado de Ab-V5 + ácido húmico promove principalmente a produção de matéria seca de folhas e não é responsivo à adubação nitrogenada para os demais componentes produtivos em estudo nem para a produtividade dos grãos.

  1. Efecto de la coinmovilización de la microalga Chlorella sorokiniana con la bacteria promotora de crecimiento vegetal Azospirillum brasilense, en el crecimiento poblacional microalgal y capacidad de remoción de amonio como uso potencial en el tratamiento..

    Directory of Open Access Journals (Sweden)

    Guillot Monroy Gabriel

    2006-06-01

    Full Text Available Se desarrollaron dos experimentos de coinmovilización de la microalga Chlorella sorokiniana con la bacteria promotora
    de crecimiento vegetal (PGPB Azospirillum brasilense en esferas de alginato, para evaluar la influencia de la bacteria en el crecimiento poblacional y en la capacidad de remoción de amonio de la microalga; con el fin de establecer el potencial que pueda tener la coinmovilización de estos microorganismos en el tratamiento terciario de aguas residuales. Los resultados revelan un significativo incremento de la población cuando C.
    sorokiniana es coinmovilizada con A. brasilense, aunque no se observó un efecto significativo en la remoción de amonio. Los resultados obtenidos en el presente trabajo, reflejan la importancia de avanzar en el estudio de un sistema coinmovilizado altamente eficiente para ser utilizado en tratamiento de aguas residuales. La coinmovilización
    de C. sorokiniana con A. brasilense, muestra la habilidad de esta bacteria para influir de manera positiva en el crecimiento y fisiología de la microalga y por lo tanto la remoción de amonio puede ser incrementada.

  2. Estudio sobre la influencia de la inoculación de las rizobacterias Azospirillum brasilense y Pseudomonas fluorescens sobre el desarrollo morfológico y el contenido de aceites esenciales en las especies aromáticas Ocimum basilicum var. genovesse, Ocimum basilicum var. minimum, Petroselinum sativum var. lisa y Salvia officinalis.

    OpenAIRE

    Martos Trenado, Pilar

    2012-01-01

    En el presente estudio se analiza la influencia de la inoculación con Azospirillum brasilense, con Pseudomonas fluorescens y la inoculación conjunta con ambas rizobacterias en las especies de plantas aromáticas Ocimum basilicum var. genovesse, Ocimum basilicum var. minimum, Petroselinum sativum var. lisa y Salvia officinalis. Se evaluará su desarrollo morfológico, atendiendo a tres parámetros: la longitud del tallo, el peso fresco y la superficie foliar. Así como el posible incremento en el c...

  3. Het CBb en 'Der digitale Taxi-Krieg'

    NARCIS (Netherlands)

    M. Westerveld

    2015-01-01

    UberPOP, the taxi service company that claims to be based on the concept of shared economy, offering a positive effect on mobility, environment and usage of energy, in reality confronts us with the question whether we are able to protect 'on demand' workers against exploitation and underpayment. The

  4. Die Gasultrazentrifuge als mediale Projektion des Kalten Krieges

    Science.gov (United States)

    Helmbold, Bernd

    Studien der letzten Dekaden nach der Wiedervereinigung von BRD und DDR erweitern die Perspektive der Wissenschaftsgeschichte vom Fokus des Big Science und der technisch-militärisch-industriellen Auseinandersetzung zwischen den zwei Blöcken zu einer globalen Transformation im Konflikt der Supermächte geprägt durch lokale und auch interne Ausformungen.

  5. Bürgerrechte im frühen Kalten Krieg

    OpenAIRE

    Meyer-Mahnkopf, Cordula

    2010-01-01

    In the period 1947/48 – 1955/58, the Supreme Court pushed a policy of desegregation through the American society. In so doing, the Justices perceived the pressing issues of American foreign policy and national security, to name only Korea (1950) and North Vietnam (1954), as the essential background to the still existing segregation in the United States. In a cultural approach, this analysis examines these coincidences on the basis of the theory of discourse and a classic philological interpre...

  6. Machtprestige als Motiv des saudischen Krieges im Jemen

    OpenAIRE

    Darwich, May

    2015-01-01

    Am 26. März 2015 begann Saudi-Arabien, Luftangriffe auf den Jemen zu fliegen mit dem Ziel, die Herrschaft des geflohenen Präsidenten Abed Rabbo Mansour Hadi wiederherzustellen. Die tatsächlichen Beweggründe für den saudischen Kriegseintritt bleiben bislang im Dunkeln. Studien zum Ausbruch von Kriegen basieren vornehmlich auf der Prämisse rational Handelnder, die materielle Ziele verfolgen. Indessen ist das saudische Motiv für seine Intervention im Jemen "Machtprestige". Saudi-Arabien will sei...

  7. Der Truchsessische Krieg in Bonn und Umgebung. Ein Lesebuch

    OpenAIRE

    Flörken, Norbert

    2014-01-01

    Gebhard Truchsess von Waldburg-Trauchburg (1547-1601) war Kurfürst und Erzbischof von Köln. Im Dezember 1577 wurde er zum Erzbischof gewählt und empfing die Priesterweihe im Jahre 1578. In demselben Jahr wurde ihm das Erzstift Köln von Kaiser Rudolf II. übertragen. 1580 wurde er von Papst Gregor XIII. bestätigt. In dieser Zeit verliebte er sich in Agnes von Mansfeld-Eisleben (“die schöne Mansfelderin“, 1551-1635), protestantische Kanonissin in dem Stift Gerresheim bei Düsseldorf. Im Februar 1...

  8. ХАРАКТЕРИСТИКА ЛИПОПОЛИСАХАРИДА ДИАЗОТРОФНЫХ РИЗОБАКТЕРИЙ AZOSPIRILLUM BRASILENSE SR55

    OpenAIRE

    Бойко, А.; Коннова, О.; Коннова, С.; Федоненко, Ю.; Игнатов, В.

    2007-01-01

    Исследованы липополисахариды грамотрицательных диазотрофных ризобактерий, стимулирующих рост растений, Azospirillum brasilense SR55, изолированных с корней пшеницы в Саратовской области. Из наружной мембраны фенольной экстракцией выделен липополисахарид и изучен его химический состав. Среди основных компонентов гидрофобной части идентифицированы 3-гидрокситетрадекановая, 3-гидроксигексадекановая, гексадекановая и октадеценовая кислоты, а в углеводной составляющей рамноза, галактоза, 3-О-метил...

  9. "Death does not rot": Transitional Justice und lokale “Wahrheiten” im vom Krieg gezeichneten Norduganda

    OpenAIRE

    Barbara Meier

    2013-01-01

    The article looks at the way Acholi in northern Uganda address war-related matters of “peace” and “justice” beyond the mainstream human rights discourse reflecting some of the basic concepts that are decisive for the way people deal with transitional and local justice. The relationality and the segmentary structure of Acholi society play major roles in categorising “peace” and “war” while being at odds with the globalised standards of human rights that have been brought into play by internati...

  10. "Krieg zwischen den Generationen?" : die Darstellung von Generationenbeziehungen in ausgewählten Sachbuchtexten

    OpenAIRE

    Bräuninger, Bettina; Lange, Andreas; Lüscher, Kurt

    1997-01-01

    The "war between the generations" is becoming a common topic of public discourse. What arguments and rhetorical elements are used to characterize intergenerational relations? How does this relate to recent findings in the social sciences? Three popular non-fiction books were chosen for a detailed analysis of arguments and rhetorical elements in the public discourse about generations. This special genre is becoming even more important in a time, when more and more people are looking for knowle...

  11. "Pensar la guerra, Clausewitz": la interpretación aroniana del Vom Kriege

    OpenAIRE

    Elía, O. (Óscar)

    2007-01-01

    For the last two centuries “Vom Kriege” has been used to justify two different kinds of totalitarianisms: Marxism-Leninism and Nazism. However, during the 1950s Liberal thinking also made use of that work. In line with Liberal thinking, Raymond Aron’s “Penser la Guerre, Clausewitz” presents Clausewitz’s work as moderate and liberal and underplays its totalitarian connections.

  12. 'WEGNER, Bernd, Wie Kriege enden. Wege zum Frieden von der Antike bis zur Gegenwart'

    OpenAIRE

    Gantet, Claire

    2013-01-01

    Ce recueil de cours dispensés à l’université de la Bundeswehr de Hambourg est le fruit d’un projet ambitieux, exposé dans deux préfaces : à la suite de Carl von Clausewitz, faire sortir l’histoire de la guerre des questions étroitement militaires. La question de la fin des guerres se pose alors pour deux raisons essentielles : dans notre monde caractérisé par des tendances à la « désétatisation » ou la « reprivatisation » de la violence, on peut se demander si la paix est encore possible. La ...

  13. Krieg der Bilder - Zur Zugänglichmachung österreichischer Filmquellen zum Ersten Weltkrieg

    Directory of Open Access Journals (Sweden)

    Thomas Ballhausen

    2014-06-01

    Full Text Available Schon in der Frühzeit des Films machten sich die Verantwortlichen und Produzenten Gedanken, wie Material dauerhaft bewahrt, sinnvoll archiviert und wieder zugänglich gemacht werden könnte: Der Wunsch nach der adäquaten Sicherung, Lagerung und weiteren Bearbeitung unter Achtung der dualen Verantwortlichkeit gegenüber den Beständen als auch der Öffentlichkeit – der Kernaufgaben eines jeden Archivs – ist bereits für das späte 19. Jahrhundert dokumentiert. Für eine zeitgemäße Erleichterung im seriösen Materialzugriff bieten wissenschaftliche Editionen und das Internet hervorragende Voraussetzungen. Insbesondere am Beispiel der österreichischen Filmquellen zum Ersten Weltkrieg lassen sich die Vorzüge beider Vermittlungsoptionen verdeutlichen.

  14. 'KRIEG, Heinz, Herrscherdarstellung in der Stauferzeit. Friedrich Barbarossa im Spiegel seiner Urkunden und der staufischen Geschichtsschreibung'

    OpenAIRE

    Depreux, Philippe

    2013-01-01

    Les sources narratives consacrées à Frédéric Barberousse (1152-1190) et contemporaines de son règne sont particulièrement nombreuses (que l’on pense en premier lieu aux Gesta d’Otton de Freising continués par Rahewin, mais aussi à ceux de Geoffroy de Viterbe, sans compter les récits annalistiques). Il s’agit d’ouvrages bien informés, dont la date de rédaction permit à leurs auteurs un regard rétrospectif sur l’action de l’empereur, également bien connue grâce à ses nombreux diplômes dont l’éd...

  15. Der Hundertjährige Krieg (1558-1660/61) in Estland / Margus Laidre

    Index Scriptorium Estoniae

    Laidre, Margus, 1959-

    2006-01-01

    Ülemvõimu pärast Läänemerel peetud sõdade perioodist, mida autor nimetaks Eesti ajaloo Saja-aastaseks sõjaks (1558-1660/61), mis jaguneks : 1) Vene-Liivi etapp 1558-1562, 2) Taani-Poola etapp 1563-1570, 3) Vene etapp 1570-1595, 4) 1595-1599 vaheetapp, 5) 1600-1629 "kolmekümneaastane sõda Rootsi ja Poola vahel, 6) 1629-1654 vaherahude etapp, 1655-1660/61 Rootsi triumf. Eesti rahvastiku suurusest 16.-18. sajandil

  16. Quo vadis, Obama? US-amerikanische Demokratieförderpolitik nach dem Kalten Krieg

    OpenAIRE

    Poppe, Annika Elena

    2011-01-01

    "Die Demokratieförderung ist eines der Herzstücke der amerikanischen nationalen Identität. Kein US-Präsident kann es sich leisten, dieses Thema zu ignorieren. Allerdings gibt es deutliche Unterschiede, wie die amerikanischen Präsidenten in der Vergangenheit mit diesem Thema umgegangen sind. Die Autorin untersucht, wie Präsident Obama mit der Bush Hinterlassenschaft – der internationalen Demokratieförderung – umgeht. Behält er den Kurs mit leichten Veränderungen bei oder schlägt er einen völli...

  17. 10 Jahre danach: Der Irak-Krieg 2003 und das (Medien-Schlachtfeld III

    Directory of Open Access Journals (Sweden)

    Karl H. Stingeder

    2013-09-01

    Full Text Available Im dritten Teil seiner dreiteiligen Analyse des Irakkriegs und der >embedded journalists< untersucht Karl H. Stingeder die Informationsstrategie der US-Regierung und prüft die Frage, ob die mediale Inszenierung der US-Regierung als politische Propaganda gewertet werden kann.

  18. Drogen, Krieg und Drogenkrieg : die USA und Kolumbien im aussichtslosen Kampf?

    OpenAIRE

    Friesendorf, Cornelius

    2006-01-01

    The United States, despite impressive efforts, have not reduced Colombian drug supplies over the recent years. Policy ineffectiveness results from problems in Colombia, including poverty, strong non-state actors, as well as a weak state and society. On the US side, ineffectiveness results from a geographically selective approach, a reliance on coercion, and bilateralism. The US has exacerbated human rights violations, environmental destruction, the displacement of the drug industry within Col...

  19. Feiglinge oder Helden? : krieg und Nachkriegszeit in Prosawerken des tschechischen Dissenses

    Czech Academy of Sciences Publication Activity Database

    Fialová, Alena

    Leipzig: Leipziger Universitätsverlag, 2015 - (Hallama, P.; Stach, S.), s. 109-134 ISBN 978-3-86583-933-6 Institutional support: RVO:68378068 Keywords : dissent * exile prose * normalization * reflection of 2nd World War * deportation of Germans * collaboration Subject RIV: AJ - Letters, Mass-media, Audiovision

  20. СРАВНИТЕЛЬНАЯ ХАРАКТЕРИСТИКА ЛИПОПОЛИСАХАРИДОВ БАКТЕРИЙ ШТАММА AZOSPIRILLUM BRASILENSE SP7 И ЕГО СПОНТАННОГО МУТАНТА SP7.K2

    OpenAIRE

    Сигида, Елена; Федоненко, Юлия; Смолькина, Ольга; Коннова, Светлана; Игнатов, Владимир

    2012-01-01

    Проведены сравнительные исследования липополисахаридов (ЛПС) азотфиксирующих ризобактерий штамма Azospirillum brasilense Sp7 и его спонтанного мутанта Sp7.K2, у которого в результате изменений плазмидного состава наблюдалось преобладание R-форм ЛПС. Выявлены различия в химическом составе и электрофоретическом профиле исследуемых препаратов ЛПС. Показано, что для получения ЛПС A. brasilense Sp7.K2 с целью проведения его дальнейших структурных исследований предпочтительнее использовать метод во...

  1. ВЛИЯНИЕ УСЛОВИЙ КУЛЬТИВИРОВАНИЯ НА ЛИГНИН-ПЕРОКСИДАЗНУЮ АКТИВНОСТЬ ЭНДОФИТНОГО И ЭПИФИТНОГО ШТАММОВ AZOSPIRILLUM BRASILENSE

    OpenAIRE

    Петров, Сергей; Купряшина, Мария; Глинская, Елена; Никитина, Валентина

    2012-01-01

    Впервые установлена способность бактерий A. brasilense к росту на лигнинсодержащих субстратах, обнаружена лигнинолитическая активность, которая в большей степени выражена у эн-дофитного штамма. Впервые обнаружена способность бактерий A. brasilense к деградации лигнина. Впервые получен чистый препарат бактериальной внеклеточной лигнин-пероксидазы. Высказано предположение об участии данного фермента в лигниндеградирующей способности азоспирилл....

  2. ВЛИЯНИЕ БАКТЕРИЙ AZOSPIRILLUM BRASILENSE НА СОДЕРЖАНИЕ ПИГМЕНТОВ У ПШЕНИЦЫ ПРИ КАДМИЕВОМ СТРЕССЕ

    OpenAIRE

    Железкова, Мария; Плешакова, Екатерина; Любунь, Елена

    2014-01-01

    Важную роль при устранении токсического действия тяжелых металлов на растения играют почвенные микроорганизмы. Известно, что ризосферные ассоциативные микроорганизмы рода Azospirillum активно взаимодействуют с растениями и могут оказывать различные воздействия на их морфологические и биохимические параметры. Проведенными исследованиями установлено, что инокуляция растений пшеницы (Triticum aestivum L.) ассоциативными бактериями Azospirillum brasilense (штаммы Sp7, SpCd, Sp245, Sp245.5) нивели...

  3. Rezension zu: Insa Eschebach, Regina Mühlhäuser (Hg.: Krieg und Geschlecht. Sexuelle Gewalt im Krieg und Sex-Zwangsarbeit in NS-Konzentrationslagern. Berlin: Metropol Verlag 2008.

    Directory of Open Access Journals (Sweden)

    Veronika Springmann

    2009-10-01

    Full Text Available In recent years, the conflict with protagonists of and functions of violence has accelerated, as has research on and interpretation of sexual violence. The conference volume collects new contributions to research on and interpretive patterns of sexual violence in war and in sexual forced labor in National Socialist concentration camps, in order first to depict the current state of research and second to look for future perspectives. The brilliant essays inform readers on the current questions and debates on these topics.

  4. Das Schöne und der Krieg : Zur filmischen Ästhetisierung des Ersten Weltkrieges gestern und heute

    OpenAIRE

    Fengler, Silke; Krebs, Stefan

    2007-01-01

    The paper explores the medial construction and aestheticising of the war, examining current TV documentaries on the First World War. The first part consists in a detailed film- and picture analysis of wartime film material. The second part examines how TV authors work with this material. These two inquiries constitute the basis of a conclusive synthesis, which examines continuities and breaks in the narration these pictures transport. This paper offers a contribution to the discussion on the ...

  5. Die Eroberung der Atmosphäre: Wetterbeeinflussung in Süddeutschland zur Zeit des Kalten Krieges

    DEFF Research Database (Denmark)

    Achermann, Dania

    2013-01-01

    By the beginning ofthe Cold War the idea to modify the weather had gained enormaus popularity. From the 1950s onwards, the new weather control technology, mainly developed within the context of the U.S. military, was being applied in many countries around the world. This article focuses on the ac...

  6. Rezension: Habsburgs schmutziger Krieg – Ermittlungen zur österreichisch-ungarischen Kriegsführung 1914 – 1918

    Directory of Open Access Journals (Sweden)

    Paul Winkler

    2015-06-01

    Full Text Available Ein AutorInnenkollektiv hat sich mit dieser Publikation dem schmutzigen 1. Weltkrieg der Habsburger zwischen 1914 und 1918 gewidmet und präsentiert dabei bedeutende Ergebnisse. Paul Winkler hat für die MEDIENIMPULSE rezensiert ... Beschlüssen, Kalkulationen und Kontrollverlust spüren Hannes Leidinger, Verena Moritz, Karin Moser und Wolfram Dornik in ihrer problemorientierten Untersuchung der dunkelsten Kapitel des letzten Waffengangs der Habsburger nach. Eine erschreckende Vielzahl dokumentierter Pflichtverletzungen und Gräuel erhellt Mechanismen der Gewalteskalation gegen pauschal verdächtigte Massen. Eine quellenorientierte Pionierleistung mit zweifelsohne nachhaltiger Beeinflussung einer österreichischen Erinnerungskultur – auch über das Gedenkjahr 2014 hinaus.

  7. Vescicular-arbuscular mycorrhiza and Azospirillum brasilense rhizocoenosis in pearlmillet in a semi-arid soil

    International Nuclear Information System (INIS)

    A field experiment was conducted in an alluvial sandy loam soil using Pearlmillet as the test crop to study the effect of Vescicular-Arbuscular Mycorrhiza (VAM) and Azospirillum with phosphorus on yield and other parameters. Dual inoculation gave a significant increase in Azospirillum and VAM infection in root over the control plants, and resulted in significant increase in grain yield. Combined inoculation alongwith N and P application showed maximum P uptake. Nitrogen fixation increased with plant growth with dually inoculated N and P treatment, The effect was more pronounced in the presence of phosphrous indicating that P is required for nitrogen fixation. (author)

  8. Influence of soil saprophyte fungus Chaetomium cochliodes on associative system "Triticum aestivum – Azospirillum brasilense"

    OpenAIRE

    E. P. Kopylov; A. A. Zhidenko

    2009-01-01

    In laboratory and vegetative experiments the ability of soil ascomycete C. cochliodes 3250 to promote the penetration of Azospirillum nitrogen-fixing bacteria into roots’ inner tissues was shown. At the same time the endophytic association: spring wheat – Azospirillum nitrogen-fixing bacteria – soil saprophyte ascomycete C. cochliodes 3250 is forming. It allows activating the nitrogen fixation in the spring wheat roots zone and biosynthetic processes in plants, in particular: to raise glutami...

  9. Tripartite symbiosis of Lentil (Lense culinaris L.), Mycorrhiza and Azospirillum brasilense under Rainfed Condition

    OpenAIRE

    Ardakani, M. Reza; Maleki, Sadegh; Aghayari, Fayaz; Rejali, Farhad; Faregh, Amir. H.

    2014-01-01

    A field experiment was conducted aiming to determine the possibility of improving the lentil performance when co-inoculated with Vesicular Arbuscular Mycorrhiza (VAM) fungi and Azospirillum under natural rain-fed conditions, in Iran. Results showed the substantial impact of VAM fungi on grain protein, root colonization and shoot dry weight. Highest value for shoot dry weight recorded in plants which inoculated with G. intraradices and highest values for root colonization and grain protein con...

  10. ХАРАКТЕРИСТИКА СТРУКТУРНЫХ ОСОБЕННОСТЕЙ ЛИПОПОЛИСАХАРИД-БЕЛКОВЫХ КОМПЛЕКСОВ КАПСУЛЫ БАКТЕРИЙ AZOSPIRILLUM BRASILENSE SR80 И SP245 ПРИ РОСТЕ НА АГАРИЗОВАННОЙ СРЕДЕ

    OpenAIRE

    Халэпа, Яна; Евстигнеева, Стелла; Сигида, Елена; Федоненко, Юлия; Коннова, Светлана; Игнатов, Владимир

    2014-01-01

    Проведено сравнительное исследование структурных особенностей липополисахарид-белковых комплексов (ЛПБК) из капсульного материала бактерий Azospirillum brasilense SR80 и Sp245, выращенных в жидкой и агаризованной питательных средах. Анализ данных ГЖХ и ЯМР-спектроскопии выявил отличия структуры липидной и полисахаридной составляющих ЛПБК исследуемых бактерий, в зависимости от условий их культивирования. Отличительной особенностью ЛПБК обоих штаммов, рост которых осуществлялся на плотной среде...

  11. Lyndon B. Johnsons triple war : der amerikanische Präsident, die Medien, die Öffentliche Meinung und der Krieg in Vietnam

    OpenAIRE

    Ebert, Martin

    2004-01-01

    There has been a dramatic shift in public opinion , sagte Lyndon B. JOHNSON am 22. März 1968. Wenige Tage später gab der am. Präsident sein Ausscheiden aus dem Präsidentschaftswahlkampf und eine Umorientierung der Vietnampolitik der USA bekannt. War die Öffentliche Meinung damit the x-factor in the whole Vietnam equation , wie in einem Memo an JOHNSONs Sicherheitsberater WALT ROSTOW behauptet und musste somit in den Worten Lesslie H. Gelbs das essential domino des amerikanischen Engagement...

  12. Politik von heute für die Welt von morgen : wie ein Bewusstsein von Nachhaltigkeit auf der Ebene der Weltpolitik den Krieg vermeiden könnte

    OpenAIRE

    Eisbrenner, Kerstin

    2009-01-01

    Rezension zu: Harald Müller : Wie kann eine neue Weltordnung aussehen? Wege in eine nachhaltige Politik ; Fischer Taschenbuch Verlag, Frankfurt am Main 2008 ; ISBN 978-3596176663, 320 Seiten, 9,95 Euro.

  13. ESTUDIO DEL EFECTO QUIMIOTÁCTICO DE LOS EXUDADOS RADICALES DEL ARROZ SOBRE Azospirillum brasilense Sp7 Y A. brasilense R5(15). PRODUCCIÓN DE AUXINAS POR AMBAS CEPAS

    OpenAIRE

    Mabel Pazos; Digna Hernández; Annia Hernández

    2003-01-01

    El género Azospirillum agrupa bacterias diazotróficas de vida libre, ampliamente encontradas en suelos tropicales y subtropicales, en asociación con raíces de cultivos de importancia económica como arroz, trigo y diversas especies vegetales. La gran mayoría de los estudios realizados con este género han demostrado su distribución prácticamente universal y sus numerosos efectos sobre el crecimiento de las plantas que coloniza. En este trabajo se demuestra el efecto quimiotáctico que ejercen lo...

  14. Toxicidade de herbicidas utilizados na cultura da cana-de-açúcar à bactéria diazotrófica Azospirillum brasilense Toxicity of herbicides applied on sugarcane to the diazotrophic bacterium Azospirillum brasilense

    OpenAIRE

    S.O. Procópio; M.F. Fernandes; D.A Teles; J.G Sena Filho; A. Cargnelutti Filho; L. Vargas; S.A.C Sant'Anna

    2011-01-01

    Objetivou-se neste trabalho identificar herbicidas utilizados na cultura da cana-de-açúcar que não alteram o crescimento ou a capacidade de fixação biológica de nitrogênio (FBN) da bactéria diazotrófica Azospirillum brasi lense. Dezoito herbicidas - paraquat, ametryn, amicarbazone, diuron, metribuzin, [hexazinone + diuron], [hexazinone + clomazone], clomazone, isoxaflutole, sulfentrazone, oxyfluorfen, imazapic, imazapyr, [trifloxysulfuron-sodium + ametryn], S-metolachlor, glyphosate, MSMA e 2...

  15. Computer simulation and experimental study of the polysaccharide-polysaccharide interaction in the bacteria Azospirillum brasilense Sp245

    Science.gov (United States)

    Arefeva, Oksana A.; Kuznetsov, Pavel E.; Tolmachev, Sergey A.; Kupadze, Machammad S.; Khlebtsov, Boris N.; Rogacheva, Svetlana M.

    2003-09-01

    We have studied the conformational properties and molecular dynamics of polysaccharides by using molecular modeling methods. Theoretical and experimental results of polysaccharide-polysaccharide interactions are described.

  16. Israels Auseinandersetzung mit terroristischer Gewalt : Geschichte, Strategien und Herausforderungen

    OpenAIRE

    Baumgart-Ochse, Claudia

    2008-01-01

    'Seit Jahrzehnten wird die israelische Demokratie immer wieder durch terroristische Gewalt bedroht. Israels Reaktionen darauf waren bislang weitgehend vom sog. Kriegs-Paradigma geprägt. Dieses Paradigma sieht den Kampf gegen terroristische Gewalt als einen militärisch zu führenden Krieg. Die Autorin zeigt anhand der israelischen Geschichte eindringlich, welche Probleme sich daraus für einen demokratischen Staat ergeben: Ein Staat im Krieg ist ein Staat im Ausnahmezustand, und es besteht beträ...

  17. "Death Does Not Rot": Transitional Justice and Local “Truths” in the Aftermath of the War in Northern Uganda "Death does not rot": Transitional Justice und lokale “Wahrheiten” im vom Krieg gezeichneten Norduganda

    Directory of Open Access Journals (Sweden)

    Barbara Meier

    2013-01-01

    Full Text Available The article looks at the way Acholi in northern Uganda address war-related matters of “peace” and “justice” beyond the mainstream human rights discourse reflecting some of the basic concepts that are decisive for the way people deal with transitional and local justice. The relationality and the segmentary structure of Acholi society play major roles in categorising “peace” and “war” while being at odds with the globalised standards of human rights that have been brought into play by international agencies, civil society and church organisations as well as the Ugandan state. A major argument is that a one-dimensional understanding of the cosmological underpinnings of rituals as a locally embedded tool of transitional justice (TJ has an impact on the failure of TJ in northern Uganda. Thus the article highlights the specific cultural dilemmas in which the process of peace currently appears to be stuck.Dieser Beitrag untersucht, wie Acholi in Norduganda jenseits des Menschenrechtsdiskurses „Frieden“ und „Gerechtigkeit“ verstehen, und zeigt grundlegende lokale Denkweisen und Rechtsvorstellungen auf, die für ihren Umgang mit Transitional-Justice-Verfahren entscheidend sind. Bei der Definition der Begriffe „Krieg“ und „Frieden“ spielen Relationalität und Segmentarität der Acholi-Gesellschaft eine wesentliche Rolle, stehen aber im Gegensatz zu den globalisierten Menschenrechtsstandards, wie sie von internationalen Akteuren, zivilgesellschaftlichen Gruppen, kirchlichen Organisationen und auch dem ugandischen Staat vertreten werden. Die Autorin betont, dass ein eindimensionales Verständnis der kosmologischen Hintergründe von Ritualen, die für Transitional-Justice-Maßnahmen herangezogen wurden, zum Scheitern des Konzepts der Transitional Justice in Norduganda beigetragen hat. Sie identifiziert die spezifischen kulturellen Dilemmata, in denen der Friedensprozess in Norduganda derzeit festzustecken scheint.

  18. Experts in the cold war. War experiences and peace conceptions of US-American physicists 1920-1963; Experten im Kalten Krieg. Kriegserfahrungen und Friedenskonzeptionen US-amerikanischer Kernphysiker 1920-1963

    Energy Technology Data Exchange (ETDEWEB)

    Wunderle, Ulrike

    2015-07-01

    The study is dedicated to the American elite of nuclear physicists, which explained after the second world war the possibilities of their science for war and peace. What induced their thinking and handling? The focus lies on the scientific shapings and war experiences of the first really international generation of physicists, which began in the 1920th years their career before many of their representatives had to fly from the NS regime from Europe and cooperated in the Manhattan project in the construction of the atomic bomb. These experiences the author refers to in order to get on the track of the explanations of the exper elite in the immediate afterwar time and in the cold war. How far their internationally and by actual war experiences shaped thinking about their own contribution as scientist to the national security - in the sense of discouragement or the cooperative conflict regulation - found its expression in the cold war, is drawn on different action levels of the participants from the Geneve conference ''Atoms for Peace'' of 1955 until the signing of the so-called Limited Test Ban Treaty of 1963.

  19. The public organization of feelings and the nuclear threat. On the political psychology of war and peace. Oeffentliche Gefuehlsorganisation und nukleare Bedrohung. Zur politischen Psychologie von Krieg und Frieden

    Energy Technology Data Exchange (ETDEWEB)

    Koenig, H.

    1987-07-01

    Lasting control of the new world-threatening potential for destruction is only possible if the passionate, instinctive nature of man is reflected on the social and individual level. The instincts and instinctive desires which are suppressed in every human social process emerge in (mostly subconscious) fantasies of total power, which the state makes use of: it does not prevent the injustice fed by instinctive desires but monopolizes it. (orig.).

  20. Plan der Erneuerung der Tschechoslowakei nach dem Krieg. Die Rolle des Prässidenten Edvard Beneš währen der Tage des kommunistischen Umsturzes im Februar 1948

    Czech Academy of Sciences Publication Activity Database

    Kocian, Jiří

    Berlin : Europäische Akademie, 2006, s. 30-40. ISBN 3-9807838-1-2. [Edvard Beneš und der europäische Kontext. Berlin (DE), 27.02.2004-29.02.2004] R&D Projects: GA ČR GA409/05/2209 Institutional research plan: CEZ:AV0Z80630520 Keywords : Communist coup d'état - February 1948 - President Edvard Beneš Subject RIV: AB - History

  1. Assessment of N2 fixing efficiency of Beijerinckia indica and Azospirillum brasilense in Sorghum (Sorghum bicolor (L.) moench) using 15N tracer

    International Nuclear Information System (INIS)

    For studying the benefits of inoculation of N2 fixing diazotrophs in the root zone of sorghum crop, a pot culture was conducted on neutral red sandy loam soil with sorghum cv. CO26, using 15N tracer. At the end of 45 days duration after sowing, Beijerinckia indica inoculation contributed 56.9 per cent N derived from N2 fixation, out of total N concentration in whole drymatter of sorghum plant. It proved to be the efficient N2 fixer by contributing N from N2 fixation to the tune of 17.6 Kg-1. Accumulation of N derived from N2 fixation from B. indica was primarily in leaf blade (50.0%) followed by stem (31.8%), leaf sheath (14.0%) and root (4.2%). Inoculation of Azospirillum brasllense accelerated uptake of N from soil and fertilizer N sources compared to B. indica and hence registered low N fixation. (author)

  2. CHANGES IN THE MORPHOLOGY OF THE ROOT SYSTEM OF WHEAT INOCULATED WITH Azospirillum brasilense Sp7 AND BACTERIOPHAGE FAb-Sp7

    OpenAIRE

    O.I. GULII; M.K. SOKOLOVA; O.I. SOKOLOV; O.V. IGNATOV

    2015-01-01

    The Azospirillum is one of the most common objects to study associative interactions between bacteria and plants. In the rhizosphere of cereals the Azospirillum cells form effective association and demonstrate a stimulating effect on plant growth and development, in particular in wheat. However, the details of these positive effects are still unknown. For example, there is no evidence of whether the Azospirillum cells are infected with bacteriophages, and little is known about the role that t...

  3. Bösartige Neubildungen : Versuch über David Cronenbergs Filme

    OpenAIRE

    Höltgen, Stefan

    2010-01-01

    Ein Krieg tobt. Ganz im Verborgenen, aber an Milliarden Fronten gleichzeitig. Eine Schlacht, die seit jeher von den gleichen Parteien geführt wird, die den Angreifer immer erbitterter zuschlagen, den Angegriffenen sich immer verzweifelter wehren lässt. Ein Krieg mit ungleichsten Waffen geschlagen: Die Zeit und das Fleisch gegen die kleinen elektrischen Blitze: das Ich. Seit ich denken kann, kämpfe ich in diesem Krieg: Das Bewusstsein gegen den Körper: Ein ständiger Zustand von Stalingrad! Doc...

  4. Paracoccus niistensis sp. nov., isolated from forest soil, India

    Digital Repository Service at National Institute of Oceanography (India)

    Dastager, S.G.; Deepa, C.K.; Li, Wen-Jun; Tang, Shu-Kun; Pandey, A.

    , lipase activity (Tween 80), production of indole and hydrogen sulfide, activities of arginine dihydrolase and urease, reduction of nitrate and nitrite were investigated using the methods of Smibert & Krieg (1994). Catalase activity was tested using...

  5. Lateinamerika: Neustart in der Drogenpolitik?

    OpenAIRE

    Kurtenbach, Sabine

    2014-01-01

    Gibt es eine Kehrtwende im "Krieg gegen die Drogen"? Statt Repression sollen künftig Prävention und staatlich kontrollierter Handel im Vordergrund stehen. Die Organisation Amerikanischer Staaten (OAS) diskutierte auf ihrer außerordentlichen Generalversammlung in Guatemala-Stadt am 19. September 2014 Möglichkeiten für einen regionalen Konsens. Nach Jahrzehnten des "Krieges gegen die Drogen" setzt sich auf dem amerikanischen Kontinent die Einsicht durch, dass Drogenanbau, -handel und -konsum al...

  6. Physiological and molecular basis of Azospirillum-Arabidopsis Interaction

    OpenAIRE

    Nazeer, Ahmed

    2012-01-01

    The present study was aimed at revealing the early signalling events during the interaction of the diazotrophic soil bacterium Azospirillum brasilense with its host plant Arabidopsis thaliana. Furthermore, taking advantage of the micro array technique, a comprehensive overview of Arabidopsis genes has been undertaken which are affected upon association with A. brasilense The characterization of the early responses of Arabidopsis plants upon inoculation with Azospirillum brasilense strain Sp7 ...

  7. Unpublished Digital Surficial Geology Map of Herbert Hoover National Historic Site and Vicinity, Iowa (NPS, GRD, GRI, HEHO, HEHO digital map) adapted from Iowa Geological Survey Open-File Report Maps by Quade et. al. (2008), Krieg et. al. (2004) and Tassier-Surine et. al. (2004)

    Data.gov (United States)

    National Park Service, Department of the Interior — The Unpublished Digital Surficial Geology Map of Herbert Hoover National Historic Site and Vicinity, Iowa is composed of GIS data layers complete with ArcMap 9.3...

  8. Enzymology of biological nitrogen fixation. Annual report

    Energy Technology Data Exchange (ETDEWEB)

    Burris, R.H.

    1992-05-01

    Two genes involved in the regulation of nitrogenase activity, draT and draG, were cloned and found to be contiguous on the Azospirillum brasilense chromosome. The nifH gene, encoding dinitrogenase reductase, is near to draT with an intervening gap of 1.9 kb. The organization of these genes in Azospirillum lipoferum and Rhodosprillum rubrum is similar, but nifH and draT are separated by only 400 bp in the organisms. A. brasilense draTG is very similar to draTG in R. rubrum with 91.8% similarity and 85.3% identity at the amino acid level. Apparently A. brasilense uses the normal ATG initiation codon for draT, and draG. The genes for A. brasilense were able to restore function to appropriate mutants of R. rubrum. The heterologous expression of A. brasilense draTG in R. rubrum was not fully normal, as it responded more slowly to darkness and more quickly to ammonia than wild type cells. Our mutational analysis of the draTG region of A. brasilense confirms the function of these genes in the regulation of nitrogenase activity, but it also revealed minor but demonstrable differences in the control systems of R. rubrum and A. brasilense.

  9. Enzymology of biological nitrogen fixation

    Energy Technology Data Exchange (ETDEWEB)

    Burris, R.H.

    1992-01-01

    Two genes involved in the regulation of nitrogenase activity, draT and draG, were cloned and found to be contiguous on the Azospirillum brasilense chromosome. The nifH gene, encoding dinitrogenase reductase, is near to draT with an intervening gap of 1.9 kb. The organization of these genes in Azospirillum lipoferum and Rhodosprillum rubrum is similar, but nifH and draT are separated by only 400 bp in the organisms. A. brasilense draTG is very similar to draTG in R. rubrum with 91.8% similarity and 85.3% identity at the amino acid level. Apparently A. brasilense uses the normal ATG initiation codon for draT, and draG. The genes for A. brasilense were able to restore function to appropriate mutants of R. rubrum. The heterologous expression of A. brasilense draTG in R. rubrum was not fully normal, as it responded more slowly to darkness and more quickly to ammonia than wild type cells. Our mutational analysis of the draTG region of A. brasilense confirms the function of these genes in the regulation of nitrogenase activity, but it also revealed minor but demonstrable differences in the control systems of R. rubrum and A. brasilense.

  10. Metal and antibiotic-resistance in psychrotrophic bacteria from Antarctic marine waters

    Digital Repository Service at National Institute of Oceanography (India)

    DeSouza, M.J.B.D.; Nair, S.; LokaBharathi, P.A; Chandramohan, D.

    genes in Escherichia coli. J. Bacteriol 171, 3458-3464. Smibert, R.M. and Krieg, N.R. (1981). General characterization In: Manual of methods for general bacteriology edt: Gerhardt P., Murray R.G.E., Costilow R.N. Nester E.W. Wood W.A. Krieg N... and antibiotic-resistance in psychrotrophic bacteria from Antarctic Marine waters Maria-Judith De Souza? , Shanta Nair, P.A. Loka bharathi and D. Chandramohan Abstract: In the wake of the findings that Antarctic krills concentrate heavy metals at ppm...

  11. [Effect of Azospirillum lectins on the Activity of Proteolytic Enzymes and Their Inhibitors in Wheat Seedling Roots].

    Science.gov (United States)

    Alen'kina, S A; Nikitina, V E

    2015-01-01

    The lectins of associative nitrogen-fixing strains Azospirillum brasilense Sp7 and Sp245 were shown to exerte a multidirectional effect on the activity of acidic (pH 3.5), neutral (6.8), and alkaline (pH 7.8) proteinases. The lectin of the epiphytic A. brasilense Sp7 decreased proteolytic activity at all pH values, whereas the lectin of the endophytic A. brasilense Sp245 activated neutral and alkaline proteinases, while not affecting the alkaline ones. Experiments with protease inhibitors made it possible to conclude that the lectins of the studied A. brasilense strains alter the ratio between the activities of different protease types in germinating seeds. The activity of trypsin inhibitors in wheat seedling roots was found to increase in the presence of the lectins. Our results indicate a broader spectrum of effects of azospirilla lectins on the host plant organism. PMID:27169244

  12. Gedichte aus den Jahren 1968 bis 1975 / Viivi Luik ; tõlk. Gisbert Jänicke

    Index Scriptorium Estoniae

    Luik, Viivi, 1946-

    1999-01-01

    Tekst saksa ja eesti keeles. Sisu: Weite = Avarus ; "Wie der Krieg..." = "Otsekui sõda..." ; "es vergehn..." = "hävivad..." ; Das Geheimnis = Saladus ; "Ob auch ich weiss..." = "Kas minagi tean..." ; "Ich redete einmal von Feldern..." = "Rääkisin väljadest ükskord..." ; Andere = Teine ; Der Tag = Päev

  13. Anmeldelser af litteratur om den græsk-romerske oldtid

    DEFF Research Database (Denmark)

    Krasilnikoff, Jens

    2007-01-01

    Anmeldelse af Neville Morley, "Trade in Classical Antiquity". Key Themes in Ancient History. Cambridge UP, 2007. p.22. Anmeldelse af J. Bingen, "Hellenistic Egypt. Monarchy, Society, economy, Culture", Edinburgh UP, 2007, pp.22-23. Anmeldelse af C. Koehn, "Krieg-Diplomatie-Ideologie. Zur...

  14. Vom Dämonischen. Zur politischen Medientheorie des Daniel Suarez

    OpenAIRE

    Alessandro Barberi

    2012-01-01

    Die Romane des Programmierers Daniel Suarez sind weit mehr als reine Fiktionen. Seine terminatorischen Inszenierungen des Endkampfs zwischen Maschinen und Menschen basieren auf äußerst realen Studien zu derzeitigen (Kriegs-)Technologien, die als politische Steuerungsmedien eingesetzt werden.This is a review of Daniel Suarez's books Daemon (2009), Darknet (2011) and Kill Decision (2013).

  15. Vom Dämonischen. Zur politischen Medientheorie des Daniel Suarez

    Directory of Open Access Journals (Sweden)

    Alessandro Barberi

    2012-12-01

    Full Text Available Die Romane des Programmierers Daniel Suarez sind weit mehr als reine Fiktionen. Seine terminatorischen Inszenierungen des Endkampfs zwischen Maschinen und Menschen basieren auf äußerst realen Studien zu derzeitigen (Kriegs-Technologien, die als politische Steuerungsmedien eingesetzt werden.This is a review of Daniel Suarez's books Daemon (2009, Darknet (2011 and Kill Decision (2013.

  16. The First World War and the End of the Habsburg Monarchy, 1914-1918

    OpenAIRE

    Rauchensteiner, Manfried

    2014-01-01

    Die Ursachen des Ersten Weltkriegs sind vielfältig. Die Entfesselung des Kriegs geschah jedoch durch Österreich-Ungarn. Nach mehr als vier Jahren zerfiel die Habsburgermonarchie als Folge innerer Auflösung und der militärischen Niederlage.

  17. Vaimuliku ja ajalookirjutaja Timann Brakeli "Kristlik vestlus" (1579) kui alahinnatud ajalooallikas / Aija Sakova-Merivee

    Index Scriptorium Estoniae

    Sakova-Merivee, Aija, 1980-

    2014-01-01

    Arvustus: Timann Brakel, Peter von Brakel. Christlich Gesprech. Darstellung der Geshcichte Livlands vor und während des "Livländischen Krieges" bis 1578 in gereimter Dialogform und Prosa von dem Prediger und Geschichtsschreiber Timann Brakel. Originaltext und Kommentaren, Erzählungen, Bildern und dem Lebenslauf des Timann Brakel. (Beiträge zur baltischen Geschichte, Band 19). Hirschheydt, 2012

  18. Test laboratory on the summit. Solar modules in the Bavarian Forest; Testlabor auf dem Gipfel. Solarmodule im Bayerischen Wald

    Energy Technology Data Exchange (ETDEWEB)

    Schwarzburger, Heiko

    2013-10-01

    Despite the difficult market a Frankish installer is investing in highest solar modules quality and revives a disused listening station of the Cold War in new ways. [German] Trotz des schwierigen Marktes investiert ein fraenkischer Installationsbetrieb in hoechste Solarmodulqualitaet - oder gerade deswegen. Und belebt eine ausgediente Abhoerstation des Kalten Krieges auf neue Weise.

  19. Survival of endophytic diazotrophic bacteria in soil under different moisture levels Sobrevivência de bactérias diazotróficas endofíticas no solo sob diferentes teores de umidade

    OpenAIRE

    André L.M. Oliveira; Erineudo L. Canuto; Edmilson E. Silva; Veronica M. Reis; José I. Baldani

    2004-01-01

    The effects of soil moisture on the survival of three diazotrophic bacteria species (Azospirillum amazonense, Gluconacetobacter diazotrophicus and Azospirillum brasilense) were tested. Soil moisture had little influence on the survival of A. brasilense, which is considered a free-living species. On the other hand, increased soil moisture extended the survival of the endophytes A. amazonense and G. diazotrophicus. These results indicate that nitrogen-fixing endophytic species are more affected...

  20. AcEST: DK961439 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0010_C02 673 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0010_C02. 5' end seq ... D1|GLND_AZOBR [Protein-PII] uridylyltransferase OS=Azospirillum ... brasilense Align length 78 Score (bit) 55.1 E-valu ... D1|GLND_AZOBR [Protein-PII] uridylyltransferase OS=Azospirillum ... brasilense GN=glnD PE=3 SV=1 Length = 933 Score = ...

  1. AcEST: DK955630 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0023_J22 592 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_J22. 5' end seq ... TB_AZOBR Glutamate synthase [NADPH] large chain OS=Azospirillum ... brasilense Align length 83 Score (bit) 32.0 E-valu ... TB_AZOBR Glutamate synthase [NADPH] large chain OS=Azospirillum ... brasilense GN=gltB PE=1 SV=1 Length = 1515 Score = ...

  2. Partial characterization of nif genes from the bacterium Azospirillum amazonense

    Directory of Open Access Journals (Sweden)

    D.P. Potrich

    2001-09-01

    Full Text Available Azospirillum amazonense revealed genomic organization patterns of the nitrogen fixation genes similar to those of the distantly related species A. brasilense. Our work suggests that A. brasilense nifHDK, nifENX, fixABC operons and nifA and glnB genes may be structurally homologous to the counterpart genes of A. amazonense. This is the first analysis revealing homology between A. brasilense nif genes and the A. amazonense genome. Sequence analysis of PCR amplification products revealed similarities between the amino acid sequences of the highly conserved nifD and glnB genes of A. amazonense and related genes of A. brasilense and other bacteria. However, the A. amazonense non-coding regions (the upstream activator sequence region and the region between the nifH and nifD genes differed from related regions of A. brasilense even in nitrogenase structural genes which are highly conserved among diazotrophic bacteria. The feasibility of the 16S ribosomal RNA gene-based PCR system for specific detection of A. amazonense was shown. Our results indicate that the PCR primers for 16S rDNA defined in this article are highly specific to A. amazonense and can distinguish this species from A. brasilense.

  3. Polyhydroxyalcanoates of strains of Azospirillum spp. isolated of roots of Lycopersicon esculentum Mill. “tomato” and Oryza sativa L. “rice” in Lambayeque

    Directory of Open Access Journals (Sweden)

    Katty Baca

    2010-12-01

    Full Text Available In this work was determined the concentration of polyhydroxyalkanoates (PHAs of Azospirillum strains isolated from roots of Lycopersicon esculentum Mill "tomato" and Oryza sativa L. "rice" as an alternative to accumulation of petroleum-based plastics. Previously disinfected root were plated in Nfb semisolid medium where nitrogen-fixing bacteria were recognized by a whitish film on the surface and turn from green to blue. The genus Azospirillum was identified in Congo red agar medium, obtained 96 isolates of A. lipoferum and A. brasilense on tomato and rice. Batch fermentation was performed with broth Azotobacter modified feeding a saturated solution of malic acid every 12 hours and were stained with Sudan Black B. Strains were selected with the greatest number of PHAs granules (in tomato, 18 of A. lipoferum and 2 of A. brasilense; in rice, 10 of A. lipoferum and 10 of A. brasilense and quantified the biomass and PHAs. PHAs concentration reached 0.661 gL-1 in A. lipoferum KM(T-73 and 0.738 gL-1 in A. brasilense KM(T-19, both isolated from tomato. Strains of A. lipoferum and A. brasilense isolated from tomato reached a higher concentration of biomass and PHAs against the strains of rice.

  4. PHYSIOLOGICAL QUALITY OF CORN SEEDS REINOCULATED WITH DIAZOTROPHIC BACTERIA

    Directory of Open Access Journals (Sweden)

    Ricardo Felipe Braga de Sousa

    2015-09-01

    Full Text Available O objetivo deste trabalho foi avaliar a qualidade fisiológica de sementes de milho provenientes do cultivo associado com Azospirillum brasilense e Herbaspirillum seropedicae e reinoculadas com A. brasilense. As sementes utilizadas foram provenientes de cultivo em condições de campo, sendo os tratamentos: T1 - testemunha; T2 - 60 kg hectare-1 de N; T3 – inoculação (Azospirillum brasilense - AbV5; T4 - inoculação (Azospirillum brasilense + 60 kg hectare-1 de N; T5 - inoculação (Herbaspirillum seropedicae - SmR1 e T6 - inoculação (Herbaspirillum seropedicae + 60 kg hectare-1 de N. Foram separados dois lotes dos tratamentos, sendo um reinoculado com A. brasilense (AbV5. O delineamento foi inteiramente ao acaso com esquema fatorial (6x2, sendo seis tratamentos; com inoculação e reinoculadas. As sementes reinoculadas apresentaram maiores comprimentos, volumes e matéria seca de raízes e parte aérea, concluindo que a reinoculação com sementes promove um incremento no desenvolvimento inicial das plântulas.

  5. "Death does not rot" : transitional justice and local "truths" in the aftermath of the war in Northern Uganda

    OpenAIRE

    Meier, Barbara

    2013-01-01

    "Dieser Beitrag untersucht, wie Acholi in Norduganda jenseits des Menschenrechtsdiskurses 'Frieden' und 'Gerechtigkeit' verstehen, und zeigt grundlegende lokale Denkweisen und Rechtsvorstellungen auf, die für ihren Umgang mit Transitional-Justice-Verfahren entscheidend sind. Bei der Definition der Begriffe 'Krieg' und 'Frieden' spielen Relationalität und Segmentarität der Acholi-Gesellschaft eine wesentliche Rolle, stehen aber im Gegensatz zu den globalisierten Menschenrechtsstandards, wie si...

  6. Die Wirksamkeit der Narrativen Expositionstherapie für traumatisierte Asylbewerber

    OpenAIRE

    Gotthardt, Silke

    2003-01-01

    Kriege, Unterdrückung und Folter aufgrund ethischer oder politischer Spannungen sind Ursachen dafür, dass weltweit etwa 40 Millionen Menschen auf der Flucht sind. Eine charakteristische psychische Folge solcher extrem belastenden Erlebnisse ist die Posttrauma-tische Belastungsstörung (PTBS). In der vorliegenden Untersuchung wurde eine Pilotstudie zur Evaluation der Wirksamkeit der Narrativen Expositionstherapie für Asylbewerber durch-geführt, welche unter einer PTBS leiden. Dabei erhielt eine...

  7. Katalog der Bibliothek der deutschen Kolonialgesellschaft in der Stadt- und Universitätsbibliothek Frankfurt a.M.

    OpenAIRE

    Stadt- und Universitätsbibliothek Frankfurt am Main

    2005-01-01

    Band 1 beinhaltet die alphabetische Gliederung und Band 2 die Gliederung nach der ehemaligen Aufstellung des Kataloges der Bibliothek der deutschen Kolonialgesellschaft. Diese Bibliothek bildet heute die größte und wichtigste geschlossene Gruppe der Sammlung ist die Deutsche Kolonialbibliothek. Sie war im 2. Weltkrieg in einem Thüringer Bergwerk ausgelagert, und wurde nach dem Krieg mit nur relativ wenig Verlusten dem Haus übergeben. Das unschätzbare Grundmaterial der Kolonialbibliothek gab 1...

  8. Yôga: Japanische Malerei im westlichen Stil

    OpenAIRE

    Reiner, Tassilo

    2013-01-01

    Wie gezeigt werden konnte, wurden die westlichen Maltechniken in der ersten Phase der wirtschaftlichen Kontaktaufnahmen für die Vorbereitung der Kolonisation eingesetzt. Die Portugiesen hatten auf der Suche nach neuen Gebieten, durch deren Kolonisation und Ausbeutung sie versuchten, ihre im Zusammenbruch befindliche Vormachtstellung in Europa zu retten, im Jahr 1543 Japan entdeckt, das sich in der Endphase eines hundertjährigen Krieges (sengoku jidai) befand und ausgezehrt war....

  9. Kosovo '98 (I) : Ursachen und Kulmination eines alt-neuen Balkan-Konflikts

    OpenAIRE

    Oschlies, Wolf

    1998-01-01

    'Ihrer jeweiligen Selbsteinschätzung nach sind Serben wie Kosovo-Albaner friedliebend und gastfreundlich. So ergab es eine Repräsentativumfrage, die im Sommer 1997 im Kosovo unter beiden Volksgruppen gemacht worden war. Das Ergebnis brachte die Autoren der Umfrage zu der 'melancholischen' Frage, warum beide ihre markantesten Eigenschaften nicht auch im Umgang miteinander zur Geltung brächten. Die Frage ist mehr als berechtigt. Seit Jahresbeginn 1998 droht der Krieg in Ex-Jugoslawien, der seit...

  10. The migration-security nexus: international migration and security before and after 9/11

    OpenAIRE

    Faist, Thomas

    2005-01-01

    Der vorliegende Beitrag untersucht die Verknüpfung von internationaler Migration und Sicherheit vor und nach dem 11. September. Welche Folgen ergeben sich daraus für Migranten und die Integrationspolitik? Der Autor untersucht zunächst aus einem historischen Blickwinkel, wie es möglich wurde, dass internationale Migration als ein Sicherheitsproblem betrachtet wurden. Besondere Berücksichtigung findet dabei die Zeit nach dem Kalten Krieg. Der zweite Abschnitt beleuchtet kurz einige Konsequenzen...

  11. Die neue Weltordnung:eine unipolare Ordnung oder eine Unordnung?

    OpenAIRE

    Peng, T.

    2006-01-01

    Das verstärkte Streben der USA nach der globalen Vorherrschaft, das insbesondere durch den Krieg gegen den Irak im Jahr 2003 zum Ausdruck gebracht worden ist, löst in der Wissenschaft und Politik die Debatte um eine neue unipolare oder multipolare Weltordnung aus. In dieser Debatte sehen viele Autoren ein erkennbares Ordnungsmuster in der Weltpolitik. Diese Arbeit führt eine kritische Auseinandersetzung mit der aktuellen Debatte um eine neue Weltordnung aus. Die Untersuchung der Arbeit weist ...

  12. Identification and dissolution behavior of the secondary uranium minerals in the corrosion products of Depleted Uranium (DU) ammunition formed in soils

    OpenAIRE

    Qader, Mohammed

    2011-01-01

    In der vorliegenden Studie wurden verschiedene Techniken eingesetzt um drei Proben (4, 7, and 8) die aus denrnKorrosionsprodukten von aus dem Kosovo Krieg stammenden Munitionskugeln, bestehend aus abgereichertem Uranrn(Depleted Uranium - DU), zu untersuchen. Als erstes Verfahren wurde die Raman-Spektroskopie eingesetzt. Hierbeirnzeigte sichin den Proben, charakterisiert durch einen Doppelpeak, die Anwesenheit von Schoepitrn(UO2)8O2(OH)12(H2O)12. Der erste und zweite Peakzeigte sich im Spektra...

  13. Dem Gründer des Roten Kreuzes Henry Dunant anlässlich seines 100. Todestages

    OpenAIRE

    Brankamp, Hauke; Dieter, Anne; Ludewig, Manuela

    2010-01-01

    Der Beitrag erinnert an das wechselvolle Leben des Friedensnobelpreisträgers Henry Dunant, sucht nach biografischen Wurzeln seines von Menschlichkeit und Würde getragenen Verhaltens und macht auf seine Leistungen aufmerksam. Er will aber auch die Frage nach der Bedeutung des humanitären Völkerrechts im Verhältnis von Krieg und Frieden nicht außer Acht lassen.

  14. Deutschland und das Völkerrecht nach der Wiedervereinigung

    OpenAIRE

    Krieger, Heike

    2011-01-01

    Inhalt: - I. Das Ende des Kalten Krieges und die internationale Neuausrichtung Deutschlands - II. Schaffung neuer Handlungsspielräume für die auswärtige Gewalt - II.1. Anpassung verfassungsrechtlicher Standards an internationale Verpflichtungen: Internationale Strafgerichtsbarkeit und Art. 16 Abs. 2 S. 1 GG - II.2. Auslegung von verfassungsrechtlichen Standardsfür sicherheitspolitische Handlungsspielräume - III. Begrenzung und Kontrolle der Einwirkung völkerrechtlicher Normen auf das innersta...

  15. Gewaltdynamiken im Spiegel von Kriegsbriefen. Eine Analyse von Briefen Mike Ransoms und anderer US-amerikanischer Soldaten aus dem Vietnamkrieg

    OpenAIRE

    Rost, Dietmar

    2011-01-01

    Wahrnehmungen und Deutungen von an Kampfeinsätzen beteiligten Soldaten werden nicht nur biografisch, also für deren subjektiven Umgang mit kriegerischer Gewalt, bedeutsam. Indem sie beispielsweise zu sinkender oder steigender Kampfbereitschaft führen, wirken sie auch auf die kollektive Gewaltausübung im Krieg selbst zurück. Sie stellen daher Faktoren dar, die ein wissenschaftliches Verstehen von Gewaltdynamiken in Kriegen berücksichtigen muss. In methodischer Hinsicht bieten sich Kriegsbriefe...

  16. Gewaltdynamiken im Spiegel von Kriegsbriefen : eine Analyse von Briefen Mike Ransoms und anderer US-amerikanischer Soldaten aus dem Vietnamkrieg

    OpenAIRE

    Rost, Dietmar

    2012-01-01

    Wahrnehmungen und Deutungen von an Kampfeinsätzen beteiligten Soldaten werden nicht nur biografisch, also für deren subjektiven Umgang mit kriegerischer Gewalt, bedeutsam. Indem sie beispielsweise zu sinkender oder steigender Kampfbereitschaft führen, wirken sie auch auf die kollektive Gewaltausübung im Krieg selbst zurück. Sie stellen daher Faktoren dar, die ein wissenschaftliches Verstehen von Gewaltdynamiken in Kriegen berücksichtigen muss. In methodischer Hinsicht bieten sich Kriegsbriefe...

  17. „… höher als die Liebe zur Wissenschaft steht die Treue zum eigenen Vaterland …“: Hallenser Romanisten im Ersten Weltkrieg

    Directory of Open Access Journals (Sweden)

    Annette Schiller

    2014-12-01

    Full Text Available Die 1914 verbreitete Kriegsbegeisterung nahm auch die Romanisten nicht aus. Briefe und Tagebuchnotizen aus der Zeit zeigen, wie Lehrende und Studenten unseres Faches, deren gemeinsamer Bezug die Zugehörigkeit zum Romanischen Seminar Halle war, vom „Großen Krieg“ betroffen waren und führen uns die Situation und Geisteshaltung der Professoren und Studenten und die Rückwirkungen des Krieges auf das Fach vor Augen.

  18. Im Lande Kambanellis

    OpenAIRE

    Mamali, Olga

    2004-01-01

    Dies ist die erste Monographie über das Frühwerk des neugriechischen Dramatikers Iakobos Kambanellis. Sie behandelt besonders seine beiden Theatertrilogien "Trilogie des Hofes" und "Trilogie des Krieges" aus der Zeit von 1952 bis 1959. Eine ausführliche Einleitung behandelt die Biographie von Iakobos Kambanellis sowie die sozialen und gesellschaftlichen Gegebenheiten Griechenlands in jener Zeit. Das folgende Kapitel analysiert die "Trilogie des Hofes" als eine griechische Version des Neoreali...

  19. On 23 March ESA’s third Automated Transfer Vehicle (ATV), named in honour of Amaldi, was launched on board an Ariane rocket.

    CERN Multimedia

    CERN Video Productions

    2012-01-01

    Live webcast from CERN on the occasion of the launch of a "Space Ferry", named after Edoardo Amaldi, by the European Space Agency (ESA). Amaldi was CERN's first Secretary General and founding father, and a visionary pioneer for ESA. With the participation of Ugo Amaldi, CERN physicist and son of Edoardo Amaldi, Carlo Rubbia, Nobel Laureate in Physics and Former Director General of CERN and Arturo Russo, historian and author with John Kriege of CERN and ESA's History

  20. [Rezensionen zu:] Gerhard Menk: Vom Bismarckianer zum Liberalen: der Politiker und Lehrer Otto Hufnagel (1885-1944) in Waldeck und Frankfurt am Main. Erster Band: Darstellung, Marburg: N.G.Elwert 2006, VIII + 972 S., ISBN 978-3-7708-1297-4 : Gerhard Menk (Hg.): Vom Bismarckianer zum Liberalen: der Politiker und Lehrer Otto Hufnagel (1885-1944) in Waldeck und Frankfurt am Main. Zweiter Band: Dokumente, Marburg: N.G.Elwert 2006, VI + 776 S., ISBN 978-3-7708-1298-1

    OpenAIRE

    Fahrmeir, Andreas

    2007-01-01

    Otto Hufnagel war bis vor dem Ersten Weltkrieg ein typischer wilhelminischer Bildungsbürger. Er wurde 1885 als Sohn eines protestantischen Frankfurter Volksschullehrers und Veteranen des Kriegs von 1870 geboren, legte 1905 das Abitur ab und studierte in Heidelberg und Leipzig Geschichte, Deutsch und Latein. Während die kontroverse Bewertung seiner Dissertation zeigte, dass (nur) ein Teil der Leipziger Historiker in ihm ein wissenschaftliches Talent sah, waren auch die Skeptiker sicher, dass e...

  1. punktum. Dezember 2006

    OpenAIRE

    Aeschlimann, Heidi; Basler, Thomas; Chassot, Isabelle; Clavuot, Silvio; Fatzer, Gerhard; Jacoby, Mario; Kulla, Manfred; Gardner, Evelin Gerda; De Meyer, Sara; Perriard, Julien; Speilmann, Thomas; Steiner, Peter; Urbaniok, Frank; Zöllner, Ulrike; SBAP. Schweizerischer Berufsverband für Angewandte Psychologie

    2006-01-01

    Kulla, Manfred: Ist das Paradies paradiesisch? ; Jacoby, Mario: Paradies als Topos - Sehnsucht nach dem Unmöglichen; Lindner, Evelin Gerda: Paradiesvorstellungen, Krieg und Terror ; Steiner, Peter: Paradiesische Werbewelt ; Spielmann, Thomas: Paradies und Sexualität "Sex, oh mein Gott"; Fatzer, Gerhard: Wie sähe das CEO-Paradies aus? ; Urbaniok, Frank: Straftäter - die Hölle auf Erden? Basler, Thomas: 3. SBAP.-Preis in Angewandter Psychologie ; Chassot, Isabelle: Portr...

  2. Azospirillum IV

    Energy Technology Data Exchange (ETDEWEB)

    Klingmuller, W.

    1988-01-01

    This book's contents include: Advances in the genetics of Azospirillum brasilense Sp7: Use of Tn5 mutagenesis for gene mapping and identification; Characterization of DNA segments adjacent to the nifHDK genes of Azospirillum brasilense by Sp7 Tn5 site-directed mutagenesis; Selection at the chemostat of Azospirillum brasilense Cd N/sub 2/-fixing at high O/sub 2/ pressure. Root hair deformation induced on maize and medicago by an Azospirillum transconjugant containing a Rhizobium meliloti nodulation region. Azospirilla are bacteria that live in association with the roots of many grain crops. Since these bacteria bind molecular nitrogen from the air and excrete plant growth substances, interest has focussed on their potential to increase crop yields.

  3. Azospirillum IV

    International Nuclear Information System (INIS)

    This book's contents include: Advances in the genetics of Azospirillum brasilense Sp7: Use of Tn5 mutagenesis for gene mapping and identification; Characterization of DNA segments adjacent to the nifHDK genes of Azospirillum brasilense by Sp7 Tn5 site-directed mutagenesis; Selection at the chemostat of Azospirillum brasilense Cd N2-fixing at high O2 pressure. Root hair deformation induced on maize and medicago by an Azospirillum transconjugant containing a Rhizobium meliloti nodulation region. Azospirilla are bacteria that live in association with the roots of many grain crops. Since these bacteria bind molecular nitrogen from the air and excrete plant growth substances, interest has focussed on their potential to increase crop yields

  4. Producción y propiedades de alginato de Sargassum sinicola (Setchell y gardner) y su aplicación en inmovilización celular

    OpenAIRE

    Yabur Pacheco, Ricardo

    2005-01-01

    Se llevó a cabo la producción de alginato de sodio del alga café S. sinicola como material para la inmovilización de la microalga Chlorella sorokiniana y co-inmovilización con la bacteria promotora de crecimiento de plantas, Azospirillum brasilense, para el tratamiento de aguas residuales. El alginato también se empleó para la formulación de microesferas de A. brasilense, para la inoculación de semillas de tomate, como promotores de crecimiento de plantas. Durante la producción se analizaron ...

  5. Identification and characterization of trans-3-hydroxy-l-proline dehydratase and Δ1-pyrroline-2-carboxylate reductase involved in trans-3-hydroxy-l-proline metabolism of bacteria

    OpenAIRE

    Watanabe, Seiya; Tanimoto, Yoshiaki; Yamauchi, Seiji; Tozawa, Yuzuru; Sawayama, Shigeki; Watanabe, Yasuo

    2014-01-01

    Highlights • The bacterial metabolic pathway of trans-3-hydroxy-l-proline (T3LHyp) has been identified. • Azospirillum brasilense can grow on T3LHyp as a sole carbon source. • The T3LHyp pathway comprises T3LHyp dehydratase and Δ1-pyrroline-2-carboxylate reductase. • This pathway is similar to one found in mammals.

  6. Survival of endophytic diazotrophic bacteria in soil under different moisture levels Sobrevivência de bactérias diazotróficas endofíticas no solo sob diferentes teores de umidade

    Directory of Open Access Journals (Sweden)

    André L.M. Oliveira

    2004-12-01

    Full Text Available The effects of soil moisture on the survival of three diazotrophic bacteria species (Azospirillum amazonense, Gluconacetobacter diazotrophicus and Azospirillum brasilense were tested. Soil moisture had little influence on the survival of A. brasilense, which is considered a free-living species. On the other hand, increased soil moisture extended the survival of the endophytes A. amazonense and G. diazotrophicus. These results indicate that nitrogen-fixing endophytic species are more affected by soil moisture than associative nitrogen-fixing species.Neste trabalho foi avaliado o efeito da umidade do solo na sobrevivência de três espécies de bactérias diazotróficas (Azospirillum amazonense, Gluconacetobacter diazotrophicus e Azospirillum brasilense. O teor de umidade apresentou pouca influência na sobrevivência de A. brasilense, considerada uma espécie cosmopolita, enquanto A. amazonense e G. diazotrophicus, consideradas endofíticas, aumentaram o período de culturabilidade na presença de umidade no solo. Os resultados demonstram que o teor de umidade do solo possui maior influência nas espécies endofíticas, em comparação às espécies associativas.

  7. Dicty_cDB: VHN643 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHN643 (Link to dictyBase) - - - Contig-U15036-1 VHN643P (Link to Original ... ents: (bits) Value AM050060_1( AM050060 |pid:none) Azospirillum ... brasilense partial pu... 198 3e-49 CP000699_3106( ...

  8. Dicty_cDB: VHQ389 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHQ389 (Link to dictyBase) - G20672 DDB0230088 Contig-U15036-1 VHQ389P (Lin ... ents: (bits) Value AM050060_1( AM050060 |pid:none) Azospirillum ... brasilense partial pu... 196 2e-48 CP000699_3106( ...

  9. fRNAdb Summary: FR199526 [

    Lifescience Database Archive (English)

    Full Text Available FR199526 AY685923,AY685924,AY685926,AY685927 transfer RNA (tRNA), TGC (Ala/A) Alanine tRNA Azospirillum ... irillum brasilense,Azospirillum ... lipoferum RF00005 Rfam v8.1 FR199526.jpg FR199526. ...

  10. Arabidopsis CDS blastp result: AK065162 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK065162 J013002C05 At5g23140.1 ATP-dependent Clp protease proteolytic subunit, putative nClpP2/ ... c subunit (EC 3.4.21.92) (Endopeptidase Clp) from [Azospirillum ... brasilense] 2e-66 ...

  11. AcEST: BP919917 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_F08 438 Adiantum capillus-veneris mRNA. clone: YMU001_000130_F08. BP919917 - Show ... R_AZOBR HTH-type transcriptional regulator gbpR OS=Azospirillum ... brasilense GN=gbpR PE=1 SV=1 Length = 342 Score = ...

  12. Dicty_cDB: VFO656 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFO656 (Link to dictyBase) - - - Contig-U15036-1 VFO656P (Link to Original ... oulou... 166 1e-39 AM050060_1( AM050060 |pid:none) Azospirillum ... brasilense partial pu... 164 7e-39 CP000943_2544( ...

  13. Arabidopsis CDS blastp result: AK073070 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK073070 J033013H23 At3g63510.1 nitrogen regulation family protein contains Pfam domain PF01207: ... lar to (SP:P45672) NIFR3-like protein (SP:P45672) [Azospirillum ... brasilense] 1e-148 ...

  14. Dicty_cDB: VHH651 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHH651 (Link to dictyBase) - - - Contig-U15036-1 VHH651P (Link to Original ... ents: (bits) Value AM050060_1( AM050060 |pid:none) Azospirillum ... brasilense partial pu... 179 2e-43 CP000943_2544( ...

  15. Dicty_cDB: SSK605 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSK605 (Link to dictyBase) - - - Contig-U15036-1 SSK605E (Link to Original ... ents: (bits) Value AM050060_1( AM050060 |pid:none) Azospirillum ... brasilense partial pu... 205 2e-51 CU234118_1139( ...

  16. Dicty_cDB: VHB561 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB561 (Link to dictyBase) - - - Contig-U15036-1 VHB561P (Link to Original ... ents: (bits) Value AM050060_1( AM050060 |pid:none) Azospirillum ... brasilense partial pu... 201 4e-50 CP000699_3106( ...

  17. Arabidopsis CDS blastp result: AK121934 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121934 J033107A05 At5g23140.1 ATP-dependent Clp protease proteolytic subunit, putative nClpP2/ ... c subunit (EC 3.4.21.92) (Endopeptidase Clp) from [Azospirillum ... brasilense] 2e-76 ...

  18. Dicty_cDB: VHE871 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE871 (Link to dictyBase) - - - Contig-U11753-1 | Contig-U13627-1 VHE871P ... 157592.... 33 7.5 EU864034_12( EU864034 |pid:none) Azospirillum ... brasilense histone a... 33 9.7 AF167159_1( AF16715 ...

  19. fRNAdb Summary: FR076235 [

    Lifescience Database Archive (English)

    Full Text Available FR076235 AY685923,AY685924,AY685926,AY685927 transfer RNA (tRNA), GAT (Ile/I) Isoleucine tRNA Azospirillum ... ospirillum brasilense,Azospirillum ... lipoferum RF00005 Rfam v8.1 FR076235.jpg FR076235. ...

  20. Dicty_cDB: CHS229 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHS229 (Link to dictyBase) - - - Contig-U15036-1 - (Link to Original site) ... ents: (bits) Value AM050060_1( AM050060 |pid:none) Azospirillum ... brasilense partial pu... 153 5e-38 CP000943_2544( ...

  1. Sequence Classification: 896752 [

    Lifescience Database Archive (English)

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|19112778|ref|NP_595986.1| protein with weak ... similarity to Azospirillum ... brasilense nifR3 protein; yeast YML080W homolog; U ...

  2. Arabidopsis CDS blastp result: AK108886 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK108886 002-152-D12 At3g63510.1 nitrogen regulation family protein contains Pfam domain PF01207 ... lar to (SP:P45672) NIFR3-like protein (SP:P45672) [Azospirillum ... brasilense] 2e-87 ...

  3. Flüchtlinge: Herausforderung und Chance für Deutschland

    OpenAIRE

    Geis, Wido; Orth, Anja Katrin

    2015-01-01

    In den letzten Monaten sind immer mehr Flüchtlinge nach Deutschland gekommen. Allein im ersten Halbjahr 2015 wurden hier 171.785 Asylanträge gestellt und für das Gesamtjahr wird mit bis zu 800.000 gerechnet. Noch höher ist die Zahl der laufenden Asylverfahren mit 274.645 im April 2015, was insbesondere für die Kommunen zu einer enormen Belastung führt. Dabei kommt ein bedeutender Teil der Flüchtlinge aus Ländern, in denen weder (Bürger-) Krieg herrscht noch politische Verfolgung droht, und ha...

  4. Das Weltflüchtlingsproblem und die Vereinten Nationen

    OpenAIRE

    Angenendt, Steffen

    2002-01-01

    "Seit dem Ende des Kalten Krieges haben sich die internationalen Fluchtbewegungen verändert. Ein Aspekt ist, dass die Zahl der Flüchtlinge abgenommen, die der Binnenvertriebenen aber zugenommen hat. Es ist fraglich, ob der bestehende Flüchtlingsschutz im Rahmen der Vereinten Nationen geeignet ist, die derzeitigen und künftigen Herausforderungen zu bewältigen. In dem Beitrag werden Kennziffern zur derzeitigen Flüchtlingsproblematik präsentiert, das bestehende System des VN-Flüchtlingsschutzes ...

  5. Adäquate Anhörung im Asylverfahren für Flüchtlingsfrauen?: zur Qualifizierung der "Sonderbeauftragten für geschlechtsspezifische Verfolgung" beim Bundesamt für die Anerkennung ausländischer Flüchtlinge

    OpenAIRE

    Gahn, Catrin

    1999-01-01

    Die Anhörung im Asylverfahren durch eine/einen EinzelentscheiderIn des Bundesamtes für die Anerkennung ausländischer Flüchtlinge ist zentrale Grundlage für die Entscheidung über ein Bleiberecht. AsylbewerberInnen müssen in der Anhörung alle ihre Fluchtgründe offen darlegen - und zwar so, dass sie 'glaubhaft' erscheinen. Auf die öffentliche Diskussion vor allem über Massenvergewaltigungen in Bosnien und im Kosovo-Krieg sowie Genitalverstümmelung hat das Bundesamt 1996 mit der Ernennung von 'So...

  6. Entstehung und Entwicklung von Rehabilitationszentren im Industrieland Deutschland und ihre Übertragbarkeit auf Afghanistan

    OpenAIRE

    Azizi, Shirshah

    2008-01-01

    Seit 1979, als sowjetische Truppen in das Land einmarschierten, wird in Afghanistan ununterbrochen gekämpft. Die durch den Krieg verursachten Schäden sind nicht abschätzbar. Infrastruktur und soziale Basisdienste wurden fast vollständig zerstört. Über 50 Millionen Minen verschiedenster Art sind in Afghanistan verstreut, die noch mehr Menschenleben kosten werden und Menschen zu Verkrüppelten machen. Die medizinische Versorgung in Afghanistan spiegelt das allgemeine für Entwicklungsländer besch...

  7. Beschreibung Afrikas in der neueren deutschsprachigen Literatur : am Beispiel von Hans Grimms afrikanischen Dramen und Novellen und Uwe Timms Roman 'Morenga'

    OpenAIRE

    Ndiaye, Baboucar

    2006-01-01

    Der afrikanische Kontinent stellt für viele Europäer immer noch einen unbekannten Teil der Erde dar. Politiker, Schriftsteller, Auslandskorrespondenten sowohl Journalisten, die sich für eine sehr kurze Zeit in Afrika aufhalten, erlauben sich Bücher über Afrika zu schreiben. Mit den wenigen Informationen über die sie verfügen, fabrizieren sie ein miserables Bild Afrikas. Dabei wird Afrika meist als Kontinent beschrieben - K für Kriege, Krisen, Katastrophen, Korruptionen, Kriminalitäten, Kapita...

  8. Sobre Clausewitz, Aron, Raymond : Buenos Aires, Ediciones Nueva Visión, 2009. 155 páginas. ISBN: 978-950-602-589-2.

    OpenAIRE

    Laleff Ilieff, Ricardo J.

    2011-01-01

    La figura de Clausewitz ha sido objeto de interés de distintos analistas de la guerra y la teoría política. Así pues, el escritor de Vom Kriege se convirtió en un tópico de referencia para abordar problemáticas fundantes de la modernidad. En esta oportunidad, el lector se encontrará con una recopilación de trabajos que vieron la luz en conferencias y en revistas especializadas de Francia, Inglaterra y Alemania. En este sentido, el presente ejemplar complementa o apoya muchas de las tesis que ...

  9. Wendepunkt 11. September

    OpenAIRE

    Crome, Erhard

    2011-01-01

    "Hin und wieder ist es sinnvoll", betonte Bertrand Russell, "ein Fragezeichen hinter Dinge zu setzen, die wir schon lange für selbstverständlich nehmen". Der US-amerikanische 11. September ist zehn Jahre her. Die Neokonservativen in den USA hatten bereits in den 1990er Jahren verschiedene Netzwerke gegründet, darunter das Project for the New American Century (PNAC). Das agitierte für den Sturz Saddam Husseins und Krieg gegen den Irak. Davon wollte Präsident Clinton nichts wissen; George W. Bu...

  10. Max Frisch: Der andorranische Jude

    OpenAIRE

    Vilas-Boas, Gonçalo

    2011-01-01

    Der Text „Der andorranische Jude“ (1966) stammt aus dem "Tagebuch 1946-1949". Max Frisch benutzte diese Skizze als Vorlage zu seinem späteren Stück "Andorra" (1961). Es soll der Versuch unternommen werden, herauszufinden, was für Leseinstruktionen dieser Text dem heutigen Leser gibt. Es darf nicht vergessen werden, daß er 1946 geschrieben worden ist, als Deutschland und Europa in Trümmern lagen. Frisch erscheint als Schweizer unbeteiligt, (er hat nicht am Krieg teilgenommen), zugleich aber al...

  11. Krzysztof Komeda (1931-1969) : auch: Christian Komeda, Christophe T. Komeda, Christopher Komeda; Geburtsname: Krzysztof Trzcinski; irreführenderweise auch: Krzysztof Komeda-Trzcinski

    OpenAIRE

    Wulff, Hans Jürgen

    2010-01-01

    Krzysztof Komeda wurde am 27.4.1931 als Krzysztof Trzcinski in Posen geboren. Komeda war einer der bekanntesten polnischen Jazz-Pianisten, der weltweit bekannt war - nicht zuletzt durch diverse Filmmusiken, die er unter anderem für Filme Roman Polanskis schrieb. Er bekam schon als Kind Klavierunterricht. Er wurde als Achtjähriger Schüler am Konservatorium in Posen (Klavierunterricht und Musiktheorie) unterrichtet. Nach dem Krieg nahm er das Medizinstudium auf, wurde Hals-Nasen-Ohr-Arzt. Noch ...

  12. Sozialberichterstattung im südlichen Afrika

    OpenAIRE

    Kleebauer, Sabine

    1997-01-01

    "'Transformation' ist zum Schlüsselbegriff der neunziger Jahre geworden. Das Ende des kalten Krieges hat nicht nur in Europa, sondern in weiten Teilen der Welt einschneidende gesellschaftliche Umwälzungen ausgelöst. Im südlichen Afrika waren diese Umwälzungen in ihre Zuspitzung auf den Konflikt zwischen der schwarzen Bevölkerungsmehrheit und der weißen Bevölkerungsminderheit besonders dramatisch. Südafrika mit seinem charismatischen Staatschef Nelson Mandela, und Namibia, die einstige deutsch...

  13. „Geschichte des Mitmachens“ oder Opferdiskurs. Frauen als Autorinnen von Kriegsliteratur “History of Participation” or Victim Discourse: Women as Authors of War Literature

    OpenAIRE

    Astrid Gehrig

    2008-01-01

    Cordula Mahr ermöglicht mit ihrer Untersuchung von 70 Autobiographien deutscher Frauen einen Blick auf die „Heimatfront“, ein Blick, der bisher in einer vornehmlich männlich besetzten Kriegsliteratur, die Krieg in erster Linie als Fronterlebnis definiert, vernachlässigt wurde. Die Autorin konzentriert sich auf die Passagen der Autobiographien, die sich direkt auf den Zweiten Weltkrieg beziehen, und berücksichtigt ausschließlich nach 1960 erschienene Texte. In den Darstellungen überwiegt in Be...

  14. Die Männlichkeit des Militärs als Dominanzkultur in Israel The Maleness of the Military as a Dominant Culture in Israel

    OpenAIRE

    Ellen Krause

    2002-01-01

    Uta Klein legt eine sehr informierte, lehrreiche und gut lesbare Studie über den komplexen Zusammenhang von Militär und Geschlecht in Israel vor – einem Land, das seit seiner Entstehung von Krieg begleitet ist, dessen Politik vom militärischen Sicherheitsdenken dominiert wird und dessen Bevölkerung, männliche wie weibliche, weitgehend zum Militärdienst herangezogen wird.Uta Klein presents an informed, informative, and readable study about the complex relationships between the army and the gen...

  15. Militär und Gesellschaft in der Frühen Neuzeit

    OpenAIRE

    Arbeitskreis Militär und Gesellschaft in der Frühen Neuzeit e.V. (Hrsg.)

    2008-01-01

    Inhalt: AUFSÄTZE Alexander Kästner: „Desertionen in das Jenseits.“ Ansätze und Desiderate einer militärhistorischen Suizidforschung für die Frühe Neuzeit. Claudia Schmitz: Der symbolische und religiöse Gehalt von Gewalt und Krieg im Prozess der inkaischen Staatsentwicklung. PROJEKTE Urte Evert: Die Eisenbraut. Symbolische Funktionen der soldatischen Waffe. Philippe Rogger: Pensionenunruhen 1513-1516. Klientelistische Verflechtung – herrschaftliche Verdichtung – bäuerlicher Widerstand? Frank Z...

  16. Représentations de la Grande Guerre dans les textes littéraires des manuels scolaires de lecture (1923-1939) en France

    OpenAIRE

    Demougin, Françoise

    2014-01-01

    International audience Die Lesebücher für das französische Schulwesen erweisen sich als sehr wirksame Vermittler von Kenntnissen und Werten. Dieser Beitrag zeigt, dass sie eine Vorstellung des Krieges mittels der ausgewählten literarischen Texte, der beigefügten Bilder und der Schüleraufgaben erzeugen können, deren Gesamtheit Formen der Argumentation zugunsten der Übernahme einer ideologischen Konstruktion bildet. Wir wissen zwar wenig über die prägende Wirkung auf die Vorstellungskraft, d...

  17. Between Ground Zero and square one : how George W. Bush failed on Russia

    OpenAIRE

    Spanger, Hans-Joachim

    2007-01-01

    'Die Beziehungen zwischen Washington und Moskau sind am Ende der Amtszeit von George W. Bush wieder dort angelangt, wo sie einst gestartet waren: im 'Kalten Krieg'. Die Raketenabwehr, das Kosovo und die Demokratie in Russland sind nur einige der Themen, bei denen beide Seiten scheinbar unüberbrückbare Differenzen aufweisen. Der Report untersucht, wie es dazu kam. Er zeigt auf, wie die Chance einer umfassenden Verständigung nach dem 11. September von den USA verspielt wurde, weil Russland zwar...

  18. Zwischen Ground Zero und Square One : George W. Bush und die Folgen der Simulation amerikanischer Russlandpolitik

    OpenAIRE

    Spanger, Hans-Joachim

    2007-01-01

    'Die Beziehungen zwischen Washington und Moskau sind am Ende der Amtszeit von George W. Bush wieder dort angelangt, wo sie einst gestartet waren: im 'Kalten Krieg'. Die Raketenabwehr, das Kosovo und die Demokratie in Russland sind nur einige der Themen, bei denen beide Seiten scheinbar unüberbrückbare Differenzen aufweisen. Der Report untersucht, wie es dazu kam. Er zeigt auf, wie die Chance einer umfassenden Verständigung nach dem 11. September von den USA verspielt wurde, weil Russland zwar...

  19. Efecto de la biofertilización y los biorreguladores en la germinación y el crecimiento de Carica papaya L.

    Directory of Open Access Journals (Sweden)

    Maricela Constantino

    2011-01-01

    Full Text Available Título en inglés: Effect of biofertilization and bioregulators on germination and growth of Carica papaya L. Resumen Con el objetivo de incrementar y acelerar el proceso de germinación de las semillas y obtener una alta producción y homogeneidad de plántulas de Carica papaya variedad Maradol en vivero, se evaluó el efecto de tres biofertilizantes aplicados solos o en combinación (Azotobacter chroococcum, Azospirillum brasilense y Glomus intraradices, y un biorregulador del crecimiento vegetal, el ácido giberélico (AG3, en la germinación y el crecimiento vegetal. Se realizó un experimento bajo un diseño completamente al azar con ocho tratamientos y tres repeticiones. A las semillas se les aplicó un pretratamiento germinativo con alternancia de temperatura para superar la dormancia. Los tratamientos simples con A. chroococcum y A. brasilense, incrementaron el porcentaje de germinación a 90,28 y 88,89% respectivamente. Además, con la aplicación de los biofertilizantes y el AG3, la velocidad de germinación se incrementó y el tiempo medio de germinación se redujo. La doble aplicación en semillas y foliar de los biofertilizantes y el AG3 en plántulas mejoró el crecimiento vegetal. La población de A. chroococcum fue mayor cuando se inoculó en combinación con G. intraradices. La prevalencia de colonización de las plántulas inoculadas con G. intraradices varió de 18,53 a 26,67%, con el mayor valor registrado para el tratamiento combinado con A. brasilense. Finalmente, aplicando esta metodología se logró acelerar la germinación, obteniéndose una mayor homogeneidad en la emergencia de las plántulas, disminuyendo así el tiempo de permanencia en el vivero. Palabras clave: Azospirillum brasilense; Azotobacter chroococcum; Glomus intraradices; ácido giberélico; dormancia. Abstract In order to increase and accelerate the process of seed germination and obtain a high yield and homogeneity of papaya seedlings cv. Maradol in

  20. Response of rice to inoculation with plant growth promoting rhizobacteria in control lab environment and field experiment

    International Nuclear Information System (INIS)

    The present study was conducted to evaluate the effects of bacterial inoculation on different growth parameters of rice variety JP-5. Three bacterial strains (Azospirillum brasilense R1, Azospirillum lipoferum RSWT1 and Pseudomonas Ky1) were used to inoculate rice varietyJP-5 at control lab environment and field. Plant growth promotion was observed in all inoculated treatments over non-inoculated, which was evident from increase in root area, root length, number of tillers, straw and grain yields and total weight of plant. Azospirillum brasilense R1 was more effective in plant growth promotion than other strains and showed 19% increase in the straw weight and 39.5% increase in grain weight. Inoculation with Azospirillum lipoferum RSWT1 and Pseudomonas Ky1 increased grain weight by 18.5% and 13.8% respectively. The study revealed that beneficial strains of PGPR can be used as biofertilizer for rice. (author)

  1. STUDY OF AZOSPIRILLUM LECTINS INFLUENCE ON HYDROGEN PEROXIDE PRODUCTION IN WHEAT-ROOTS

    Directory of Open Access Journals (Sweden)

    Alen’kina S.A.

    2009-12-01

    Full Text Available It was found that two cell-surface lectins isolated from the nitrogen-fixing soil bacterium Azospirillum brasilense Sp7 and from its mutant defective in lectin activity, A. brasilense Sp7.2.3 can stimulate rapid formation of hydrogen peroxide, associated with an increase in the activities of oxalate oxidase and peroxidase in the roots of wheat seedlings. The most advantageous and most rapidly induced pathway of hydrogen peroxide formation was the oxidation of oxalic acid by oxalate oxidase because in this case, a 10-min treatment of the roots with the lectins at 10 µg ml-1 was sufficient. The data from this study attest that the Azospirillum lectins can act as inducers of adaptation processes in the roots of wheat seedlings.

  2. Studies on phosphorus utilization as influenced by bacterial seed inoculation and phosphorus fertilization in summer mung (Vigna radiata L. Wilczek)

    International Nuclear Information System (INIS)

    A greenhouse experiment was conducted with four types of bacterial inoculation (Rhizobium alone; Rhizobium along with Azotobacter chroococcum; Rhizobium along with Azospirillum brasilense and no inoculation) and three levels of phosphorus (32P labelled SSP) application (O, 6.5 ppm and 13.0 ppm P). Inoculation with Rhizobium along with Azotobacter chroococcum was found to be better than Rhizobium alone or Rhizobium along with Azospirillum brasilense in respect of leaf, stem, root and nodule dry weight, phosphorus uptake and utilization efficiency. P application upto 6.5 ppm significantly increased leaf, stem, root and nodule dry weight and phosphorus uptake. Per cent phosphorus derived from fertilizer (per cent pdff) and fertilizer P uptake significantly increased while P utilization efficiency significantly decreased with increasing levels of P application. (author). 12 refs., 2 tables

  3. Change in the Content of Salicylic Acid and in the Activities of Phenylalanine Ammonia-Lyase and Catalase in Wheat Seedling Roots Under the Effect of Azospirillum Lectins

    Directory of Open Access Journals (Sweden)

    Alen'kina S.A.

    2012-05-01

    Full Text Available We investigated the time course of changes in the endogenous content of salicylic acid, the ratio between the acid's free and bound forms, and changes in the activities of phenylalanine ammonia-lyase and catalase in wheat seedling roots under the effect of the lectins of two strains of the associative nitrogen-fixing bacterium Azospirillum: A. brasilense Sp7 and its mutant defective in lectin activity, A. brasilense Sp7.2.3. Differences in plant response to the action of the lectins from these two strains were established. On the basis of the obtained data, a model was proposed for lectin-assisted induction of resistance, according to which the lectin effect on the roots of seedlings results in accumulation of free salicylic acid, which inhibits catalase activity, ultimately leading to accumulation of hydrogen peroxide and to formation of induced resistance.

  4. Cellulose decomposition and associated nitrogen fixation by mixed cultures of Cellulomonas gelida and Azospirillum species or Bacillus macerans

    Energy Technology Data Exchange (ETDEWEB)

    Halsall, D.M.; Gibson, A.H.

    1985-10-01

    Mixed cultures of Cellulomonas gelida plus Azospirillum lipoferum or Azospirillum brasilense and C. gelida plus Bacillus macerans were shown to degrade cellulose and straw and to utilize the energy-yielding products to fix atmospheric nitrogen. This cooperative process was followed over 30 days in sand-based cultures in which the breakdown of 20% of the cellulose and 28 to 30% of the straw resulted in the fixation of 12 to 14.6 mg of N per g of cellulose and 17 to 19 mg of N per g of straw consumed. Cellulomonas species have certain advantages over aerobic cellulose-degrading fungi in being able to degrade cellulose at oxygen concentrations as low as 1% O/sub 2/ (vol/vol) which would allow a close association between cellulose-degrading and microaerobic diazotrophic microorganisms. Cultures inoculated with initially different proportions of A. brasilense and C. gelida all reached a stable ratio of approximately 1 Azospirillum/3 Cellulomonas cells.

  5. [Comparative assessment of inductive effects of Azospirillum lectins with different antigenic properties on the signal systems of wheat seedling roots].

    Science.gov (United States)

    Alen'kina, S A; Petrova, L P; Sokolova, M K; Chernyshova, M P; Trutneva, K A; Bogatyrev, V A; Nikitina, V E

    2014-01-01

    The lectins of associative nitrogen-fixing bacteria Azospirillum brasilense Sp7 and its mutant A. brasilense Sp7.2.3 were shown to have different effects on the components of the wheat seedling root signal system, namely to regulate the levels of cAMP, nitric oxide, diacylglycerol, and salicylic acid, as well as to induce the activities of superoxide dismutase and lipoxygenase. Our results make it possible to consider azospirilla lectins as inducers of the signal systems in wheat seedling roots, since they cause development of several flows of primary signals. These data are of general biological importance, since lectins are present in all living organisms and most ot the functions of lectins remain insufficiently understood. PMID:25844444

  6. LA BIOFERTILIZACIÓN CON RIZOBACTERIAS Y HONGOS MICORRÍZICOS ARBUSCULARES EN LA PRODUCCIÓN DE POSTURAS DE TOMATE (Lycopersicon esculentum Mill. Y CEBOLLA (Allium cepa L.. I. CRECIMIENTO VEGETATIVO

    Directory of Open Access Journals (Sweden)

    L. E. Pulido

    2003-01-01

    Full Text Available En áreas experimentales de la Universidad de Ciego de Ávila, sobre un suelo Ferralítico Rojo compactado eútrico y durante dos campañas hortícolas sucesivas, se estudió el efecto de la inoculación, simple y combinada, mediante recubrimiento de las semillas y prescindiendo de la fertilización mineral, con cuatro y cinco especies, respectivamente, de rizobacterias promotoras del crecimiento vegetal -RPCV- (Azospirillum brasilense, Azotobacter chroococcum, Burkholderia cepacia y Pseudomonas fluorescens y de hongos micorrízicos arbusculares -HMA- (Glomus clarum, G. fasciculatum, G. mosseae, G. agregatum y G. versiculiferum, sobre algunos indicadores del crecimiento de posturas de tomate y cebolla, tomando como criterio de evaluación la altura y la longitud radical de las plántulas. Los resultados mostraron que, para el tomate, la inoculación con Azospirillum brasilense, Azotobacter chroococcum y Burkholderia cepacia permitió obtener posturas de calidad equivalente a la alcanzada con la fertilización mineral, mientras que para la cebolla, solo Azospirillum brasilense y Azotobacter chroococcum lograron que las posturas tuvieran dicha calidad. En relación con la inoculación con HMA, las especies Glomus clarum, G. fasciculatum y G. mosseae, para ambos cultivos, produjeron posturas con valores de altura y longitud radical considerados óptimos. Con las coinoculaciones de RPCV + HMA se lograron posturas de calidad superior a la alcanzada con las mejores variantes de inoculación simple, destacándose las combinaciones de G. clarum y G. fasciculatum con A. brasilense para el tomate y de G. clarum y G. fasciculatum con A. chroococcum para la cebolla.

  7. HONGO ENDOMICORRÍZICO Y BACTERIA FIJADORA DE NITRÓGENO INOCULADAS A Coffea arabica EN VIVERO

    Directory of Open Access Journals (Sweden)

    Juan Francisco Aguirre-Medina

    2011-01-01

    Full Text Available Con el objetivo de determinar el efecto de la inoculación con Azospirillum brasilense y Glomus intraradice en café, se estableció la presente investigación en un vivero en el Campo Experimental Rosario Izapa, Chiapas, México de septiembre de 2005 a abril de 2006. Se utilizó un suelo Andosol¿mólico típico de la región cafetalera del Soconusco Chiapas, México. El A. brasilense tuvo una concentración de 100 x 106 bacterias por gramo de turba y el hongo micorrízico, cuarenta esporas por gramo de suelo con infección de 95% en el sistema radical de cebolla. Los tratamientos utilizados fueron los microorganismos solos, la combinación de ambos y el testigo sin inocular que se distribuyeron en un diseño de bloques completos al azar. Se evaluaron variables morfológicas y fisiológicas del rendimiento cada treinta días a partir del segundo mes de siembra durante siete meses y se determinó el contenido de N, P y Ca en el tejido vegetal. Los resultados se analizaron estadísticamente y las diferencias entre tratamientos se compararon de acuerdo a Tukey 5%. Los resultados indican una respuesta diferencial entre los microorganismos. A. brasilense indujo mayor desarrollo radical y la simbiosis doble G. intraradices + A. brasilense mejoró el desarrollo del tallo y lámina foliar. El contenido de N, P y Ca se presentó de forma consistente con G. intraradices.

  8. Plant-microorganism-soil interactions influence the Fe availability in the rhizosphere of cucumber plants.

    Science.gov (United States)

    Pii, Youry; Penn, Alexander; Terzano, Roberto; Crecchio, Carmine; Mimmo, Tanja; Cesco, Stefano

    2015-02-01

    Iron (Fe) is a very important element for plants, since it is involved in many biochemical processes and, often, for the low solubility of the natural Fe sources in soil, plants suffer from Fe - deficiency, especially when grown on calcareous soils. Among the numerous plant growth-promoting rhizobacteria (PGPR) that colonize the rhizosphere of agronomically important crops, Azospirillum brasilense has been shown to exert strong stimulating activities on plants, by inducing alterations of the root architecture and an improvement of mineral nutrition, which could result from an enhancement of ion uptake mechanisms as well as by increased bioavailability of nutrients. Some studies have also established that A. brasilense can act as biocontrol agent, by preventing the growth and/or virulence of phytopathogens, most likely through the production of microbial siderophores that sequester Fe from the soil. Despite microbial siderophores complexed with Fe could be an easily accessible Fe source for plants, the possible involvement of A. brasilense in improving Fe nutrition in plants suffering from the micronutrient deficiency has not been investigated yet. Within the present research, the characterization of the physiological and biochemical effects induced by Fe starvation and PGPR inoculation in cucumber plants (Cucumis sativus L. cv. Chinese Long) was carried out. The analyses of root exudates released by hydroponically grown plants highlighted that cucumber plants respond differently depending on the nutritional status. In addition, following the cultivation period on calcareous soil, also the root exudates found in the extracts suggested a peculiar behaviour of plants as a function of the treatment. Interestingly, the presence of the inoculum in soil allowed a faster recovery of cucumber plants from Fe-deficiency symptoms, i.e. increase in the chlorophyll content, in the biomass and in the Fe content of leaves. These observations might suggest a feasible application of

  9. CO-INOCULAÇÃO NO DESENVOLVIMENTO VEGETATIVO E NODULAÇÃO DE PLÂNTULAS DE SOJA SUBMETIDAS À CALAGEM, FERTILIZAÇÃO NITROGENADA E APLICAÇÃO DE MICRONUTRIENTES

    OpenAIRE

    LIBÓRIO, Paloma Helena da Silva; Bárbaro, Ivana Marino; NOBILE, Fábio Olivieri de

    2015-01-01

    In order to evaluate the co-inoculation of soybeans, or mixed inoculation with bacteria of the genus Bradyrhizobium and Azospirillum brasilense, at the expense of traditional inoculation with Bradyrhizobium, two experiments were installed in october 2014, in a greenhouse. The experimental design was completely randomized with eight treatments and eight replications in pots rotation system. Treatments involving different combinations as commercial fertilizer formulations, with or without inocu...

  10. Effect of plant growth-promoting bacteria on the growth and fructan production of Agave americana L.

    OpenAIRE

    De La Torre-Ruiz, Neyser; Ruiz-Valdiviezo, Víctor Manuel; Rincón-Molina, Clara Ivette; Rodríguez-Mendiola, Martha; Arias-Castro, Carlos; Gutiérrez-Miceli, Federico Antonio; Palomeque-Dominguez, Héctor; Rincón-Rosales, Reiner

    2016-01-01

    The effect of plant growth-promoting bacteria inoculation on plant growth and the sugar content in Agave americana was assessed. The bacterial strains ACO-34A, ACO-40, and ACO-140, isolated from the A. americana rhizosphere, were selected for this study to evaluate their phenotypic and genotypic characteristics. The three bacterial strains were evaluated via plant inoculation assays, and Azospirillum brasilense Cd served as a control strain. Phylogenetic analysis based on the 16S rRNA gene sh...

  11. THE SCIENTIFIC BASIS FOR THE CREATION OF NEW FORMS OF MICROBIAL BIOCHEMICALS

    OpenAIRE

    A.P. KOZHEMYAKOV; Yu.V. LAKTIONOV; T.A. POPOVA; A.G. ORLOVA; A.L. KOKORINA; Vaishlya, O. B.; E.V. AGAFONOV; S.A. GUZHVIN; A.A. CHURAKOV; M.T. YAKOVLEVA

    2015-01-01

    Herein we summarize the results of a comprehensive study aimed on the creation of liquid form of biological products for symbiotic and associative rhizobacteria. The objects of study were nodule bacteria from the rhizosphere of galegae (Rhizobium galegae), soybean (Bradyrhizobium japonicum) and associative rhizobacteria (Arthrobacter mysorens, Azospirillum brasilense, Agrobacterium radiobacter), as well as plants of soybean (Glycine max L.), barley (Hordeum L.), alfalfa (Medicago L.), etc. As...

  12. History on the biological nitrogen fixation research in graminaceous plants: special emphasis on the Brazilian experience

    OpenAIRE

    José I. Baldani; Vera L.D. Baldani

    2005-01-01

    This review covers the history on Biological Nitrogen Fixation (BNF) in Graminaceous plants grown in Brazil, and describes research progress made over the last 40 years, most of whichwas coordinated by Johanna Döbereiner. One notable accomplishment during this period was the discovery of several nitrogen-fixing bacteria such as the rhizospheric (Beijerinckia fluminensis and Azotobacter paspali), associative (Azospirillum lipoferum, A. brasilense, A. amazonense) and the endophytic (Herbaspiril...

  13. Identification and characterization of trans-3-hydroxy-l-proline dehydratase and Δ1-pyrroline-2-carboxylate reductase involved in trans-3-hydroxy-l-proline metabolism of bacteria

    Directory of Open Access Journals (Sweden)

    Seiya Watanabe

    2014-01-01

    Full Text Available trans-4-Hydroxy-l-proline (T4LHyp and trans-3-hydroxy-l-proline (T3LHyp occur mainly in collagen. A few bacteria can convert T4LHyp to α-ketoglutarate, and we previously revealed a hypothetical pathway consisting of four enzymes at the molecular level (J Biol Chem (2007 282, 6685–6695; J Biol Chem (2012 287, 32674–32688. Here, we first found that Azospirillum brasilense has the ability to grow not only on T4LHyp but also T3LHyp as a sole carbon source. In A. brasilense cells, T3LHyp dehydratase and NAD(PH-dependent Δ1-pyrroline-2-carboxylate (Pyr2C reductase activities were induced by T3LHyp (and d-proline and d-lysine but not T4LHyp, and no effect of T3LHyp was observed on the expression of T4LHyp metabolizing enzymes: a hypothetical pathway of T3LHyp → Pyr2C → l-proline was proposed. Bacterial T3LHyp dehydratase, encoded to LhpH gene, was homologous with the mammalian enzyme. On the other hand, Pyr2C reductase encoded to LhpI gene was a novel member of ornithine cyclodeaminase/μ-crystallin superfamily, differing from known bacterial protein. Furthermore, the LhpI enzymes of A. brasilense and another bacterium showed several different properties, including substrate and coenzyme specificities. T3LHyp was converted to proline by the purified LhpH and LhpI proteins. Furthermore, disruption of LhpI gene from A. brasilense led to loss of growth on T3LHyp, d-proline and d-lysine, indicating that this gene has dual metabolic functions as a reductase for Pyr2C and Δ1-piperidine-2-carboxylate in these pathways, and that the T3LHyp pathway is not linked to T4LHyp and l-proline metabolism.

  14. Search for endophytic diazotrophs in barley seeds

    Directory of Open Access Journals (Sweden)

    Myriam S. Zawoznik

    2014-06-01

    Full Text Available Eight endophytic isolates assigned to Pseudomonas, Azospirillum, and Bacillus genera according to pheno-genotypic features were retrieved from barley seeds under selective pressure for nitrogen-fixers. Genetic relationships among related isolates were investigated through RAPD. Six isolates displayed nitrogen-fixing ability, while all could biosynthesize indolacetic acid in vitro and showed no antibiosis effects against Azospirillum brasilense Az39, a recognized PGPR.

  15. Genome-wide survey of two-component signal transduction systems in the plant growth-promoting bacterium Azospirillum

    OpenAIRE

    Borland, Stéphanie; Oudart, Anne; Prigent-Combaret, Claire; Brochier-Armanet, Céline; Wisniewski-Dyé, Florence

    2015-01-01

    Background Two-component systems (TCS) play critical roles in sensing and responding to environmental cues. Azospirillum is a plant growth-promoting rhizobacterium living in the rhizosphere of many important crops. Despite numerous studies about its plant beneficial properties, little is known about how the bacterium senses and responds to its rhizospheric environment. The availability of complete genome sequenced from four Azospirillum strains (A. brasilense Sp245 and CBG 497, A. lipoferum 4...

  16. Biology of Azospirillum-Sugarcane Association: Enhancement of Nitrogenase Activity †

    OpenAIRE

    Berg, R. Howard; Tyler, Max E.; Novick, Norman J.; Vasil, Vimla; Vasil, Indra K.

    1980-01-01

    Azospirillum brasilense was reisolated from associations with callus tissue cultures of sugarcane and compared with stock cultures of the inoculated bacterium and related strains. Although the reisolate had a growth rate similar to stock cultures, it exhibited a severalfold increase in maximum specific activity of nitrogenase. The reisolate and the parent culture had similar ultrastructure. The general ultrastructure of Azospirillum is described. The bacterium was capsulated when grown on nit...

  17. Chemotaxis of Azospirillum Species to Aromatic Compounds

    OpenAIRE

    Lopez-de-Victoria, Geralyne; Lovell, Charles R.

    1993-01-01

    Chemotaxis of Azospirillum lipoferum Sp 59b and Azospirillum brasilense Sp 7 and Sp CD to malate and to the aromatic substrates benzoate, protocatechuate, 4-hydroxybenzoate, and catechol was assayed by the capillary method and direct cell counts. A. lipoferum required induction by growth on 4-hydroxybenzoate for positive chemotaxis to this compound. Chemotaxis of Azospirillum spp. to all other substrates did not require induction. Maximum chemotactic responses for most aromatic compounds occu...

  18. Optical methods for creating delivery systems of chemical compounds to plant roots

    Science.gov (United States)

    Kuznetsov, Pavel E.; Rogacheva, Svetlana M.; Arefeva, Oksana A.; Minin, Dmitryi V.; Tolmachev, Sergey A.; Kupadze, Machammad S.

    2004-08-01

    Spectrophotometric and fluorescence methods have been used for creation and investigation of various systems of target delivery of chemical compounds to roots of plants. The possibility of using liposomes, incrusted by polysaccharides of the external surface of nitrogen-fixing rizospheric bacteria Azospirillum brasilense SP 245, and nanoparticles incrusted by polysaccharides of wheat roots, as the named systems has been shown. The important role of polysaccharide-polysaccharide interaction in the adsorption processes of bacteria on wheat roots has been demonstrated.

  19. Growth Promotion and Enhanced Nutrient Uptake of Maize (Zea maysL.) by Application of Plant Growth Promoting Rhizobacteria in Arid Region of Iran

    OpenAIRE

    A. Biari; A. Gholami; H.A. Rahmani

    2008-01-01

    The effect of plant growth-promoting rhizobacteria (PGPR) belonging to the genera Azospirillum and Azotobacter on the growth and nutrient uptake of maize (Zea mays) was investigated in the field as factorial experiment. Azospirillum strains were: Z0 = no inoculation, Z1 = Azospirillum sp. Strain 21, Z2 = Azospirillum lipoferum DSM 1691, Z3 = Azospirillum brasilense DSM 1690 and Azotobacter strains were: A0 = no inoculation, A1 = Azotobacter sp. Strain 5, A2 = Azotobacter chroococcum ...

  20. Use of Bio-Organic Fertilizers to Develop N Uptake Using 15N Technique

    International Nuclear Information System (INIS)

    Experimental work either in field scale or in green house conditions were conducted using 15N technique to evaluate the role of different bio fertilizers and different plant residues as organic amendments on enhancement of plant N nutrition. Nitrogen fixation by a symbiotic bacteria has been observed in greenhouse and field experiments under dry land cropping systems. Biological N2 fixation associated with crop residues (legumes or cereals) was investigated in pot experiments with wheat and chickpea cultivars. In these experiments, labelled wheat and rice straw were used as organic N sources in comparison with either 15N-labelled ammonium sulfate or ammonium nitrate as chemical nitrogen fertilizers. Rhizobium inoculation extended to be used with wheat gave the best results of N uptake and N2 fixation when combined with Azospirillum brasilense as heterotrophic diazotrophs. The nitrogen uptake by wheat plants was significantly increased by application of soybean residues and inoculation with Azospirillum brasilense. From the field trial we can conclude that soybean residue as enriched N material, and Azospirillum brasilense inoculation enhanced N yields of wheat cultivars grown in poor fertile sandy soil

  1. A novel interaction between plant-beneficial rhizobacteria and roots: colonization induces corn resistance against the root herbivore Diabrotica speciosa.

    Directory of Open Access Journals (Sweden)

    Franciele Santos

    Full Text Available A number of soil-borne microorganisms, such as mycorrhizal fungi and rhizobacteria, establish mutualistic interactions with plants, which can indirectly affect other organisms. Knowledge of the plant-mediated effects of mutualistic microorganisms is limited to aboveground insects, whereas there is little understanding of what role beneficial soil bacteria may play in plant defense against root herbivory. Here, we establish that colonization by the beneficial rhizobacterium Azospirillum brasilense affects the host selection and performance of the insect Diabrotica speciosa. Root larvae preferentially orient toward the roots of non-inoculated plants versus inoculated roots and gain less weight when feeding on inoculated plants. As inoculation by A. brasilense induces higher emissions of (E-β-caryophyllene compared with non-inoculated plants, it is plausible that the non-preference of D. speciosa for inoculated plants is related to this sesquiterpene, which is well known to mediate belowground insect-plant interactions. To the best of our knowledge, this is the first study showing that a beneficial rhizobacterium inoculant indirectly alters belowground plant-insect interactions. The role of A. brasilense as part of an integrative pest management (IPM program for the protection of corn against the South American corn rootworm, D. speciosa, is considered.

  2. Microorganisms associated to tomato seedlings growing in saline culture act as osmoprotectant

    Directory of Open Access Journals (Sweden)

    Daniel Cortés-Jiménez

    2014-06-01

    Full Text Available Less than 0.5% of total water in the world is available for human consumption and agriculture. The major part of the world's water is saline and salinity in soils interferes in germination of seeds and the posterior development of the plant. In order to increase the osmotolerance of tomato, seedlings were associated with Azospirillum brasilense Cd, Azospirillum brasilense Cd transformed bacteria with a plasmid harboring a trehalose biosynthesis gene-fusion or Chlorella vulgaris. Two plant culture media: Hydroponic and Murashige and Skoog were tested. In the first set of studies seedlings were associated to single free cells meanwhile in a second set single and combined free cells were studied. A positive interaction between transformed Azospirillum and Chlorella vulagris and tomato plants was observed. Seedlings showed a salt concentration tolerance, as sodium chloride, up to 200 mM. According to our results, the association of plants with A. brasilense Cd-BIF and C. vulgaris is a viable approach to increase their salt tolerance and biomass, as consequence the possible use of sea water to irrigate horticultural plants.

  3. Coexistence and survival of pathogenic leptospires by formation of biofilm with Azospirillum.

    Science.gov (United States)

    Kumar, K Vinod; Lall, Chandan; Raj, R Vimal; Vedhagiri, K; Vijayachari, P

    2015-06-01

    Pathogenic Leptospira spp. represent one cause of leptospirosis worldwide and have long been regarded as solitary organisms in soil and aquatic environments. However, in the present study, Leptospira interrogans was observed to be associated with environmental biofilms with 21 bacterial isolates belonging to 10 genera. All 21 isolates were examined for their coaggregation and biofilm-forming ability with leptospires in vitro. Among these, Azospirillum brasilense RMRCPB showed maximum interspecies coaggregation with leptospiral strains (>75%, visual score of +4). Other significant coaggregating isolates belonged to the genera Sphingomonas, Micrococcus, Brevundimonas, Acinetobacter and Paracoccus. Biofilms of leptospires in combination with A. brasilense RMRCPB showed high resistance to penicillin G, ampicillin and tetracycline (minimum bactericidal concentration ≥800 μg/mL) and tolerance to UV radiation and high temperature (up to 49°C). This study hypothesized that biofilm formation with A. brasilense protects the pathogenic Leptospira from adverse environmental conditions/stress. This coexistence of pathogenic Leptospira with other bacteria may be the key factor for its persistence and survival. However, the mechanism of biofilm formation by leptospires needs to be explored to help devise an appropriate control strategy and reduce transmission of leptospires. PMID:25962762

  4. PRODUTIVIDADE DA SOJA EM RESPOSTA Á INOCULAÇÃO PADRÃO E COINOCULAÇÃO

    Directory of Open Access Journals (Sweden)

    Ivana Marino Bárbaro

    2009-06-01

    Full Text Available The objectives of this research were to evaluate the response to a standard inoculation with Bradyrhizobium, as well as the co-inoculation with Azospirillum brasilense and Bradyrhizobium in soybean sown area already established with the culture. The rehearsal was installed in Colina-SP, in november of 2007, with the use of the soybean cultivar MG BR 46 (Conquista. The treatments were: 1 - control without N and without inoculation of Bradyrhizobium, 2-control with 200 kg N / ha split, 3-inoculation with Bradyrhizobium, 4-coinoculation with Bradyrhizobium and Azospirillum brasilense peat and 5 - co-inoculation with Bradyrhizobium and Azospirillum brasilense liquid. The experimental design was randomized blocks, with four replications. The experimental plots were constituted by six rows of four meters of length, with spacing of 0,50 m. In V6, were evaluated the nodulation, root dry mass and shoot dry mass. The crop was accomplished manually, in the useful area of the plot, being dear the yield of grains in kg/ha, after obtaining of the mass of grains for portion, being determined the text of water, calculated in 13% of humid base. Besides, the mass of the thousand seeds/plot was evaluated, in grams. In general, it was found that inoculation as well as the coinoculation did not cause an increase in most parameters assessed and soybean yield when grown in area already established with the culture, in Colina-SP.

  5. Gluconic acid production and phosphate solubilization by the plant growth-promoting bacterium Azospirillum spp.

    Science.gov (United States)

    Rodriguez, Hilda; Gonzalez, Tania; Goire, Isabel; Bashan, Yoav

    2004-11-01

    In vitro gluconic acid formation and phosphate solubilization from sparingly soluble phosphorus sources by two strains of the plant growth-promoting bacteria A. brasilense (Cd and 8-I) and one strain of A. lipoferum JA4 were studied. Strains of A. brasilense were capable of producing gluconic acid when grown in sparingly soluble calcium phosphate medium when their usual fructose carbon source is amended with glucose. At the same time, there is a reduction in pH of the medium and release of soluble phosphate. To a greater extent, gluconic acid production and pH reduction were observed for A. lipoferum JA4. For the three strains, clearing halos were detected on solid medium plates with calcium phosphate. This is the first report of in vitro gluconic acid production and direct phosphate solubilization by A. brasilense and the first report of P solubilization by A. lipoferum. This adds to the very broad spectrum of plant growth-promoting abilities of this genus.

  6. arp literatūros ir politikos – paskutiniųjų dviejų XX a. dešimtmečių Hanso Magnuso Enzensbergerio eseistika. Zwischen Literatur und Politik: die neuen Essays von Hans Magnus Enzensberger

    Directory of Open Access Journals (Sweden)

    Rūta Eidukevičienė

    2008-01-01

    Full Text Available Gegenstand dieses Beitrags sind die sozialkritischen Essays Hans Magnus Enzensbergers, in denen litera­rische Reflexionen zeitgenössischer politischer De­batten im Zentrum stehen. Die Analyse der in den lezten Jahrzehnten des 20 Jhs. erschienenen Texte verdeutlicht einige relevante Wendepunkte in der politischen und literarischen Entwicklung Enzens­bergers als eines kritischen Intellektuellen. Während der Autor sich in den 60er Jahren als Vertreter der Linksorientierten und als eine Art Leitfigur der Stu­dentenbewegung präsentiert und seine wichtigste schriftstellerische Aufgabe in der „politischen Al­phabetisierung Deutschlands“ sieht, kündigt sich ge­gen Ende der 70er Jahre eine zunehmende Skepsis gegenüber früheren sozialistischen Ideen und revo­lutionären Utopien. Seine kritische Stimme wird in den 80er Jahren etwas leiser, bleibt aber stets ver­nehmlich, so z. B. in den Essaysammlungen Politi­sche Brosamen, Mittelmaß und Wahn. In den Ende der 80er und Anfang der 90er Jahre verfassten Es­saysammlungen Ach Europa! und Die große Wan­derung erweitert sich die Perspektive auf den glo­balen politischen Kontext, wobei auch – besonders in dem Essay Aussichten auf den Bürgerkrieg – die Krisenstimmung des Schrifstellers im ersten Jahr­zehnt nach dem Ende des Kalten Krieges spürbar wird. Die Jahre 1989/1990 markieren für den Autor den Anfang eines politischen Durcheinanders, weil mit dem Ende des Kalten Krieges eine Weltordnung zusammengeberochen sei, die der Politik Orientie­rung und Verständigung garantieren konnte. Enzens­berger schildert, wie mit dem Ende der zweipoligen Weltordnung die Zahl der Kriege weltweit erheblich gestiegen ist, wie die Menschen zur Flucht getrieben werden und wie die schwer erklärbare Neigung zum Vandalismus wächst. Es fällt auf, dass der Autor in den neuesten Essays darauf verzichtet, Kunst bzw. Literatur in wirkungsvollen Gegensatz zu den von ihm mehrmals angeklagten Massenmedien zu

  7. 帕那维亚的"狂风"(Tornado)——"狂风"战斗机的技术与发展回顾

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    @@ 冷战(英语:Cold War,俄语:холоднаяВойна德语 Kalter Krieg)这个词起源于1947年4月16日伯纳德·巴鲁克在南卡罗来纳州哥伦比亚的一次演说.但人们通常更喜欢将其与1946年丘吉尔访问美国时发表的著名铁幕演说捆绑在一起:"从波罗的海边的什切青到亚得里亚海边的的里雅斯特,一幅横贯欧洲大陆的铁幕已经降落来了……".

  8. Die Landschaft der verlassenen Ortschaften. (Zwischen Natur und Kultur

    Directory of Open Access Journals (Sweden)

    Tiziana Coletta

    2012-08-01

    Full Text Available Die Landschaft der verlassenen Ortschaften ist ein Reichtum mit vielen Perspektiven, die meisten davon sind noch auszukundschaften. In ihr leben zusammen das Tun der Menschen und die Heftigkeit der Natur in ewigem Konflikt , in einer Art von Krieg, mit Siegen und Niederlagen. Einerseits bringen sie die Umgestaltung der Natur durch den Menschen mit sich (Abtragung, Abholzen, Urbarmachen auf der anderen Seite die Zerstoerung von Ortschaften durch tellurische Phaenomene (Erdbeben, Ueberschwemmungen, Vulkanausbruche. Dem aesthetischen Reiz, den diese Landschaft auf internationale Maler und Kuenstler, ebenso wie auf napoletanische Krippenbauer ausuebt, steht keine gleichartige Aufmerksamkeit ihrer anderen Werte gegenueber (technisch-wissenschaftliche, historische, naturwissenschaftliche, erzieherische die sie jedoch auf ein Niveau das “Kulturerben” erhebt, und die als solches Erhaltung, Renovierung, und Aufwertung verdient.

  9. Julien Longhi, Georges-Elia Sarfati éd. (2014). Les discours institutionnels en confrontation. Contribution à l’analyse des discours institutionnels et politiques

    OpenAIRE

    Guilhaumou, Jacques

    2015-01-01

    La problématique des discours institutionnels s’efforce d’excéder l’approche, en analyse de discours, des discours politiques appréhendés essentiellement à travers des conflits idéologiques. En effet, elle marque un intérêt particulier pour les formes de contrôle des activités langagières engagées par les institutions pour se construire en tant que telles, ce qui leur confère une matérialité propre. Alice Krieg-Planque a tracé les contours de ce nouveau domaine de recherche dans son ouvrage A...

  10. Bettina Engels, Corinna Gayer (Hg.: Geschlechterverhältnisse, Frieden und Konflikt. Feministische Denkanstöße für die Friedens- und Konfliktforschung. Baden-Baden: Nomos Verlag 2011.

    Directory of Open Access Journals (Sweden)

    Heinz-Jürgen Voß

    2012-11-01

    Full Text Available Die feministische Friedens- und Konfliktforschung steht vor neuen Herausforderungen, u. a. dadurch, dass Kriege aktuell insbesondere durch Verweis auf Frauen- und Homosexuellenrechte gerechtfertigt werden. Die Autor/-innen in dem von Bettina Engels und Corinna Gayer herausgegebenen Band wenden sich diesen Herausforderungen zu. Neben einer klaren Analyse bieten die Beiträge auch Anregungen für feministische Antworten gegen die ‚feindliche Übernahme‘.Feminist peace and conflict research is facing new challenges among others because wars are currently often justified particularly through reference to women’s and gay rights. The authors of this volume, edited by Bettina Engels and Corinna Gayer, address these challenges. In addition to a clear analysis, the papers offer suggestions for feminist answers to this ‘hostile takeover’.

  11. [Peter von Brackel. Christlich Gesprech von der grawsamen Zerstörung in Lifland durch den Muscowiter vom 58. Jar her geschehenn...] / Stefan Donecker

    Index Scriptorium Estoniae

    Donecker, Stefan, 1977-

    2015-01-01

    Arvustus: Christlich Gesprech von der grawsamen Zerstörung in Lifland durch den Muscowiter vom 58. Jar her geschehenn: auch ihren Ursachen mit einer kurtzen Predig und Vermanung, wie beid, Gotlosenn unnd Frommen, diese schreckliche Mutation fruchtbarlich behertzigen und ihnen zu Nutz machen sollen: durch Timannum Brakel Livoniensem, der Gemeine Christi vonn der Augsburgischen Confession Prediger zu Anttorf einfeltig gestellet unnd inn Druck verfertiget = Darstellung der Geschichte Livlands vor und während des "Livländischen Krieges" bis 1578 in gereimter Dialogform und Prosa von dem Prediger und Geschichtsschreiber Timann Brakel : Originaltext und Übersetzung ins Hochdeutsche mit Kommentaren, Ergänzungen, Bildern und dem Lebenslauf des Timann Brakel. (Beiträge zur baltischen Geschichte, 19). Verlag Harro von Hirschheydt. Wedemark 2012

  12. Kinematografische Propaganda und Zensur in Österreich-Ungarn von 1914–1918 als gescheitertes kybernetisches Modell

    Directory of Open Access Journals (Sweden)

    Paul Winkler

    2014-12-01

    Full Text Available (Medien-Pädagogik, verstanden als Medienverbund zur programmierten "Unterrichtung" einer breiten Masse wurde bereits vor 1914 erfahren. Zweifelsohne kam es jedoch während dem Ersten Weltkrieg zu einer intensiven Orchestrierung der zur Verfügung stehenden Medien. Die angestrebte Volkserziehung kann dabei als kybernetisches Regelkreismodell betrachtet werden. Als ganz spezielles systemimmanentes Instrument, stellte sich dabei das Kino heraus. Anfangs etwas zögerlich, verstand man es mit Verlauf des Krieges auch in der Donaumonarchie, die Möglichkeiten der bewegten Bilder immer umfassender auszunützen. Das Kino sollte als Regler, dem Publikum Führungsgrößen vor Augen führen und das einzelne Individuum gleichzeitig zu einer Art Selbstregulation auffordern. Vorstellungs- und Wertewelten der Menschen sollten homogenisiert werden und das System in dieser Weise stabilisieren. Offenes Feedback war unerwünscht; Grundstimmungen und Diskurse innerhalb der Bevölkerung blieben jedoch nicht unbemerkt und wurden auf der Leinwand bearbeitet, wobei begründete Befürchtungen, Zweifel und Ängste, zu entkräften versucht wurden. Mit fortschreitender Kriegsdauer taten sich Zensur und Propaganda immer schwerer, ein geschöntes Bild der Situation glaubhaft darzustellen. Schließlich vermochte das Flimmern der Leinwände, die Botschaften des Systems nicht mehr zu vermitteln. Das kybernetische Modell der Volkserziehung über Kamera und Leinwand, welches die Gesellschaft militärisch überprägte, Überlegenheit predigte, Gewalt normalisierte und das kriegsbedingte Sterben humanisierte, musste letztlich scheitern. Der vorliegende Artikel soll einen kurzen Einblick in den Aufbau dieses – letztlich gescheiterten – regulativen Werkes der kinematografischen Propaganda und Zensur in Österreich-Ungarn geben, wobei der Fokus auf der dokumentarischen Berichterstattung vom Krieg liegt, die eine vermeintliche Realität repräsentieren sollte.

  13. Critique of War Reason. A Perspective on Self-referential Systems, 11th-21st Centuries

    Directory of Open Access Journals (Sweden)

    Gorm Harste

    2016-03-01

    Full Text Available This paper is a summary of my 700-page very academic thesis, in Danish, to be published by Aarhus University Press (AUP. A shorter booklet based on it was published by AUP too (November 2014, 250 pages and so were a number of shorter articles in English, French and German. In Luhmann’s systems theory and in sociology at large there is a missing link consisting in the lack of a sociology of war. A number of German systems theoreticians use Luhmann’s theory to fill that gap. Yet Luhmann (born 1927, who was a soldier and a prisoner of war from age 15-17, would not write a “Der Krieg der Gesellschaft”. The attempt to narrow this lacuna is indeed a heavy burden and a difficult task, in which it is decisive firstly to get the basic distinctions right about a second order observation of war as a conflict system – to be distinct from a military organisational system. This, I do by beginning with a reconceptualization of Carl von Clausewitz’ form analysis and self-description of war from Vom Kriege (1832. The central point is to observe the self-reference of war, or how war became war about war. Conflict is basically a problem of essentially contested communication. Once this historical self-reference established around the 17th century was in place, war became delimited by its structural couplings to religion, mass media (propaganda, finance, welfare for victims and veterans, law, politics and other functional systems. The costs of war increased, reconstituted and transformed modern society in a way that has formed a range of risks and – of course – neglected blind spots.

  14. Massenmedien und Versöhnung: Die Berichterstattung über den deutsch-französischen Friedensprozeß nach dem 2. Weltkrieg

    Directory of Open Access Journals (Sweden)

    Susanne Jaeger

    2003-10-01

    Full Text Available Der vorliegende Beitrag beinhaltet die ersten Ergebnisse einer Langzeitstudie, bei der flächendeckend die deutsche Nachkriegsberichterstattung über Frankreich von 1946 bis 1970 inhaltsanalytisch ausgewertet wurde. Die Studie stützt sich dabei auf das Modell der Nachrichtenfaktoren von Johan Galtung, welche nach seiner Ansicht die Auswahl der Themen bestimmen, die zu einer Nachricht werden. Genau in diesen Selektionsroutinen liegt jedoch die implizite Gefahr, Konflikte zu vertiefen statt sie einzudämmen bzw. durch ein breites Verständnis der Hintergründe gewaltfrei bearbeitbar zu machen. Für die Zeit nach einem Krieg könnten sie Hindernisse auf dem Weg zur Annäherung und Aussöhnung ehemaliger Gegner darstellen. Wie jedoch sieht die Berichterstattung nach dem Krieg tatsächlich aus? Zeigen Massenmedien Bereitschaft zu einer veränderten Berichterstattung? Der Fall der französisch-deutschen Aussöhnung, welcher als Beispiel für einen gelungenen Aussöhnungsprozess gelten kann, belegt, dass Friedensprozesse von den Medien durchaus adäquat begleitet werden können: Z.B. ist der Anteil "positiver" Themen bzw. Berichterstattung konsistent höher als der "negativer", und der Anteil von Non-Elite-Themen steigt an und kündet von Interesse an französischer Lebensart und Kultur. Die Ergebnisse zeigen, dass Negativismus in den Medien kein Naturgesetz ist, sondern überwunden werden kann, wenn Frieden und Versöhnung auf der Tagesordnung stehen.

  15. „Geschichte des Mitmachens“ oder Opferdiskurs. Frauen als Autorinnen von Kriegsliteratur “History of Participation” or Victim Discourse: Women as Authors of War Literature

    Directory of Open Access Journals (Sweden)

    Astrid Gehrig

    2008-03-01

    Full Text Available Cordula Mahr ermöglicht mit ihrer Untersuchung von 70 Autobiographien deutscher Frauen einen Blick auf die „Heimatfront“, ein Blick, der bisher in einer vornehmlich männlich besetzten Kriegsliteratur, die Krieg in erster Linie als Fronterlebnis definiert, vernachlässigt wurde. Die Autorin konzentriert sich auf die Passagen der Autobiographien, die sich direkt auf den Zweiten Weltkrieg beziehen, und berücksichtigt ausschließlich nach 1960 erschienene Texte. In den Darstellungen überwiegt in Bezug auf den Krieg und den Nationalsozialismus das Selbstverständnis als Geschädigte und Leidtragende. Nur sieben Frauen schreiben in ihren Autobiographien auch ihre „Geschichte des Mitmachens”. Mahrs Untersuchung gibt gerade durch diese Auffälligkeit Anlass, auch über formale Strukturmerkmale der Autobiographie nachzudenken, z. B. darüber, ob diese eventuell eine Selbstdarstellung als Opfer begünstigen.Cordula Mahr’s examination of 70 autobiographies of German women provides insight into the “home front,” insight that till now has been neglected in male-dominated war literature, which defines war first and foremost as an experience of the front. The author concentrates on passages in autobiographies that refer to the World War II directly and takes into account only those texts that appeared before 1960. Self-images as the marred and the suffering woman with respect to war and to National Socialism dominate the descriptions. Only seven women include their own “history of participation” in their autobiographies. Mahr’s study also incites a consideration of the formal structural features of the autobiography, for example, whether the structures may potentially aid the construction of a self-portrait as victim.

  16. EFECTO DE LA BIOFERTILIZACIÓN SOBRE EL CRECIMIENTO EN MACETA DE PLANTAS DE CAÑA DE AZÚCAR (Saccharum officinarum EFEITO DA BIOFERTILIZAÇÃO NO CRESCIMENTO DE PLANTAS EM VASOS açúcar de cana (Saccharum officinarum EFFECT OF BIOFERTILIZATION ON THE GROWTH OF POTTED SUGARCANE PLANTS (Saccharum officinarum

    Directory of Open Access Journals (Sweden)

    LILIANA SERNA-COCK

    2011-12-01

    Full Text Available El uso de microorganismos como fertilizante, ha demostrado tener efectos benéficos sobre el crecimiento de plantas y son una alternativa al uso de fertilizantes guímicos, sin embargo, cada microorganismo difiere en sus efectos benéficos. En este trabajo se evaluó el efecto de la aplicación de microorganismos fertilizantes, Azospirillum brasilense, Azotobacter chroccocum y Trichoderma lignorum sobre el crecimiento en maceta de plantas de caña de azúcar variedad CC 934418. El crecimiento de las plantas se midió en términos de diámetro del tallo, longitud de tallo y raíces, y número de hojas y raíces a los 15, 30 y 45 días de la siembra. El crecimiento de las plantas mostró diferencias estadísticamente significativas entre los tratamientos. Los microorganismos fertilizantes mostraron efecto positivo sobre el crecimiento de plantas de caña de azúcar, siendo Azospirillum brasilense y Trichoderma lignorum los microorganismos gue ejercieron mayor efecto sobre el diámetro del tallo y los sistemas radical y foliar de la planta. Se observaron los efectos beneficiosos de Trichoderma lignorum sobre el crecimiento de la hoja. Este es un nuevo aporte científico, ya que esta especie no ha sido reportada como promotora de crecimiento vegetal.0 uso de microrganismos como fertilizante, tem sido demonstrado gue têm efeitos benéficos no crescimento das plantas e são considerados uma alternativa ao uso de fertilizantes guímicos, no entanto, cada microrganismo possui diferentes efeitos benéficos. Neste estudo foi avaliado o efeito da aplicação de microorganismos fertilizantes, Azospirillum brasilense, Azotobacter chroccocum e Trichoderma lignorum no crescimento de cana-de-açucar da variedade CC 934418 plantadas em vasos. 0 crescimento das plantas foi medido em termos do diâmetro do caule, comprimento de caule e da raiz e número de folhas e raízes nos dias 15, 30 e 45 após a semeadura. 0 crescimento da planta mostrou diferen

  17. Plant growth-promoting bacteria associated with nitrogen fertilization at topdressing in popcorn agronomic performance

    Directory of Open Access Journals (Sweden)

    Leandro Teodoski Spolaor

    2016-03-01

    Full Text Available ABSTRACT The use of plant growth-promoting bacteria is a promising alternative with low environmental impact to increase the efficiency of use of chemical fertilizers, ensuring high yield with better cost-effective ratio. In maize crops, several studies have demonstrated an increased yield when Azospirillum-based inoculants are used. In the case of popcorn, there are no available studies related to use of inoculation and its response on yield parameters. Thus, the aim of this study was to evaluate the field performance of popcorn when inoculated with the commercial product Masterfix L (A. brasilense Ab-V5 and A. brasilense Ab-V6 and the non-commercial inoculant UEL (A. brasilense Ab-V5 + Rhizobium sp. 53GRM1 associated with nitrogen fertilization. The trials were conducted in Londrina and Maringá, Paraná State, Brazil, in a randomized block design with four replications, in a split plot design with the inoculation treatments located in the plots (uninoculated, Masterfix L, and UEL and the different N rates located in the subplots where ammonium sulphate was applied in the topdressing at the V6 stage (0, 50, 100, and 150 kg∙ha–1. The variance analysis showed significant effects (p < 0.05 of inoculation (Londrina environment and N rates (both environments only for grain yield. There was no inoculation effect in the grain yield when inoculants were applied together with N-fertilization at topdressing. In the absence of N-fertilization at topdressing, the inoculants Masterfix L. and UEL promoted higher grain yield as compared to the uninoculated plants, with resulting increases of 13.21 and 26.61% in yield, respectively.

  18. LAS MICORRIZAS ARBUSCULARES Y LAS BACTERIAS RIZOSFÉRICAS COMO ALTERNATIVA A LA NUTRICIÓN MINERAL DEL TOMATE

    Directory of Open Access Journals (Sweden)

    María I. Hernández

    2004-01-01

    Full Text Available El presente estudio se desarrolló en el Instituto de Investigaciones Hortícolas "Liliana Dimitrova" durante los años 1996-2000 con la variedad de tomate HC 38-80 sembrada en período tardío. En la fase de semillero se realizó un screening, con el objetivo de seleccionar las cepas de micorrizas arbusculares y rizobacterias más eficientes para el cultivo del tomate, así como las mejores combinaciones. Para ello se determinaron la altura de la planta, el diámetro del tallo, la longitud radical y la masa seca total. Posteriormente, se evaluó el efecto de los biofertilizantes seleccionados y la fertilización mineral en el rendimiento del cultivo, sus componentes y el estado nutricional de la planta. El mejor comportamiento en la fase de semillero se obtuvo con la inoculación de las cepas Glomus mosseae, Glomus fasciculatum, Azospirillum brasilense, Azotobacter chroococcum, Glomus mosseae + Pseudomonas fluorescens y Glomus mosseae + Azospirillum brasilense. En la fase de campo se observó que el rendimiento y sus componentes se beneficiaron con la aplicación de niveles óptimos de fertilizantes, mientras que para los tratamientos inoculados los mayores valores correspondieron a Glomus mosseae, Glomus mosseae + Pseudomonas flourescens y Glomus mosseae + Azospirillum brasilense combinadas con el 50 % de la fertilización nitrogenada. Los HFMA y su coinoculación con bacterias rizosféricas influyeron de manera positiva en la absorción de nitrógeno y fósforo.

  19. Effect of arsenic on tolerance mechanisms of two plant growth-promoting bacteria used as biological inoculants.

    Science.gov (United States)

    Armendariz, Ana L; Talano, Melina A; Wevar Oller, Ana L; Medina, María I; Agostini, Elizabeth

    2015-07-01

    Bacterial ability to colonize the rhizosphere of plants in arsenic (As) contaminated soils is highly important for symbiotic and free-living plant growth-promoting rhizobacteria (PGPR) used as inoculants, since they can contribute to enhance plant As tolerance and limit metalloid uptake by plants. The aim of this work was to study the effect of As on growth, exopolysaccharide (EPS) production, biofilm formation and motility of two strains used as soybean inoculants, Bradyrhizobium japonicum E109 and Azospirillum brasilense Az39. The metabolism of arsenate (As(V)) and arsenite (As(III)) and their removal and/or possible accumulation were also evaluated. The behavior of both bacteria under As treatment was compared and discussed in relation to their potential for colonizing plant rhizosphere with high content of the metalloid. B. japonicum E109 growth was reduced with As(III) concentration from 10 μM while A. brasilense Az39 showed a reduction of growth with As(III) from 500 μM. EPS and biofilm production increased significantly under 25 μM As(III) for both strains. Moreover, this was more notorious for Azospirillum under 500 μM As(III), where motility was seriously affected. Both bacterial strains showed a similar ability to reduce As(V). However, Azospirillum was able to oxidize more As(III) (around 53%) than Bradyrhizobium (17%). In addition, both strains accumulated As in cell biomass. The behavior of Azospirillum under As treatments suggests that this strain would be able to colonize efficiently As contaminated soils. In this way, inoculation with A. brasilense Az39 would positively contribute to promoting growth of different plant species under As treatment. PMID:26141894

  20. Enhanced Mineral Uptake by Zea mays and Sorghum bicolor Roots Inoculated with Azospirillum brasilense†

    OpenAIRE

    Lin, Willy; Okon, Yaacov; Hardy, Ralph W. F.

    1983-01-01

    Inoculation of corn (Zea mays) seeds with Azospirillum brasilense strain Cd or Sp 7 significantly enhanced (30 to 50% over controls) the uptake of NO3−, K+, and H2PO4− into 3- to 4-day- and 2-week-old root segments. No gross changes in root morphology were observed; altered cell arrangement in the outer four or five layers of the cortex was seen in photomicrographs of cross sections of inoculated corn roots. The surface activity involved in ion uptake probably increased, as shown by the darke...

  1. AcEST: DK961024 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ia with plantlets Developmental stage gametophytes with sporophytes...36 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0008_P24. 5' end sequence. Accession DK961024 Tissue type prothall...04F76|Y987_OENOB Putative metalloprotease OEOE_0987 OS=Oenoc... 30 8.0 sp|P0C6P5|RGNEF_RAT Rho-guanine nucleotide excha... A ++ Q Sbjct: 61 DVSDFESCKAMVAKIEADLGPVDILVNNAGITRDKFFAKMDKAQ 104 >sp|Q04F76|Y987_OENOB Putative metalloprote...p|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum brasilense Align length 44 Score (bit) 30.8 E-value

  2. BIOFERTILIZATION USING RHIZOBACTERIA AND AMF IN THE PRODUCTION OF TOMATO (Lycopersicon esculentum Mill. AND ONION (Allium cepa L. SEEDLINGS. II. ROOT COLONIZATION AND NUTRITIONAL STATUS

    Directory of Open Access Journals (Sweden)

    L. E. Pulido

    2003-01-01

    Full Text Available Como complemento a estudios precedentes de la biofertilización en posturas de plantas hortícolas sobre suelos Ferralíticos Rojos compactados, eútricos y en áreas experimentales de la Universidad de Ciego de Ávila, se evaluaron los efectos de la inoculación simple y la coinoculación, mediante el recubrimiento de semillas y sin aplicar fertilizantes minerales, con rizobacterias promotoras del crecimiento vegetal -RPCV- (Azospirillum brasilense, Azotobacter chroococcum y Burkholderia cepacia y hongos micorrízicos arbusculares - HMA- (Glomus clarum y G. fasciculatum en algunos indicadores de la colonización radical por los microorganismos y el estado nutricional de plántulas de tomate y cebolla. A partir de los resultados, se evidenció que, para ambos cultivos, las poblaciones de A. chroococcum, B. cepacia y A. brasilense se incrementaron significativamente en aquellos tratamientos inoculados con estas rizobacterias, encontrando, en general, los mayores valores en los tratamientos que fueron coinoculados. Respecto a la micorrización, los mayores porcentajes de colonización micorrízica y masa del endófito en tomate se obtuvieron mediante la coinoculación de A. brasilense con ambas especies de HMA y, para la cebolla, la máxima colonización la realizó G. fasciculatum aplicada de forma independiente, mientras que la masa del endófito fue mayor en la coinoculación de G. clarum + A. chroococcum. En relación con el estado nutricional de las plantas, en tomate, los tratamientos con presencia conjunta de A. brasilense y ambas especies de HMA fueron los que hicieron mayores extracciones de N y estuvieron entre los que realizaron mayores extracciones de P y K. En cebolla, todos los tratamientos inoculados con ambos tipos de microorganismos fueron capaces de extraer mayores cantidades de N, P y K. Todos estos resultados permiten explicar las causas de la obtención de posturas de adecuada calidad mediante la biofertilización sin el uso

  3. Estudio de algunos géneros bacterianos asociados a la rizosfera de los cultivos de gerbera (Gerbera jamesonii) y clavel (Dianthus barbatus, Dianthus caryophyllus)

    OpenAIRE

    Annia Hernández; Damarys García; María R. Soroa; Hernández, Ana N.

    2000-01-01

    En este trabajo se realizó la caracterización de algunos géneros bacterianos presentes en la rizosfera de los cultivos de gerbera (Gerbera jamesonii) y clavel (Dianthus barbatus y Dianthus caryophyllus), en un suelo Ferralítico Rojo compactado de San José de las Lajas. También se estudió la quimioatracción de los exudados radicales de estos cultivos hacia diferentes rizobacterias (Pseudomonas (Burkholderia) cepacia, P. fluorescens y Azospirillum brasilense). En ambos casos se utilizó el Model...

  4. EVALUACIÓN DE CEPAS NATIVAS DEL GÉNERO Azospirillum Y SU INTERACCIÓN CON EL CULTIVO DEL ARROZ

    OpenAIRE

    Mabel Pazos; Annia Hernández

    2001-01-01

    Catorce cepas nativas pertenecientes a la especie Azospirillum brasilense se caracterizaron en cuanto a su ca- pacidad de fijar el nitrógeno atmosférico. Se estudió su efecto en el cultivo del arroz (Oryza sativa), mediante el modelo Microcosmos, realizando determinaciones de la altura de las plantas inoculadas, masa fresca de la raíz y el contenido de fenoles libres y la cuantificación de proteínas en las hojas. Se observó en todos los casos un efecto positivo por la inocula- ción con e...

  5. AcEST: DK950816 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0009_L09 635 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_L09. 5' end seq ... tion sp|P50872|TRPE_AZOBR Anthranilate synthase OS=Azospirillum ... brasilense Align length 54 Score (bit) 32.7 E-valu ... alue sp|P50872|TRPE_AZOBR Anthranilate synthase OS=Azospirillum ... brasi... 33 1.6 sp|Q86WI1|PKHL1_HUMAN Fibrocystin- ...

  6. AcEST: DK948521 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0003_I14 690 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_I14. 5' end seq ... 1 5.3 sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum ... brasil... 31 6.9 sp|P0C6P5|RGNEF_RAT Rho-guanine n ... 121 >sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum ... brasilense GN=nodG PE=3 SV=2 Length = 246 Score = ...

  7. Applicability of the 16S-23S rDNA internal spacer for PCR detection of the phytostimulatory PGPR inoculant Azospirillum lipoferum CRT1 in field soil

    OpenAIRE

    Baudoin, Ezékiel; Couillerot, O.; Spaepen, S.; Moenne-Loccoz, Y.; Nazaret, S.

    2010-01-01

    Aims: To assess the applicability of the 16S-23S rDNA internal spacer regions (ISR) as targets for PCR detection of Azospirillum ssp. and the phytostimulatory plant growth-promoting rhizobacteria seed inoculant Azospirillum lipoferum CRT1 in soil. Methods and Results: Primer sets were designed after sequence analysis of the ISR of A. lipoferum CRT1 and Azospirillum brasilense Sp245. The primers fAZO/rAZO targeting the Azospirillum genus successfully yielded PCR amplicons (400-550 bp) from Azo...

  8. AcEST: BP919119 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_D11 308 Adiantum capillus-veneris mRNA. clone: YMU001_000121_D11. BP919119 - Show ... 6 sp|P28604|NODQ_AZOBR Bifunctional enzyme nodQ OS=Azospirillum ... br... 31 2.2 sp|Q6AEW2|SYL_LEIXX Leucyl-tRNA synth ... >sp|P28604|NODQ_AZOBR Bifunctional enzyme nodQ OS=Azospirillum ... brasilense GN=nodQ PE=3 SV=2 Length = 620 Score = ...

  9. GERMINATION OF GRASSES DUE TO INOCULATION DIAZOTROPHIC BACTERIA

    Directory of Open Access Journals (Sweden)

    C. D. A. Moreira

    2014-07-01

    Full Text Available The germination of forage grasses suffers from numbness and a natural tendency to low quality. The use of microorganisms inoculated in seeds with the purpose of increasing and meet the demand of some nutrient has been shown to be efficient, but the role of the microorganism in germination and rate of force is still unknown. Therefore the goal as study was to evaluate the germination rate of seeds of three cultivars of Brachiaria brizantha CV. Marandu, b., b. brizantha CV. Xaraés and b. humidícola cv Tupi and a cultivar of millet, P. hybrid cv Massai depending on the bacterium Azospirillum brasilense diazotrofic inoculation (nitrogen-fixing. Germination test was used in seed dispersal to assess the effect of first count (VPC in the treatments with and without inoculation. It was done also conducted further tests of electrical conductivity, weight of thousand seeds and water content. The delineation used was randomized entirely (DIC and the statistical analysis carried out through the analysis of variance and comparison of means using the Tukey test, the 5% probability. Massai grass seeds have the highest rate of force of first count in both treatments. Inoculation of bacterium Azospirillum brasilense did not affect the values of force of first count on seeds of the cultivars Marandu, Xaraés, Tupi and Massai. The seeds of the massai have higher germination speed relative the other cultivars evaluated when inoculated.

  10. PAS domain of the deduced Org35 protein mediates the interaction with NifA

    Institute of Scientific and Technical Information of China (English)

    TU Ran; CUI Yanhua; CHEN Sanfeng; LI Jilun

    2006-01-01

    NifA in Azospirillum brasilense plays a key role in regulating the synthesis of nitrogenase in response to ammonia and oxygen available. Recently,our laboratory has identified four clones, whose gene prodcuts interact with NifA, from A. brasilense Sp7genomic libraries by using the yeast two-hybrid system with NifA as bait. We are interested in clone S35,one of the four clones, because it contains a PAS-domain coding region. The entire open reading frame (ORF) for the PAS domain-containing protein was isolated and designated as org35 here. org35gene is 2211-bp long and encodes a protein of 736aa with a predicted molecular weight of about 78.4 kD.The predicted amino acid sequence of org35 has similarity to some two-component sensor kinase/response regulator hybrids of bacteria. Structural analyses showed that Org35 comprises at least three discrete conserved domains: the N-terminal PAS, the central histidine protein kinase (HPK) and the C-terminal response regulator (RR). The PAS domain of the deduced Org35 protein was found to interact directly with NifA, but the central HPK and the C-terminal RR domains of Org35 were not. These results indicated that interaction between NifA and Org35 was mediated by PAS domain.

  11. Azospirillum rugosum sp. nov., isolated from oil-contaminated soil.

    Science.gov (United States)

    Young, C C; Hupfer, H; Siering, C; Ho, M-J; Arun, A B; Lai, W-A; Rekha, P D; Shen, F-T; Hung, M-H; Chen, W-M; Yassin, A F

    2008-04-01

    The taxonomic status of a light-orange-coloured bacterial isolate from an oil-contaminated soil sample was characterized by using a polyphasic taxonomic approach. Comparative analysis of 16S rRNA gene sequences demonstrated that the isolate belonged phylogenetically to the genus Azospirillum, with Azospirillum canadense, Azospirillum brasilense and Azospirillum doebereinerae as its closest phylogenetic relatives (97.3, 97.0 and 97.0 % similarity, respectively). DNA-DNA pairing studies showed that the unidentified organism displayed 25.0, 17.0 and 19.0 % relatedness to the type strains of A. brasilense, A. canadense and A. doebereinerae, respectively. The generic assignment was confirmed by chemotaxonomic data, which revealed a fatty acid profile that was characteristic of the genus Azospirillum, consisting of straight-chain saturated and unsaturated fatty acids with C18 : 1 omega 7c as the major fatty acid, and ubiquinone with ten isoprene units (Q-10) as the predominant respiratory quinone. On the basis of both the phenotypic and molecular genetic evidence, it is proposed that the unknown isolate be classified as a representative of a novel species of the genus Azospirillum, for which the name Azospirillum rugosum sp. nov. is proposed. The type strain is IMMIB AFH-6T (=CCUG 53966T=DSM 19657T). PMID:18398202

  12. Swimming motility plays a key role in the stochastic dynamics of cell clumping

    International Nuclear Information System (INIS)

    Dynamic cell-to-cell interactions are a prerequisite to many biological processes, including development and biofilm formation. Flagellum induced motility has been shown to modulate the initial cell–cell or cell–surface interaction and to contribute to the emergence of macroscopic patterns. While the role of swimming motility in surface colonization has been analyzed in some detail, a quantitative physical analysis of transient interactions between motile cells is lacking. We examined the Brownian dynamics of swimming cells in a crowded environment using a model of motorized adhesive tandem particles. Focusing on the motility and geometry of an exemplary motile bacterium Azospirillum brasilense, which is capable of transient cell–cell association (clumping), we constructed a physical model with proper parameters for the computer simulation of the clumping dynamics. By modulating mechanical interaction (‘stickiness’) between cells and swimming speed, we investigated how equilibrium and active features affect the clumping dynamics. We found that the modulation of active motion is required for the initial aggregation of cells to occur at a realistic time scale. Slowing down the rotation of flagellar motors (and thus swimming speeds) is correlated to the degree of clumping, which is consistent with the experimental results obtained for A. brasilense. (paper)

  13. Construction of expression vector containing glnA gene and detection of NPT II activity in the transgenic rice calli using 32P-labelled compound

    International Nuclear Information System (INIS)

    The glnA gene encoding glutamine synthetase (GS) was amplified from Azospirillum brasilense Sp7 by PCR technique. the amplified 1.4 kb DNA fragment was cloned at the EcoRV site of Bluescript-SK. Both sequencing and restriction digestion data showed that the 1.4 kb DNA fragment flanked with BamHI site at each end was really the glnA gene of A. brasilense Sp7. The glnA gene was ligated with Bg1 II site of pCo24. As a result, an expression vector pGSC35 with CaMV35S promoter was obtained. Using colony in situ hybridization with α-32P-dATP labelled probes to screen the positive clones, another glnA gene expression vector pAGNB92 with rice actin 1 promoter was constructed after three rounds of ligation and transformation. Protoplasts isolated from rice cell suspension line cv. T986 were transformed with glnA expression vectors pGSC35 and pAGNB92 containing neomycin phosphotransferase II (NPTII) gene by using PEG fusion and electroporation. Transformed microcalli were selected on media containing G418 disulfate salt. NPT II activity was detected in 37% of G418 resistant calli by using dot blot hybridization with γ-32P-ATP and kanamycin as substrate

  14. Swimming motility plays a key role in the stochastic dynamics of cell clumping

    Science.gov (United States)

    Qi, Xianghong; Nellas, Ricky B.; Byrn, Matthew W.; Russell, Matthew H.; Bible, Amber N.; Alexandre, Gladys; Shen, Tongye

    2013-04-01

    Dynamic cell-to-cell interactions are a prerequisite to many biological processes, including development and biofilm formation. Flagellum induced motility has been shown to modulate the initial cell-cell or cell-surface interaction and to contribute to the emergence of macroscopic patterns. While the role of swimming motility in surface colonization has been analyzed in some detail, a quantitative physical analysis of transient interactions between motile cells is lacking. We examined the Brownian dynamics of swimming cells in a crowded environment using a model of motorized adhesive tandem particles. Focusing on the motility and geometry of an exemplary motile bacterium Azospirillum brasilense, which is capable of transient cell-cell association (clumping), we constructed a physical model with proper parameters for the computer simulation of the clumping dynamics. By modulating mechanical interaction (‘stickiness’) between cells and swimming speed, we investigated how equilibrium and active features affect the clumping dynamics. We found that the modulation of active motion is required for the initial aggregation of cells to occur at a realistic time scale. Slowing down the rotation of flagellar motors (and thus swimming speeds) is correlated to the degree of clumping, which is consistent with the experimental results obtained for A. brasilense.

  15. KONY 2012, Military Humanitarianism, and the Magic of Occult Economies KONY 2012, militärische Humanität und die Magie verborgener Wirtschaftsbeziehungen

    Directory of Open Access Journals (Sweden)

    Sverker Finnström

    2012-01-01

    Full Text Available The global success of the film KONY 2012 by Invisible Chil-dren, Inc., manifests far greater magical powers than those of Joseph Kony and his ruthless Lord’s Resistance Army, which it portrays. The most prominent feature of the Invisible Children lobby is the making and constant remaking of a master narrative that depoliticizes and dehistoricizes a murky reality of globalized war into an essentialized black-and-white story. The magic of such a digestible storyline, with Ugandan rebel leader Joseph Kony as a global poster boy for evil personified, not only plays into the hands of the oppressive Ugandan government but has also become handy for the US armed forces as they seek to increase their presence on the African continent. As the US-led war on terror is renewed and expanded, Invisible Children’s humanitarian slogan, “Stop at nothing”, has proven to be exceptionally selective, manifesting the occult economy of global activism that calls for military interventions.Der weltweite Erfolg des Films KONY 2012 von Invisible Children, Inc. offenbart weit stärkere magische Kräfte, als sie dem darin portraitierten Joseph Kony und seiner skrupellosen „Lord’s Resistance Army“ zugeschrieben werden. Die wichtigste Wirkung der Lobbyarbeit von Invisible Children besteht darin, die finstere Realität des globalisierten Krieges zu entpolitisieren, zu enthistorisieren und auf ein immer neu variiertes Schwarz-Weiß-Denkmuster zu reduzieren. Die magische Wirkung einer solchen leicht verwertbaren inhaltlichen Reduktion – mit dem ugandischen Rebellenführer Joseph Kony als globalem Inbegriff des personifizierten Bösen – liegt im Interesse der repressiven ugandischen Regierung, insbesondere aber auch der US-Streitkräfte, die ihre Präsenz auf dem afrikanischen Kontinent verstärken wollen. Während der US-geführte Krieg gegen den Terror wieder aufgenommen und ausgeweitet wird, hat sich der von Invisible Children genutzte Slogan „Stop at

  16. Singapore-India Relations: A Return to History

    Directory of Open Access Journals (Sweden)

    Ming Hwa Ting

    2009-01-01

    Full Text Available Michael Leifer observes Singapore-India relations to be ‘diplomatically distant’. This observation was correct during the Cold War when differing political ideologies made it difficult for these two countries to develop close relations. With the end of the Cold War, bilateral relations improved rapidly, especially on the economic front. Consequently, most literature focuses on the economic interaction between them, at the expense of other significant developments on the political, military as well as social and cultural fronts. In order to better understand Singapore-India relations in the present, a well-rounded approach is necessary. Hence, this article addresses this lacuna in the present scholarship by providing a comprehensive overview that takes into account developments in both the areas of high and low politics. In so doing, this article argues that Singapore-India relations are now no longer ‘diplomatically distant’, but instead mirror the close relations they had during the colonial period, and so represent a ‘return to history’ instead. --- Michael Leifer beschreibt die Beziehungen zwischen Singapur und Indien als "diplomatisch distanziert". Diese Beobachtung war während des Kalten Krieges korrekt, als unterschiedliche politische Ideologien eine enge Zusammenarbeit dieser beiden Länder erschwerten. Mit dem Ende des Kalten Krieges verbesserten sich bilaterale Beziehungen – vor allem im wirtschaftlichen Bereich – rapide. Aus diesem Grund konzentrieren sich die meisten Publikationen auf die wirtschaftliche Interaktion der beiden Länder und vernachlässigen gleichzeitig weitere wichtige Entwicklungen in der politischen, militärischen, sozialen und kulturellen Sphäre. Um die Beziehungen zwischen Singapur und Indien besser zu verstehen, ist ein vielseitigerer Ansatz notwendig. Der vorliegende Artikel versucht diese Lücke gegenwärtiger Forschung zu schließen und einen umfassenden Überblick der Entwicklungen

  17. Ocorrência e diversidade de bactérias diazotróficas associadas a gramíneas forrageiras do Pantanal Sul Matogrossense Occurrence and diversity of diazotrophic bacteria associated to forage grasses of the Pantanal in the state of Mato Grosso do Sul

    Directory of Open Access Journals (Sweden)

    Marivaine da Silva Brasil

    2005-04-01

    Full Text Available Este trabalho teve por objetivo avaliar a ocorrência e a diversidade genética de bactérias fixadoras de N2 associadas às gramíneas nativas Elyonurus muticus (capim carona e Axonopus purpusii (capim mimoso e à gramínea exótica Brachiaria humidicola (braquiária que formam as pastagens na região da Nhecolândia. As coletas das plantas e solo foram feitas nos períodos de seca e de cheia para determinar a população de bactérias diazotróficas. Identificaram-se Azospirillum brasilense, A. lipoferum, A. amazonense, Herbaspirillum spp., Burkholderia spp. em amostras de solo, raízes e folhas das três espécies forrageiras. As populações dessas bactérias foram menores na época da cheia em comparação com a época da seca. A diversidade genética das bactérias isoladas foi avaliada por meio da técnica de análise de restrição do DNA ribossomal amplificado (ARDRA. Os isolados foram divididos em cinco grupos genotípicos distintos. Os isolados de A. brasilense e A. lipoferum apresentaram cerca de 50 % de similaridade, enquanto A. amazonense formou um grupo a parte, com apenas 25 % de similaridade em relação ao grupo das espécies do gênero. As bactérias do gênero Herbaspirillum formaram um grupo isolado com apenas 25 % de similaridade em relação ao gênero Azospirillum. O quinto grupo foi formado por apenas um isolado com 25 % de similaridade em relação aos demais.This study was carried out to verify the occurrence and genetic diversity of diazotrophic bacteria associated to the native graminaceus plants Elyonurus muticus (Carona grass and Axonopus purpusii (Mimoso grass and the exotic Brachiaria humidicola (Brachiaria that form the pastures in the Nhecolândia region of the Pantanal in the state of Mato Grosso do Sul, Brazil. The plants were harvested in the dry and rainy seasons and the diazotrophic bacteria populations in the soil and on roots and leaves of the three grasses were determined. Strains belonging to the

  18. Effect of plant growth-promoting bacteria on the growth and fructan production of Agave americana L.

    Science.gov (United States)

    De La Torre-Ruiz, Neyser; Ruiz-Valdiviezo, Víctor Manuel; Rincón-Molina, Clara Ivette; Rodríguez-Mendiola, Martha; Arias-Castro, Carlos; Gutiérrez-Miceli, Federico Antonio; Palomeque-Dominguez, Héctor; Rincón-Rosales, Reiner

    2016-01-01

    The effect of plant growth-promoting bacteria inoculation on plant growth and the sugar content in Agave americana was assessed. The bacterial strains ACO-34A, ACO-40, and ACO-140, isolated from the A. americana rhizosphere, were selected for this study to evaluate their phenotypic and genotypic characteristics. The three bacterial strains were evaluated via plant inoculation assays, and Azospirillum brasilense Cd served as a control strain. Phylogenetic analysis based on the 16S rRNA gene showed that strains ACO-34A, ACO-40 and ACO-140 were Rhizobium daejeonense, Acinetobacter calcoaceticus and Pseudomonas mosselii, respectively. All of the strains were able to synthesize indole-3-acetic acid (IAA), solubilize phosphate, and had nitrogenase activity. Inoculation using the plant growth-promoting bacteria strains had a significant effect (pagave plants with proper biological characteristics for agroindustrial and biotechnological use and to increase the sugar content in this agave species. PMID:27268113

  19. Dicty_cDB: Contig-U11623-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CP000272_337( CP000272 |pid:none) Burkholderia xenovorans LB400 ch... 108 5e-22 (Q9CTY5) RecName: Full=EF-hand domain-containing fam... 51908, c... 94 1e-17 CP000480_6168( CP000480 |pid:none) Mycobacterium smegmatis str. MC... 94 1e-17 CP00094...as syringae pv. tomato... 92 4e-17 CP000480_3868( CP000480 |pid:none) Mycobacterium smegmatis...e) Azospirillum brasilense AraR, AraC... 71 9e-11 CP000248_515( CP000248 |pid:none) Novosphingobium aromati...e) Novosphingobium aromaticivorans... 60 2e-07 CP001029_1248( CP001029 |pid:none) Me

  20. Increased root exudation of 14C-compounds by sorghum seedlings inoculated with nitrogen-fixing bacteria

    International Nuclear Information System (INIS)

    Organic components leaked from Sorghum bicolor seedlings ('root exudates') were examined by recovering 14C labelled compounds from root solutions of seedlings inoculated with Azospirillum brasilense, Azotobacter vinelandii or Klebsiella pneumoniae nif-. Up to 3.5% of the total 14C recovered from shoots, roots, and nutrient solutions was found in the root solutions. Inoculation with Azospirillum and Azotobacter increased the amounts of 14C and decreased the amounts of carbohydrates in the root solutions. When sucrose was added as a carbon source for the bacteria, the increase of 14C in the solutions did not occur. Quantities of 14C found in the root solutions were proportional to amounts of mineral nitrogen supplied to the plants. Bacterial growth also was proportional to nitrogen levels. When sorghum plants were grown in soil and labelled with 14CO2, about 15% of the total 14C recovered within 48 hours exposure was found in soil leachates. (orig.)

  1. Azospirillum, a free-living nitrogen-fixing bacterium closely associated with grasses: genetic, biochemical and ecological aspects.

    Science.gov (United States)

    Steenhoudt, O; Vanderleyden, J

    2000-10-01

    Azospirillum represents the best characterized genus of plant growth-promoting rhizobacteria. Other free-living diazotrophs repeatedly detected in association with plant roots, include Acetobacter diazotrophicus, Herbaspirillum seropedicae, Azoarcus spp. and Azotobacter. Four aspects of the Azospirillum-plant root interaction are highlighted: natural habitat, plant root interaction, nitrogen fixation and biosynthesis of plant growth hormones. Each of these aspects is dealt with in a comparative way. Azospirilla are predominantly surface-colonizing bacteria, whereas A. diazotrophicus, H. seropedicae and Azoarcus sp. are endophytic diazotrophs. The attachment of Azospirillum cells to plant roots occurs in two steps. The polar flagellum, of which the flagellin was shown to be a glycoprotein, mediates the adsorption step. An as yet unidentified surface polysaccharide is believed to be essential in the subsequent anchoring phase. In Azoarcus sp. the attachment process is mediated by type IV pili. Nitrogen fixation structural genes (nif) are highly conserved among all nitrogen-fixing bacteria, and in all diazotrophic species of the class of proteobacteria examined, the transcriptional activator NifA is required for expression of other nif genes in response to two major environmental signals (oxygen and fixed N). However, the mechanisms involved in this control can vary in different organisms. In Azospirillum brasilense and H. seropedicae (alpha- and beta-subgroup, respectively), NifA is inactive in conditions of excess nitrogen. Activation of NifA upon removal of fixed N seems to involve, either directly or indirectly, the signal transduction protein P(II). The presence of four conserved cysteine residues in the NifA protein might be an indication that NifA is directly sensitive to oxygen. In Azotobacter vinelandii (gamma-subgroup) nifA is cotranscribed with a second gene nifL. The nifL gene product inactivates NifA in response to high oxygen tension and cellular

  2. Utilization of Lignocellulosic Waste for the Preparation of Nitrogenous Biofertilizer

    Directory of Open Access Journals (Sweden)

    Farhat R. Malik

    2001-01-01

    Full Text Available This work is a part of solid waste management project. Bagasse, a lignocellulosic waste of sugarcane industry was utilized for producing the nitrogenous biofertilizer. Nitrogen fixing free living bacteria were isolated from soil samples using dilution plate method. Selection of bacteria Azotobacter chroococcum was made due to its capability to survive and fix the maximum nitrogen as compared to other bacteria tested in a medium in which bagasse was the only carbon source. A. chroococcum, A. indicus and Azospirilum brasilense were tested for nitrogen fixation from 7 to 28 days. Maximum nitrogen fixed by these bacteria was 67.81, 28.00 and 43.20 mg/L respectively. Experimental results justified that bagasse biomass with A. chroococcum is a good source of nitrogen and organic matter, which can be utilized as a biofertilizer.

  3. Efecto de diferentes concentraciones de ácido antranílico en el crecimiento del maíz

    Directory of Open Access Journals (Sweden)

    José Luis Hernández-Mendoza

    2010-08-01

    Palabras clave: auxinas, fitohormonas, rizobacterias promotoras del crecimiento vegetal, Zea mays L. Abstract: The plant growth-promoting ability of rhizo-bacterium Azospirillum brasilense is based on production of auxins and other hormones, among them outstanding antranilic acid (AA. In this work we determined the antranilic acid (0, 500, 1000, 3000, and 5000 ppm effects on maize growth and dry biomass accumulation under greenhouse conditions using the hybrid 83G66. From 500 to 3000 ppm of AA significantly increased plant growth (leaf area and plant height while 1000 and 3000 ppm of AA significantly increased dry biomass accumulation in maize compared with control (0 ppm. The 90 % of AA in maize plants was assimilated during the early 10 days after treatment. Key words: Auxins, phyto-hormones, plant growth promoting rhizobacteria, Zea mays L.

  4. AMPLIFICATION OF AZOSPIRILLUM SP. JG3 GLPD GENE FRAGMENT USING DEGENERATE PRIMERS GENERATED BY WEB-BASED TOOLS

    Directory of Open Access Journals (Sweden)

    Stalis Norma Ethica

    2013-12-01

    Full Text Available Primaclade and In Silico web-based tools were used as a strategy to obtain the correct-size PCR amplicon targeting a fragment of gene encoding glycerol-3-phosphate dehydrogenase (glpD of Azospirillum sp. JG3. The bacterial strains are soil, Gram-negative PGPR (Plant-Growth Promoting Rhizobacteria isolated from an agricultural land in Purwokerto, Central Java, Indonesia, which have ability to produce several commercial enzymes. The aim is to obtain a pair of reliable degenerate primers from a limited number of glpD sequences from other Azospirilla retrieved in GenBank using bioinformatics approach. We demonstrated degenerate primer design that led to successful PCR amplification corresponding to the targeted DNA fragment. Homology analysis showed that the obtained DNA fragment is 61% and 99% similar to sn-glycerol-3-phosphate dehydrogenase genes of Azospirillum brasilense and Stenotrophomonas maltophili respectively.

  5. EVALUACIÓN DE CEPAS NATIVAS DEL GÉNERO Azospirillum Y SU INTERACCIÓN CON EL CULTIVO DEL ARROZ

    Directory of Open Access Journals (Sweden)

    Mabel Pazos

    2001-01-01

    Full Text Available Catorce cepas nativas pertenecientes a la especie Azospirillum brasilense se caracterizaron en cuanto a su ca- pacidad de fijar el nitrógeno atmosférico. Se estudió su efecto en el cultivo del arroz (Oryza sativa, mediante el modelo Microcosmos, realizando determinaciones de la altura de las plantas inoculadas, masa fresca de la raíz y el contenido de fenoles libres y la cuantificación de proteínas en las hojas. Se observó en todos los casos un efecto positivo por la inocula- ción con estas rizobacterias, donde se destaca la cepa R5(15 con los mayores incrementos en los indicadores estudiados.

  6. [Characterization of the lipopolysaccharides of serogroup II Azospirillum].

    Science.gov (United States)

    Sigida, E N; Fedonenko, Iu P; Zdorovenko, É L; Butygin, G L; Konnova, S A; Ignatov, V V

    2014-01-01

    Lipopolysaccharides of six Azospirillum strains (A. brasilense SR50, SR80, SR88, SR109, SR111, SR115, and A. lipoferum SR 42) isolated from the rhizosphere of cereal plants of Saratov oblast, Russia and assigned to serogroup II by serological analysis were studied. In the lipid A fatty acid composition, the lipopolysaccharides under study were similar to those of other Azospirillum strains and were characterized by predominance of 3-hydroxytetradecanoic, 3-hydroxyhexadecanoic, and octadecenoic acids. Monosaccharide analysis of the O-specific polysaccharides (including determination of the absolute configurations, methylation analysis, and one- and two-dimensional NMR spectroscopy) revealed the presence of two types of repeating units in varying ratios. High degree of serological similarity between the strains under study was shown to result from the presence of repeating units with identical structure in their O antigens. PMID:25844452

  7. [Immunochemical Detection of Azospirilla in Soil with Genus-Specific Antibodies].

    Science.gov (United States)

    Shirokov, A A; Krasov, A I; Selivanov, N Yu; Burygin, G L; Shchegolev, S Yu; Matora, L Yu

    2015-01-01

    Immunoelectrophoresis and immunodiffusion analysis with antibodies to whole intact cells of the type strain of nitrogen-fixing soil bacteria Azospirillum brasilense Sp7 revealed at least three conservative surface immunogenic proteins of azospirilla. Cross-reactions with these proteins made it possible to use the above antibodies for detection of azospirilla as a genus-specific probe conjugated with horseradish peroxidase as an enzymatic label. Direct immune-enzyme analysis of soil suspensions (typical chernozem, Saratov oblast) confirmed applicability of the conjugates based on genus-specific antibodies to the surface proteins of azospirilla for direct detection of this bacterial genus in environmental samples. These results provide a basis for broad application of this method for analysis of Azospirillum occurrence in soil. PMID:26263631

  8. Molecular responses in root-associative rhizospheric bacteria to variations in plant exudates

    Science.gov (United States)

    Abdoun, Hamid; McMillan, Mary; Pereg, Lily

    2015-04-01

    Plant exudates are a major factor in the interface of plant-soil-microbe interactions and it is well documented that the microbial community structure in the rhizosphere is largely influenced by the particular exudates excreted by various plants. Azospirillum brasilense is a plant growth promoting rhizobacterium that is known to interact with a large number of plants, including important food crops. The regulatory gene flcA has an important role in this interaction as it controls morphological differentiation of the bacterium that is essential for attachment to root surfaces. Being a response regulatory gene, flcA mediates the response of the bacterial cell to signals from the surrounding rhizosphere. This makes this regulatory gene a good candidate for analysis of the response of bacteria to rhizospheric alterations, in this case, variations in root exudates. We will report on our studies on the response of Azospirillum, an ecologically, scientifically and agriculturally important bacterial genus, to variations in the rhizosphere.

  9. Quantification of root associated nitrogen fixation in kallar grass as estimated by sup/15/nitrogen isotope dilution

    International Nuclear Information System (INIS)

    Present investigations were made by using sup/15/N isotope dilution technique to quantitatively estimate BNF in Kallar grass when grown under controlled conditions in nutrient solution and inoculated with N sub/2/-fixing bacteria. Azospirillum brasilense and two isolates from the rhizosphere of kallar grass were used as inoculant. After harvest acetylen reduction of roots, total yield, total N and sup/15/ N analysis were made. Total-N in inoculated treatments was 2-3 times higher than in control and so were the fresh and dry weight yields. The estimates based on isotopic dilution indicated that 50-70 percent N in the plant was derived from BNF in case of inoculated treatment. The results based on N balance gave relatively lower values of 40-60 percent of total N derived from fixation. The data revealed that in Kallar grass a substantial amount of plant N is derived from BNF. (orig./A.B.)

  10. Robust biological nitrogen fixation in a model grass-bacterial association.

    Science.gov (United States)

    Pankievicz, Vânia C S; do Amaral, Fernanda P; Santos, Karina F D N; Agtuca, Beverly; Xu, Youwen; Schueller, Michael J; Arisi, Ana Carolina M; Steffens, Maria B R; de Souza, Emanuel M; Pedrosa, Fábio O; Stacey, Gary; Ferrieri, Richard A

    2015-03-01

    Nitrogen-fixing rhizobacteria can promote plant growth; however, it is controversial whether biological nitrogen fixation (BNF) from associative interaction contributes to growth promotion. The roots of Setaria viridis, a model C4 grass, were effectively colonized by bacterial inoculants resulting in a significant enhancement of growth. Nitrogen-13 tracer studies provided direct evidence for tracer uptake by the host plant and incorporation into protein. Indeed, plants showed robust growth under nitrogen-limiting conditions when inoculated with an ammonium-excreting strain of Azospirillum brasilense. (11)C-labeling experiments showed that patterns in central carbon metabolism and resource allocation exhibited by nitrogen-starved plants were largely reversed by bacterial inoculation, such that they resembled plants grown under nitrogen-sufficient conditions. Adoption of S. viridis as a model should promote research into the mechanisms of associative nitrogen fixation with the ultimate goal of greater adoption of BNF for sustainable crop production. PMID:25645593

  11. Radiant business. Hazards of international, illicit trafficking with nuclear materials; Strahlende Geschaefte. Gefahren des internationalen Atomschmuggels

    Energy Technology Data Exchange (ETDEWEB)

    Attali, J.

    1996-03-01

    Since the Cold War has been terminated, public media increasingly come out with reports about cases of illicit trafficking with nuclear technology and nuclear materials. So far, the potential hazard has not been exploding into the big disaster, but imagine what may happen if uranium or plutonium falls into the hands of terrorists, fanatics, or Mafia-type organisations ? The author has been investigating into this problem on behalf of the Secretary General of the UN. He has been travelling all around the world in pursuit of information and indications, and now presents us with the essential results of his mission, compiled in this explosive report. (orig./HP) [Deutsch] Seit dem Ende des Kalten Krieges berichten die Medien immer haeufiger ueber Schmuggel von Atomtechnologie und spaltbarem Material. Bis heute ist uns eine Katastrophe erspart geblieben. Was geschieht aber, wenn Uran oder Plutonium in die Haende von Terroristen, Fanatikern oder mafiaaehnlichen Kartellen faellt? Der Autor ist im Auftrag des Generalsekretaers der Vereinten Nationen dieser Frage nachgegangen. Rund um die Welt fuehrten ihn seine Nachforschungen und Gespraeche. Die wichtigsten Ergebnisse aus seinem brisanten Bericht enthuellt er in diesem Buch. (orig./HP)

  12. NATO aggression against FRY: “A war on the border between law and morality”

    Directory of Open Access Journals (Sweden)

    Radojičić Mirjana

    2011-01-01

    Full Text Available The paper focuses on the ethical aspects of NATO aggression (or so-called “humanitarian intervention”, exerted against the FRY, actually Serbia, in the period from March to June 1999. The paper has been conceived as a critical dialogue with Jürgen Habermas, or rather the positions presented by him in a text entitled “Bestialität und Humanität: Eine Krieg an der Grenze zwischen Recht und Moral”. Following a short presentation of Habermas’s point of view, in the introduction to her paper the author discusses the moral implications of, as he points out, “the surgical precision of the air-strikes, as well as the programmatic sparing of the civilian population”, which are, according to him, the characteristics of this aggression with “a highly legitimating effect”. She then focuses on the key and declaratively moral argument that served to justify the aggression - the protection of human rights of Kosmet Albanians and the prevention of the humanitarian catastrophe they had been allegedly exposed to. After analyzing this argument thoroughly, in several steps, the author concludes that the aggression was not, as Habermas claimed, a “war on the border between law and morality”, but that it was actually beyond the borders of both law and morality and was deeply situated into a domain of interest-driven armed acts of the US foreign policy.

  13. Continuity in a Changing World: Malaysia’s Coercive Security Apparatus in the Age of Terror and Beyond

    Directory of Open Access Journals (Sweden)

    Andrew Humphreys

    2009-01-01

    Full Text Available The Malaysian government’s use of its repressive security legislation has had a significant impact on Malaysia’s modern political history. The focus of the present article is on the government’s use of its coercive security apparatus since the terrorist attacks of 9/11. My argument is that the apparatus is largely unchanged by the current global climate of the "War on Terror." Notably, Malaysia’s use of coercion has become increasingly less criticized by other governments, notably those in the West. Perhaps as a consequence, the government has become increasingly bold in its crackdowns against opposition elements. Following the political upheaval of the 2008 election, however, the future of the security apparatus is in question. --- Der Einsatz repressiver Sicherheitsgesetze durch die malaysische Regierung beeinflusste die moderne politische Geschichte Malaysias in nicht unerheblicher Weise. Dieser Beitrag analysiert den Einsatz des Sicherheitsapparates durch die malaysische Regierung seit den Terroranschlägen des 11. September 2001. Ich argumentiere, dass dieser Apparat im gegenwärtigen weltweiten Klima des "Kriegs gegen den Terrorismus" größtenteils unverändert blieb, dass jedoch gleichzeitig Malaysias Einsatz von Gewalt von anderen (vor allem westlichen Regierungen weniger kritisiert wird als früher. Eine mögliche Konsequenz dessen ist die zunehmend rücksichtslosere Vorgehensweise der Regierung gegen oppositionelle Strömungen. Als Folge des politischen Umschwungs nach der Wahl 2008 steht die Zukunft des Sicherheitsapparates jedoch in den Sternen.

  14. Elucidation of the mechanisms of CryIIIA overproduction in a mutagenized strain of Bacillus thuringiensis var. tenebrionis

    International Nuclear Information System (INIS)

    NB176 is a Bacillus thuringiensis mutant derived by λ-irradiation of NB125 Bacillus thuringiensis var. tenebrionis (Krieg). It exhibits two interesting phenotypes: (i) oligosporogeny and (ii) twofold to threefold overproduction of the CryIIIA protein. Southern profiles of the NB176 strain showed an additional copy(s) of the cryIIIA gene located on a 4 kb HindIII fragment, in addition to the expected cryIIIA gene on a 3 kb HindIII fragment. Each cryIIIA gene-bearing HindIII fragment was cloned from NB176. The restriction map of the 3 kb HindIII fragment was identical to that published by Donovan and coworkers. Sequencing of the 4 kb HindIII fragment showed no alterations in the promoter region of the cryIIIA gene but did show replacement of the region immediately following the cryIIIA open reading frame with a sequence encoding a transposase with 50% amino acid homology to that of Tn 1000. These findings suggest that the overproduction phenotype of NB176 results from extra copies of the cryIIIA gene produced from a transposition event(s) induced or stabilized by γ-irradiation. Integration of additional copies of the cryIIIA gene into the native 90MDa plasmid of the wild-type B. thuringiensis var. tenebrionis strain resulted in strains that made enormous crystals, many possessing greatly enhanced insecticidal activity

  15. Critique of the War Reason

    DEFF Research Database (Denmark)

    Harste, Gorm

    This paper is a summary of my 700 pages very academic thesis, in Danish, to be published at Aarhus University Press. A shorter booklet is published at AUP too (nov. 2014, 250 pages) and a number of shorter articles are published in English, French and German. In Luhmann’s systems theory, and in...... social theory and sociology as well, there is a missing link in the lack of a sociology of war. A number of German systems theoreticians use Luhmann’s theory to fulfil that gap (Gertrud Brücher; Krysztof Matuszek; Rasmus Beckmann; Barbara Kuchler; Tobias Kohl; Klaus Dammann) Luhmann (born 1927), who was...... soldier and prisoner of war from age 15-17, would not write a “Der Krieg der Gesellschaft”. Yet the attempt to narrow this lacuna is indeed a heavy burden and a difficult task, in which, firstly, it is methodologically decisive to get the basic distinctions right about a second order observation of war as...

  16. In situ radiation measurement and estimation of U/Th ratio to reflect on the uranium bearing potential zone in metamorphic rocks of Mahendragarh District, Haryana

    International Nuclear Information System (INIS)

    Gross gamma radiation survey was carried out using NaI(Tl) scintillator based portable gamma ray spectrometer (PGRS) around areas of Gaonri, Dholera, Pachnota and Meghot in Mahendragarh district, Haryana. Geologically the area forms part of north Delhi fold belt comprising calc-silicate, quartz biotite schist, impure marble, quartzite and pegmatite rocks. Equivalent uranium (eU3O8) concentration in ppm was estimated in situ on a regular grid pattern of 500 m (E-W) x 1000 m (N-S) and grab samples were collected at grid locations for analyzing in the laboratory for estimating the contents of eU3O8 Raeq, ThO2 and %K. A comparison with the laboratory analysed grab samples for eU3O8 data and in situ radiation measurements shows a good match of the two sets of data. The in situ measurements indicate higher concentration of eU3O8 in Chapra Bibipur in northeastern most corners, Maghot area in central part, Gaonri in western part and Pachnota in southwestern part of the study area. As index to uranium favorability, U(Raeq)/Th contour map (prepared using Surfer software with Krieging interpolation method for this grid size) based on the data on grab samples was generated which show three major clusters of relatively high U/Th ratio. The blocks delineated are enriched in sodic minerals albite which support albite hosted uranium mineralization potential in metamorphic rocks in Haryana. (author)

  17. Privatiserung von Geschichte. Probleme einer differenzierten Aufarbeitung

    Directory of Open Access Journals (Sweden)

    Birthe Kundrus

    2000-11-01

    Full Text Available Ausgangspunkt der Untersuchung von Vera Neumann ist die These, daß im Krieg Erlebtes und Erlittenes in den Wiederaufbau- und Wirtschaftswunderjahren Westdeutschlands einem Thematisierungstabu unterlegen sei. Anhand von 50 Interviews, die in den 80er Jahren im Rahmen des von Lutz Niethammer geleiteten Projekts „Lebensgeschichte und Sozialgeschichte im Ruhrgebiet 1930–1960“ (LUSIR entstanden sind und die sie jetzt anhand der Tonbandprotokolle und Abschriften ein zweites Mal auswertet, möchte die Historikerin diese Verschüttungen aufspüren. Im Anschluß an Niethammers These der „Privatisierung von Geschichte“ will sie zeigen, daß seelische und körperliche Kriegsfolgen wie Deprivations- und Überlastungsgefühle, der Verlust von Angehörigen und Kriegsbeschädigungen „privatisiert“, d.h. an die Familien übertragen wurden. Dort seien dann in erster Linie die weiblichen Familienmitglieder mit der Versorgungs- und Pflegearbeit konfrontiert worden. An vier Fallbeispiele schließt sich eine detaillierte Auswertung des gesamten Interviewmaterials an. Diesen Teilen folgt ein Abschnitt zur staatlichen Kriegsopferversorgung in der frühen Bundesrepublik.

  18. Bioinoculants: A sustainable approach to maximize the yield of Ethiopian mustard (Brassica carinata L.) under low input of chemical fertilizers.

    Science.gov (United States)

    Nosheen, Asia; Bano, Asghari; Ullah, Faizan

    2016-02-01

    This study aimed to find out the effect of plant growth-promoting rhizobacteria (PGPR; Azospirillum brasilense and Azotobacter vinelandii) either alone or in combination with different doses of nitrogen and phosphate fertilizers on growth, seed yield, and oil quality of Brassica carinata (L.) cv. Peela Raya. PGPR were applied as seed inoculation at 10(6) cells/mL(-1) so that the number of bacterial cells per seed was 2.6 × 10(5) cells/seed. The chemical fertilizers, namely, urea and diammonium phosphate (DAP) were applied in different doses (full dose (urea 160 kg ha(-1) + DAP 180 kg ha(-1)), half dose (urea 80 kg ha(-1) + DAP 90 kg ha(-1)), and quarter dose (urea 40 kg ha(-1) + DAP 45 kg ha(-1)). The chemical fertilizers at full and half dose significantly increased the chlorophyll, carotenoids, and protein content of leaves and the seed yield (in kilogram per hectare) but had no effect on the oil content of seed. The erucic acid (C22:1) content present in the seed was increased. Azospirillum performed better than Azotobacter and its effect was at par with full dose of chemical fertilizers (CFF) for pigments and protein content of leaves when inoculated in the presence of half dose of chemical fertilizers (SPH). The seed yield and seed size were greater. Supplementing Azospirillum with SPH assisted Azospirillum to augment the growth and yield, reduced the erucic acid (C22:1) and glucosinolates contents, and increased the unsaturation in seed oil. It is inferred that A. brasilense could be applied as an efficient bioinoculant for enhancing the growth, seed yield, and oil quality of Ethiopian mustard at low fertilizer costs and sustainable ways. PMID:24097367

  19. Alternative rooting induction of semi-hardwood olive cuttings by several auxin-producing bacteria for organic agriculture systems

    Directory of Open Access Journals (Sweden)

    M. C. Montero-Calasanz

    2013-01-01

    Full Text Available Southern Spain is the largest olive oil producer region in the world. In recent years organic agriculture systems have grown exponentially so that new alternative systems to produce organic olive cuttings are needed. Several bacterial isolates, namely Pantoea sp. AG9, Chryseobacterium sp. AG13, Chryseobacterium sp. CT348, Pseudomonas sp. CT364 and Azospirillum brasilense Cd (ATCC 29729, have been used to induce rooting in olive semi-hardwood cuttings of Arbequina, Hojiblanca and Picual cultivars of olive (Olea europea L. The first four strains were previously selected as auxin-producing bacteria and by their ability to promote rooting in model plants. They have been classified on the basis of their 16S rDNA gene sequence. The known auxin producer A. brasilense Cd strain has been used as a reference. The inoculation of olive cuttings was performed in two different ways: (i by dipping cuttings in a liquid bacterial culture or (ii by immersing them in a paste made of solid bacterial inoculant and sterile water. Under nursery conditions all of the tested bacterial strains were able to induce the rooting of olive cuttings to a similar or greater extent than the control cuttings treated with indole-3-butyric acid (IBA. The olive cultivars responded differently depending on the bacterial strain and the inoculation method. The strain that consistently gave the best results was Pantoea sp. AG9, the only one of the tested bacterial strains to express the enzyme 1-aminocyclopropane-1-carboxylate (ACC deaminase. The results are also discussed in terms of potential commercial interest and nursery feasibility performance of these strains.

  20. Effect of immobilized rhizobacteria and organic amendment in bulk and rhizospheric soil of Cistus albidus L.

    Science.gov (United States)

    Mengual, Carmen Maria; del Mar Alguacil, Maria; Roldan, Antonio; Schoebitz, Mauricio

    2013-04-01

    A field experiment was carried out to assess the effectiveness of the immobilized microbial inoculant and the addition of organic olive residue. The microbial inoculant contained two rhizobacterial species identified as Azospirillum brasilense and Pantoea dispersa immobilized in a natural inert support. Bacterial population densities were 3.5×109 and 4.1×109 CFU g-1 of A. brasilense M3 and P. dispersa C3, respectively. The amendment used was the organic fraction extracted with KOH from composted "alperujo". The raw material was collected from an olive-mill and mixed with fresh cow bedding as bulking agent for composting. The inoculation of rhizobacteria and the addition of organic residue were employed for plant growth promotion of Cistus albidus L. and enhancement of soil physicochemical, biochemical and biological properties in a degraded semiarid Mediterranean area. One year after planting, the available phosphorus and potassium content in the amended soils was about 100 and 70% respectively higher than in the non-amended soil. Microbial inoculant and their interaction with organic residue increased the aggregate stability of the rhizosphere soil of C. albidus (by 12% with respect to control soil) while the organic residue alone not increased the aggregate stability of the rhizosphere of C. albidus. Microbial biomass C content and enzyme activities (dehydrogenase, urease, protease-BAA and alkaline phosphatase) of the rhizosphere of C. albidus were increased by microbial inoculant and organic residue interaction but not by microbial inoculation alone. The microbial inoculant and organic residue interaction were the most effective treatment for stimulating the roots dry weight of C. albidus (by 133% with respect to control plants) and microbial inoculant was the most effective treatment for increase the shoot dry weigh of plants (by 106% with respect to control plants). The combined treatment, involving microbial inoculant and addition of the organic residue

  1. Evaluation of potential crushed-salt constitutive models

    International Nuclear Information System (INIS)

    Constitutive models describing the deformation of crushed salt are presented in this report. Ten constitutive models with potential to describe the phenomenological and micromechanical processes for crushed salt were selected from a literature search. Three of these ten constitutive models, termed Sjaardema-Krieg, Zeuch, and Spiers models, were adopted as candidate constitutive models. The candidate constitutive models were generalized in a consistent manner to three-dimensional states of stress and modified to include the effects of temperature, grain size, and moisture content. A database including hydrostatic consolidation and shear consolidation tests conducted on Waste Isolation Pilot Plant and southeastern New Mexico salt was used to determine material parameters for the candidate constitutive models. Nonlinear least-squares model fitting to data from the hydrostatic consolidation tests, the shear consolidation tests, and a combination of the shear and hydrostatic tests produces three sets of material parameter values for the candidate models. The change in material parameter values from test group to test group indicates the empirical nature of the models. To evaluate the predictive capability of the candidate models, each parameter value set was used to predict each of the tests in the database. Based on the fitting statistics and the ability of the models to predict the test data, the Spiers model appeared to perform slightly better than the other two candidate models. The work reported here is a first-of-its kind evaluation of constitutive models for reconsolidation of crushed salt. Questions remain to be answered. Deficiencies in models and databases are identified and recommendations for future work are made. 85 refs

  2. Consolidation of the Waste Isolation Pilot Plant crushed salt/bentonite mixtures as a function of confining pressure and moisture content as compared with constitutive model predictions

    International Nuclear Information System (INIS)

    Four hydrostatic consolidation tests were performed on crushed salt/bentonite mixtures to evaluate the influence of moisture on consolidation rate, permeability, and compressive strength. Specimens comprised 30 percent bentonite and 70 percent salt based on total dry weight. Brine was added to each specimen to adjust its total moisture content to between 3.5 and 10 percent (nominal) of the total dry weight. In the consolidation tests, each specimen was subjected to two stages of hydrostatic stress: 0.5 MPa and 3.45 MPa. During each stage, the pressure was maintained at a constant level and volumetric strain data were continuously logged. By using multiple stages, consolidation data were obtained at two pressures and the time required to consolidate the specimens to full saturation was reduced. Once full saturation was achieved, specimens were subjected to a final test stage in which the hydrostatic stress was reduced and a permeability test was performed. A steady flow permeability test was performed successfully on only one specimen and its permeability was determined to be 1.12 x 10-19 m2. An unconfined compressive strength test was conducted on one of the consolidated specimens and was found to be 1.66 MPa. A density model proposed by Sjaardema and Krieg was compared to the dry density data using parameter values established by Callahan and DeVries. The model fit the data best at intermediate moisture contents and low pressures. The model was also fitted to the data obtained in this study to determine additional parameter values

  3. Nuclear disarmament - A consultants observations; Abruestung im Nuklearsektor. Beobachtungen eines Beraters

    Energy Technology Data Exchange (ETDEWEB)

    Stoll, W.

    2003-05-01

    The changed situation in the conflict between the superpowers after the end of the Cold War requires a reduction in the excessive number of weapon systems, especially of nuclear weapons of mass destruction. While the U.S. approach is relatively transparent, Russia harbors a large number of administrative and technical reservations and uncertainties. This affects the nuclear fuel cycle in particular. The contribution analyzes the general boundary conditions, taking into account experience accumulated on the spot in a number of trips to Russia in the course of the past decade. A detailed account is given of the current situation in the civilian and military nuclear sectors in Russia. The state of development and the problems of the Russian nuclear fuel cycle are addressed. Other items discussed are aspects of the future nuclear fuel supply situation and other perspectives of the use of nuclear power in Russia associated with an establishment of closed nuclear fuel cycles in the interest of the long-term continuity of power supply. (orig.) [German] Die veraenderte Konfliktlage zwischen den Grossmaechten nach Beendigung des Kalten Krieges bedingt eine Reduzierung der Ueberzahl von Waffensystemen, vor allem der nuklearen Massenvernichtungswaffen. Waehrend die amerikanische Vorgehensweise einigermassen durchsichtig ist, bestehen in Russland eine grosse Zahl organisatorischer und technischer Vorbehalte und Unsicherheiten. Besonders der nukleare Brennstoffkreislauf ist davon begroffen. Im vorliegenden Beitrag werden die allgemeinen Randbedingungen analysiert und es werden Vor-Ort-Erfahrungen mehrerer Russlandreisen der vergangenen Dekade beruecksichtigt. Ausfuehrlich wird die aktuelle Situation des zivilen und militaerischen Nuklearsektors in Russland vorgestellt. Entwicklungsstand und Probleme des russischen Brennstoffkreislaufs werden angesprochen. Aspekte der zukuenftigen Versorgungslage mit Kernbrennstoff und weiterer Perspektiven der Kernenergienutzung in Russland mit

  4. Molecular characterization of nitrogen-fixing bacteria isolated from brazilian agricultural plants at São Paulo state Caracterização molecular de bactérias fixadoras de nitrogênio isoladas de plantas brasileiras no estado de São Paulo

    Directory of Open Access Journals (Sweden)

    Érica. L. Reinhardt

    2008-09-01

    Full Text Available Fourteen strains of nitrogen-fixing bacteria were isolated from different agricultural plant species, including cassava, maize and sugarcane, using nitrogen-deprived selective isolation conditions. Ability to fix nitrogen was verified by the acetylene reduction assay. All potentially nitrogen-fixing strains tested showed positive hybridization signals with a nifH probe derived from Azospirillum brasilense. The strains were characterized by RAPD, ARDRA and 16S rDNA sequence analysis. RAPD analyses revealed 8 unique genotypes, the remaining 6 strains clustered into 3 RAPD groups, suggesting a clonal origin. ARDRA and 16S rDNA sequence analyses allowed the assignment of 13 strains to known groups of nitrogen-fixing bacteria, including organisms from the genera Azospirillum, Herbaspirillum, Pseudomonas and Enterobacteriaceae. Two strains were classified as Stenotrophomonas ssp. Molecular identification results from 16S rDNA analyses were also corroborated by morphological and biochemical data.Quatorze linhagens de bactérias fixadoras de nitrogênio foram isoladas de diferentes espécies de plantas, incluindo cassava, milho e cana-de-açúcar, usando condições seletivas desprovidas de nitrogênio. A capacidade de fixar nitrogênio foi verificada por ensaio de redução de acetileno. Todas as linhagens fixadoras de nitrogênio testadas apresentaram hibridização positiva com sonda de gene nifH derivada de Azospirillum brasilense. As linhagens foram caracterizadas por RAPD, ARDRA e sequenciamento do gene 16S rDNA. As análises de RAPD revelaram 8 genótipos, as 6 linhagens restantes foram agrupadas em 3 grupos de RAPD, sugerindo uma origem clonal. ARDRA e seqüências de 16S rDNA foram alocadas em 13 grupos conhecidos de bactérias fixadoras de nitrogênio, incluindo organismos dos gêneros Azospirillum, Herbaspirillum, Pseudomonas e Enterobacteriaceae. Duas linhagens foram classificadas como Stenotrophomonas ssp. Os resultados da identifica

  5. ИЗУЧЕНИЕ ВЛИЯНИЯ ЛЕКТИНОВ АЗОСПИРИЛЛ НА ОБРАЗОВАНИЕ ПЕРЕКИСИ ВОДОРОДА В КОРНЯХ ПРОРОСТКОВ ПШЕНИЦЫ

    OpenAIRE

    Аленькина, Светлана; Трутнева, Ксения; Великов, Владимир; Никитина, Валентина

    2012-01-01

    Показана способность лектинов, выделенных с поверхности почвенных азотфиксирующих бактерий штамма Azospirillum brasilense Sp7 и его мутанта по лектиновой активности Azospirillum brasilense Sp7.2.3, регулировать продукцию перекиси водорода в корнях проростков пшеницы, связанную с активацией супероксиддисмутазы, пероксидазы, оксалатоксидазы и ингибированием активности каталазы. Было показано, что в корнях проростков пшеницы при воздействии лектинов наиболее быстро индуцируемым путем образования...

  6. Aeração e adição de sais na produção de ácido indol acético por bactérias diazotróficas Aeration and salt effects on indol acetic production by diazotrophic bacteria

    Directory of Open Access Journals (Sweden)

    Tharwat El-Sayed El-Desouk Radwan

    2005-10-01

    Full Text Available Foi analisada a produção de compostos indólicos por Azospirillum brasilense Cd, A. lipoferum Br 17, Herbaspirillum seropedicae Z 67, H. rubrisubalbicans M4 e a estirpe 34 isolada de arroz, que não se enquadra em nenhuma das espécies de Herbaspirillum já descritas, em relação a diferentes condições de aeração e concentrações de sais. A maior aeração do meio propiciou aumento na produção de compostos indólicos pelas bactérias testadas. Foi verificado aumento desses compostos, em culturas estáticas, em meio sem nitrogênio no caso de Azospirillum, e na presença de N para as estirpes de Herbaspirillum. O aumento da concentração de sais no meio de cultivo inibiu a produção de compostos indólicos, embora tenha sido observado um pequeno aumento quando a concentração de CaCl2 foi de 1 g L-1. O efeito mais deletério da salinidade foi observado com a presença de NaHCO3, seguido de NaCl e Na2SO4. Azospirillum produziu mais compostos indólicos em meio semi-sólido e Herbaspirillum em meio líquido, mas em menor nível.The production of indolic compounds by Azospirillum brasilense Cd, A. lipoferum Br 17, Herbaspirillum seropedicae Z 67, H. rubrisubalbicans M4, and strain 34 isolated from rice, which does not fit into the described Herbaspirillum species, was measured under aeration ratio and salt concentrations. Aeration of the medium increased growth and production of indole compounds by these bacteria. Under static condition, the production was higher both in nitrogen-free medium for Azospirillum, and in amended N medium for the Herbaspirillum strains. Increasing salt concentration into the medium inhibited the production of indole compounds, although a small increase in production was observed, when CaCl2 concentration was raised above 1 g L-1. Deleterious effect of salinity was more pronounced in the presence of NaHCO3, followed by NaCl and Na2SO4. Azospirillum produced more indolic compounds in semi-solid cultures, and

  7. Nitrogen fixed by wheat plants as affected by nitrogen fertilizer levels and Non-symbiotic bacteria

    International Nuclear Information System (INIS)

    Inorganic nitrogen is required for all egyptian soils for wheat. Free living and N 2-fixing microorganisms are able associate closely related with the roots of geraminacae. Pot experiment studies were carried out to examine the response of wheat plants to inoculation with Azospirillum Brasilense and Azotobacter Chroococcum, single or in combination, under various levels of ammonium sulfate interaction between both the inoculants increased straw or grain yield as well as N-uptake by wheat plants with increasing N levels. Results showed that grains of wheat plants derived over 19,24 and 15% of its N content from the atmospheric - N 2 (Ndfa) with application of 25,50 and 75 mg N kg-1 soil in the presence of + Azospirillum + azotobacter. The final amount of N 2-fixers. The highest values of N 2-fixed were observed with mixed inoculants followed by inoculation with Azospirillum and then azotobacter. The recovery of applied ammonium sulfate-N was markedly increased by inoculation with combined inoculants, but less in uninoculated treatments. Seeds inoculated with non-symbiotic fixing bacteria could be saved about 25 kg N without much affecting the grain yield. i fig., 4 tabs

  8. Characterization of diazotrophic bacteria non-symbiotic associated with eucalyptus (eucalyptus sp.) in Codazzi, Cesar (Colombia)

    International Nuclear Information System (INIS)

    The effect of climatic seasons (rainy and dry) and the stratum sample (rhizospheric soil, roots and leaves) the population of the genera Azotobacter, Beijerinckia, Derxia, Azospirillum, Herbaspirillum, Gluconacetobacter and Burkholderia in soil rhizosphere, roots and leaves of eucalyptus (eucalyptus sp.). It also assesses their ability to produce indoles compounds as plant growth promoters and their acetylene reduction activity as an indicator of biological fixation of nitrogen. The results showed no statistically significant differences in the Duncan test (p ≤ 0.05) in the population with respect to the climate epoch, suggesting that these bacteria are able to tolerate stress conditions by different physiological mechanisms. With respect to the stratum sample isolates attempts of Herbaspirillum sp. and Azospirillum sp. significant differences in rhizospheric soil and roots. we obtained 44 isolates of which were grouped by phenotypic characterization as 14 suspected of Beijerinckia sp., 12 Azotobacter sp., 8 Derxia sp., 4 Herbaspirillum sp., 5 Azospirillum sp., 1 Gluconacetobacter sp. and 1 Burkholderia sp. due to their high potential were selected isolates C27, C26 and C25. These four strains present the best values of efficiency in vitro, exceeding production values of the reference strains used (A. chroococcum (AC1) and a. brasilense (SP7)).

  9. The crude plant juices of desert plants as appropriate culture media for the cultivation of rhizospheric microorganisms

    Directory of Open Access Journals (Sweden)

    Eman H. Nour

    2012-01-01

    Full Text Available The exclusive use of plant juices, not as a mere supplement to synthetic culture media, for culturing rhizospheric microorganisms (RMO is introduced here. Juices were prepared from desert (Mesembryanthemum crystallinum L., Zygophyllum album L., Carpobrotus edulis L. as well as cultivated (Trifolium alexandrinum L., Beta vulgaris L. plants. Colonies of RMO (Azospirillum brasilense, Enterobacter agglomerans and Klebsiella pneumoniae nicely developed on surface-inoculated agar plates prepared from crude and diluted juice of M. crystallinum (ice plant. Furthermore, hundreds of RMO colonies developed on various standard culture media were replicated (>90% on agar plates of different plant juices. RMO cells grew nicely in liquid ice plant juice, with doubling times comparable to those grown in the reference culture medium. RMO populations resident in various host plants were able to develop on culture media prepared from homologous and heterologous juices. The application of a thin semi-solid overlay agar on the surfaces of inoculated agar plates significantly increased the recovery of micro-colonies on agar plates, particularly those prepared from plant juices.

  10. Identification, sequencing and structural analysis of a nifA-like gene of Acetobacter diazotrophicus.

    Science.gov (United States)

    Teixeira, K R; Morgan, T; Meletzus, D; Galler, R; Baldani, J I; Kennedy, C

    1999-01-01

    A recombinant plasmid, pAD101, containing a DNA fragment of Acetobacter diazotrophicus strain PAL5 was isolated by its ability to restore Nif+ phenotype to a nifA- ntrC- double mutant of Azotobacter vinelandii. Hybridization with the nifA genes of Azospirillum brasilense located the nifA gene more precisely to specific fragments of pAD101. DNA sequencing of appropriate subclones of pAD101 revealed that the nifA gene was adjacent to the nifB gene in A. diazotrophicus, and the 5' end of the nifB gene was located downstream of the nitrogenase MoFe subunit gene, nifK. The deduced aminoacid sequence of A. diazotrophicus nifA and nifB gene were most similar to the NifA and NifB proteins of Azorhizobium caulinodans and Rhodobacter capsulatus, respectively. In addition, nucleotide sequences upstream of the A. diazotrophicus nifA-encoding region indicate features similar to those in the A. caulinodans nifA promoter region involved in O2 and fixed N regulation of nifA expression. PMID:10530336

  11. Increased root exudation of /sup 14/C-compounds by sorghum seedlings inoculated with nitrogen-fixing bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Lee, K.J. (Institute of Forest Genetics, Suweon (Republic of Korea)); Gaskins, M.H. (Florida Univ., Gainesville (USA). Dept. of Agriculture)

    1982-01-01

    Organic components leaked from Sorghum bicolor seedlings ('root exudates') were examined by recovering /sup 14/C labelled compounds from root solutions of seedlings inoculated with Azospirillum brasilense, Azotobacter vinelandii or Klebsiella pneumoniae nif-. Up to 3.5% of the total /sup 14/C recovered from shoots, roots, and nutrient solutions was found in the root solutions. Inoculation with Azospirillum and Azotobacter increased the amounts of /sup 14/C and decreased the amounts of carbohydrates in the root solutions. When sucrose was added as a carbon source for the bacteria, the increase of /sup 14/C in the solutions did not occur. Quantities of /sup 14/C found in the root solutions were proportional to amounts of mineral nitrogen supplied to the plants. Bacterial growth also was proportional to nitrogen levels. When sorghum plants were grown in soil and labelled with /sup 14/CO/sub 2/, about 15% of the total /sup 14/C recovered within 48 hours exposure was found in soil leachates.

  12. Differential growth responses of Brachypodium distachyon genotypes to inoculation with plant growth promoting rhizobacteria.

    Science.gov (United States)

    do Amaral, Fernanda P; Pankievicz, Vânia C S; Arisi, Ana Carolina M; de Souza, Emanuel M; Pedrosa, Fabio; Stacey, Gary

    2016-04-01

    Plant growth promoting rhizobacteria (PGPR) can associate and enhance the growth of important crop grasses. However, in most cases, the molecular mechanisms responsible for growth promotion are not known. Such research could benefit by the adoption of a grass model species that showed a positive response to bacterial inoculation and was amenable to genetic and molecular research methods. In this work we inoculated different genotypes of the model grass Brachypodium distachyon with two, well-characterized PGPR bacteria, Azospirillum brasilense and Herbaspirillum seropedicae, and evaluated the growth response. Plants were grown in soil under no nitrogen or with low nitrogen (i.e., 0.5 mM KNO3). A variety of growth parameters (e.g., shoot height, root length, number of lateral roots, fresh and dry weight) were measured 35 days after inoculation. The data indicate that plant genotype plays a very important role in determining the plant response to PGPR inoculation. A positive growth response was observed with only four genotypes grown under no nitrogen and three genotypes tested under low nitrogen. However, in contrast, relatively good root colonization was seen with most genotypes, as measured by drop plate counting and direct, microscopic examination of roots. In particular, the endophytic bacteria H. seropedicae showed strong epiphytic and endophytic colonization of roots. PMID:26873699

  13. Densidade e diversidade fenotípica de bactérias diazotróficas endofíticas em solos de mineração de bauxita, em reabilitação Density and phenotypic diversity of endophytic nitrogen fixing bacteria in soils under rehabilitation after bauxite mining

    Directory of Open Access Journals (Sweden)

    R. Melloni

    2004-02-01

    Full Text Available Bactérias diazotróficas endofíticas contribuem para o desenvolvimento das plantas por meio da fixação biológica do nitrogênio, produção e liberação de substâncias reguladoras do crescimento vegetal, podendo, assim, facilitar a revegetação de solos degradados por atividades antrópicas. No entanto, pouco se conhece sobre as populações destas bactérias em solos ou plantas de áreas de mineração. Objetivando avaliar o efeito de diferentes tipos de vegetação e tempo de reabilitação de áreas degradadas por mineração de bauxita na densidade e diversidade de algumas espécies de bactérias diazotróficas endofíticas, realizaram-se, em duas épocas, amostragens de solo, de dois ambientes distintos, submetidos a diferentes processos de reabilitação. A densidade, avaliada pelo número mais provável, utilizando os meios de cultura: NFb, JNFb e Fam, para Azospirillum brasilense e A. lipoferum, Herbaspirillum spp. e A. amazonense, respectivamente, variou de 0 a 2,0 x 10(4 bactérias por grama de solo e mostrou que o tipo de vegetação influiu nas populações destas bactérias. Foram encontradas densidades maiores em solos revegetados com gramíneas: braquiária (Brachiaria decumbens, capim-azevém (Lolium multiflorum e capim-gordura (Melinis minutiflora. Contudo, estas densidades podem ser consideradas baixas, se comparadas às de solos agrícolas, e não apresentaram relação com o tempo de reabilitação da área. Foram encontrados 36 fenótipos culturais em meio batata, entre os 72 isolados obtidos dos três meios de cultura utilizados. A partir destes, foram formados sete grandes grupos com similaridade superior ou igual a 63 %, dos quais cinco, representando 62,5 % do total de isolados obtidos, continham as estirpes-tipo de Burkholderia brasilensis, Herbaspirillum seropedicae e Azospirillum spp. (A. brasilense, A. amazonense, A. lipoferum, A. irakense. Apesar da baixa densidade, este grupo de bactérias apresentou alta

  14. USO COMBINADO DE MICROORGANISMOS BENÉFICOS Y PRODUCTOS BIOACTIVOS COMO ALTERNATIVA PARA LA PRODUCCIÓN DE TOMATE (Lycopersicon esculentum, Mill

    Directory of Open Access Journals (Sweden)

    Elein Terry

    2005-01-01

    Full Text Available Con el objetivo de conocer la efectividad agrobiológica de la combinación de microorganismos benéficos y productos bioactivos, sobre el desarrollo, rendimiento y la calidad interna en el cultivo del tomate (variedad 'Amalia', se llevó a cabo un experimento de campo en el 2000 y 2001, sobre un suelo Ferralítico Rojo lixiviado típico. Los tratamientos consistieron en plantas coinoculadas (Glomus clarum- Azospirillum brasilense y asperjadas foliarmente con el producto bioactivo Biostan en diferentes momentos del desarrollo de las plantas. Los resultados mostraron una relación armónica y ecológicamente compatible entre ambos productos, permitiendo un adecuado estado nutricional de las plantas, así como posibilitó un rendimiento de 35 t.ha-1, siendo superior en un 17 % al testigo de producción; por otra parte, los frutos obtenidos con estos tratamientos tuvieron una mejor calidad bromatológica.

  15. Development of sequence-characterized amplified region (SCAR) markers as a quality standard of inoculants based on Azospirillum.

    Science.gov (United States)

    Reddy Priya, Pasupuleti; Selastin Antony, Raju; Gopalaswamy, Ganesan; Balachandar, Dananjeyan

    2016-04-01

    An attempt was made in this work to develop a strain-level molecular marker for unambiguous authentication of two Azospirillum inoculants, viz. A. lipoferum (strain Az204) and A. brasilense (strain Sp7). The sequence-characterized amplified region (SCAR) markers obtained from DNA fingerprints were designed for discrete detection of the strains. The SCAR primers could successfully amplify the target strain without cross-reaction with other Azospirillum strains, native isolates and other inoculants. The detection limit of SCAR primer for Az204 was 8.00 pg of DNA (approximately 10(5) cells per mL), and for Sp7, it was 0.49 pg of DNA (equal to 10(4) cells per mL). A simplified Sephadex G100-based crude DNA extraction protocol developed in this study was found suitable for SCAR marker-based strain authentication. Further, SCAR primers were assessed for simultaneous authentication as well as quantification of commercially prepared Azospirillum inoculants by quantitative real-time PCR (RT-PCR) and most-probable-number PCR (MPN-PCR). The RT-PCR assay can be able to quantify the commercial formulations as equal to culturable MPN method, while MPN-PCR failed for Az204. The SCAR marker-based strain authentication and presumptive quantification developed in the present work can contribute to improving the quality standard of commercial inoculants. PMID:26792777

  16. Ticks (Acari: Ixodidae) infesting birds in an Atlantic rain forest region of Brazil.

    Science.gov (United States)

    Ogrzewalska, Maria; Pacheco, Richard C; Uezu, Alexandre; Richtzenhain, Leonardo J; Ferreira, Fernando; Labruna, Marcelo B

    2009-09-01

    Brazil has the third richest bird diversity of the world; however, there are few data concerning ticks (Acari: Ixodidae) parazitizing birds. The aim of the study was to report tick infestations on wild birds from an Atlantic rain forest region of Brazil. During 2 yr, ticks were collected from birds and from the environment in 12 forest sites. A total of 1,725 birds were captured representing 80 species from 24 families. In total, 223 (13%) birds were found infested by immature stages of Amblyomma ticks: 1,800 larvae and 539 nymphs. The prevalence of ticks was higher among birds from the families Thamnophilidae, Conopophagidae, and Momotidae. The most common tick parasitizing birds was Amblyomma nodosum Koch. Other tick species, Amblyomma coelebs Neumann, Amblyomma cajennense (F.), Amblyomma ovale Koch, Amblyomma longirostre (Koch), Amblyomma calcaratum Neumann, and Amblyomma naponense (Packard), were found sporadically. Among free-living ticks collected in the environment, A. cajennense was the most common, followed by A. coelebs, A. naponense, Amblyomma brasilense Aragão, and Hemaphysalis juxtakochi Cooley. PMID:19769058

  17. Bioremediation of hydrocarbons contaminating sewage effluent using man-made biofilms: effects of some variables.

    Science.gov (United States)

    Al-Mailem, D M; Kansour, M K; Radwan, S S

    2014-11-01

    Biofilm samples were established on glass slides by submerging them in oil-free and oil-containing sewage effluent for a month. In batch cultures, such biofilms were effective in removing crude oil, pure n-hexadecane, and pure phenanthrene contaminating sewage effluent. The amounts of the removed hydrocarbons increased with increasing biofilm surface area exposed to the effluent. On the other hand, addition of the reducing agent thioglycollate dramatically inhibited the hydrocarbon bioremediation potential of the biofilms. The same biofilm samples removed contaminating hydrocarbons effectively in three successive batch bioremediation cycles but started to become less effective in the cycles thereafter, apparently due to mechanical biofilm loss during successive transfers. As major hydrocarbonoclastic bacteria, the biofilms harbored species belonging to the genera Pseudomonas, Microvirga, Zavarzinia, Mycobacterium, Microbacterium, Stenotrophomonas, Gordonia, Bosea, Sphingobium, Brachybacterium, and others. The nitrogen fixer Azospirillum brasilense and the microalga Ochromonas distigma were also present; they seemed to enrich the biofilms, with nitrogenous compounds and molecular oxygen, respectively, which are known to enhance microbiological hydrocarbon degradation. It was concluded that man-made biofilms based upon sewage microflora are promising tools for bioremediation of hydrocarbons contaminating sewage effluent. PMID:25146193

  18. Trace cobalt speciation in bacteria and at enzymic active sites using emission Moessbauer spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Kamnev, A.A.; Antonyuk, L.P.; Smirnova, V.E.; Serebrennikova, O.B. [Laboratory of Biochemistry, Institute of Biochemistry and Physiology of Plants and Microorganisms, Russian Academy of Sciences, Saratov (Russian Federation); Kulikov, L.A.; Perfiliev, Yu.D. [Laboratory of Nuclear Chemistry Techniques, Department of Radiochemistry, Faculty of Chemistry, Moscow State University (Russian Federation)

    2002-02-01

    {sup 57}Co emission Moessbauer spectroscopy (EMS) allows the chemical state of cobalt, as influenced by its coordination environment, to be monitored in biological samples at its physiological (trace) concentrations. To draw attention to EMS as a valuable tool for speciation of cobalt in biocomplexes, the process of cobalt(II) metabolism in cells of the plant growth-promoting rhizobacterium Azospirillum brasilense Sp245 was investigated using EMS of {sup 57}Co{sup II}-doped bacterial cells. EMS measurements also showed {sup 57}Co{sup II}-activated glutamine synthetase (GS, a key enzyme of nitrogen metabolism, isolated from this bacterium) to have two different cobalt(II) forms at its active sites, in agreement with data available on other bacterial GSs. Chemical after-effects following electron capture by the nucleus of the parent {sup 57}Co{sup II} during the {sup 57}Co{yields}{sup 57}Fe transition, which contribute to the formation of a stabilised daughter {sup 57}Fe{sup III} component along with the nucleogenic {sup 57}Fe{sup II} forms, are also briefly considered. (orig.)

  19. The effect of ectomycorrhizal fungi and bacteria on pine seedlings

    Directory of Open Access Journals (Sweden)

    Hanna Dahm

    2014-08-01

    Full Text Available The effect of ecomycorrhizal fungi (Hebelon crustuliniforme(Bull.: Fr. Quél. 5392 and Pisolithus tinctorius (Pers. Coker et Couch 5335 and bacteria (Bacillus polymyxa and Azospirillum brasilense. associated with mycorrhizas on the growth of pine seedligs was investigated. In addition the influence of bacteria on fungal biomass production and the relationship between ectomycorrhizal fungi and fungi pathogenic to root of pine seedlings were determined. In general, the shoot/root ratio was higher in plants inoculated with Hebeloma crustuliniforme and bacteria than in the control seedlings (grown only under sterile conditions. In non-sterile substrate the root/shoot ratio of the mycorrhizal seedlings was lower as compared to the control. Similar phenomenon was noted in plants inoculated with the mycorrhizal fungus Pisolithus tinetorius. The bacteria used as well as the time of introduction of these organisms into the cultures of mycorrhiza fungi affected the production of fungal biomass. Hebeloma crustuliniforme and Pisolithus tinctorius inhibited the growth of Rizoctonia solani and Fusarium oxysporum fungi pathogenic to pine seedlings.

  20. Oviposition Attractancy of Bacterial Culture Filtrates: response of Culex quinquefasciatus

    Directory of Open Access Journals (Sweden)

    S Poonam

    2002-04-01

    Full Text Available Oviposition attractants could be used for monitoring as well as controlling mosquitoes by attracting them to lay eggs at chosen sites. In the present study, culture filtrates of seven bacterial species were tested for their attractancy against gravid females of Culex quinquefasciatus. When their oviposition active indices (OAI were studied, the culture filtrates of Bacillus cereus and Pseudomonas fluorescens exhibited oviposition attractancy (OAI = >0.3 at 100 ppm and the OAI were respectively 0.70 and 0.47. Culture filtrates of B. thuringiensis var. israelensis (wild type, B. t. var. israelensis (mutant and B. sphaericus showed attractancy at 2000 ppm with OAI of respectively 0.71, 0.59 and 0.68. However, the OAI of B. megaterium as well as Azospirillum brasilense was 0.13 (at 2000 ppm, which was less than 0.3 required to be considered them as attractants. When the oviposition attractancy of the bacterial culture filtrates were compared with that of a known oviposition attractant, p-cresol (at 10 ppm, the culture filtrates of B. t. var. israelensis (wild type and B. cereus were found to be more active than p-cresol, respectively with 64.2 and 54.3% oviposition.

  1. ESTUDIO DE LA INTERACCIÓN PLANTA-Azospirillum EN EL CULTIVO CAÑA DE AZÚCAR (Saccharum sp.

    Directory of Open Access Journals (Sweden)

    Juana Pérez

    2005-01-01

    Full Text Available Se realizó el aislamiento y la caracterización de cepas nativas de Azospirillum en la rizosfera de las variedades comerciales de caña de azúcar Ja60-5 y C266-70 en los suelos Ferralítico Rojo y Ferralítico Amarillento de las provincias de La Habana y Ciego de Avila. A los aislamientos se les evaluó la actividad nitrogenasa mediante la técnica de reducción del acetileno y la actividad estimuladora del crecimiento en vitroplantas de caña de azúcar. Las cepas fueron caracterizadas mediante pruebas morfológicas y bioquímicas. Se encontraron concentraciones de bacterias del orden de 104 cel. g -1 de raíces, correspondiendo los mayores valores a la variedad Ja60-5 en ambos suelos. Se aislaron cuatro cepas con características propias del género Azospirillum, seleccionándose la cepa 8 INICA de Azospirillum brasilense para estudios posteriores, por sus elevados valores de reducción de acetileno y su mayor efecto sobre el crecimiento de vitroplantas de caña de azúcar.

  2. BIOFERTILIZANTES Y PRODUCTOS BIOACTIVOS, ALTERNATIVAS PARA LA ASOCIACIÓN MAÍZ-TOMATE EN EL PERÍODO TEMPRANO DE SIEMBRA

    Directory of Open Access Journals (Sweden)

    Elein Terry

    2006-01-01

    Full Text Available Con el objetivo de conocer el efecto agronómico de la utilización combinada de biofertilizantes y productos bioactivos, sobre el desarrollo, rendimiento y la calidad interna del tomate (variedad ´Amalia´, cultivado fuera del período óptimo bajo un sistema de asociación de cultivos, se llevó a cabo un experimento de campo en el 2000 y 2001, sobre un suelo Ferralítico Rojo lixiviado típico. Los tratamientos consistieron en plantas coinoculadas (Glomus clarum + Azospirillum brasilense y asperjadas foliarmente con los productos bioactivos Biostan y Biobras-16, aplicados al inicio de la floracióndel cultivo. Los resultados mostraron una relación compatibleentre microorganismos y productos bioactivos, permitieron un adecuado balance nutricional de las plantas, así como un rendimiento entre 26 y 29 t.ha-1, siendo superior en un rango del 12-19 % con respecto al testigo de producción; por otra parte, los frutos obtenidos con estos tratamientos presentaron una calidad bromatológica superior.

  3. Effects of head pruning and different nutritional systems (chemical, biological and integrated on seed yield and oil content in medicinal pumpkin (Cucurbita pepo L.

    Directory of Open Access Journals (Sweden)

    Zarei Dariush

    2016-01-01

    Full Text Available To evaluate the effect of head pruning and different nutritional systems (chemical, biological and integrated on yield and seed oil content in medicinal pumpkin (Cucurbita pepo L., an experiment was conducted in Kermanshah/Iran during the 2013 growing season. The experimental treatments consisted of two levels - no head pruning, control (Co and head pruning (C1 allocated to the main plots. Four levels of different fertilizing systems - control (without fertilizer (T0, chemical (T1, biological (a combination of nitrogen fixing bacteria, Azospirillum brasilense and Glomus mosseae (T2, and integrated fertilizing system (biological fertilizer + 50% chemical fertilizer (T3 were assigned to the sub-plots. The experimental treatments were arranged as a split plot based on a randomized complete block design with three replications. The results showed that the highest percentage of seed oil was obtained (37% in the integrated nutritional system along with the head pruning treatment. The highest grain yields of 53 and 50 g per square meter were obtained in integrated and chemical fertilizing systems, respectively while no pruning was applied. The highest fruit yields of 3,710 and 3,668 kg per hectare were produced by chemical and integrated fertilizing systems, respectively. The biological nutrition system required more time to demonstrate its positive effect on the growth and yield of medicinal pumpkin.

  4. Growth promoting characteristics of rhizobacteria and AM Fungi for biomass amelioration of Zea mays

    Directory of Open Access Journals (Sweden)

    Kumar Manoj

    2015-01-01

    Full Text Available Plant growth promoting rhizobacteria (PGPR and mycorrhiza were evaluated on the growth (biomass and yield of Zea mays. In the present study, selective rhizospheric PGPR (Azotobacter chroococcum, Pseudomonas aeruginosa, Azospirillum brasilense and Streptomyces sp. and a combination of six strains of arbuscular mycorrhizal fungi (AMF (Acaulospora morrowae, Gigaspora margarita, Glomus constrictum, Glomus mossae, Glomus aggregatum and Scutellospora calospora were isolated and identified with standard methods and 16S rRNA sequence analysis. PGPR and AMF were checked for their growth-promoting behavior under specific treatment conditions. The 30-48-day-old treated plants in all combinations showed a significantly higher mass value. The average dry weight from the shoot was in a range from 41-52% as compared to the control. This increase also translated into a higher mass value of the roots. Overall, an 82% growth rate was observed in terms of height as the consequence of biomass production, specifically in the case of AMF + rhizobacteria combination. We report an efficient, sustainable and cost-effective biofertilizer for enhanced biomass of Z. mays, one of the staple food crops worldwide.

  5. Bacillus pumilus ES4: candidate plant growth-promoting bacterium to enhance establishment of plants in mine tailings

    Science.gov (United States)

    de-Bashan, Luz E.; Hernandez, Juan-Pablo; Bashan, Yoav; Maier, Raina

    2014-01-01

    Three plant growth-promoting bacteria (PGPB; Bacillus pumilus ES4, B. pumilus RIZO1, and Azospirillum brasilense Cd) were tested for their ability to enhance plant growth and development of the native Sonoran Desert shrub quailbush (Atriplex lentiformis) and for their effect on the native bacterial community in moderately acidic, high-metal content (AHMT) and in neutral, low metal content natural tailings (NLMT) in controlled greenhouse experiments. Inoculation of quailbush with all three PGPB significantly enhanced plant growth parameters, such as germination, root length, dry weight of shoots and roots, and root/shoot ratio in both types of tailings. The effect of inoculation on the indigenous bacterial community by the most successful PGPB Bacillus pumilus ES4 was evaluated by denaturating gradient gel electrophoresis (PCR-DGGE) fingerprinting and root colonization was followed by specific fluorescent in situ hybridization (FISH). Inoculation with this strain significantly changed the bacterial community over a period of 60 days. FISH analysis showed that the preferred site of colonization was the root tips and root elongation area. This study shows that inoculation of native perennial plants with PGPB can be used for developing technologies for phytostabilizing mine tailings. PMID:25009362

  6. Improvement of Canola (Brassica napus L.) Inoculated with Rhizobium, Azospirillum and/or Mycorrhizal Fungi Under Salinity Stress

    International Nuclear Information System (INIS)

    Bio fertilization technology was applied for improving canola plant growth and nutrient acquisition in sandy saline soil ,as a biological mean used to develop plant growth and nutrient uptake under salinity stress. Canola was cultivated in pots packed at rate of 7 kg saline sandy soil pot-1, and inoculated with Rhizobium leguminosarum biovar viceae, Azospirillum brasilense strain no. 40 and arbuscular mycorrhizal fungi either solely or in combinations of them. Nitrogen fertilizer was added in form (15NH4)2SO4 with 5%15N atom excess at rate of 0.99 g N pot-1. Maximum dry matter accumulation induced by composite inoculation (Rh + Azo + AM). Na concentrations were frequently affected by Rhizobium and /or mycorrhizae while K was affected by Azospirillum and /or mycorrhizae. Azospirillum enhanced Ca uptake whereas Mg content was responded well to composite inoculants of Rh + Azo + AM. Dual inoculation with Rh + Azo resulted in the highest values of N uptake by plant. Similar effect was noticed with P uptake when dual inoculums of Azo + AM were applied. Data of 15N isotope showed that the highest portion and value of N2-fixed was recorded with composite inoculums followed by dual inoculations. On the other hand, the infection with AM fungi gave the highest proportion of N derived from fertilizer as compared to other inoculants or uninoculated control. In the same trend, the fertilizer use efficiency (FUE%) was enhanced by AM infection. Dual inoculums of Rh + Azo induced highest content of proline in leaves. (Authors)

  7. Search for novel targets of the PII signal transduction protein in Bacteria identifies the BCCP component of acetyl-CoA carboxylase as a PII binding partner.

    Science.gov (United States)

    Rodrigues, Thiago E; Gerhardt, Edileusa C M; Oliveira, Marco A; Chubatsu, Leda S; Pedrosa, Fabio O; Souza, Emanuel M; Souza, Gustavo A; Müller-Santos, Marcelo; Huergo, Luciano F

    2014-02-01

    The PII family comprises a group of widely distributed signal transduction proteins. The archetypal function of PII is to regulate nitrogen metabolism in bacteria. As PII can sense a range of metabolic signals, it has been suggested that the number of metabolic pathways regulated by PII may be much greater than described in the literature. In order to provide experimental evidence for this hypothesis a PII protein affinity column was used to identify PII targets in Azospirillum brasilense. One of the PII partners identified was the biotin carboxyl carrier protein (BCCP), a component of the acetyl-CoA carboxylase which catalyses the committed step in fatty acid biosynthesis. As BCCP had been previously identified as a PII target in Arabidopsis thaliana we hypothesized that the PII -BCCP interaction would be conserved throughout Bacteria. In vitro experiments using purified proteins confirmed that the PII -BCCP interaction is conserved in Escherichia coli. The BCCP-PII interaction required MgATP and was dissociated by increasing 2-oxoglutarate. The interaction was modestly affected by the post-translational uridylylation status of PII ; however, it was completely dependent on the post-translational biotinylation of BCCP. PMID:24329683

  8. Nitrogen translocation in wheat inoculated with Azospirillum and fertilized with nitrogen

    Directory of Open Access Journals (Sweden)

    RODRIGUES OSMAR

    2000-01-01

    Full Text Available The productivity and the translocation of assimilates and nitrogen (N were compared after inoculation of wheat (Triticum aestivum L., cv. BR-23 seeds with two strains of Azospirillum brasilense (strains 245 and JA 04 under field conditions. The inoculation of wheat seeds was done with a peat inoculant at sowing time. Plant material for evaluations were collected at anthesis and maturity. No differences in grain yield and in the translocation of assimilates resulting from inoculation were detected. Differences were observed in relation to N rates (0, 15, and 60 kg ha-1. N content in the grain increased significantly in the bacteria-inoculated treatments in which N was not added. This increase in N content in the grain with inoculation was probably due to higher N uptake after anthesis without any significant contribution on the grain yield. Such increment was of 8.4 kg ha-1 of N representing 66% more N than in no inoculated treatment. Regardless of the inoculation and the rate of N applied, it was observed that about 70% of the N accumulated at anthesis was translocated from vegetative parts to the grain.

  9. Structure of insoluble immune complexes as studied by spectroturbidimetry and dynamic light scattering

    Science.gov (United States)

    Khlebtsov, Boris N.; Burygin, Gennadii L.; Matora, Larisa Y.; Shchyogolev, Sergei Y.; Khlebtsov, Nikolai G.

    2004-07-01

    We describe two variants of a method for determining the average composition of insoluble immune complex particles (IICP). The first variant is based on measuring the specific turbidity (the turbidity per unit mass concentration of the dispersed substance) and the average size of IICP determined from dynamic light scattering (DLS). In the second variant, the wavelength exponent (i.e., the slope of the logarithmic turbidity spectrum) is used in combination with specific turbidity measurements. Both variants allow the average biopolymer volume fraction to be determined in terms of the average refractive index of IICP. The method is exemplified by two experimental antigen+antibody systems: (i) lipopolysaccharide-protein complex (LPPC) of Azospirillum brasilense Sp245+rabbit anti-LPPC; and (ii) human IgG (hIgG)+sheep anti-hIgG. Our measurements by the two methods for both types of systems gave, on the average, the same result: the volume fraction of the IICP biopolymers is about 30%; accordingly, the volume fraction of buffer solvent is 70%.

  10. Plant yield and nitrogen content of a digitgrass in response to azospirillum inoculation

    Energy Technology Data Exchange (ETDEWEB)

    Schank, S.C.; Weier, K.L.; MacRae, I.C.

    1981-02-01

    Two Australian soils, a vertisol (pH 6.8, 0.299% N) and a sandy yellow podzol (pH 6.2, 0.042% N), were used with digitgrass, Digitaria sp. X46-2 (PI 421785), in a growth room experiment. Comparisons were made between plants inoculated with live and autoclaved bacterial suspensions of Australian and Brazilian isolates of Azospirillum brasilense. Seedlings were inoculated on days 10 and 35. Acetylene-reducing activity was measured five times during the experiment. Dry matter yields of the digitgrass on the podzol (low N) inoculated with liver bacteria were 23% higher than those of the controls. On the vertisol (high N), yield increases from inoculation with live bacteria were 8.5%. The higher-yielding plants had significantly lower precent nitrogen, but when total nitrogen of the tops was calculated, the inoculated plants had a higher total N than did the controls (P = 0.04). Acetylene-reducing activity was variable in the experiment, ranging from 0.5 to 11.9 mu mol of C2H2 core -1 day -1. Live bacterial treatment induced a proliferation of roots, possible earlier maturity, higher percent dry matter, and a higher total N in the tops. (Refs. 21).

  11. bio fertilization of soybean in sandy soils of egypt using N-15 tracer technique

    International Nuclear Information System (INIS)

    The effect of inoculation of soybeans with B. Japonicum and A. brasilense either solely or in mixture, and N fertilizer levels had been studied in pot experiment Nodulation of soybean grown in sandy soil was enhanced by inoculation. The highest values of nodules number and fresh weight were recorded at rate of 20 Kg N ha-1, and decreased with increasing N rate up to 40 kg N ha-1. In contrast, the dry weight of the above ground parts, as well as the N uptake was increased with increasing N fertilizer level. Similar effect was observed for inoculation as compared with the un inoculated treatment. Despite the nodulating and nonnodulating soybeans has almost the same dry weight, the nodulating isoline accumulated more N than the non-nodulating. Percentages of nitrogen derived from air (%Ndfa) was depressed with increasing N rates from 10 to 40 kg N ha-1 either estimated by isotope dilution (I D) or N difference method (D M). Dual inoculation resulted in high percent of N 2-fixed (42.5%) at rate of 10 kg N ha-1. Correlation between I D and D M methods was found to be dependent on inoculation treatments. However, nitrogen utilized by nodulating soybean (FUE%) was enhanced as a function of inoculation with B. Japonicum. 2 figs., 3 tabs

  12. L-arabonate and D-galactonate production by expressing a versatile sugar dehydrogenase in metabolically engineered Escherichia coli.

    Science.gov (United States)

    Liu, Huaiwei; Valdehuesa, Kris Niño G; Ramos, Kristine Rose M; Nisola, Grace M; Lee, Won-Keun; Chung, Wook-Jin

    2014-05-01

    The production of L-arabonate and D-galactonate employing a versatile l-arabinose dehydrogenase (AraDH) from Azospirillum brasilense is presented. The promiscuity of AraDH is manifested by its appreciable activity towards L-arabinose and D-galactose as substrates, and NAD(+) and NADP(+) as cofactors. The AraDH was introduced into an engineered Escherichia coli with inactive L-arabinose or D-galactose metabolism, resulting in strains EMA2 and EWG4, respectively. EMA2 produced 43.9 g L(-1)L-arabonate with a productivity of 1.22 g L(-1)h(-1) and 99.1% (mol/mol) yield. After methanol precipitation, 92.6% of L-arabonate potassium salt was recovered with a purity of 88.8%. Meanwhile, EWG4 produced 24.0 g L(-1)D-galactonate, which is 36% higher than that of the strain carrying the specific d-galactose dehydrogenase. Overall results reveal that the versatility of AraDH to efficiently catalyze the formation of L-arabonate and D-galactonate could be a useful tool in advancing industrial viability for sugar acids production. PMID:24713235

  13. Theory of sampling and its application in tissue based diagnosis

    Directory of Open Access Journals (Sweden)

    Kayser Gian

    2009-02-01

    Full Text Available Abstract Background A general theory of sampling and its application in tissue based diagnosis is presented. Sampling is defined as extraction of information from certain limited spaces and its transformation into a statement or measure that is valid for the entire (reference space. The procedure should be reproducible in time and space, i.e. give the same results when applied under similar circumstances. Sampling includes two different aspects, the procedure of sample selection and the efficiency of its performance. The practical performance of sample selection focuses on search for localization of specific compartments within the basic space, and search for presence of specific compartments. Methods When a sampling procedure is applied in diagnostic processes two different procedures can be distinguished: I the evaluation of a diagnostic significance of a certain object, which is the probability that the object can be grouped into a certain diagnosis, and II the probability to detect these basic units. Sampling can be performed without or with external knowledge, such as size of searched objects, neighbourhood conditions, spatial distribution of objects, etc. If the sample size is much larger than the object size, the application of a translation invariant transformation results in Kriege's formula, which is widely used in search for ores. Usually, sampling is performed in a series of area (space selections of identical size. The size can be defined in relation to the reference space or according to interspatial relationship. The first method is called random sampling, the second stratified sampling. Results Random sampling does not require knowledge about the reference space, and is used to estimate the number and size of objects. Estimated features include area (volume fraction, numerical, boundary and surface densities. Stratified sampling requires the knowledge of objects (and their features and evaluates spatial features in relation to

  14. Power-Sharing, Conflict and Transition in Burundi: Twenty Years of Trial and Error Machtteilung, Konflikt und Wandel in Burundi: Zwanzig Jahre Versuch und Irrtum

    Directory of Open Access Journals (Sweden)

    Stef Vandeginste

    2009-01-01

    Full Text Available For the past twenty years, Burundi has experimented with powersharing as an instrument of political liberalisation, democratisation and conflict resolution. This contribution analyses the different meanings the concept of power-sharing has had throughout Burundi’s recent and extremely violent political transition, in particular during the lengthy peace process. It shows how national and international actors have found inspiration in the toolbox of consociationalism to negotiate and design the Arusha Peace and Reconciliation Agreement for Burundi signed in August 2000 and its posttransition Constitution. Power-sharing has been instrumental in achieving the – short-term – objective of war termination. It has also de-ethnicised political competition and reduced the (potentially destabilising effect of elections. Measured against more ambitious state-building objectives (democracy, rule of law, accountable and effective governance, power-sharing has (so far not been able to make a difference. Several factors and developments threaten the “survival” of the power-sharing model in Burundi. In Burundi wird seit zwanzig Jahren mit Power-Sharing als Instrument politischer Liberalisierung, Demokratisierung und Konfliktlösung experimentiert. Der vorliegende Beitrag analysiert, welche unterschiedlichen Bedeutungen das Konzept der Machtteilung in der jüngsten und extrem gewalttätigen Entwicklungsphase Burundis angenommen hat, insbesondere während des langwierigen Friedensprozesses. Er zeigt auf, inwieweit nationale und internationale Akteure sich bei der Aushandlung und Planung des Arusha-Abkommens zu Frieden und Versöhnung in Burundi, das im August 2000 unterzeichnet wurde, sowie der anschließenden Verfassung am Instrumentarium der Konkordanzdemokratie bedient haben. Power-Sharing erwies sich als nützlich, das kurzfristige Ziel einer Beendigung des Krieges zu erreichen, und trug zur De-Ethnisierung des politischen Wettbewerbs und zur

  15. Roman Policies towards Antiochus III and the Greeks from Winter 197/196 B.C. to Autumn 196 B.C.

    Directory of Open Access Journals (Sweden)

    Deutschmann, Eike Hellmut

    2012-01-01

    Full Text Available In the Second Macedonian War (200-196 B.C., the res publica reduced the strength of the enemy King Philip V apparently to establish a new political order in Southern Balkans: Assumedly a pro-Roman balance of forces should prevail there, untainted by influence of another major power. A particular senatorial policy towards the Greeks probably did not exist before the fighting in Hellas came to an end in summer 197 B.C. In the same year, the Seleucid king Antiochus III brought large parts of the west coast of Asia Minor under control and set about crossing the Hellespont. Rome subsequently stylized itself as the guardian of freedom for the Greeks living in Hellas and Asia Minor. The statesmen of the res publica could have perceived Antiochus’ expansion as a threat to the mentioned new order. Therefore, the Roman Policy of Freedom was possibly applied primarily to take action against the Seleucid king. Die res publica verminderte im Zweiten Makedonischen Krieg (200-196 a.c. die Macht des gegnerischen Königs Philipp V - anscheinend um eine neue politische Ordnung im südlichen Balkanraum zu etablieren: Vermutlich sollte dort ein romfreundliches Kräftegleichgewicht vorherrschen, auf das keine andere Großmacht Einfluß hat. Eine speziell an die Griechen gerichtete Politik seitens des römischen Senats gab es wahrscheinlich nicht vor Ende der Kampfhandlungen in Hellas im Sommer 197 a.c. In dem Jahr erweiterte der seleukidische König Antiochos III. seinen Einflussbereich auf große Teile der kleinasiatischen Westküste und schickte sich an, den Hellespont zu überqueren. Rom stilisierte sich in der Folgezeit zum Freiheitsgarant der in Hellas und Kleinasien lebenden Griechen. Antiochos Expansion könnte von den Staatsmännern der res publica als Bedrohung der genannten neuen Ordnung angesehen worden sein. Demzufolge wurde die römische Freiheitspolitik möglicherweise in erster Linie angewendet, um gegen den seleukidischen König vorzugehen.

  16. THE TRANSFORMATION OF WAR

    Directory of Open Access Journals (Sweden)

    L.S. Mnyandu

    2012-02-01

    Full Text Available "A ghost is stalking the corridors of general staffs and defence departments all over the 'developed' world - the fear of military impotence, even irrelevance. ...As new forms of armed conflict multiply and spread, they will cause the lines between public and private, government and people, military and civilian to become as blurred as they were before 1648. ...One very important way in which men can attain joy, freedom, happiness is (through war." (Van Creveld, 1991: 1,226,227 These are the words that open and conclude this book whose stated objective is to provide a non-Clausewitzian perspective to 'modern' warfare (p ix. In the first two chapters, Van Creveld perceptively addresses the bankruptcy of nuclear weapons and strategy, the declining utility of conventional armed forces and the resurgence of low intensity conflict as well as the resounding political outcomes accrued through such conflicts. Acknowledging Karl von Clausewitz as an outstanding military theoretician, Van Creveld not only delineates the historical context in which Clausewitz's writings were most relevant, but goes on to evoke the works of Colmar von der Goltz (Das Volk in Waffen, 1883 and Erich Ludendorf (Der Totale Krieg, 1936 in order to clearly distinguish the concept of a trinitarian war in comparison to those of a total war and nontrinitarian war (p 35, 42, 45, 49. "Involving the surgical separation of the state, society and the military, the trinitarian war is compatible with the Clausewitzian prescription and primary notion of war as a continuation of politics" (p 63. While total war appears to be an extreme and perverted form of trinitarian war - it plays a vital role in as far as it nearly obliterated society, facilitated the rise of totalitarian governments and even precipitated the Second World War. This openened the flood gates for the resurgence of nontrinitarian conflict in which individuals and individual societies (not established armies acting on behalf

  17. Especificidade de anti-soro policlonal à Leifsonia xyli subsp. xyli Policlonal antiserum specifity against Leifsonia xyli subsp. xyli

    Directory of Open Access Journals (Sweden)

    Josil B. Carneiro Jr

    2004-12-01

    Full Text Available Detectar a presença da bactéria Leifsonia xyli subsp. xyli em material de propagação da cana-de-açúcar (Saccharum sp. é importante para direcionar o controle do raquitismo-da-soqueira. Neste trabalho, objetivou-se produzir anticorpo policlonal específico contra Leifsonia xyli subsp. xyli (Lxx, visando utilizá-lo em método sorológico para detecção do patógeno. Para isso, o antígeno foi preparado a partir de células intactas, após lavagem por centrifugação de cultura-pura em tampão fosfato salino 0,01 M (PBS e diálise em glutaraldeido 2% em PBS. O plano de imunização em coelho consistiu de duas injeções intramusculares da mistura 1:1 do antígeno com adjuvante Freund (completo e incompleto, a intervalos de 21 dias e duas injeções subcutâneas do antígeno puro, a intervalos de dez dias. O anti-soro foi testado pelo método de Dot Blot com revelação por peroxidase para se determinar: (i título do anticorpo e (ii reação contra Lxx, Xanthomonas axonopodis pv. vesicatoria e bactérias endofíticas de cana-de-açúcar (Azospirillum brasilense, A. lipoferum, Herbaspirillum rubrisubalbicans, H. seropedicae e Gluconacetobacter diazotrophicus. A maior diluição analisada do anti-soro 1:20.000 mostrou reação fortemente positiva e específica contra Lxx e ausência de reação contra as demais bactérias. A purificação da fração IgG (Imunoglobulina G não resultou em melhoria na reatividade e especificidade do anti-soro. Estimou-se o nível de detecção do método a partir de suspensão bacteriana em 2x10(6 células/ml.To detect the presence of the bacterium Leifsonia xyli subsp. xyli (Lxx in propagation material is important for the control of the ratoon stunting disease. The objective of this work was to improve a serological method for detection of the pathogen and to evaluate the policlonal antiserum specificity produced against Lxx. The antigen was prepared by resuspending pure culture in PBS and dialyzing it in

  18. CARACTERIZACIÓN DE BACTERIAS DIAZOTRÓFICAS ASIMBIÓTICAS ASOCIADAS AL EUCALIPTO (Eucalyptussp. EN CODAZZI, CESAR (COLOMBIA Characterization of Diazotrophic Bacteria Non-Symbiotic Associated with Eucalyptus (Eucalyptussp. in Codazzi, Cesar (Colombia

    Directory of Open Access Journals (Sweden)

    DOLLY MELISSA OBANDO CASTELLANOS

    Full Text Available Se evaluó el efecto de las épocas climáticas (lluvia y sequía y del estrato de la muestra (suelo rizosférico, raíces y hojas sobre la población de los géneros Azotobacter, Beijerinckia, Derxia, Azospirillum, Herbaspirillum, Gluconacetobacter y Burkholderia en el Eucalipto (Eucalyptus sp.. Así mismo, se evalúo su capacidad en la producción de compuestos indólicos como promotores del crecimiento vegetal y su actividad de reducción de acetileno como indicador de la fijación biológica de nitrógeno. Los resultados no registraron diferencias estadísticas significativas en el test de Tukey (P ≤ 0.05 en la población con respecto a la época climática. Con respecto al estrato de muestra, los aislamientos tentativos de Herbaspirillum sp. y Azospirillum sp. presentaron diferencias significativas en suelo rizosférico y raíces. Se obtuvieron 44 aislamientos de los cuales se agruparon por caracterización fenotípica como: 14 presuntivos de Beijerinckia sp., 12 de Azotobacter sp., ocho de Derxia sp., cuatro de Herbarpirillum sp., cinco de Azospirillum sp., uno de Gluconacetobacter sp. y uno de Burkholderia sp. Por su alto potencial fueron seleccionados y criopreservados los aislamientos C27, C26 y C25, las cuales presentaron los mejores valores de eficiencia in vitro, superando valores de producción de las cepas de referencia utilizadas (A. chroococcum (AC1 y A. brasilense (SP7.The effect of climatic seasons (rainy and dry and the stratum sample (rhizospheric soil, roots and leaves the population of the genera Azotobacter, Beijerinckia, Derxia, Azospirillum, Herbaspirillum, Gluconacetobacter and Burkholderia in soil rhizosphere, roots and leaves of Eucalyptus (Eucalyptus sp.. It also assesses their ability to produce indoles compounds as plant growth promoters and their acetylene reduction activity as an indicator of biological fixation of nitrogen. The results showed no statistically significant differences in the Duncan test (P ≤ 0

  19. Evaluation of the association nitrogen fixing bacterias interspecific – rice lines – nitrogen, in typic haplustalf. Ibagué, Colombia Evaluación de la asociación bacterias fijadoras de nitrógeno – líneas interespecíficas de arroz–nitrógeno, en Typic haplustalf. Ibagué, Colombia

    Directory of Open Access Journals (Sweden)

    Bonilla Correa Carmen Rosa

    2008-03-01

    Full Text Available The study was carried out at the Cauchitos farm, Ibague municipality department of Tolima, with bounds: North 4°23'51"; and west 75°9'7";, 979 ansm, the average temperature is 24,3°C, tropical dry forest (bs–t in the Holdridge classification. The purpose of this study was to evaluate the association between the nitrogen fixation bacteries with and without inoculo in 10 interespecific rice lines with three nitrogen dosis (0, 50 and 100% de 250 kg/ ha–1 and three repetitions. The inoculation was realized with 108 former units of colonies per millimeter. 2.260 bacteries of the generums Azotobacter spp y Azospirrillum spp., and identification the species: Azospirillum brasilense, Azospirillum lipoferum, Azospirillum amazonense, were identified and from the genus Azotobacter were identified the species: A. choroococcum, A. vinelandii, A. paspali and A. veijerinckii. Weren't found none significative differences after the inoculation. Azotobacter spp and Azospirillum spp. were typical generums of the bacterian flora in the rice plantation and in field conditions were effect of the treatment effects in the bacterian . The Azotobacter spp was the predominant in generum in each one of the treatments.El estudio se llevó a cabo en la hacienda Cauchitos, municipio de Ibagué, departamento del Tolima (Norte 4° 23' 51"; y Oeste 75° 9' 7";, 979 msnm, 24.3°C, bosque seco tropical (bs–T, con el objetivo de evaluar las asociaciones entre bacterias fijadoras de nitrógeno con inóculo y sin él en diez líneas interespecíficas de arroz, con tres dosis de nitrógeno (0%, 50% y 100% de 250 kg/ha–1 y tres repeticiones por tratamiento. La inoculación se

  20. CO-INOCULAÇÃO NO DESENVOLVIMENTO VEGETATIVO E NODULAÇÃO DE PLÂNTULAS DE SOJA SUBMETIDAS À CALAGEM, FERTILIZAÇÃO NITROGENADA E APLICAÇÃO DE MICRONUTRIENTES

    Directory of Open Access Journals (Sweden)

    LIBÓRIO, Paloma Helena da Silva

    2015-11-01

    Full Text Available In order to evaluate the co-inoculation of soybeans, or mixed inoculation with bacteria of the genus Bradyrhizobium and Azospirillum brasilense, at the expense of traditional inoculation with Bradyrhizobium, two experiments were installed in october 2014, in a greenhouse. The experimental design was completely randomized with eight treatments and eight replications in pots rotation system. Treatments involving different combinations as commercial fertilizer formulations, with or without inoculant application (s and micronutrients cobalt and molybdenum (Co-Mo in the seeds, being: 0-20-20; 4-20-20; 0-20-20 + inoculant (s; 4-20-20 + inoculant (s; 0-20-20 + inoculant (s + Co-Mo; 4-20-20 + inoculant (s + Co-Mo; 0-20-20 + Co-Mo and 4-20-20 + Co-Mo. Evaluations constituted the% of normal seedlings, number and dry weight of nodules / plant, dry weight of shoot and root / plant. In liming performed with only 30 days before sowing, limestone has not had sufficient time to react with soil, which showed deficiency in calcium, in addition to aluminum and manganese toxicity, reducing the % normal seedlings in the pots, which batch seed was already low in certain physiological quality of germination and emergence tests. Nevertheless, the practice of co-inoculation combined with the formulation (0-20-20 and without Co-Mo in the seeds stood out in relation to the evaluated parameters. Com o objetivo de avaliar a co-inoculação de soja, ou seja, inoculação mista com bactérias do gênero Bradyrhizobium e Azospirillum brasilense, em detrimento da inoculação tradicional com Bradyrhizobium foram instalados dois experimentos em outubro de 2014, em casa de vegetação. O delineamento experimental utilizado foi o inteiramente casualizado com oito tratamentos e oito repetições sob rodízio diário dos vasos. Os tratamentos envolveram diferentes combinações quanto a formulações comerciais de adubo, com ou sem aplicação de inoculante (s e micronutrientes

  1. Realocação de nitrogênio e de biomassa para os grãos, em trigo submetido a inoculação de Azospirillum Reallocation of nitrogen and biomass to the seeds in wheat inoculated with Azospirillum bacteria

    Directory of Open Access Journals (Sweden)

    AGOSTINHO DIRCEU DIDONET

    2000-02-01

    Full Text Available Estudou-se, em condições de campo, o efeito de inoculante turfoso em pó contendo bactérias do gênero Azospirillum no rendimento de grãos e na remobilização de N e de biomassa para os grãos de trigo (Triticum aestivum L., cultivar Embrapa 16. Usaram-se como inoculantes, a estirpe de Azospirillum brasilense 245 e o isolado 10 de Azospirillum lipoferum. Em cada tratamento de inoculação, e também sem inoculação, aplicaram-se diferentes doses de N em diferentes estádios de desenvolvimento das plantas, distribuídos em blocos ao acaso com parcelas subdivididas. Na antese e na maturação fisiológica, avaliaram-se o acúmulo de massa seca e N total nas diferentes partes da planta. Na colheita, além do rendimento de grãos, avaliaram-se também o índice de colheita para biomassa e para N, os principais componentes do rendimento e o teor de N total de grãos. Os resultados ainda preliminares evidenciaram que, mesmo não havendo efeito da inoculação no rendimento de grãos, houve um melhor alocamento de N e de biomassa para os grãos, resultando em maior massa de mil grãos e em menor quantidade de N restante na palha das plantas na maturação fisiológica. Esses efeitos resultaram de um menor número de espigas m-2, provavelmente devido à morte de afilhos, fator que determinou maior disponibilidade de N e de biomassa às espigas e grãos restantes.The effect of inoculating wheat (Triticum aestivum L. seeds, cultivar Embrapa 16, with powder peat inoculant containing Azospirillum bacteria on yield and remobilization of nitrogen and biomass was studied under field conditions. The strain of Azospirillum brasilense 245 and the isolate 10 of Azospirillum lipoferum were used as inoculants. Different rates of nitrogen were applied at varying stages of plant growth for each inoculated and non-inoculated treatment, distributed in blocks at random with split plots. The accumulation of dry matter and total nitrogen in plant parts was evaluated

  2. History on the biological nitrogen fixation research in graminaceous plants: special emphasis on the Brazilian experience

    Directory of Open Access Journals (Sweden)

    José I. Baldani

    2005-09-01

    Full Text Available This review covers the history on Biological Nitrogen Fixation (BNF in Graminaceous plants grown in Brazil, and describes research progress made over the last 40 years, most of whichwas coordinated by Johanna Döbereiner. One notable accomplishment during this period was the discovery of several nitrogen-fixing bacteria such as the rhizospheric (Beijerinckia fluminensis and Azotobacter paspali, associative (Azospirillum lipoferum, A. brasilense, A. amazonense and the endophytic (Herbaspirillum seropedicae, H. rubrisubalbicans, Gluconacetobacter diazotrophicus, Burkholderia brasilensis and B. tropica. The role of these diazotrophs in association with grasses, mainly with cereal plants, has been studied and a lot of progress has been achieved in the ecological, physiological, biochemical, and genetic aspects. The mechanisms of colonization and infection of the plant tissues are better understood, and the BNF contribution to the soil/plant system has been determined. Inoculation studies with diazotrophs showed that endophytic bacteria have a much higher BNF contribution potential than associative diazotrophs. In addition, it was found that the plant genotype influences the plant/bacteria association. Recent data suggest that more studies should be conducted on the endophytic association to strengthen the BNF potential. The ongoing genome sequencing programs: RIOGENE (Gluconacetobacter diazotrophicus and GENOPAR (Herbaspirillum seropedicae reflect the commitment to the BNF study in Brazil and should allow the country to continue in the forefront of research related to the BNF process in Graminaceous plants.A presente revisão aborda a história da Fixação Biológica de Nitrogênio (FBN em Gramíneas no Brasil, procurando mostrar a evolução da pesquisa na área iniciada a mais de 40 anos sob a liderança da pesquisadora Johanna Döbereiner. Um aspecto marcante deste período foi a descoberta de diversas bactérias fixadoras de nitrogênio atmosf

  3. Ocorrência de bactérias diazotróficas em diferentes genótipos de cana-de-açúcar Occurrence of diazotrophic bacteria in different sugar cane genotypes

    Directory of Open Access Journals (Sweden)

    FÁBIO BUENO DOS REIS JUNIOR

    2000-05-01

    Full Text Available O objetivo deste trabalho foi avaliar a localização e o número de bactérias endofíticas em quatro genótipos de cana-de-açúcar e investigar sobre a possível existência de correlação com os resultados apresentados em trabalhos de quantificação da fixação biológica de nitrogênio (FBN. Fez-se um levantamento das bactérias diazotróficas presentes, e quantificou-se a população de Herbaspirillum spp. e Acetobacter diazotrophicus, em genótipos de cana-de-açúcar contrastantes quanto à capacidade de obter N da FBN. De acordo com o levantamento realizado neste trabalho, as bactérias estudadas (Azospirillum lipoferum, A. brasilense, A. amazonense, Herbaspirillum spp. e Acetobacter diazotrophicus estavam presentes nos quatro genótipos avaliados e em todas as partes da planta, exceto A. amazonense, que não foi isolado de amostras de folhas. A quantificação das bactérias Herbaspirillum spp. e A. diazotrophicus mostrou não haver diferenças significativas entre os genótipos, e que, geralmente, elas estão presentes em maior número nas raízes. Enquanto Herbaspirillum spp. mantém-se mais estável ao longo do ciclo da cultura, a população de A. diazotrophicus decresce com a aproximação do final do ciclo comercial. Pode-se sugerir que as diferenças entre as taxas de FBN encontradas nos diversos genótipos não é causada por diferenças na presença ou no número das bactérias aqui estudadas.The objective of this work was to find out the localization and number of endophytic bacteria in four sugar cane genotypes and investigate upon the possible existence of correlation to the results obtained in some studies about quantification of biological nitrogen fixation (BNF. A survey of the diazotrophic bacteria present in sugar cane genotypes differing in their capacity to obtain nitrogen through BNF was performed, and population of Herbaspirillum spp. and Acetobacter diazotrophicus was quantified. The bacteria tested in the

  4. Influencia de lo abono nitrogenado en la calidad de ensilaje de maíz Influência da adubação nitrogenada sobre a qualidade da silagem de milho

    Directory of Open Access Journals (Sweden)

    Simone Basi

    2012-06-01

    Full Text Available

    La calidad final de ensilaje de maíz está directamente relacionada con el estado nutricional de las plantas. De los nutrientes requeridos por el cultivo, el nitrógeno (N es considerado el más importante. Esta revisión tiene como objetivo discutir temas relacionados con la dinámica de este nutriente en la planta de maíz, con énfasis en su influencia en los diversos eventos fisiológicos en los que participa. La producción de materia seca depende de la fuente y forma de suministro de este elemento a la planta. El uso de Azospirillum brasilense ha tenido prominencia a través de la fijación biológica de nitrógeno mediante la reducción de los costes de producción para la economía en el uso de N mineral, así como con el incremento de producción debido al uso más regular de lo nutriente en relación con los fertilizantes minerales, asegurando así una mayor productividad y calidad del material. Con un entendimiento de las funciones de este importante nutriente a la planta, el suministro alternativo y técnicas de gestión puede obtener un mayor valor nutritivo del ensilaje, debido al aumento de la concentración de proteína en la planta. Además con el aumento de la producción de materia seca por unidad de área, aumento de la producción de grano, mayor valor energético, influye en la concentración de fibras del material ensilado y posiblemente en el rendimiento de los animales.

    A qualidade final da silagem de milho está diretamente relacionada ao estado nutricional das plantas. Dos nutrientes exigidos pela cultura, o nitrogênio (N é considerado o de maior importância. A presente revisão tem como objetivo discutir aspectos relacionados à dinâmica deste nutriente na planta de milho, dando ênfase em sua influência nos diversos eventos fisiológicos dos quais participa. A produção de matéria seca depende da fonte e da forma de fornecimento deste elemento à planta. O uso

  5. Biological deterioration of alginate beads containing immobilized microalgae and bacteria during tertiary wastewater treatment.

    Science.gov (United States)

    Cruz, Ivonne; Bashan, Yoav; Hernàndez-Carmona, Gustavo; de-Bashan, Luz E

    2013-11-01

    Secondary treatment of municipal wastewater affects the mechanical stability of polymer Ca-alginate beads containing the microalgae Chlorella vulgaris that are jointly immobilized with Azospirillum brasilense as treating agents whose presence do not affect bead stability. Nine strains of potential alginate-degrading bacteria were isolated from wastewater and identified, based on their nearly complete 16S rDNA sequence. Still, their population was relatively low. Attempts to enhance the strength of the beads, using different concentrations of alginate and CaCl2 or addition of either of three polymers (polyvinylpyrrolidone, polyvinyl alcohol, carboxymethylcellulose), CaCO3, or SrCl2, failed. Beads lost their mechanical strength after 24 h of incubation but not the integrity of their shape for at least 96 h, a fact that sustained successful tertiary wastewater treatment for 48 h. In small bioreactors, removal of phosphorus was low under sterile conditions but high in unsterile wastewater. Alginate beads did not absorb PO4 (-3) in sterile wastewater, but in natural wastewater, they contained PO4 (-3). Consequently, PO4 (-3) content declined in the wastewater. A supplement of 10 % beads (w/v) was significantly more efficient in removing nutrients than 4 %, especially in a jointly immobilized treatment where >90 % of PO4 (-3) and >50 % ammonium were removed. Tertiary wastewater treatment in 25-L triangular, airlift, autotrophic bioreactors showed, as in small bioreactors, very similar nutrient removal patterns, decline in bead strength phenomena, and increase in total bacteria during the wastewater treatment only in the presence of the immobilized treatment agents. This study demonstrates that partial biological degradation of alginate beads occurred during tertiary wastewater treatment, but the beads survive long enough to permit efficient nutrient removal. PMID:23354446

  6. CARACTERIZACIÓN DE BACTERIAS DIAZOTRÓFICAS ASIMBIÓTICAS ASOCIADAS AL EUCALIPTO (Eucalyptus sp. EN CODAZZI, CESAR.

    Directory of Open Access Journals (Sweden)

    Divan Baldani Vera Lúcia

    2010-12-01

    Full Text Available Se evaluó el efecto de las épocas climáticas (lluvia y sequía y del estrato de la muestra (Suelo rizosférico, raíces y hojas sobre la población de los géneros Azotobacter, Beijerinckia, Derxia, Azospirillum, Herbaspirillum, Gluconacetobacter y Burkholderia en el Eucalipto (Eucalyptus sp.. Así mismo, se evalúo su capacidad en la producción de compuestos indólicos como promotores del crecimiento vegetal y su actividad de reducción de acetileno como indicador de la fijación biológica de nitrógeno. Los resultados no registraron diferencias estadísticas significativas en el test de Tukey (P ≤ 0.05 en la población con respecto a la época climática. Con respecto al estrato de muestra, los aislamientos tentativos a Herbaspirillum sp. y Azospirillum sp. presentaron diferencias significativas en suelo rizosférico y raíces. Se obtuvieron 44 aislamientos de los cuales se agruparon por caracterización fenotípica como: 14 presuntivos del género Beijerinckia sp., 12 de Azotobacter sp., 8 de Derxia sp., 4 de Herbarpirillum sp., 5 de Azospirillum sp., 1 de Gluconacetobacter sp. y 1 de Burkholderia sp. Por su alto potencial fueron seleccionados y criopreservados los aislamientos C27, C26, C25 y C45, las cuales presentaron los mejores valores de eficiencia in vitro, superando valores de producción de las cepas de referencia utilizadas (A. chroococcum (AC-01 y A. brasilense (SP7.

  7. Manejo agronómico integral de sustratos, métodos de siembra y biofertilización en la producción sostenible de tubérculos-semilla de papa por semilla sexual

    Directory of Open Access Journals (Sweden)

    A. Hernández

    2001-01-01

    Full Text Available Con el objetivo de producir tubérculos-semilla de papa a partir de semilla sexual (SSP de forma ecológica y sostenible, se llevaron a cabo entre los años 1994-1998 tres experimentos en el Instituto Nacional de Ciencias Agrícolas (INCA, en el municipio de San José de las Lajas, La Habana, sobre un suelo Ferrálitico Rojo compactado, donde se estudiaron dos métodos de siembra (directa y transplante, el uso de dos fuentes de materia orgánica; dosis de aplicación de la materia orgánica en la composición del sustrato y la combinación de losmejores resultados de estos experimentos, con la inoculación de las semillas con biofertilizantes (bacterias nitrofijadoras, fosfosolubilizadoras y hongos micorrizógenos, utilizando pulso de nitrógeno a razón de 60 kg de N. ha-1, combinando todos estos en un experimento. Las bacterias empleadas fueron Azospirillum brasilense, Pseudomonas cepacia, Pseudomonas fluorescens y la micorriza empleada fue Glomus fasciculatum.Los resultados finales arrojaron que las plantas donde se había utilizado la coinoculación micorriza + Pseudomonascepacia, tuvieron una mayor producción de tubérculos semilla así como el tratamiento inoculado con Pseudomonas fluorescens, siendo los resultados superiores a los del testigo con fertilización química, consiguiéndose con ello una tecnologíade producción más económica y ecológica en este cultivo.

  8. COMO FAZER UMA AGRICULTURA VERDE USANDO O MAIS ANTIGO PROCESSO DE OBTENÇÃO DE NITROGÊNIO EM PLANTAS

    Directory of Open Access Journals (Sweden)

    Veronica Massena Reis

    2013-06-01

    Full Text Available Around 78% of the air is composed by nitrogen and this element is the third most important to the maintenance of life on the planet, after the carbon (C and oxygen (O. The greatparadox is life in earth it that this gas (N2 is inert and can only be reduced to a form assimilated by plants by different genus of bacteria called diazotrophs. These bacteria interact with other organisms including agricultural crops as the most famous one, the rhizobia of soybean. Another example recently incorporated to the cereal production routine is the application of another bacterium called Azospirillum brasilense described by the research group of Johanna Döberenier in the 80’s. The association of diazotrophs and grasses has been studied for about 60 years and revealed that in addition to providing nitrogen to the crops (contributing with up to 58% of its necessity, can also produce phyto-hormones, act as a biocontrol agents, solubilize phosphates and some other features; helping plants in the response of environmental stresses and refl ecting in crop productivity using reduced doses of N-fertilizer. With the objective of develop a cropmanagement based on biological nitrogen fi xation and a recommendation of inoculant application in order to improve the utilization of N-fertilizers, also preconized by the green revolution, made this research recognized worldwide for its innovation that advocates the use of a conservative practice, keeping the man in the fi eld, producing more without harming the environment.

  9. utilization of bio fertilizers and organic sources in arable soils under saline conditions using tracer technique

    International Nuclear Information System (INIS)

    Recently, more attention has been paid to conserve and save surrounding environment via minimizing the excessive use of chemical fertilizers and, in general, the agrochemicals applied in heavy quantities in agricultural agroecosystems. Therefore, the attention of most of agronomists was turned towards the use of so called clean agriculture or organic farming. Many of organic systems was pointed out such as the recycling of farm wastes i.e. crop residues, animal manure, organic conditioners for reclamation of soil and in the same time enhancement of plant growth and improving yield quality. The application of organic wastes combined with or without microbial inoculants to plant media are considered as a good management practice in any agricultural production system because it improves, plant quality and soil fertility. Therefore, we have the opportunity to conduct some experiments for achieving the clean agriculture approach, combating the adverse effects of salinity and avoiding the environmental pollution. Series of laboratory and greenhouse experiments were carried out to evaluate the impact of (1) potent isolated fungi (Aspergillus oryzae and Aspergillus terreus) on degrading plant residues (Leucaena and Acacia green parts), and (2) biofertilizers (Sinorhizobium meliloti, Azospirillum brasilense, and Pseudomonas aeruginosa) in assessing barley and spinach plants to combat salinity of soil and irrigation water.15N-tracer technique that considered unique and more reliable technique may benefits in clarifying the responsible mechanisms related to plant growth and gave us the opportunity to quantify the exact amounts of N derived from the different sources of nitrogen available to spinach and barley plants grown on sandy saline soil and irrigated with saline water.

  10. Use of Phosphate Solubilizing Bacteria to Leach Rare Earth Elements from Monazite-Bearing Ore

    Directory of Open Access Journals (Sweden)

    Doyun Shin

    2015-04-01

    Full Text Available In the present study, the feasibility to use phosphate solubilizing bacteria (PSB to develop a biological leaching process of rare earth elements (REE from monazite-bearing ore was determined. To predict the REE leaching capacity of bacteria, the phosphate solubilizing abilities of 10 species of PSB were determined by halo zone formation on Reyes minimal agar media supplemented with bromo cresol green together with a phosphate solubilization test in Reyes minimal liquid media as the screening studies. Calcium phosphate was used as a model mineral phosphate. Among the test PSB strains, Pseudomonas fluorescens, P. putida, P. rhizosphaerae, Mesorhizobium ciceri, Bacillus megaterium, and Acetobacter aceti formed halo zones, with the zone of A. aceti being the widest. In the phosphate solubilization test in liquid media, Azospirillum lipoferum, P. rhizosphaerae, B. megaterium, and A. aceti caused the leaching of 6.4%, 6.9%, 7.5%, and 32.5% of calcium, respectively. When PSB were used to leach REE from monazite-bearing ore, ~5.7 mg/L of cerium (0.13% of leaching efficiency and ~2.8 mg/L of lanthanum (0.11% were leached by A. aceti, and Azospirillum brasilense, A. lipoferum, P. rhizosphaerae and M. ciceri leached 0.5–1 mg/L of both cerium and lanthanum (0.005%–0.01%, as measured by concentrations in the leaching liquor. These results indicate that determination of halo zone formation was found as a useful method to select high-capacity bacteria in REE leaching. However, as the leaching efficiency determined in our experiments was low, even in the presence of A. aceti, further studies are now underway to enhance leaching efficiency by selecting other microorganisms based on halo zone formation.

  11. Microbial consortium role in processing liquid waste of vegetables in Keputran Market Surabaya as organic liquid fertilizer ferti-plus

    Science.gov (United States)

    Rizqi, Fauziah; Supriyanto, Agus; Lestari, Intan; Lita Indri D., L.; Elmi Irmayanti, A.; Rahmaniyah, Fadilatur

    2016-03-01

    Many activities in this market is directly proportional to increase production of vegetables waste, especially surabaya. Therefore, in this study aims to utilize liquid waste of vegetables into liquid organic fertilizer by mixing microbial consorsium. The microbial consorsium consist of Azotobacter chrococcum, Azospirillum brasilense, Rhizobium leguminosarum, Bacillus subtilis, Bacillus megaterium, Pseudomonas putida, and Pseudomonas fluorescens. Ttreatment of microbial concentrations (5%, 10%, 15%) and the length of the incubation period (7 days, 14 days, 21 days) used in this research. The parameters used are: C/N ratio, levels of CNP, and BOD value. This study uses a standard organic fertilizer value according SNI19-7030-2004, The results show the value of C/N ratio comply with the ISO standards. C levels showed an increase during the incubation period but not compare with standards. N levels that compare with standards are microbial treatment in all group concentration except control group with an incubation period of 21 days is > 7. P levels compare with the existing standards in the group of microbe concentration of 10% and 15% during the incubation period. The value of the initial BOD liquid waste of vegetable is 790.25 mg / L, this value indicates that the waste should not go into the water body. Accordingly, the results of this study can not be used as a liquid organic fertilizer, but potentially if it is used as a natural career or build natural soil. The Building natural soil is defined as the natural ingredients that can be used to improve soil properties.

  12. Isolation and identification by 16S rRNA sequence analysis of plant growth-promoting azospirilla from the rhizosphere of wheat.

    Science.gov (United States)

    Ayyaz, Khadija; Zaheer, Ahmad; Rasul, Ghulam; Mirza, Muhammad Sajjad

    2016-01-01

    The main objective of the present study was to isolate phytohormone-producing, phosphate-solubilizing strains of Azospirillum from wheat to be used as inoculants for plant growth promotion. Five Azospirillum strains were isolated from the rhizosphere of field-grown wheat (Triticum aestivum L.), and it was confirmed by BOX-polymerase chain reaction (PCR) that the isolates were different and not re-isolates of the same strain. Sequence analysis of the PCR-amplified 16S rRNA gene indicated that four isolates showed maximum similarity to Azospirillum brasilense and one isolate showed maximum similarity to Azospirillum zeae. This is the first report indicating the presence of an A. zeae like isolate in the wheat rhizosphere in Pakistan. The bacterial isolates were characterized for their plant growth-promoting traits, phosphate solubilization, and indole-3-acetic acid (IAA) production. None of the isolates showed phosphate solubilization activity in the commonly used Pikovskaya medium. However, all strains (except AzoK4) exhibited ability to solubilize tricalcium phosphate (TCP) in modified Pikovskaya medium in which sucrose was replaced by Na-malate, as well as in TCP-supplemented Luria-Bertani (LB) medium. Organic acids, such as acetic, citric, lactic, malic, and succinic acids, were detected in culture supernatants of the tested Azospirillum strains. All strains exhibited ability to produce IAA in the growth medium, except Azospirillum sp. AzoK1. Among the strains tested, the maximum IAA production (30.49±1.04mgL(-1)) and phosphate solubilization (105.50±4.93mgL(-1)) were shown by a pure culture of Azospirillum sp. AzoK2. In pot experiments, single-strain inocula of Azospirillum sp. AzoK1 and AzoK2 improved wheat plant growth. PMID:27133558

  13. Potential of plant growth promoting rhizobacteria and chemical fertilizers on soil enzymes and plant growth

    International Nuclear Information System (INIS)

    The present investigation deals with the role of Plant Growth Promoting Rhizobacteria and chemical fertilizers alone or in combination on urease, invertase and phosphatase activities of rhizospheric soil and also on general impact on growth of safflower cvv. Thori and Saif-32. The PGPR (Azospirillum brasilense and Azotobacter vinelandii) were applied at 10/sup 6/ cells/mL as seed inoculation prior to sowing. Chemical fertilizers were applied at full (Urea 60 Kg ha/sup -1/ and Diammonium phosphate (DAP) 30 Kg ha/sup -1/), half (Urea 30 Kg ha/sup -1/ and DAP 15 Kg ha/sup -1/) and quarter doses (Urea 15 Kg ha-1 and DAP 7.5 Kg ha/sup -1/) during sowing. The chemical fertilizers and PGPR enhanced urease and invertase activities of soil. Presence of PGPR in combination with quarter and half doses of chemical fertilizers further augmented their effect on soil enzymes activities. The soil phosphatase activity was greater in Azospirillum and Azotobacter in combination with half dose of chemical fertilizers. Maximum increase in leaf melondialdehyde content was recorded in full dose of chemical fertilizers whereas coinoculation treatment exhibited significant reduction in cv. Thori. Half and quarter dose of chemical fertilizers increased the shoot length of safflower whereas maximum increase in leaf protein was recorded in Azotobacter in combination with full dose of chemical fertilizers. Root length was improved by Azospirillum and Azotobacter in combination with quarter dose of chemical fertilizers. Leaf area and chlorophyll contents were significantly improved by Azotobacter in combination with half dose of chemical fertilizers. It is inferred that PGPR can supplement 50 % chemical fertilizers for better plant growth and soil health. (author)

  14. Instrumental analysis of bacterial cells using vibrational and emission Moessbauer spectroscopic techniques

    International Nuclear Information System (INIS)

    In biosciences and biotechnology, the expanding application of physicochemical approaches using modern instrumental techniques is an efficient strategy to obtain valuable and often unique information at the molecular level. In this work, we applied a combination of vibrational (Fourier transform infrared (FTIR), FT-Raman) spectroscopic techniques, useful in overall structural and compositional analysis of bacterial cells of the rhizobacterium Azospirillum brasilense, with 57Co emission Moessbauer spectroscopy (EMS) used for sensitive monitoring of metal binding and further transformations in live bacterial cells. The information obtained, together with ICP-MS analyses for metals taken up by the bacteria, is useful in analysing the impact of the environmental conditions (heavy metal stress) on the bacterial metabolism and some differences in the heavy metal stress-induced behaviour of non-endophytic (Sp7) and facultatively endophytic (Sp245) strains. The results show that, while both strains Sp7 and Sp245 take up noticeable and comparable amounts of heavy metals from the medium (0.12 and 0.13 mg Co, 0.48 and 0.44 mg Cu or 4.2 and 2.1 mg Zn per gram of dry biomass, respectively, at a metal concentration of 0.2 mM in the medium), their metabolic responses differ essentially. Whereas for strain Sp7 the FTIR measurements showed significant accumulation of polyhydroxyalkanoates as storage materials involved in stress endurance, strain Sp245 did not show any major changes in cellular composition. Nevertheless, EMS measurements showed rapid binding of cobalt(II) by live bacterial cells (chemically similar to metal binding by dead bacteria) and its further transformation in the live cells within an hour

  15. Instrumental analysis of bacterial cells using vibrational and emission Moessbauer spectroscopic techniques

    Energy Technology Data Exchange (ETDEWEB)

    Kamnev, Alexander A. [Laboratory of Biochemistry of Plant-Bacterial Symbioses, Institute of Biochemistry and Physiology of Plants and Microorganisms, Russian Academy of Sciences, 410049 Saratov (Russian Federation)]. E-mail: aakamnev@ibppm.sgu.ru; Tugarova, Anna V. [Laboratory of Biochemistry of Plant-Bacterial Symbioses, Institute of Biochemistry and Physiology of Plants and Microorganisms, Russian Academy of Sciences, 410049 Saratov (Russian Federation); Antonyuk, Lyudmila P. [Laboratory of Biochemistry of Plant-Bacterial Symbioses, Institute of Biochemistry and Physiology of Plants and Microorganisms, Russian Academy of Sciences, 410049 Saratov (Russian Federation); Tarantilis, Petros A. [Laboratory of Chemistry, Department of Science, Agricultural University of Athens, 11855 Athens (Greece); Kulikov, Leonid A. [Laboratory of Nuclear Chemistry Techniques, Department of Radiochemistry, Faculty of Chemistry, M.V. Lomonosov Moscow State University, 119992 Moscow (Russian Federation); Perfiliev, Yurii D. [Laboratory of Nuclear Chemistry Techniques, Department of Radiochemistry, Faculty of Chemistry, M.V. Lomonosov Moscow State University, 119992 Moscow (Russian Federation); Polissiou, Moschos G. [Laboratory of Chemistry, Department of Science, Agricultural University of Athens, 11855 Athens (Greece); Gardiner, Philip H.E. [Division of Chemistry, School of Science and Mathematics, Sheffield Hallam University, Sheffield S1 1WB (United Kingdom)

    2006-07-28

    In biosciences and biotechnology, the expanding application of physicochemical approaches using modern instrumental techniques is an efficient strategy to obtain valuable and often unique information at the molecular level. In this work, we applied a combination of vibrational (Fourier transform infrared (FTIR), FT-Raman) spectroscopic techniques, useful in overall structural and compositional analysis of bacterial cells of the rhizobacterium Azospirillum brasilense, with {sup 57}Co emission Moessbauer spectroscopy (EMS) used for sensitive monitoring of metal binding and further transformations in live bacterial cells. The information obtained, together with ICP-MS analyses for metals taken up by the bacteria, is useful in analysing the impact of the environmental conditions (heavy metal stress) on the bacterial metabolism and some differences in the heavy metal stress-induced behaviour of non-endophytic (Sp7) and facultatively endophytic (Sp245) strains. The results show that, while both strains Sp7 and Sp245 take up noticeable and comparable amounts of heavy metals from the medium (0.12 and 0.13 mg Co, 0.48 and 0.44 mg Cu or 4.2 and 2.1 mg Zn per gram of dry biomass, respectively, at a metal concentration of 0.2 mM in the medium), their metabolic responses differ essentially. Whereas for strain Sp7 the FTIR measurements showed significant accumulation of polyhydroxyalkanoates as storage materials involved in stress endurance, strain Sp245 did not show any major changes in cellular composition. Nevertheless, EMS measurements showed rapid binding of cobalt(II) by live bacterial cells (chemically similar to metal binding by dead bacteria) and its further transformation in the live cells within an hour.

  16. Zur Geschichte der Geowissenschaften im Museum für Naturkunde zu Berlin Teil 1: Aus der Vorgeschichte bis zur Gründung der Berliner Bergakademie im Jahre 1770

    Directory of Open Access Journals (Sweden)

    G. Hoppe

    1998-01-01

    Full Text Available Die Geschichte der beiden Institute für Mineralogie und für Paläontologie des Berliner Museums für Naturkunde mit ihren sehr großen Sammlungen beginnt mit ihrer direkten Vorgängerin, der Berliner Bergakademie, die 1770 gegründet worden ist. Aber bereits vor dieser Zeit hat es in Berlin geowissenschaftliche Interessen und Betätigungen gegeben. Diese Vorgeschichte wird mit einer Zeit begonnen, in der es den Ort Berlin noch längst nicht gab. Aus der La-Tene-Zeit, die der Zeit der griechischen Antike entspricht, stammt eine Aschenurne mit einer Sammlung fossiler Mollusken, die im norddeutschen Flachland bei Bernburg gefunden wurde. Die Zusammensetzung dieser Sammlung läßt bereits ein wissenschaftliches Herangehen erkennen. Für Berlin selbst ist kurz nach Georg Agricola eine Persönlichkeit der Renaissance zu verzeichnen, Leonhard Thurneysser zum Thurn, in dessen vielfältigen Aktivitäten auch Mineralien einen Platz hatten. In gleicher Zeit war in Berlin am brandenburgischen Hofe eine Raritätenkammer vorhanden, die spätere Kunst- und Naturalienkammer. Sie existierte bis über das Jahr 1770 hinaus und enthielt auch Mineralien und Versteinerungen. Das sich hierdurch zeigende Interesse an solchen Objekten war noch recht oberflächlich. Erst die Sammlungen privater Personen, die in Berlin seit Ende des 17. Jahrhunderts entstanden sind, zeigen ein tieferes und wissenschaftliches Interesse, wenn auch in verschiedenem Maße und in unterschiedlicher Spezialisierung. Unter ihnen ragt besonders Johann Gottlob Lehmann heraus. Als vielseitiger Naturwissenschaftler und Bergrat hielt er privat Vorlesungen in Mineralogie und Bergbaukunde. Der Siebenjährige Krieg verhinderte den Ausbau und die Fortsetzung. Erst Jahre danach, 1768, reorganisierte König Friedrich II. das preußische Bergwesen und richtete 1770 die Berliner Bergakademie ein. Hierbei kam dem Arzt und Bergrat Carl Abraham Gerhard bei der Einrichtung und als Lehrkraft eine wesentliche

  17. Die Veränderung der Grenzen in einer transnationalen Gebietskörperschaft

    Directory of Open Access Journals (Sweden)

    Karen Denni

    2009-12-01

    konfliktreichen Linie der Trennung während des deutsch-französischen Krieges von 1870-1871 zu einer friedvollen und integrierten Grenzzone innerhalb der Europäischen Union. Die Vereinbarung von 2005 über die Gründung des Eurodistrikts Straßburg-Ortenau sieht sogar die Überwindung politischer und sozialer Grenzen vor, indem langfristig eine Fusion der beiden benachbarten Gebietskörperschaften angestrebt wird. Obwohl diese Vereinbarung zu einer Verstärkung der grenzüberschreitenden Zusammenarbeit geführt hat, sind viele juristische, politische und soziale Fragen noch ungeklärt. Auch die Bürger der Grenzregion sind bisher nur unzureichend in den Entwicklungsprozess des Eurodistrikts einbezogen worden. Es ist daher noch ein langer Weg zu beschreiten, ehe der Rhein nicht mehr die Grenze zwischen Frankreich und Deutschland darstellt, sondern einen Bindestrich zwischen beiden Ländern.

  18. Ekkehart Krippendorff, investigador para la paz. Una biografía intelectual

    Directory of Open Access Journals (Sweden)

    Francesco Pistolato

    2011-06-01

    Full Text Available Ekkehart Krippendorff, nacido en 1934, es un ilustre investigador para la paz alemán,prácticamente ignoto en el mundo hispano-hablante por falta de estudios sobre él yde traducción de sus obras más importantes. Educado en el nazismo y en la Alemaniadel Oeste de la posguerra, profundiza su formación en Ciencias Políticas en los EEUUa comienzos de los años Sesenta. Regresado a Alemania, en 1966 publica la antologíaPolitical Science, una introducción al estudio de las Ciencias Políticas estadounidenses,en aquella época desconocidas en Alemania.A pesar de su admiración a la democracia estadounidense, Krippendorff critica la políticaimperialista de los EEUU con el ensayo “Amerikanische Politik in Asien” de 1963 y conDie amerikanische Strategie de 1970. Su posición anticonformista impide su ingreso enla Universidad de Berlín hasta finales de los años Setenta, después de varias experienciasde docencia en los EEUU y en Italia.En los años Ochenta se compromete en el movimiento contra la instalación de losmisiles de medio alcance en Alemania. Su obra teórica principal, Staat und Krieg (ElEstado y la guerra de 1985 se convierte en un clásico del pacifismo en los países deidioma alemán. En ésta explica que el Estado moderno nació para reglamentar a las tropasmercenarias y garantizar a los poderosos la fuerza necesaria no sólo para defendersede los ataques externos y para conquistar nuevos territorios, sino para controlar a losciudadanos de su mismo país. Además de proporcionar varios ejemplos históricos parafundamentar su tesis, la obra demuestra la insensatez de las políticas de potencia concitas de literatos, filósofos y otros estudiosos de ciencias humanas. Un excursus dedicadoal Tolstoi pacifista concluye esta obra riquísima e inclasificable, quizás ante todoun tratado sobre la necesidad de desconfiar de los políticos y de participar activamenteen la política nacional.En los últimos veinte años Krippendorff

  19. Berliner Geowissenschaftlerinnen an der Friedrich-Wilhelms-Universität von 1906 bis 1945, eine Fallstudie

    Directory of Open Access Journals (Sweden)

    B. A. R. Mohr

    2003-01-01

    Full Text Available In dieser Untersuchung werden beispielhaft die Lebenswege und Karrieren von Berliner Geowissenschaftlerinnen im Zeitraum von 1906 bis 1945 nachgezeichnet und analysiert. Ähnlich wie an anderen deutschen bzw. westlichen Universitäten, aber im Gegensatz zu Russland, begann die Tätigkeit von Frauen in den Geowissenschaften spät, und das Fach wurde auch relativ selten gewählt, hauptsächlich wegen der zu geringen Berufschancen. Aber die besondere Situation in Berlin mit mehreren sich ergänzenden Institutionen und dem daraus resultierenden breiten Spektrum an geowissenschaftlichen Disziplinen, sowie ausgezeichneten Professoren, ließ dennoch Raum für eine Ausbildung in diesem Bereich und erlaubte, wenn auch in bescheidenem Maße, eine gewisse Karrieremöglichkeit. Während der hier untersuchten 40 Jahre haben weniger als 20 Frauen in den Geowissenschaften und benachbarten Gebieten promoviert. Mehrere dieser Frauen blieben in dem von ihnen gewählten Fach weiterhin aktiv und wurden erfolgreich. Zwei Frauen gelang eine akademische Karriere — eine als Universitätsprofessorin, die auch Schülerinnen hatte. Andere arbeiteten an staatlichen Institutionen, wie z. B. dem Geologischen Landesamt. Wenige Frauen blieben nach ihrer Verheiratung beruflich aktiv, wenn auch nicht offiziell angestellt, sondern als Ehefrauen. Andere arbeiteten als "Ersatz" für die im Kriege stehenden Männer. Einige waren aus persönlichen und politischen Gründen, insbesondere während der NS-Zeit, gezwungen, die Geowissenschaften zu verlassen, konnten aber teilweise auf anderen Gebieten erfolgreich arbeiten. This paper documents the lives and careers of women geoscientists at the Berlin Friedrich-Wilhelms-University from 1906 through 1945. Traditionally, in Germany, women had difficulties to be accepted in geosciences (except for geography/geology teachers, because of strong links between geology and mining, a field dominated clearly by men. In western European countries

  20. 利用小鼠模型评价含有5'-GTCGTT-3'特征序列的人CpG寡脱氧核苷酸的免疫刺激活性%Evaluation of Immunostimulatory Activities of Human CpG-ODN Containing 5'-GTCGTT-3' Motif in Murine Model

    Institute of Scientific and Technical Information of China (English)

    许洪林; 王四清; 王世峰; 郭斐; 陆柔剑; 阮力

    2001-01-01

    While bacterial DNA and synthetic oligodeoxynucleotides(ODN)containing unmethylated CpG dinucleotides with specific flanking sequences are well described activators of murine immune cells, CpG-ODN for activating human immune responses remains unclear. Recently Krieg et al. and our group have identified that the sequences with 5'-GTCGTT-3' motif acted as immunostimulatory CpG-ODN for human B lymphocytes, and also we found they cross-activated with murine immune cells. In the present study, we evaluated their activities in a murine model. In vitro, human CpG-ODN induced murine splenocyte transformation and production of IgM, but no IFN-γ. The in vivo adjuvanticity of human CpG-ODN for recombinant HBsAg was examined in mice. And the data showed that (1)human CpG-ODN induced a strong Th1 response with predominant IgG2a isotype, and (2)the immune response could be anchored at Th1 response when primed with human CpG-ODN, and (3)boosting with human CpG-ODN partially reversed the Th2 response induced by alum during priming, and (4)one dose of HBsAg with human CpG-ODN as adjuvant elicited a stronger humoral response (Th1 biased)than two doses of conventional vaccine with alum (Th2 biased). These studies demonstrated that mice may be used as an animal model for the evaluation of the activities of some human CpG-ODN, and it also indicated that CpG-ODN containing 5'-GTCGTT-3' motif is a candidate adjuvant for human vaccines.%为了寻找合适的动物模型来评价人CpG寡脱氧核苷酸(CpG-ODN)的活性,研究了CpG2006等含有5'-GTCGTT-3'特征序列的人CpG-ODN对小鼠的免疫刺激活性。在体外它们能够促进小鼠脾淋巴细胞转化,促进B细胞分泌IgM,但不能诱生高水平的IFN-γ。研究了CpG2006等序列在体内作为疫苗佐剂对HBsAg免疫效果的影响,发现:(1)人CpG-ODN能够明显提高抗-HBs抗体水平,并逆转Al(OH)3对Thl类免疫应答的抑制;(2)初免时以CpG2006为佐剂可以使免

  1. Speciation and transformations of cobalt(II) in bacterial cells using emission (57Co) Moessbauer spectroscopy

    International Nuclear Information System (INIS)

    Complete text of publication follows. The 57Co emission variant of Moessbauer spectroscopy (EMS), despite its solitary applications in biology owing to intrinsic methodological difficulties (Yu.D. Perfiliev, A.A. Kamnev, Moessbauer Effect Ref. and Data J., 30 (2007) 121-122; A.A. Kamnev, J. Mol. Struct., 744-747 (2005) 161-167), is highly sensitive and informative. The parameters of 57Co emission spectra provide chemical speciation data for the 57Co cation (chemical state, coordination environment and symmetry, etc.), as well as quantitative information on its distribution between different cation-binding sites in complicated biosystems (A.A. Kamnev, in 'Metal Ions in Biology and Medicine', Vol. 10, John Libbey Eurotext, Paris (2008), pp. 522-527). 57Co EMS can be successfully applied for monitoring 57Co2+ interactions with microbial cells, including its metabolic transformations (A.A. Kamnev et al., Anal. Chim. Acta, 573-574 (2006) 445-452). Comparative studies in rapidly frozen aqueous suspensions of live and dead cells of the ubiquitous phytostimulating soil bacterium Azospirillum brasilense have shown similarities in the chemical species formed upon purely chemical interaction of 57Co2+ traces with dead cell biomass and those formed upon primary rapid steps (2 min) of 57Co2+ sorption by the surface of live cells. For live cells, however, the parameters of 57Co emission spectra were found to change within an hour, which reflected ongoing metabolic transformations of the cation. The data obtained are in good agreement with the recently discovered involvement of Co2+ in reactions with labile [Fe-S] clusters during their de novo biosynthesis or repair in E. coli (C. Ranquet et al., J. Biol. Chem., 282 (2007) 30442-30451), presenting the molecular basis for Co2+ toxicity, besides Co2+-induced oxidative stress. The results obtained show that 57Co EMS can provide unique information both for speciation bioanalysis and for the monitoring of radionuclide bioleaching and

  2. Desempenho agronômico a campo de híbridos de milho inoculados com Azospirillum

    Directory of Open Access Journals (Sweden)

    Patricia Dörr de Quadros

    2014-04-01

    Full Text Available O uso de inoculantes na cultura do milho tem sido cada vez mais valorizado, em vista dos benefícios que pode trazer à cultura, como a fixação biológica do nitrogênio e o aumento da quantidade de raízes. Isto pode melhorar a absorção de água e nutrientes pela planta, contribuindo para o desenvolvimento do milho, principalmente em períodos de seca. Este estudo foi desenvolvido com o objetivo de avaliar, em condições de campo, as características agronômicas e o rendimento de grãos de híbridos de milho, inoculados, ou não, com uma mistura de três espécies de Azospirillum (A. brasilense, A. lipoferum, A. oryzae. Foram avaliados o teor relativo de clorofila nas folhas, a altura de planta, a senescência foliar, os componentes de rendimento de grãos, o teor de N, a matéria seca da parte aérea das plantas e o número mais provável de bactérias diazotróficas na rizosfera das plantas. A inoculação manteve o teor de clorofila significativamente maior até o estádio R3 das plantas, para os três híbridos testados, aumentou o rendimento da matéria seca da parte aérea, dos híbridos AS 1575 e SHS 5050, o peso de 1000 grãos, para o híbrido P32R48 e altura, para o AS 1575. Houve interação entre os genótipos de milho e as bactérias inoculadas, visto que, cada híbrido testado respondeu de forma diferente à inoculação. A inoculação de Azospirillum em milho demonstrou estimular o desenvolvimento das plantas no período vegetativo, aumentando a probabilidade de obter-se um estande de plantas uniforme, maior resistência ao estresse e maior concentração de clorofila nas folhas.

  3. Identificação e avaliação de rizobactérias isoladas de raízes de milho

    Directory of Open Access Journals (Sweden)

    Eliamar Aparecida Nascimbém Pedrinho

    2010-12-01

    Full Text Available Estudos sobre a atividade microbiológica que ocorre na rizosfera de diversos vegetais levaram ao descobrimento de grupos de microrganismos importantes para o desenvolvimento vegetal. Dentre eles estão as rizobactérias que são capazes de colonizar as raízes, estimulando-a diretamente ou beneficiando o crescimento e o desenvolvimento de diversas plantas. Estas bactérias são chamadas Rizobactérias Promotoras de Crescimento em Plantas (RPCP. Este trabalho teve o objetivo de isolar, identificar, testar a capacidade da solubilização de fosfato e a produção de ácido indol acético (AIA de bactérias que habitam a rizosfera de plantas de milho. A análise parcial do gene 16S rRNA dos 58 isolados possibilitou a identificação dos gêneros, Bacillus, Burkholderia e Azospirillum, sendo os mais frequentes totalizando 68% dos isolados, seguidos de Sphingomonas, Pseudomonas, Herbaspirillum, Pantoea , Bosea. Desses, 27 apresentaram a capacidade de solubilização do fosfato e 18 foram positivos no teste colorimétrico para detecção de produção do AIA. A partir destes resultados, selecionou-se um organismo pertencente ao gênero Sphingomonas para ser testado em casa de vegetação como promotor de crescimento com as estirpes de Azospirillum brasilense (AbV5 e AbV6. As plantas foram avaliadas quanto à altura aos vinte e setenta dias após a germinação e a massa seca da parte aérea (MSPAe parte radicular (MSPR foi quantificada após setenta dias no encerramento do experimento. Os resultados das análises do isolado pertencente ao gênero Sphingomonas foram estatisticamente semelhantes às estirpes AbV5 e AbV6 na planta de milho indicando que este microrganismo possui potencial para ser utilizado como RPCP

  4. A disposable laser print-cut-laminate polyester microchip for multiplexed PCR via infra-red-mediated thermal control.

    Science.gov (United States)

    Ouyang, Yiwen; Duarte, Gabriela R M; Poe, Brian L; Riehl, Paul S; dos Santos, Fernando M; Martin-Didonet, Claudia C G; Carrilho, Emanuel; Landers, James P

    2015-12-11

    Infrared (IR)-mediated thermal cycling system, a method proven to be a effective for sub-μL scale polymerase chain reaction (PCR) on microchips, has been integrated with DNA extraction and separation on a glass microchip in a fully integrated micro Total Analysis System by Easley et al., in 2006. IR-PCR has been demonstrated on both glass and PMMA microdevices where the fabrication (bonding) is not trivial. Polyester-toner (PeT) microfluidic devices have significant potential as cost-effective, disposable microdevices as a result of the ease of fabrication (∼$0.25 USD and <10 min per device) and availability of commercial substrates. For the first time, we demonstrate here the thermal cycling in PeT microchips on the IR-PCR system. Undesirable IR absorption by the black-toner bonding layer was eliminated with a spatial filter in the form of an aluminum foil mask. The solution heating rate for a black PeT microchip using a tungsten lamp was 10.1 ± 0.7 °C s(-1) with a cooling rate of roughly -12 ± 0.9 °C s(-1) assisted by forced air cooling. Dynamic surface passivation strategies allowed the successful amplification of a 520 bp fragment of the λ-phage genome (in 11 min) and a 1500 bp region of Azospirillum brasilense. Using a centrosymmetric chamber configuration in a multichamber PeT microchip, homogenous temperature distribution over all chambers was achieved with inter-chamber temperature differences at annealing, extension and denaturing steps of less than ±2 °C. The effectiveness of the multichamber system was demonstrated with the simultaneous amplification of a 390 bp amplicon of human β-globin gene in five PeT PCR microchambers. The relative PCR amplification efficiency with a human β-globin DNA fragment ranged from 70% to 90%, in comparison to conventional thermal cyclers, with an inter-chamber standard deviation of ∼10%. Development of PeT microchips for IR-PCR has the potential to provide rapid, low-volume amplification while

  5. АГРОТЕХНОЛОГИЧЕСКИЕ ОСНОВЫ СОЗДАНИЯ УСОВЕРШЕНСТВОВАННЫХ ФОРМ МИКРОБНЫХ БИОПРЕПАРАТОВ ДЛЯ ЗЕМЛЕДЕЛИЯ

    OpenAIRE

    Кожемяков, А.; Лактионов, Ю.; Попова, Т.; Орлова, А.; Кокорина, А.; Вайшля, О.; Агафонов, Е.; Гужвин, С.; Чураков, А.; Яковлева, М.

    2015-01-01

    Выполнены комплексные исследования по созданию жидкой формы биопрепаратов для симбиотических и ассоциативных ризобактерий. Объектами изучения служили клубеньковые бактерии, обитающие в ризосфере козлятника (Rhizobium galegae), сои (Bradyrhizobium japonicum), и ассоциативные ризобактерии (Arthrobacter mysorens, Azospirillum brasilense, Ag-robacterium radiobacter), а также растения сои (Glycine max), кукурузы (Zea L.) и пшеницы (Triticum L.). В качестве носителей бактерий использовали гамма-сте...

  6. Ecology of nitrogen fixation in soils and rhizospheres. Pt. 5

    Energy Technology Data Exchange (ETDEWEB)

    Werner, D.; Stripf, R.; Abramowski, R.; Fiedler, U.

    1980-12-01

    The effects of reduced oxygen concentration on root growth and activities of enzymes of N-metabolism of wheat (Triticum aestivum var. Kolibri) have been studied, for low O/sub 2/ tensions are required for N/sub 2/ fixation by microaerophilic bacteria (e.g. Azospirillum) associated with root systems of grasses. In hydrocultures with oxygen concentrations in the range of 0.2 to 1 mg O/sub 2/ x 1/sup -1/ compared to aerated cultures (8-9 mg O/sub 2/ x 1/sup -1/) root growth was reduced from 10 mg fresh weight x day/sup -1/ x plant/sup -1/ to one tenth 15 to 30 d after sowing. Specific activity of NADH and NADPH dependent glutamate dehydrogenase (E.C. 1.4.1.2 and 1.4.1.4) is reduced by 50% in the cultures with low oxygen concentrations 20 to 30 days after sowing, whereas specific activity of aspartate aminotransferase (E.C. 2.6.1.1) and alanine amino transferase (E.C. 2.6.1.2) is enhanced by a factor of two to three. Specific activity of glutamine synthetase is almost unaffected. Specific activity of glutamate dehydrogenase is lowest in the root tips, medium in young root hair zone and highest in the old root hair zone, glutamine synthetase activity is reverse in the three zones with differences by a factor of 3-5; aspartate aminotransferase is similarly active in the three zones. Nitrate concentration used (100 ..mu..M) for cultivation of the wheat plants was tested with Azospirillum brasilense in pure culture on agar surfaces exposed to air at the same pH (5.8), used for cultivation of the wheat plants. Activiy after a 14 day period (peak activity 70 mmol C/sub 2/H/sub 4/ x mg protein/sup -1/ x h/sup -1/) was not affected, however 1 mM and 5 mM nitrate added reduced the total activity to 50% and 10% respectively.

  7. ИСПОЛЬЗОВАНИЕ МЕТОДА ЭЛЕКТРООПТИЧЕСКОГО АНАЛИЗА МИКРОБНЫХ СУСПЕНЗИЙ ДЛЯ ОПРЕДЕЛЕНИЯ СПЕЦИФИЧНОСТИ БАКТЕРИОФАГА

    OpenAIRE

    Караваева, Ольга; Гулий, Ольга; Павлий, Сергей; Володин, Дмитрий; Игнатов, Олег

    2011-01-01

    Изучена возможность использования метода электрооптического анализа клеточных суспензий для определения специфичности бактериофага, выделенного из клеток Azospirillum brasilense Sp7, в отношении клеток хозяина и близкородственных штаммов. Для определения селективности также был использован стандартный метод стекающей капли. Эксперименты проводились с клетками бактериальных штаммов Azospirillum brazilense Sp7, Azospirillum brazilense Sr75, Azospirillum brazilense Cd, Azospirillum brazilense Sp...

  8. ИММУНОХИМИЧЕСКОЕ ИССЛЕДОВАНИЕ АНТИГЕННЫХ СВОЙСТВ ПОЧВЕННЫХ РОСТСТИМУЛИРУЮЩИХ БАКТЕРИЙ РОДА AZOSPIRILLUM

    OpenAIRE

    Филипьечева, Юлия; Беляков, Алексей; Бурыгин, Геннадий; Коннова, Светлана

    2010-01-01

    В статье представлены результаты иммунохимического анализа 63 штаммов ассоциативных ризобактерий рода Azospirillum. Показаны значительная гетерогенность О-антигенов штаммов видов A. lipoferum и A. brasilense, а также высокое сходство антигенных свойств ЛПС штаммов A. irakense. Серологически обособленным оказался штамм A. amazonense. Продемонстрирована высокая консервативность мажорных белковых антигенов данных бактерий....

  9. Densidade e diversidade fenotípica de bactérias diazotróficas não simbióticas em solos da Reserva Biológica Serra dos Toledos, Itajubá (MG

    Directory of Open Access Journals (Sweden)

    Talita Filomena Silva

    2011-04-01

    Full Text Available Bactérias diazotróficas não simbióticas (BDNS atuam no desenvolvimento das plantas por meio da fixação biológica de nitrogênio e também pela produção e liberação de substâncias reguladoras do crescimento vegetal. Este estudo objetivou avaliar a densidade e diversidade fenotípica desse grupo de bactérias em fragmentos de solo da Reserva Biológica Serra dos Toledos e entorno, em Itajubá/MG. Essa reserva localiza-se na Área de Proteção Ambiental da Mantiqueira, constituindo-se em uma importante área de recarga e de abrigo à flora e fauna endêmicas. Amostras de solo superficial foram coletadas em áreas com diferentes declividades na reserva, em épocas representativas das estações de inverno (setembro/2006 e verão (abril/2007. A densidade, avaliada pelo número mais provável, utilizando os meios de cultura NFb, JNFb e Fam, para Azospirillum spp., Herbaspirillum spp. e A. amazonense, respectivamente, variou de 0,12 a 75,60 (NMP x 10(5 bactérias g-1 solo seco. Foram obtidos 172 e 174 isolados, respectivamente para as amostras de inverno e verão, dos quais 30 e 55 % apresentaram similaridade igual ou superior a 70 % com as estirpes-tipo Azospirillum brasilense, A. amazonense, A. lipoferum, Herbaspirillum seropedicae e Burkholderia brasilensis. O resultado do comportamento dos isolados com base na tolerância à salinidade nem sempre foi semelhante ao obtido pelas características fenotípicas culturais a 70 % de similaridade, sendo indicado para estudos complementares de diversidade desses organismos. As BDNS apresentam potencial de utilização em estudos de avaliação da qualidade e sustentabilidade de ecossistemas. No entanto, apesar da alta densidade e diversidade fenotípica em solos da reserva, maiores valores foram obtidos no entorno, evidenciando o efeito positivo da cobertura vegetal do tipo gramíneas sobre elas, independentemente da variação climática.

  10. Bionota: Bacterias promotoras de crecimiento de microalgas: una nueva aproximación en el tratamiento de aguas residuales Microalgae growth-promoting bacteria: A novel approach in wastewater treatment

    Directory of Open Access Journals (Sweden)

    Bashan Yoav

    2003-12-01

    Full Text Available Las bacterias promotoras de crecimiento en plantas (PGPB del género Azospirillum son conocidas porque mejo­ran el crecimiento de numerosas cosechas agrícolas; sin embargo, el presente trabajo pretende extender el uso de estas bacterias a "bacterias promotoras de crecimiento de microalgas" (MPGB para aumentar la capacidad de las microalgas de eliminar nutrientes de aguas residuales. La inoculación deliberada de las microalgas Chlorella spp. con PGPB de origen terrestre no ha sido reportada con anterioridad, tal vez debido al origen diferente de estos dos microorganismos. Al inmovilizar de manera conjunta Chlorella vulgaris y Azospirillum brasilense Cd en esferas de alginato, se obtuvo como resultado un aumento significativo en varios parámetros de crecimiento de la microalga, como el peso fresco y seco, el número total de células, el tamaño de las colonias de microalgas dentro de la esfera, el número de organismos por colonia y la concentración de pigmentos. Además, aumenta­ron los lípidos y la variedad de ácidos grasos. La microalga combinada con la MGPB tiene una mayor capacidad de eliminar amonio y fósforo tanto en agua residual sintética como en agua residual doméstica. Actualmente se ha estado experimentando con otras PGPB (Flavobacterium sp. Azospirillum sp. y Azotobacter sp. para propósitos acuícolas; por ejemplo aumentar el crecimiento de fitoplancton utilizado en el cultivo de carpas y estabilizar cultivos masivos de microalgas marinas utilizadas como alimento para organismos marinos, todo esto con resul­tados promisorios. Si bien el efecto de las PGPB en microorganismos acuáticos aún no ha sido suficientemente explorado, proponemos que la co-inmovilización de microalgas y bacterias promotoras de crecimiento es un medio efectivo para aumentar la población microalgal y también su capacidad de limpiar aguas residuales. Palabras clave: PGPB; microalgas; biotratamiento de aguas residuales; co

  11. Estimation of the efficiency of hydrocarbon mineralization in soil by measuring CO2-emission and variations in the isotope composition of carbon dioxide

    Science.gov (United States)

    Dubrovskaya, Ekaterina; Turkovskaya, Olga

    2010-05-01

    Estimation of the efficiency of hydrocarbon mineralization in soil by measuring CO2-emission and variations in the isotope composition of carbon dioxide E. Dubrovskaya1, O. Turkovskaya1, A. Tiunov2, N. Pozdnyakova1, A. Muratova1 1 - Institute of Biochemistry and Physiology of Plants and Microorganisms, RAS, Saratov, 2 - A.N. Severtsov Institute of Ecology and Evolution, RAS, Moscow, Russian Federation Hydrocarbon mineralization in soil undergoing phytoremediation was investigated in a laboratory experiment by estimating the variation in the 13С/12С ratio in the respired СО2. Hexadecane (HD) was used as a model hydrocarbon pollutant. The polluted soil was planted with winter rye (Secale cereale) inoculated with Azospirillum brasilense strain SR80, which combines the abilities to promote plant growth and to degrade oil hydrocarbon. Each vegetated treatment was accompanied with a corresponding nonvegetated one, and uncontaminated treatments were used as controls. Emission of carbon dioxide, its isotopic composition, and the residual concentration of HD in the soil were examined after two and four weeks. At the beginning of the experiment, the CO2-emission level was higher in the uncontaminated than in the contaminated soil. After two weeks, the quantity of emitted carbon dioxide decreased by about three times and did not change significantly in all uncontaminated treatments. The presence of HD in the soil initially increased CO2 emission, but later the respiration was reduced. During the first two weeks, nonvegetated soil had the highest CO2-emission level. Subsequently, the maximum increase in respiration was recorded in the vegetated contaminated treatments. The isotope composition of plant material determines the isotope composition of soil. The soil used in our experiment had an isotopic signature typical of soils formed by C3 plants (δ13C,-22.4‰). Generally, there was no significant fractionation of the carbon isotopes of the substrates metabolized by the

  12. Response of Sunflower (Helianthus annuus L.) to N-application and Bio fertilization with Assessment of Fertilizer N Recovery by 15N Versus Subtraction Methods

    International Nuclear Information System (INIS)

    A factorial field experiment was conducted on sunflower (Helianthus annuus L.) grown on a sand soil (98% sand) supplied the different combinations of 4 N rates of 0, 105, 140 and 175 kg N ha-1 i.e. N0, N1, N2, and N3 respectively - as (NH4)2SO4 and 4 bio fertilization inoculation (B) of none, Azotobacter chroococcum, Azospirillum brasilense and Bacillus megaterium. i.e. B0,B1,B2, and B3 respectively. Labeled ammonium sulphate with 2% 15N atom excess was used for 15N assessment. All plots were supplied with 21 Mg compost +24 kg P +80 kg K ha-'1. Non-treated plants gave 0.534 Mg seeds ha-1 while the treated ones - especially those of N or N + bio fertilizers - gave increases of up to 403% (N2B). Main effect response patterns were: N: N3>N2>N1, for B: B1≥B3≥B2. Seed oil content in the N0B0 treatment was 222 gkg-1 increased reaching as high as 445 gkg-1by N2B3; with N main effect of N2>N3>N1and B main effect of B2>B3>B1. Seed oil yield was 113 kg ha-1 by N0B0 increased to as high as 1105 kg ha-1 by N2B1 with main effects of N2>N3>N1and B3≥B2>B1.Uptake of N (in total plant parts of roots + stems + leaves + discs + seeds) increased by N application; averages for non-N were 18.1 kg ha-118.5,14.7,17.4 by N0B0, N0B1, N0B2, and N0B3 respectively; increased considerably by up to 667% (N3B3) upon N application. Plants recovered a portion of fertilizer N of 19.6 to 40.9% by N1B1and N2B1 respectively as determined by 15N technique, but 27.7 to 59.6% respectively as calculated by subtraction of non-N from N treatments. The subtraction estimation considerably exceeded the 15N determined ones by + 39.5% to as high as + 194.6% indicating a non-real estimation of recovered fertilizer-N in crops. Thus, in studies using non-tracer techniques, estimation of uptake of fertilizer N could be erroneous. The reason in the current study could most certainly be a greater volume of root system expansion of N-treated plants, causing more uptake of non-fertilizer-N than in the no

  13. Physics in one dimension

    Science.gov (United States)

    van Houselt, A.; Schäfer, J.; Zandvliet, H. J. W.; Claessen, R.

    2013-01-01

    Pashkin, C A Kuntscher, S G Ebbinghaus, M Hanfland, F Lissner, Th Schleid and M Dressel Photoemission spectroscopy and the unusually robust one-dimensional physics of lithium purple bronzeL Dudy, J D Denlinger, J W Allen, F Wang, J He, D Hitchcock, A Sekiyama and S Suga Luttinger liquid behaviour of Li0.9Mo6O17 studied by scanning tunnelling microscopyT Podlich, M Klinke, B Nansseu, M Waelsch, R Bienert, J He, R Jin, D Mandrus and R Matzdorf Mn-silicide nanostructures aligned on massively parallel silicon nano-ribbonsPaola De Padova, Carlo Ottaviani, Fabio Ronci, Stefano Colonna, Bruno Olivieri, Claudio Quaresima, Antonio Cricenti, Maria E Dávila, Franz Hennies, Annette Pietzsch, Nina Shariati and Guy Le Lay Iridium silicide nanowires on Si(001) surfacesNuri Oncel and Dylan Nicholls Structure and growth of quasi-one-dimensional YSi2 nanophases on Si(100)V Iancu, P R C Kent, S Hus, H Hu, C G Zeng and H H Weitering Metallic rare-earth silicide nanowires on silicon surfacesMario Dähne and Martina Wanke One-dimensional collective excitations in Ag atomic wires grown on Si(557)U Krieg, C Brand, C Tegenkamp and H Pfnür Interfering Bloch waves in a 1D electron systemR Heimbuch, A van Houselt, M Farmanbar, G Brocks and H J W Zandvliet Au-induced quantum chains on Ge(001)—symmetries, long-range order and the conduction pathC Blumenstein, S Meyer, S Mietke, J Schäfer, A Bostwick, E Rotenberg, R Matzdorf and R Claessen

  14. Kirjalikud teated eesti libahundipärimuse kohta kuni 20. sajandini alguseni / Schriftliche Überlieferungen zum Werwolfsglauben in Estland bis Anfang des 20. Jahrhunderts

    Directory of Open Access Journals (Sweden)

    Tiina Vähi

    2011-01-01

    Full Text Available Die Geisteshaltung bei der Beschreibung des Werwolfglaubens ist seit Herodot (484-425 vor Chr. durch das Mittelalter bis zur Frühen Neuzeit relativ unverändert geblieben. Ein Merkmal der Kolonialliteratur ist der Ethnozentrismus bei der Darstellung von in der Peripherie lebenden Heiden bis hin zu deren Dämonisierung. Sebastian Münster (1489-1552 schrieb im fünften Band seines Werkes Cosmographey. Oder Beschreibung Aller Länder. (1544, dass es in Livland zahlreiche Hexen und Werwölfe gebe und Olaus Magnus schrieb in seinem Buch Historia de Gentibus Septentrionalibus (1555, dass Werwölfe in Livland mehr Schaden anrichteten als gewöhnliche Wölfe. Ein schreckenerregendes Bild von Übeltaten von Wölfen oder von in Werwölfe verwandelten Räubern malt der Jesuit Antonio Possevino (1533-1611, Gesandter des Papstes, in seinem Brief an die Herzogin von Mantua (verfasst in Tartu am 9. August 1585. Gegen Ende des Mittelalters erhielt die Tierwandlung, besonders die Verwandlung in einen Wolf, eine äußerst negative Bedeutung, sie wurde mit Lykanthropie in Verbindung gebracht. In einem Abschnitt von Balthasar Russows Chronica der Provintz Lyfflandt (1584, der die mehrwöchige Belagerung der Burg Toolse durch die Schweden 1574 während des Livländischen Krieges beschreibt, heißt es, dass die russischen Verteidiger den Belagerern jeden Abend als heulende Wolfsherde erschienen und die Angreifer so einschüchterten.Auch die aufgeklärten Gelehrten des 18. und beginnenden 19. Jahrhunderts kamen nicht gänzlich von den Konzepten der Vergangenheit los, ein „Werwolf“ drückte den Unglauben des Volkes aus, der von der Ungebildetheit des Volkes herrührte. August Wilhelm Hupel (1737-1819, der in der estnischen Kulturgeschichte als Sammler von Daten zur Geographie, Ethnographie und Bevölkerung Liv- und Estlands geschätzt wird, behandelte im sechsten Teil seines Werkes Nordische Miscellen (1781-1791 den Werwolfglauben, wobei er sich auf frühere von

  15. EDITORIAL: Van der Waals interactions in advanced materials, in memory of David C Langreth Van der Waals interactions in advanced materials, in memory of David C Langreth

    Science.gov (United States)

    Hyldgaard, Per; Rahman, Talat S.

    2012-10-01

    Solid State Commun. 17 1425 [4]Gunnarsson O and Lundqvist B I 1976 Exchange and correlation in atoms, molecules, and solids by the spin-density-functional formalism Phys. Rev. B 13 4274 [5]Langreth D C and Mehl M J 1981 Beyond the local-density approximation in calculations of ground-state electronic properties Phys. Rev. B 47 446 [6]Dion M, Rydberg H, Schröder E, Langreth D C and Lundqvist B I 2004 Van der Waals density functional for general geometries Phys. Rev. Lett. 92 246401 Thonhauser T, Cooper V R, Li S, Puzder A, Hyldgaard P and Langreth D C 2007 Van der Waals density functional: self-consistent potential and the nature of the van der Waals bond Phys. Rev. B 76 125112 [7]Lee K, Murray E D, Kong L, Lundqvist B I and Langreth D C 2010 A higher-accuracy van der Waals density functional Phys. Rev. B 82 081101 [8]Rapcewicz K and Ashcroft N W 1991 Fluctuation attraction in condensed matter: a nonlocal functional approach Phys. Rev. B 44 4032 Lundqvist B I, Andersson Y, Shao H, Chan S and Langreth D C 1995 Density functional theory including van der Waals forces Int. J. Quant. Chem. 56 247 [9]Langreth D C et al 2009 A density functional for sparse matter J. Phys.: Condens. Matter 21 084203 [10]For example, Kohn W, Meir Y and Makarov D E 1998 The exchange-correlation energy of a metallic surface Phys. Rev. Lett. 80 4153 Kurth S and Perdew J P 1999 Phys. Rev. B 59 10461 Dobson J F and Wang J 1999 Phys. Rev. Lett. 82 2123 Pitarke J M and Perdew J P 2003 Phys. Rev. B 67 045101 Vydrov O A and van Voorhi T 2009 Phys. Rev. Lett. 103 063004 [11]For example, Grimme S 2004 J. Comput. Phys. 25 1463 Tkatchenko A and Scheffler M 2009 Phys. Rev. Lett. 102 073005 Grimme S, Antony J, Ehrlich S and Krieg H 2010 J. Chem. Phys. 132 154004 [12]Burke K 2012 Perspectives on density functional theory J. Chem. Phys. 136 150901 Van der Waals interactions in advanced materials contents Van der Waals interactions in advanced materials, in memory of David C LangrethPer Hyldgaard and Talat S