WorldWideScience

Sample records for braces

  1. Spanish validation of Bad Sobernheim Stress Questionnaire (BSSQ (brace.es for adolescents with braces

    Directory of Open Access Journals (Sweden)

    Rigo Manuel

    2010-07-01

    Full Text Available Abstract Background As a result of scientific and medical professionals gaining interest in Stress and Health Related Quality of Life (HRQL, the aim of our research is, thus, to validate into Spanish the German questionnaire Bad Sobernheim Stress Questionnaire (BSSQ (mit Korsett, for adolescents wearing braces. Methods The methodology used adheres to literature on trans-cultural adaptation by doing a translation and a back translation; it involved 35 adolescents, ages ranging between 10 and 16, with Adolescent Idiopathic Scoliosis (AIS and wearing the same kind of brace (Rigo System Chêneau Brace. The materials used were a socio-demographics data questionnaire, the SRS-22 and the Spanish version of BSSQ(brace.es. The statistical analysis calculated the reliability (test-retest reliability and internal consistency and the validity (convergent and construct validity of the BSSQ (brace.es. Results BSSQ(brace.es is reliable because of its satisfactory internal consistency (Cronbach's alpha coefficient was 0.809, p It demonstrated convergent validity with SRS-22 since the Pearson correlation coefficient was 0.656 (p Conclusions BSSQ (brace.es is reliable and valid and can be used with Spanish adolescents to assess the stress level caused by the brace.

  2. Spanish validation of Bad Sobernheim Stress Questionnaire (BSSQ (brace).es) for adolescents with braces.

    Science.gov (United States)

    D'Agata, Elisabetta; Testor, Carles Pérez; Rigo, Manuel

    2010-07-15

    As a result of scientific and medical professionals gaining interest in Stress and Health Related Quality of Life (HRQL), the aim of our research is, thus, to validate into Spanish the German questionnaire Bad Sobernheim Stress Questionnaire (BSSQ) (mit Korsett), for adolescents wearing braces. The methodology used adheres to literature on trans-cultural adaptation by doing a translation and a back translation; it involved 35 adolescents, ages ranging between 10 and 16, with Adolescent Idiopathic Scoliosis (AIS) and wearing the same kind of brace (Rigo System Chêneau Brace). The materials used were a socio-demographics data questionnaire, the SRS-22 and the Spanish version of BSSQ(brace).es. The statistical analysis calculated the reliability (test-retest reliability and internal consistency) and the validity (convergent and construct validity) of the BSSQ (brace).es. BSSQ(brace).es is reliable because of its satisfactory internal consistency (Cronbach's alpha coefficient was 0.809, p < 0.001) and temporal stability (test-retest method with a Pearson correlation coefficient of 0.902 (p < 0.01)).It demonstrated convergent validity with SRS-22 since the Pearson correlation coefficient was 0.656 (p < 0.01). By undertaking an Exploratory Principal Components Analysis, a latent structure was found based on two Components which explicate the variance at 60.8%. BSSQ (brace).es is reliable and valid and can be used with Spanish adolescents to assess the stress level caused by the brace.

  3. (Vapor + liquid) equilibrium for the binary systems {l_brace}water + glycerol{r_brace} and {l_brace}ethanol + glycerol, ethyl stearate, and ethyl palmitate{r_brace} at low pressures

    Energy Technology Data Exchange (ETDEWEB)

    Coelho, Renata; Santos, Priscilla G. dos; Mafra, Marcos R. [Department of Chemical Engineering, Federal University of Parana, CEP 81531-990, Curitiba, PR (Brazil); Cardozo-Filho, Lucio [Department of Chemical Engineering, Maringa State University (UEM), Av. Colombo 5790, 87020-900 Maringa, PR (Brazil); Corazza, Marcos L., E-mail: corazza@ufpr.br [Department of Chemical Engineering, Federal University of Parana, CEP 81531-990, Curitiba, PR (Brazil)

    2011-12-15

    Highlights: > We measured VLE for the binary system {l_brace}ethyl stearate and palmitate + ethanol{r_brace}. > The boiling temperatures were obtained using Othmer-type ebuliometer. > The experimental data were modeled using NRTL, UNIQUAC, and UNIFAC models. - Abstract: This work reports the experimental measurements {l_brace}(vapor + liquid) equilibrium{r_brace} for the systems {l_brace}water(1) + glycerol(2){r_brace}, {l_brace}ethanol(1) + glycerol(2){r_brace}, {l_brace}ethanol(1) + ethyl stearate(2){r_brace}, and {l_brace}ethanol(1) + ethyl palmitate(2){r_brace}. Boiling temperatures were measured using an Othmer-type ebulliometer over a pressure range of 14 kPa to 96 kPa. The experimental data were well correlated using the NRTL and UNIQUAC models. The performance of the UNIFAC-Dortmund model in relation to predicting the phase equilibrium of the systems was also studied.

  4. Earthquake response of steel braces and braced steel frames

    OpenAIRE

    Gan, Wenshui

    1996-01-01

    This thesis consists of three parts. Chapter 2 deals with the dynamic buckling behavior of steel braces under cyclic axial end displacement. Braces under such a loading condition belong to a class of "acceleration magnifying" structural components, in which a small motion at the loading points can cause large internal acceleration and inertia. This member-level inertia is frequently ignored in current studies of braces and braced structures. This chapter shows that, under certain conditions, ...

  5. User Survey of 3 Ankle Braces in Soccer, Volleyball, and Running: Which Brace Fits Best?

    Science.gov (United States)

    Janssen, Kasper; Van Den Berg, Anjulie; Van Mechelen, Willem; Verhagen, Evert

    2017-08-01

      Recurrence rates for ankle sprains are high. Therefore, preventive measures such as ankle bracing during sports are recommended.   To systematically evaluate the perceived ease of use, quality, comfort, stability, and hindrance of and the overall satisfaction with 3 contemporary brace types in 3 types of sports.   Randomized comparative user survey.   Recreational sports: soccer, volleyball, and running.   Young adult recreational athletes (29 soccer players, 26 volleyball players, and 31 runners).   Compression brace (CB), lace-up brace (LB), and semirigid brace (SB).   Rating of perceived ease of use, quality, comfort, stability, and hindrance of and overall satisfaction with the brace types during sports on a 5-point Likert scale. The secondary outcome measure was participants' willingness to buy the tested brace.   Overall, the 3 brace types received high mean scores for ease of use and quality. Soccer players preferred the CB over both alternatives, considering the higher scores for comfort (CB = 4.0, LB = 3.5, SB = 2.8), hindrance (CB = 3.7, LB = 2.9, SB = 2.8), overall satisfaction (CB = 3.6, LB = 3.0, SB = 2.5), and greatest willingness to buy this brace. Volleyball players preferred the LB over both alternatives, considering the higher scores for stability (LB = 4.2, CB = 3.2, SB = 3.3), overall satisfaction (LB = 3.8, CB = 3.0, SB = 3.0), and greatest willingness to buy this brace. Runners preferred the CB over both alternatives considering the better score for hindrance (CB = 3.6, LB = 2.8, SB = 2.9) and greatest willingness to buy this brace.   All 3 ankle-brace types scored high on perceived ease of use and quality. Regarding the brace types, soccer players, volleyball players, and runners differed in their assessments of subjective evaluation of comfort, stability, hindrance, overall satisfaction, and willingness to buy the brace. Soccer players and runners preferred the CB, whereas volleyball players preferred the LB.

  6. Cu-capped surface alloys of Pt/Cu left brace 100 right brace

    CERN Document Server

    Alshamaileh, E; Wander, A

    2003-01-01

    The room-temperature deposition of 0.5 monolayer (ML) Pt on Cu left brace 100 right brace followed by annealing to 525 K results in a sharp c(2 x 2) low-energy electron diffraction (LEED) pattern. The structure of this surface alloy is investigated by means of symmetrized automated tensor low-energy electron diffraction (SATLEED) analysis and ab initio plane wave density functional calculations. The results are then compared with those for the similar system 0.5 ML Pd/Cu left brace 100 right brace. SATLEED results for the Pt/Cu left brace 100 right brace show that it consists of an ordered c(2 x 2) Cu-Pt second layer alloy capped with a pure Cu first layer. The first and second interlayer spacings are found to be expanded by +5.1 +- 1.7 and +3.5 +- 1.7% respectively (relative to the bulk Cu interlayer spacing of 1.807 A) due to the insertion of the 8% larger Pt atoms into the second layer. The ordered mixed layer is found to be rippled by 0.08 +- 0.06 A with Pt atoms rippled outwards towards the solid-vacuum ...

  7. Scoliosis brace (image)

    Science.gov (United States)

    ... on the back and ribs to push the spine in a straighter position. The brace usually fits snugly around the torso and can come in many styles. In a child who is still growing, bracing is usually recommended ...

  8. Brace treatment for patients with Scheuermann's disease - a review of the literature and first experiences with a new brace design

    Directory of Open Access Journals (Sweden)

    Turnbull Deborah

    2009-09-01

    Full Text Available Abstract Background In contemporary literature few have written in detail on the in-brace correction effects of braces used for the treatment of hyperkyphosis. Bradford et al. found their attempts effective, treating Scheuermann's kyphosis with Milwaukee braces, but their report did not specifically focus on in-brace corrections. White and Panjabi's research attempted to correct a curvature of > 50° with the help of distraction forces, but consequently led to a reduction in patient comfort in the application of the Milwaukee brace. In Germany they avoid this by utitlising braces to treat hyperkyphosis that use transverse correction forces instead of distraction forces. Further efforts to reduce brace material have resulted in a special bracing design called kyphologic™ brace. The aim of this review is to present appropriate research to collect and evaluate possible in-brace corrections which have been achieved with brace treatment for hyperkyphosis. This paper introduces new methods of bracing and compares the results of these with other successful bracing concepts. Materials and methods 56 adolescents with the diagnosis of thoracic Scheuermann's hyperkyphosis or a thoracic idiopathic hyperkyphosis (22 girls and 34 boys with an average age of 14 years (12-17 yrs. were treated with the kyphologic™ brace between May 2007 and December 2008. The average Stagnara angle was 55,6° (43-80. In-brace correction was recorded and compared to the initial angle using the t-test. Results The average Stagnara angle in the brace was 39°. The average in-brace correction was 16.5° (1-40°. The verage percentage of in-brace correction compared to the initial value was 36%. The differences were significant in the t-test (t = 5.31, p Discussion If we assume that outcome of brace treatment positively correlates with in-brace correction, the treatment should be initiated before the curvature angle exceeds 50 - 55° in a growing adolescent. In scoliosis bracing

  9. NTERIOR CRUCIATE LIGAMENT RECONSTRUCTION: WITH BRACE VS WITHOUT BRACE AFTER OPERATION A RANDOMIZED CONTROLLED CLINICAL TRIAL

    Directory of Open Access Journals (Sweden)

    KH.A NAZEM

    2002-03-01

    Full Text Available Introduction. Anterior cruciate ligament (ACL ruputer specially in athletics induces knee instability results in pateint disability. Surgical treatment consist of ACL reconstruction and repair. In this study the efficacy of surgical management with brace after operation was compaired to surgical management without brace.
    Methods. One hundred ACL ruptured pateints had reconstructed with BPB graft in two randomzed gruops (50 with brace afetr operation and 50 without brace. Study durated 4 year (1997-2000 in alzahra hospital (affiliated to IUMSHS. Patients had followed for 12 months after operation.
    Results. Knee range of motion after 1, 3, 6, 12 months follow up were the same in both groups (P > 0.05. Degree and duration of returning to sport, complications, need to reoperation, stair climbing, specific ACL tests, patelofemoral pain, pain in squatting, running and cutting and quadriceps atrophy, after 12 months follow up were the same in both groups (P > 0.05. Patients without brace returned to their job more sooner than another group (P < 0.05.
    Discussion. There are no significant differnce in cilinical results in tow groups and ACL reconstruction with BPB dose not require to routine bracing. Faster return to job in non bracing group is due to removal of liminting effect of brace wearing. Lesser rate of pain in patients that return to sport due to quadriceps strengthening.

  10. Brace technology thematic series - The Sforzesco and Sibilla braces, and the SPoRT (Symmetric, Patient oriented, Rigid, Three-dimensional, active concept

    Directory of Open Access Journals (Sweden)

    Marchini Gianfranco

    2011-05-01

    Full Text Available Abstract Background Bracing is an effective strategy for scoliosis treatment, but there is no consensus on the best type of brace, nor on the way in which it should act on the spine to achieve good correction. The aim of this paper is to present the family of SPoRT (Symmetric, Patient-oriented, Rigid, Three-dimensional, active braces: Sforzesco (the first introduced, Sibilla and Lapadula. Methods The Sforzesco brace was developed following specific principles of correction. Due to its overall symmetry, the brace provides space over pathological depressions and pushes over elevations. Correction is reached through construction of the envelope, pushes, escapes, stops, and drivers. The real novelty is the drivers, introduced for the first time with the Sforzesco brace; they allow to achieve the main action of the brace: a three-dimensional elongation pushing the spine in a down-up direction. Brace prescription is made plane by plane: frontal (on the "slopes", another novelty of this concept, i.e. the laterally flexed sections of the spine, horizontal, and sagittal. The brace is built modelling the trunk shape obtained either by a plaster cast mould or by CAD-CAM construction. Brace checking is essential, since SPoRT braces are adjustable and customisable according to each individual curve pattern. Treatment time and duration is individually tailored (18-23 hours per day until Risser 3, then gradual reduction. SEAS (Scientific Exercises Approach to Scoliosis exercises are a key factor to achieve success. Results The Sforzesco brace has shown to be more effective than the Lyon brace (matched case/control, equally effective as the Risser plaster cast (prospective cohort with retrospective controls, more effective than the Risser cast + Lyon brace in treating curves over 45 degrees Cobb (prospective cohort, and is able to improve aesthetic appearance (prospective cohort. Conclusions The SPoRT concept of bracing (three-dimensional elongation pushing in

  11. Brace technology thematic series: the progressive action short brace (PASB

    Directory of Open Access Journals (Sweden)

    Aulisa Angelo G

    2012-02-01

    Full Text Available Abstract Background The Progressive Action Short Brace (PASB is a custom-made thoraco-lumbar-sacral orthosis (TLSO, devised in 1976 by Dr. Lorenzo Aulisa (Institute of Orthopedics at the Catholic University of the Sacred Heart, Rome, Italy. The PASB was designed to overcome the limits imposed by the trunk anatomy. Indeed, the particular geometry of the brace is able to generate internal forces that modify the elastic reaction of the spine. The PASB is indicated for the conservative treatment of lumbar and thoraco-lumbar scoliosis. The aim of this article is to explain the biomechanic principles of the PASB and the rationale underlying its design. Recently published studies reporting the results of PASB-based treatment of adolescent scoliotic patients are also discussed. Description and principles On the coronal plane, the upper margin of the PASB, at the side of the curve concavity, prevents the homolateral bending of the scoliotic curve. The opposite upper margin ends just beneath the apical vertebra. The principle underlying such configuration is that the deflection of the inferior tract of a curved elastic structure, fixed at the bottom end, causes straightening of its upper tract. Therefore, whenever the patient bends towards the convexity of the scoliotic curve, the spine is deflected. On the sagittal plane, the inferior margins of the PASB reach the pelvitrochanteric region, in order to stabilize the brace on the pelvis. The transverse section of the brace above the pelvic grip consists of asymmetrical ellipses. This allows the spine to rotate towards the concave side only, leading to the continuous generation of derotating moments. On the sagittal plane, the brace is contoured so as to reduce the lumbar lordosis. The PASB, by allowing only those movements counteracting the progression of the curve, is able to produce corrective forces that are not dissipated. Therefore, the brace is based on the principle that a constrained spine dynamics

  12. Competition of the Peierls relief and structural defects in damping the domain walls in [Mn left brace (R/S)-pn right brace]2[Mn left brace(R/S)-pn right brace2(H2O)][Cr(CN)6]2 ferrimagnet

    International Nuclear Information System (INIS)

    Talantsev, A.D.; Kollak, O.V.; Kirman, M.V.; Morgunov, R.B.

    2015-01-01

    The [ [Mn left brace (R/S)-pn right brace] 2 [Mn left brace(R/S)-pn right brace 2 (H 2 O)][Cr(CN) 6 ] 2 molecular ferrimagnet exhibits an inverse sequence of changes in the domain wall motion regimes with increasing temperature in alternative magnetic field of 0.04-1400 Hz frequency. Initiation of the relaxation regime on the background of creep indicates that there are two different systems of the domain walls damping. The threshold amplitude of the alternative magnetic field corresponds to the Peierls relief contribution to the domain wall dynamics as well as the defect contribution usually considered.

  13. The SPoRT concept of bracing for idiopathic scoliosis.

    Science.gov (United States)

    Zaina, Fabio; Fusco, Claudia; Atanasio, Salvatore; Negrini, Stefano

    2011-01-01

    The SPoRT (acronym: Symmetrical, Patient-oriented, Rigid, Three-dimensional, active) concept of bracing is a new way to build braces based on our 20 years of experience and the biomechanical principles of scoliosis correction, inclusive of the Sibilla and Sforzesco braces. The concept always requires a custom brace, which is made according to the patient's individual requirements. New technologies such as CAD-CAM can be applied, and often for better results, without the customary use of prebuilt forms whose measurements are stored in databases. Once the initial draft brace is completed, a final test must be made on the patient to modify and adapt it, depending on his or her real interaction between the body and the brace. The results that are today available on the SPoRT concept relate to the Sforzesco brace and are necessarily short-term, because the first treated patients are now reaching the fourth-year follow-up examination and haven't yet completed their treatments. On the basis of the initial evaluations, we can state that the Sforzesco brace is more effective than the Lyon brace after 6 months of treatment and that the Sforzesco brace is equally effective as the Risser Plast brace.

  14. Braces

    Science.gov (United States)

    ... wear a retainer , which is a small, hard piece of plastic with metal wires or a thin piece of plastic shaped like a mouthguard. Retainers make ... More on this topic for: Kids Word! Braces Going to the Dentist Going to the Orthodontist Taking ...

  15. Isothermal (vapour + liquid) equilibrium for the binary {l_brace}1,1,2,2-tetrafluoroethane (R134) + propane (R290){r_brace} and {l_brace}1,1,2,2-tetrafluoroethane (R134) + isobutane (R600a){r_brace} systems

    Energy Technology Data Exchange (ETDEWEB)

    Dong Xueqiang [Key Laboratory of Cryogenics, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, P.O. Box 2711, Beijing 100190 (China); Graduate University of Chinese Academy of Sciences, Beijing 100039 (China); Gong Maoqiong, E-mail: gongmq@mail.ipc.ac.c [Key Laboratory of Cryogenics, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, P.O. Box 2711, Beijing 100190 (China); Liu Junsheng [Key Laboratory of Cryogenics, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, P.O. Box 2711, Beijing 100190 (China); Graduate University of Chinese Academy of Sciences, Beijing 100039 (China); Wu Jianfeng, E-mail: jfwu@mail.ipc.ac.c [Key Laboratory of Cryogenics, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, P.O. Box 2711, Beijing 100190 (China)

    2010-09-15

    (Vapour + liquid) equilibrium (VLE) data for the binary systems of {l_brace}1,1,2,2-tetrafluoroethane (R134) + propane (R290){r_brace} and {l_brace}1,1,2,2-tetrafluoroethane (R134) + isobutane (R600a){r_brace} were measured with a recirculation method at the temperatures ranging from (263.15 to 278.15) K and (268.15 to 288.15) K, respectively. All of the data were correlated by the Peng-Robinson (PR) equation of state (EoS) with the Huron-Vidal (HV) mixing rules utilizing the non-random two-liquid (NRTL) activity coefficient model. Good agreement can be found between the experimental data and the correlated results. Azeotropic behaviour can be found at the measured temperature ranges for these two mixtures.

  16. Simulation of Scoliosis Treatment Using a Brace

    Directory of Open Access Journals (Sweden)

    J. Čulík

    2004-01-01

    Full Text Available Ivo Maoík M.D. has treated many child patients with scoliosis at the "Centre for Locomotor Defects", Olšanská 7, 130 00 Prague 3. The author has cooperated with him, and composed the computer program for the spine stress state under brace effects and for simulating scoliosis treatment. The program simulates the spinal curve remodelling in time for a specific child patients, and the algorithm for stress state calculation and treatment simulation is given.Orthopaedists in the Czech Republic use Cheneau-type or Cerny-type corrective braces. The brace exerts force effects on the skeleton of a child. The brace is made individually for each patient, in the following way: first, a negative plaster form of the child`s trunk is made, and then the positive plaster form is created. The orthopaedist determines the places where brace has to load the patient`s trunk, and the plaster form deepened in these places on the basis of his advice. The laminate brace made according to this plaster form constricts the child`s trunk (like a tight shoe.This paper shows how the stress state is determined in vertebrae and in inter-vertebral discs, and the solution of spinal curvature correction under brace force effects for a specific child patient. The project aims to find the dependence of the activation and velocity of spinal curvature correction in the spinal stress state for many patients. The paper shows the computing algorithms for spinal deformations and the stress state under brace force effects, and a simulation of spinal curvature correction.Spinal curvature is determined according to measured values on an X-ray of a patient before a brace is applied. The stress state in the spine and the spinal deformation are investigated by the finite element method as beam (spine in an elastic ground (soft tissue. Two algorithms are used. The first algorithm deals with the spine above and below the soft tissues, and it is loaded by given displacements of the trunk surface

  17. Effect of uniaxial strain on adatom diffusion across {l_brace}1 1 1{r_brace}-faceted step

    Energy Technology Data Exchange (ETDEWEB)

    Yang Jianyu, E-mail: wuliyangjianyu@yahoo.com.cn [Department of Maths and Physics, Hunan Institute of Engineering, Donghu Street, Xiangtan 411104 (China); Hu Wangyu, E-mail: Wangyuhu2001@yahoo.com.cn [Department of Applied Physics, Hunan University, Changsha 410082 (China); Tang Jianfeng [Department of Applied Physics, Hunan Agricultural University, Changsha 410128 (China)

    2011-02-01

    Diffusion of Pt adatom across the strained {l_brace}1 1 1{r_brace}-faceted step is studied by embedded atom method along with nudged elastic band method. For adatom on the flat (1 1 1) surface, the anisotropic diffusion behavior is found as the uniaxial strain is imposed. For the strained {l_brace}1 1 1{r_brace}-faceted step, our results show that the maximum energy barrier for adatom crossing step edge remains approximately constant as the strain varied from -1.0% to 1.0%, and there is a rise as the larger uniaxial strain is applied. The calculated energy barrier for adatom diffusion along the step edge increases with increasing tensile strain, and the slope of the straight line is small.

  18. Anisotropy and magnetostriction as corrections for the Heisenberg model at the example of the molecule {l_brace}Ni{sub 4}Mo{sub 12}{r_brace}; Anisotropie und Magnetostriktion als Korrekturen zum Heisenberg-Modell am Beispiel des Molekuels {l_brace}Ni{sub 4}Mo{sub 12}{r_brace}

    Energy Technology Data Exchange (ETDEWEB)

    Brueger, Mirko

    2008-07-15

    In the first part of this thesis the different effects of the molecular magnetism were extensively considered and the possibility of their occurence in {l_brace}Ni{sub 4}Mo{sub 12}{r_brace} checked. In the second part of this thesis different models for the description of experimental results were presented. thereby the results of ESR, SQUIO, and high-field pulse measurements on {l_brace}Ni{sub 4}Mo{sub 12}{r_brace} are described.

  19. New Generation Lockable Knee Brace

    Science.gov (United States)

    2000-01-01

    A knee brace that uses Space Shuttle propulsion technology has moved a step closer to being available to help knee injury and stroke patients and may possibly benefit patients with birth defects, spinal cord injuries, and post-polio conditions. After years of hard work, inventors at NASA's Marshall Space Flight Center (MSFC) in Huntsville, Alabama, have turned over the final design and prototype to industry partners at Horton's Orthotic Lab in Little Rock, Arkansas for further clinical testing. The device, called the Selectively Lockable Knee Brace, may mean faster, less painful rehabilitation for patients by allowing the knee to move when weight is not on the heel. Devices currently on the market lock the knee in a rigid, straight-leg position, or allow continuous free motion. The knee brace is just one example of how space technology is being used to improve the lives of people on Earth. NASA's MSFC inventors Michael Shadoan and Neill Myers are space propulsion engineers who use the same mechanisms and materials to build systems for rockets that they used to design and develop the knee brace.

  20. Initial experience with the providence nighttime bracing in adolescent idiopathic scoliosis

    DEFF Research Database (Denmark)

    Quisth, Lena; Beuschau, Inge; Simony, A.

    2015-01-01

    Background: Since 2008 the primary non-surgical treatment of adolescent idiopathic scoliosis (AIS) in the southern part of Denmark, went from full-time bracing with Boston brace, to Providence nighttime bracing. Aim: To evaluate the effectiveness of nighttime bracing, with the Providence brace...... with the Providence nighttime brace and an acceptable 18 % failure rate. The nighttime brace is an excellent alternative to standard conservative treatment, and reduces the need for physiotherapy after brace termination. The patients tolerate the nighttime brace treatment well, and compliance within the cohort......, in AIS. Method: Patients diagnosed with AIS. With an apex from TH7 and below and with a cobb angel between 20-45 degrees. The patients were evaluated every 6 months with standing x-rays and the brace treatment was continued until two years post menarche. Cobb angle of the major curve pretreatment, in...

  1. Dynamic extensor brace for lateral epicondylitis.

    NARCIS (Netherlands)

    Faes, M.C.; Akker, B. van den; Lint, J.A. de; Kooloos, J.G.M.; Hopman, M.T.E.

    2006-01-01

    Lateral epicondylitis (tennis elbow) is a common, often disabling ailment. Based on the failure of current therapies, a new dynamic extensor brace has been developed. In this study, the effects of application of this brace for 3 months on the most important and disabling symptoms of patients with

  2. Providence nighttime bracing, in treatment of adolescent idiopathic scoliosis

    DEFF Research Database (Denmark)

    Simony, A.; Beuschau, Inge; Quisth, Lena

    2015-01-01

    Introduction: Since 2008 the non-surgical treatment of adolescent idiopathic scoliosis (AIS) in the southern part of Denmark, went from full-time bracing with Boston brace, to Providence night-time bracing. Methods: Since 2008, skeletally immature patients diagnosed with AIS and a primary curve w...

  3. Eccentric bracing of steel frames in seismic design

    International Nuclear Information System (INIS)

    Popov, E.P.; Manheim, D.

    1981-01-01

    The general concepts of designing eccentrically braced steel frames are discussed. A number of possible bracing configurations are pointed out which are suitable for this type of framing. The necessity for considering the collapse mechanism for the selected frame is brought out, and the need for considering the ductility demands for the critical elements is indicated. The need for web stiffness along the critical beam elements (links), and the necessity for lateral bracing at the potential plastic hinges is emphasized. Properly designed eccentrically braced frames provide good drift control for moderate earthquakes, and good ductility for extreme earthquakes. Experience gained in practice attests to the practicality and economy of this kind of framing. The major disadvantage of properly designed eccentrically braced frames lies in the fact that high local distortions may occur during a severe earthquake requiring repair. However, such severe distortions should attenuate rapidly from the damaged areas. (orig./HP)

  4. 49 CFR 195.208 - Welding of supports and braces.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Welding of supports and braces. 195.208 Section 195.208 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS... HAZARDOUS LIQUIDS BY PIPELINE Construction § 195.208 Welding of supports and braces. Supports or braces may...

  5. Three dimensional analysis of brace biomechanical efficacy for patients with AIS

    DEFF Research Database (Denmark)

    Lebel, David E; Al-Aubaidi, Zaid; Shin, Eyun-Jung

    2013-01-01

    Corrective three dimensional (3D) effect of different braces is debatable. We evaluated differences in in-brace radiographic correction comparing a custom thoracic-lumbo-sacral-orthosis (TLSO) (T) brace to a Chêneau type TLSO (C) brace using 3D EOS reconstruction technology. Our primary research ...

  6. Corrective Bracing for Severe Idiopathic Scoliosis in Adolescence: Influence of Brace on Trunk Morphology

    Directory of Open Access Journals (Sweden)

    Edyta Kinel

    2012-01-01

    Full Text Available Aim. The aim of the work was to study whether wearing a corrective brace by adolescent girls with severe idiopathic scoliosis can influence external shape of the trunk. Methods. Comparison of clinical deformity of two groups of girls matched for age and Cobb angle: group (1 of 23 girls, aged 14.9±1.3 years, Cobb angle 55.0°±6.8°, who refused surgical treatment and have been wearing Chêneau brace for more than 6 months, compared with group (2 of 22 girls, aged 14.1±1.8 years, Cobb angle 59.7°±14.6° never treated with corrective bracing. Clinical deformity was assessed with the Bunnell scoliometer (angle of trunk rotation ATR and surface topography (posterior trunk symmetry index POTSI and Hump Sum HS. Results. The ATR in the primary curvature was 11.9°±3.4° (5°–18° in group 1 versus 15.1°±5.6° (6°–25° in group 2 (P=0.027. The HS was 16.8°±3.8 versus 19.2°±4.6, respectively, P=0.07. The POTSI value did not differ between groups. Conclusion. Girls with Cobb angle above 45 degrees, who have been subjected to brace treatment, revealed smaller clinical deformity of their back comparing to nontreated girls having similar radiological curvatures.

  7. MINIMUM BRACING STIFFNESS FOR MULTI-COLUMN SYSTEMS: THEORY

    OpenAIRE

    ARISTIZÁBAL-OCHOA, J. DARÍO

    2011-01-01

    A method that determines the minimum bracing stiffness required by a multi-column elastic system to achieve non-sway buckling conditions is proposed. Equations that evaluate the required minimum stiffness of the lateral and torsional bracings and the corresponding “braced" critical buckling load for each column of the story level are derived using the modified stability functions. The following effects are included: 1) the types of end connections (rigid, semirigid, and simple); 2) the bluepr...

  8. Different coordination modes for disulfoxides towards diorganotin(IV) dichlorides. X-ray crystal structures of 1,2-cis-bis-(phenylsulfinyl)ethene (rac-,cis-cbpse) and adducts [{l_brace}Ph{sub 2}SnCl{sub 2}(meso-bpse){r_brace}{sub n}] and [{l_brace}n-Bu{sub 2}SnCl{sub 2}(pdtd){r_brace}{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Sousa, Gerimario F. de [Universidade de Brasilia (UnB), DF (Brazil). Inst. de Quimica], e-mail: gfreitas@unb.br; Ellena, Javier [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Fisica; Malta, Valeria R.S. [Universidade Federal de Alagoas (UFAL), Maceio, AL (Brazil). Dept. de Quimica e Biotecnologia; Ardisson, Jose D. [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Lab. de Fisica Aplicada

    2009-07-01

    The reactions of meso-1,2-bis(phenylsulfinyl)ethane (meso-bpse) with Ph{sub 2}SnCl{sub 2}, 2-phenyl-1,3-dithiane trans-1-trans-3-dioxide (pdtd) with n-Bu{sub 2}SnCl{sub 2} and 1,2-cis-bis-(phenylsulfinyl) ethene (rac-,cis-cbpse) with Ph{sub 2}SnCl{sub 2}, in 1:1 molar ratio, yielded [{l_brace}Ph{sub 2}SnCl{sub 2}(meso-bpse){r_brace}{sub n}], [{l_brace}n-Bu{sub 2}SnCl{sub 2}(pdtd){r_brace}{sub 2}] and [{l_brace}Ph{sub 2}SnCl{sub 2}(rac,cis-cbpse){r_brace}x] (x = 2 or n), respectively. All adducts were studied by IR, Moessbauer and {sup 119}Sn NMR spectroscopic methods, elemental analysis and single crystal X-ray diffractometry. The X-ray crystal structure of [{l_brace}Ph{sub 2}SnCl{sub 2}(meso-bpse){r_brace}{sub n}] revealed the occurrence of infinite chains in which the tin(IV) atoms appear in a distorted octahedral geometry with Cl atoms in cis and Ph groups in trans positions. The X-ray crystal structure of [{l_brace}n-Bu{sub 2}SnCl{sub 2}(pdtd){r_brace}{sub 2}] revealed discrete centrosymmetric dimeric species in which the tin(IV) atoms possess a distorted octahedral geometry with bridging disulfoxides in cis and n-butyl moieties in trans positions. The spectroscopic data indicated that the adduct containing the rac,cis-cbpse ligand can be dimeric or polymeric. The X-ray structural analysis of the free rac-,cis-cbpse sulfoxide revealed that the crystals belong to the C2/c space group. (author)

  9. Development and preliminary validation of Brace Questionnaire (BrQ: a new instrument for measuring quality of life of brace treated scoliotics

    Directory of Open Access Journals (Sweden)

    Gkoltsiou Konstantina

    2006-05-01

    Full Text Available Abstract Background The quality of life among children with idiopathic scoliosis during their adolescence has been reported to be affected by the brace itself. However, a controversy exists whether brace treated scoliotics experience a poor quality of life, thus there is a need for the development of a brace-oriented instrument, as the now-existing questionnaires that are commonly used, such as the SRS -22, take into consideration the effects of both the conservative and the surgical treatment on quality of life of scoliotic children. The aim of the present study is to assess the validity and reliability of Brace Questionnaire (BrQ, a new instrument for measuring quality of life of scoliotic adolescents who are treated conservatively with a brace. Material-method Methodology of development involved literature review, patient and health care professionals' in-depth interviews and content validity analysis on patients. A validation study was performed on 28 brace treated scoliotic children aged between 9 and 18 years old. BrQ was assessed for the following psychometric properties: item convergent validity, floor and ceiling effects, internal consistency reliability, clinical validity and responsiveness to change. Results BrQ is self administrated and developmentally appropriate for ages 9 to 18 years old and is consisted of 34 Likert-scale items associated with eight domains: general health perception, physical functioning, emotional functioning, self esteem and aesthetics, vitality, school activity, bodily pain and social functioning of scoliotic children treated conservatively with a brace. The subscales of these eight dimensions can be combined to produce a total score. Higher scores mean a better quality of life. An item convergent validity ≥ 0.40 was satisfied by all items in the present study. A satisfactory internal consistency reliability for the BrQ was recorded (Cronbach's alpha coefficient was 0.82. There were no floor or ceiling

  10. A prospective randomized controlled study on the treatment outcome of SpineCor brace versus rigid brace for adolescent idiopathic scoliosis with follow-up according to the SRS standardized criteria.

    Science.gov (United States)

    Guo, Jing; Lam, Tsz Ping; Wong, Man Sang; Ng, Bobby Kin Wah; Lee, Kwong Man; Liu, King Lok; Hung, Lik Hang; Lau, Ajax Hong Yin; Sin, Sai Wing; Kwok, Wing Kwan; Yu, Fiona Wai Ping; Qiu, Yong; Cheng, Jack Chun Yiu

    2014-12-01

    SpineCor is a relatively innovative brace for non-operative treatment of adolescent idiopathic scoliosis (AIS). However, the effectiveness of SpineCor still remains controversial. The objective of the current study was to compare the treatment outcomes of SpineCor brace with that of rigid brace following the standardized Scoliosis Research Society (SRS) criteria on AIS brace study. Females subjects with AIS and aged 10-14 were randomly allocated into two groups undergoing treatment of SpineCor (S Group, n = 20) or rigid brace (R Group, n = 18). During SpineCor treatment, patients who had curve progression of >5° would be required to switch to rigid brace treatment. The effectiveness of the two brace treatments was assessed using the SRS standardized criteria. Before skeletal maturity, 7 (35.0%) patients in the S Group and 1 (5.6%) patient in the R Group had curve progression >5° (P = 0.026). At skeletal maturity, 5 of the 7 (71.4%) patients who failed with SpineCor bracing showed control from further progression by changing to rigid bracing. At the latest follow-up with a mean duration of 45.1 months after skeletally maturity, 29.4% of patients who were successfully treated by rigid brace showed further curve progression beyond skeletal maturity, versus 38.5% of patients in the SpineCor group (P > 0.05). For both groups, the primary curves were slightly improved at the time of brace weaning, but additionally increased at the latest follow-up, with a rate of 1.5° per year for post-maturity progression. Curve progression rate was found to be significantly higher in the SpineCor group when compared with the rigid brace group. Changing to rigid bracing could control further curve progression for majority of patients who previously failed with SpineCor bracing. For both SpineCor and rigid brace treatments, 30-40% of patients who were originally successfully treated by bracing would exhibit further curve progression beyond skeletal maturity. The post

  11. Scoliosis brace design: influence of visual aesthetics on user acceptance and compliance.

    Science.gov (United States)

    Law, Derry; Cheung, Mei-Chun; Yip, Joanne; Yick, Kit-Lun; Wong, Christina

    2017-06-01

    Adolescent idiopathic scoliosis is a common condition found in adolescents. A rigid brace is often prescribed as the treatment for this spinal deformity, which negatively affects user compliance due to the discomfort caused by the brace, and the psychological distress resulting from its appearance. However, the latter, which is the impact of visual aesthetics, has not been thoroughly studied for scoliosis braces. Therefore, a qualitative study with in-depth interviews has been carried out with 10 participants who have a Cobb angle of 20°-30° to determine the impact of visual aesthetics on user acceptance and compliance towards the brace. It is found that co-designing with patients on the aesthetic aspects of the surface design of the brace increases the level of user compliance and induces positive user perception. Therefore, aesthetic preferences need to be taken into consideration in the design process of braces. Practitioner Summary: The impact of visual aesthetics on user acceptance and compliance towards a rigid brace for scoliosis is investigated. The findings indicate that an aesthetically pleasing brace and the involvement of patients in the design process of the brace are important for increasing user compliance and addressing psychological issues during treatment.

  12. Cyclic Testing of Steel Chevron Braces with Vertically Slotted Beam Connection

    Directory of Open Access Journals (Sweden)

    Rozlyn K. Bubela

    2010-07-01

    Full Text Available Experimental tests were performed to study the seismic behavior and performance of modified steel chevron braced frame systems, which incorporate a vertical slotted connection (VSC detail between the top of the braces and the floor beam above. The VSC detail is intended to prevent vertical load transfer to the beam and limit brace forces to the compressive resistance of the members. Full-scale quasi-static cyclic tests were performed on two specimens with hollow tube braces, with one specimen having the braces filled with concrete. Both frames exhibited stable, predictable behavior under cyclic loading. The VSC detail provided free vertical movement of the brace assembly during both tests. However, its flexibility created a moderate reduction in the overall lateral stiffness of the frame. The concrete-filled tube specimen sustained higher peak loads, demonstrated greater residual strength and dissipated more energy than the hollow tube specimen due to the partial inhibition of local buckling by the concrete core. It was found that the VSC chevron braced frame system is a suitable concept for use in buildings in high-risk seismic zones.

  13. Workflow of CAD / CAM Scoliosis Brace Adjustment in Preparation Using 3D Printing.

    Science.gov (United States)

    Weiss, Hans-Rudolf; Tournavitis, Nicos; Nan, Xiaofeng; Borysov, Maksym; Paul, Lothar

    2017-01-01

    High correction bracing is the most effective conservative treatment for patients with scoliosis during growth. Still today braces for the treatment of scoliosis are made by casting patients while computer aided design (CAD) and computer aided manufacturing (CAM) is available with all possibilities to standardize pattern specific brace treatment and improve wearing comfort. CAD / CAM brace production mainly relies on carving a polyurethane foam model which is the basis for vacuuming a polyethylene (PE) or polypropylene (PP) brace. Purpose of this short communication is to describe the workflow currently used and to outline future requirements with respect to 3D printing technology. Description of the steps of virtual brace adjustment as available today are content of this paper as well as an outline of the great potential there is for the future 3D printing technology. For 3D printing of scoliosis braces it is necessary to establish easy to use software plug-ins in order to allow adding 3D printing technology to the current workflow of virtual CAD / CAM brace adjustment. Textures and structures can be added to the brace models at certain well defined locations offering the potential of more wearing comfort without losing in-brace correction. Advances have to be made in the field of CAD / CAM software tools with respect to design and generation of individually structured brace models based on currently well established and standardized scoliosis brace libraries.

  14. A new dual bracing system for improving the seismic behavior of steel structures

    International Nuclear Information System (INIS)

    Kari, A; Ghassemieh, M; Abolmaali, S A

    2011-01-01

    Shape memory alloy braces and buckling restrained braces have been shown to exhibit favorable energy dissipating characteristics in steel structures. However, buckling restrained braces are unable to recover their original shape after unloading and consequently experience large residual inter-story drifts after the earthquake, which leads to large permanent deformations in the structure. On the other hand, shape memory braces possess the recentering feature which enables them to recover their original shape. Nevertheless, compared to buckling restrained braced frames, the shape memory bracing frame usually experiences larger maximum inter-story drifts during the earthquake. This paper presents the results of a numerical study conducted to investigate the benefit of using the combination of buckling restrained braces and shape memory braces (dual bracing) in one structure, for the new design as well as retrofitting purposes. The superelastic model of shape memory alloy and plasticity model of steel are incorporated into the nonlinear finite element program particularly developed for this research. Results revealed that, with the proper configuration, both aims, namely minimizing both residual and maximum inter-story drifts, can be attained

  15. Treatment of osteoarthritis of the knee with bracing: a scoping review

    Directory of Open Access Journals (Sweden)

    Steven Phillips

    2016-06-01

    Full Text Available Knee osteoarthritis is a leading cause of disability around the world. Knee bracing provides a conservative management option for symptom relief. A variety of different bracing types, manufacturers and products are currently available on the market. The goal of this study is to examine the current state of the literature regarding the treatment of knee osteoarthritis with unloader bracing, specifically examining the representation of specific brace types, manufacturers and models within the literature. A scoping review technique was used because of its ability to evaluate research activity within an area of study and identify gaps within the literature. A thorough search of the MEDLINE database was conducted for articles where a knee brace model was identified, and we identified characteristics of the studies to evaluate important information about the body of literature related to knee bracing for the treatment of osteoarthritis. Fifty eligible studies were identified. The majority of studies have been published in the United States, and a large increase in the number of publications in this field was seen between 2010-2014. The most prominent study type was prospective comparative studies (44%, however there is a lack of randomized controlled trials (6% within the literature. The most prominent hinge type within the literature is the dual hinge push brace, followed by the single hinge pull. While a large increase in the number of studies evaluating the treatment of knee osteoarthritis with bracing has occurred in the past 5 years, there is a lack of high quality studies evaluating the efficacy of the technique, as well as a lack of studies comparing bracing types and models.

  16. Quantifying the Lateral Bracing Provided by Standing Steam Roof Systems

    OpenAIRE

    Sorensen, Taylor J.

    2016-01-01

    One of the major challenges of engineering is finding the proper balance between economical and safe. Currently engineers at Nucor Corporation have ignored the additional lateral bracing provided by standing seam roofing systems to joists because of the lack of methods available to quantify the amount of bracing provided. Based on the results of testing performed herein, this bracing is significant, potentially resulting in excessively conservative designs and unnecessary costs. This proje...

  17. Cervical bracing practices after degenerative cervical surgery: a survey of cervical spine research society members.

    Science.gov (United States)

    Lunardini, David J; Krag, Martin H; Mauser, Nathan S; Lee, Joon Y; Donaldson, William H; Kang, James D

    2018-05-21

    Context: Prior studies have shown common use of post-operative bracing, despite advances in modern day instrumentation rigidity and little evidence of brace effectiveness. To document current practice patterns of brace use after degenerative cervical spine surgeries among members of the Cervical Spine Research Society (CSRS), to evaluate trends, and to identify areas of further study. A questionnaire survey METHODS: A 10 question survey was sent to members of the Cervical Spine Research Society to document current routine bracing practices after various common degenerative cervical spine surgical scenarios, including fusion and non-fusion procedures. The overall bracing rate was 67%. This included 8.4% who used a hard collar in each scenario. Twenty-two percent of surgeons never used a hard collar, while 34% never used a soft collar, and 3.6% (3 respondents) did not use a brace in any surgical scenario. Bracing frequency for specific surgical scenarios varied from 39% after foraminotomy to 88% after multi-level corpectomy with anterior & posterior fixation. After one, two and three level anterior cervical discectomy & fusion (ACDF), bracing rates were 58%, 65% and 76% for an average of 3.3, 4.3 and 5.3 weeks, respectively. After single level corpectomy, 77% braced for an average of 6.2 weeks. After laminectomy and fusion, 72% braced for an average of 5.4 weeks. Significant variation persists among surgeons on the type and length of post-operative brace usage after cervical spine surgeries. Overall rates of bracing have not changed significantly with time. Given the lack evidence in the literature to support bracing, reconsidering use of a brace after certain surgeries may be warranted. Copyright © 2018. Published by Elsevier Inc.

  18. Behaviour of Strengthened RC Frames with Eccentric Steel Braced Frames

    Science.gov (United States)

    Kamanli, Mehmet; Unal, Alptug

    2017-10-01

    After devastating earthquakes in recent years, strengthening of reinforced concrete buildings became an important research topic. Reinforced concrete buildings can be strengthened by steel braced frames. These steel braced frames may be made of concentrically or eccentrically indicated in Turkish Earthquake Code 2007. In this study pushover analysis of the 1/3 scaled 1 reinforced concrete frame and 1/3 scaled 4 strengthened reinforced concrete frames with internal eccentric steel braced frames were conducted by SAP2000 program. According to the results of the analyses conducted, load-displacement curves of the specimens were compared and evaluated. Adding eccentric steel braces to the bare frame decreased the story drift, and significantly increased strength, stiffness and energy dissipation capacity. In this strengthening method lateral load carrying capacity, stiffness and dissipated energy of the structure can be increased.

  19. Prophylactic Bracing Has No Effect on Lower Extremity Alignment or Functional Performance.

    Science.gov (United States)

    Hueber, Garrett A; Hall, Emily A; Sage, Brad W; Docherty, Carrie L

    2017-07-01

    Prophylactic ankle bracing is commonly used during physical activity. Understanding how bracing affects body mechanics is critically important when discussing both injury prevention and sport performance. The purpose is to determine if ankle bracing affects lower extremity mechanics during the Landing Error Scoring System test (LESS) and Sage Sway Index (SSI). Thirty physically active participants volunteered for this study. Participants completed the LESS and SSI in both a braced and unsupported conditions. Total errors were recorded for the LESS. Total errors and time (seconds) were recorded for the SSI. The Wilcoxon signed-rank test was utilized to evaluate any differences between the brace conditions for each dependent variable. A priori alpha level was set at pWilcoxon signed-rank test yielded no significant difference between the braced and unsupported conditions for the LESS (Z=-0.35, p=0.72), SSI time (Z=-0.36, p=0.72), or SSI Errors (Z=-0.37, p=0.71). Ankle braces had no effect on subjective clinical assessments of lower extremity alignment or postural stability. Utilization of a prophylactic support at the ankle did not substantially alter the proximal components of the lower kinetic chain. © Georg Thieme Verlag KG Stuttgart · New York.

  20. The Basics of Braces

    Science.gov (United States)

    ... wear a specially molded retainer — a small, hard piece of plastic with metal wires or a thin piece of plastic shaped like a mouthguard. Retainers keep ... Teeth Keeping Your Child's Teeth Healthy Word! Braces Going to the Dentist The Reality of Retainers What ...

  1. Electronic and structural characterizations of unreconstructed {l_brace}0001{r_brace} surfaces and the growth of graphene overlayers

    Energy Technology Data Exchange (ETDEWEB)

    Emtsev, Konstantin

    2009-06-03

    The present work is focused on the characterization of the clean unreconstructed SiC{l_brace}0001{r_brace} surfaces and the growth of graphene overlayers thereon. Electronic properties of SiC surfaces and their interfaces with graphene and few layer graphene films were investigated by means of angle resolved photoelectron spectroscopy, X-ray photoelectron spectroscopy and low energy electron diffraction. Structural characterizations of the epitaxial graphene films grown on SiC were carried out by atomic force microscopy and low energy electron microscopy. Supplementary data was obtained by scanning tunneling microscopy. (orig.)

  2. Behaviour of Strengthened RC Frames with Eccentric Steel Braced Frames

    Directory of Open Access Journals (Sweden)

    Kamanli Mehmet

    2017-01-01

    Full Text Available After devastating earthquakes in recent years, strengthening of reinforced concrete buildings became an important research topic. Reinforced concrete buildings can be strengthened by steel braced frames. These steel braced frames may be made of concentrically or eccentrically indicated in Turkish Earthquake Code 2007. In this study pushover analysis of the 1/3 scaled 1 reinforced concrete frame and 1/3 scaled 4 strengthened reinforced concrete frames with internal eccentric steel braced frames were conducted by SAP2000 program. According to the results of the analyses conducted, load-displacement curves of the specimens were compared and evaluated. Adding eccentric steel braces to the bare frame decreased the story drift, and significantly increased strength, stiffness and energy dissipation capacity. In this strengthening method lateral load carrying capacity, stiffness and dissipated energy of the structure can be increased.

  3. Prospective study of 158 adult scoliosis treated by a bivalve polyethylene overlapping brace and reviewed at least 5 years after brace fitting

    Directory of Open Access Journals (Sweden)

    Jean Claude de Mauroy

    2016-10-01

    Full Text Available Abstract Background The conservative orthopaedic treatment of adult scoliosis is very disappointing. In a series of 144 patients; only 25 % (33 cases were monitored at 2 years of treatment. (Papadopoulos 2013. Thereby the literature typically focuses on a small number of patients, which limits the usefulness and relevance of its results. The brace effect on pain has been systematically described, but there is no publication on the effect of treatment on the Cobb angle and main clinical parameters. Methods From a prospective database started in 1998, we selected all 158 consecutive patients effectively treated conservatively with the Lyon management treatment and controlled five years after brace fitting. Lyon management includes a lordosing bivalve polyethylene overlapping brace in association with specific physiotherapy. The brace can either be short with anterior support under the chest or long with sterno-clavicular support when there is a high thoracic kyphosis. Results 1. For the rate of scoliosis controlled after 5 years, the follow-up was 24 % of the 661 patients accepting the treatment. Pain is almost the main reason for the medical consultation, generally correlating with an increase of the scoliotic angulation. 2. The descriptive data can be superimposed on general group with age (m=56 years, SD=13 but initial Cobb angulation is significantly higher (m=40°, SD=17. Ratio Female/Male=0.91. Generally, the scoliosis is stabilized at (m=39.74 °, SD=19.40, 8 years after the beginning of the treatment. 38 improvements of more than 5°= 24 %; 88 stable = 56 %; 32 worsening of more than 5° = 20 % The rib hump is improved of by 3 mm, (modelling effect of the brace. The occipital axis is improved by more than 6 mm. But the T1 plumb line distance is worsening by 7 mm (most braces are short without sterno-clavicular support. Conclusions For the first time, the number of records and follow up after 8 years allows to study the

  4. Bracing of the Reconstructed and Osteoarthritic Knee during High Dynamic Load Tasks.

    Science.gov (United States)

    Hart, Harvi F; Crossley, Kay M; Collins, Natalie J; Ackland, David C

    2017-06-01

    Lateral compartment osteoarthritis accompanied by abnormal knee biomechanics is frequently reported in individuals with knee osteoarthritis after anterior cruciate ligament reconstruction (ACLR). The aim of this study was to evaluate changes in knee biomechanics produced by an adjusted and unadjusted varus knee brace during high dynamic loading activities in individuals with lateral knee osteoarthritis after ACLR and valgus malalignment. Nineteen participants who had undergone ACLR 5 to 20 yr previously and had symptomatic and radiographic lateral knee osteoarthritis with valgus malalignment were assessed. Quantitative motion analysis experiments were conducted during hopping, stair ascent, and descent under three test conditions: (i) no brace, (ii) unadjusted brace with sagittal plane support and neutral frontal plane alignment, and (iii) adjusted brace with sagittal plane support and varus realignment (valgus to neutral). Sagittal, frontal, and transverse plane knee kinematics, external joint moment, and angular impulse data were calculated. Relative to an unbraced knee, braced conditions significantly increased knee flexion and adduction angles during hopping (P = 0.003 and P = 0.005; respectively), stair ascent (P = 0.003 and P stair ascent (P = 0.008) and flexion moments during stair descent (P = 0.006). There were no significant differences between the adjusted and the unadjusted brace conditions (P > 0.05). A knee brace, with or without varus alignment, can modulate knee kinematics and external joint moments during hopping, stairs ascent, and descent in individuals with predominant lateral knee osteoarthritis after ACLR. Longer-term use of a brace may have implications in slowing osteoarthritis progression.

  5. Evaluation of Long Leg Braces in Regard to Biomechanical, Clinival and Technical Orthopedic\\'s Fundamentals

    Directory of Open Access Journals (Sweden)

    Reza Vahhab-Kashani

    2006-01-01

    Full Text Available Objective: In some clients, for lower extremity, long leg brace, is prescribed. Then it will be fabricated bye orthotist and worn by patient. According to clinical principles, the brace should be as fit as possible with limb form. Also, an individual, walks and sits with his or her brace. Brace functions around joint motion axis. Quality and exact place of movement is define by biomechanical principles. Therefore, brace should be adapted with biochemical principles of the limb. Materials & Methods: A brace is made up several components which are assembled through acceptable technical orthopaedic methods and this procedure should be done without omission or neglect. If orthotist has enough scientific knowledge and observes all details, he or she will fabricate a perfect brace. We considered fabricated long leg brace according to this principle to meet study objectives while answering some question of study, we will disguss on the finding of our assessment. Also, we examine some possible deviations with accured by unsuitable fabrication, more over we suggest that some failur in designing procedure which leads to such deviation material and methods: In this descriptive analytic cross sectional study, long leg braces of 193 clients who were selected by random stratified sampling method, were evaluated by a previously designed questionare . Results: A. By assessment of 7 variables, it was revealed that 28.86% of manufactured braces, was not adapted with defined fundamentals, biomechanically. B. By evaluation of 9 variables, it was made known that 30 % of produced braces was not adapted with established fabricating fundamentals of lower limb braces clinically. C. By examination of 23 variables it was find out that 25.4% of fabricated braces, it was observed, which has some failures by attention to defined fabricating technical orthopaedic fundamentals. Conclusion: All the details, fabrication and design procedures should be carefully observed and

  6. Reforming the Belgian market for orthotic braces: what can we learn from the international experience?

    Science.gov (United States)

    Simoens, Steven; De Coster, Sandra; Moldenaers, Ingrid; Guillaume, Paul; Depoorter, Antony; Van den Steen, Dirk; Van de Sande, Stefaan; Debruyne, Hans; Ramaekers, Dirk; Lona, Murielle

    2008-05-01

    This article aims to review regulation governing outpatient orthotic braces (neck, wrist and knee braces) in France, the Netherlands and Sweden with a view to reforming the Belgian market. Information about the regulatory framework was derived from an analysis of legal texts and a survey completed by national experts. Strategies to keep down prices include public procurement in Sweden, maximum prices in France, and exclusion of expensive braces from reimbursement in the Netherlands. Reimbursement is linked to a medical indication or a chronic condition in France, the Netherlands and Sweden. To gain reimbursement, the cost-effectiveness of orthotic braces needs to be demonstrated in France and the Netherlands. Orthotic braces tend to be initially prescribed by a specialist physician and distributed by orthotists, medical equipment shops and/or community pharmacies. Extensive government intervention exists in the outpatient orthotic brace market in the countries studied. Our recommendations to reform the Belgian market for prefabricated orthotic braces are to separate reimbursement for service provision from reimbursement for braces; to set prices by means of a tendering process or an international price comparison; and to make reimbursement conditional on effectiveness and cost-effectiveness of braces.

  7. A new method of MR total spine imaging for showing the brace effect in scoliosis

    Energy Technology Data Exchange (ETDEWEB)

    Schmitz, A.; Kandyba, J.; Koenig, R.; Jaeger, U.E.; Gieseke, J.; Schmitt, O. [Univ. of Bonn (Germany)

    2001-07-01

    Bracing is a method of early, nonsurgical treatment for scoliosis, but a hypokyphotic effect on the thoracic spine is reported. We developed a magnetic resonance tomography (MR) procedure presenting an image of the whole spine in the coronal and sagittal planes (MR total spine imaging), and studied the brace effect, using this technique. We examined 26 female patients with idiopathic scoliosis treated with a Cheneau brace (mean age, 13.2 years; mean duration of brace treatment at the time of investigation, 1.5 years). The MR examinations were performed with the patient in the supine position with and without the brace in direct sequence. As measured on the coronal MR images, the thoracic curve was corrected, on average, from 29 deg to 22 deg (mean correction, 24%). There was a slight reduction in the sagittal Cobb angle measured between T4 and T12 (mean sagittal Cobb angle without brace, 14 deg ; with brace, 12 deg), which was still a significant change. MR total spine imaging could be a useful tool for studying the brace effect in scoliosis in two planes. Using this technique, we found reduced sagittal Cobb angles for the thoracic kyphosis with brace. Because there is no radiation exposure, the MR procedure has a potential use in the monitoring of brace treatment. (author)

  8. Clinical practice guidelines for rest orthosis, knee sleeves, and unloading knee braces in knee osteoarthritis.

    Science.gov (United States)

    Beaudreuil, Johann; Bendaya, Samy; Faucher, Marc; Coudeyre, Emmanuel; Ribinik, Patricia; Revel, Michel; Rannou, François

    2009-12-01

    To develop clinical practice guidelines concerning the use of bracing--rest orthosis, knee sleeves and unloading knee braces--for knee osteoarthritis. The French Physical Medicine and Rehabilitation Society (SOFMER) methodology, associating a systematic literature review, collection of everyday clinical practice, and external review by multidisciplinary expert panel, was used. Few high-level studies of bracing for knee osteoarthritis were found. No evidence exists for the effectiveness of rest orthosis. Evidence for knee sleeves suggests that they decrease pain in knee osteoarthritis, and their use is associated with subjective improvement. These actions do not appear to depend on a local thermal effect. The effectiveness of knee sleeves for disability is not demonstrated for knee osteoarthritis. Short- and mid-term follow-up indicates that valgus knee bracing decreases pain and disability in medial knee osteoarthritis, appears to be more effective than knee sleeves, and improves quality of life, knee proprioception, quadriceps strength, and gait symmetry, and decreases compressive loads in the medial femoro-tibial compartment. However, results of response to valgus knee bracing remain inconsistent; discomfort and side effects can result. Thrombophlebitis of the lower limbs has been reported with the braces. Braces, whatever kind, are infrequently prescribed in clinical practice for osteoarthritis of the lower limbs. Modest evidence exists for the effectiveness of bracing--rest orthosis, knee sleeves and unloading knee braces--for knee osteoarthritis, with only low level recommendations for its use. Braces are prescribed infrequently in French clinical practice for osteoarthritis of the knee. Randomized clinical trials concerning bracing in knee osteoarthritis are still necessary.

  9. The effects of a supportive knee brace on leg performance in healthy subjects.

    Science.gov (United States)

    Veldhuizen, J W; Koene, F M; Oostvogel, H J; von Thiel, T P; Verstappen, F T

    1991-12-01

    Eight healthy volunteers were fitted with a supportive knee brace (Push Brace 'Heavy') to one knee for a duration of four weeks wherein they were tested before, during and after the application to establish the effect of bracing on performance. The tests consisted of isokinetic strength measurement of knee flexion and extension, 60 meter dash, vertical jump height and a progressive horizontal treadmill test until exhaustion (Vmax) with determination of oxygen uptake, heart rate and plasma lactate concentration. Wearing the brace for one day, the performance indicators showed a decline compared with the test before application (base values). Sprint time was 4% longer (p less than 0.01) and Vmax 6% slower (p less than 0.01). Peak torque of knee flexion at 60 and 240 deg.sec-1 was 6% (p less than 0.05) respectively 9% (p less than 0.05) less. Peak extension torque at 60 deg.sec-1 was 9% less (p less than 0.05). While wearing the brace for four weeks, the test performances were practically identical to their base values. After removal of the brace, all test parameters were statistically similar to the base values. Heart rate at submaximal exercise levels was even lower (p less than 0.05). In conclusion, performance in sports with test-like exercise patterns is not affected by the brace tested. Bracing does not "weaken the knee" as it is widely believed in sports practice.

  10. The effect of ankle brace type on braking response time-A randomised study.

    Science.gov (United States)

    Dammerer, Dietmar; Waidmann, Cornelia; Haid, Christian; Thaler, Martin; Krismer, Martin; Liebensteiner, Michael C

    2015-11-01

    The question whether or not a patient with an ankle brace should drive a car is of obvious importance because brake response time (BRT) is considered one of the most important factors for driving safety. Applying a crossover study design, 70 healthy participants (35 women, 35 men) participated in our study. BRT was assessed using a custom-made driving simulator. We assessed BRT under six conditions: without a brace (control) (1), with a typical postoperative ankle brace with adjustable ROM and the settings: unrestricted (2), fixed at 15° (3) plantar flexion, restricted with 15°/50° (4) (dorsal/plantar flexion), a brace for ligament instabilities (5) and an elastic ankle bandage (6). Participants were instructed to apply the brake pedal exclusively with the right foot as quickly as possible on receipt of a visual stimulus. The 70 participants showed significantly impaired BRT with the ankle brace for ROM restriction in the settings: unrestricted (p<0.001), fixed at 15° plantar flexion (p<0.001) and 15°/50° dorsal/plantar flexion (p<0.001) as compared to the control group. BRT was not impaired with the brace for ankle instabilities or the elastic ankle bandage. In conclusion, right-sided ROM restricting ankle braces involve significant impairment of BRT in healthy participants. No such prolonged BRT was found for an elastic ankle bandage or the ligament brace. Copyright © 2015 Elsevier Ltd. All rights reserved.

  11. The effect of ankle bracing on knee kinetics and kinematics during volleyball-specific tasks.

    Science.gov (United States)

    West, T; Ng, L; Campbell, A

    2014-12-01

    The purpose of this study was to examine the effects of ankle bracing on knee kinetics and kinematics during volleyball tasks. Fifteen healthy, elite, female volleyball players performed a series of straight-line and lateral volleyball tasks with no brace and when wearing an ankle brace. A 14-camera Vicon motion analysis system and AMTI force plate were used to capture the kinetic and kinematic data. Knee range of motion, peak knee anterior-posterior and medial-lateral shear forces, and peak ground reaction forces that occurred between initial contact with the force plate and toe off were compared using paired sample t-tests between the braced and non-braced conditions (P volleyball tasks. However, ankle bracing was demonstrated to reduce knee lateral shear forces during all of the lateral movement volleyball tasks. Wearing the Active Ankle T2 brace will not impact knee joint range of motion and may in fact reduce shear loading to the knee joint in volleyball players. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  12. On the origin of higher braces and higher-order derivations

    Czech Academy of Sciences Publication Activity Database

    Markl, Martin

    2015-01-01

    Roč. 10, č. 3 (2015), s. 637-667 ISSN 2193-8407 Institutional support: RVO:67985840 Keywords : Koszul braces * Börjeseon braces * higher-order derivation Subject RIV: BA - General Mathematics Impact factor: 0.600, year: 2015 http://link.springer.com/article/10.1007/s40062-014-0079-2

  13. Early weaning might reduce the psychological strain of Boston bracing

    DEFF Research Database (Denmark)

    Andersen, Mikkel Ø; Andersen, Gert Rahbek; Thomsen, Karsten

    2002-01-01

    From 1983 to 1990 a total of 136 patients with adolescent idiopathic scoliosis were treated with the Boston brace. With the aim of examining the social and psychological impact of the brace treatment all patients received a questionnaire at an average of 3.5 years after termination of the treatment...

  14. Versatility of {l_brace}M(30-crown-10){r_brace} (M = K{sup +}, Ba{sup 2+}) as a guest in UO{sub 2}{sup 2+} complexes of 3.1.3.1 - and 3.3.3 homo-oxa-calixarenes

    Energy Technology Data Exchange (ETDEWEB)

    Masci, B. [Univ Roma La Sapienza, Dipartimento Chim, I-00185 Rome, (Italy); Thuery, P. [CEA Saclay, DSM/DRECAM/SCM, CNRS-URA 331, F-91191 Gif Sur Yvette, (France)

    2007-07-01

    The reaction between p-R-[3.1.3.1]- or [3.3.3] homo-oxa-calixarenes and uranyl salts in the presence of 30-crown-10 and the alkali or alkaline-earth metal cations K{sup +} or Ba{sup 2+} gives various supramolecular assemblages characterized by 'complex-within-complex' architectures. These can be of the simple nesting or sandwich types, as in [{l_brace}Ba(30-crown-10){r_brace}{l_brace}UO{sub 2}(L{sup 1}){r_brace}]. 2H{sub 2}O.3CHCl{sub 3} (L{sup 1}H{sub 4} p-tert-butyl[3.1.3.1] homo-oxa-calixarene) and [{l_brace}Ba(30-crown-10){r_brace}{l_brace}UO{sub 2}(L{sup 4}){r_brace}{sub 2}].2CHCl{sub 3} (L{sup 4}H{sub 3} p-bromo[3.3.3]homo-oxa-calixarene), respectively, with the cation held in the cavity of the homo-oxa-calixarene complexes in cone conformation by weak interactions, but more original structures arise when uranyl-cation bonds are present. In [{l_brace}Ba(30-crown-10){r_brace}{l_brace}UO{sub 2}(L{sup 2}){r_brace}] (L{sup 2}H{sub 4} p-phenyl[3.1.3.1] homo-oxa-calixarene), the barium ion included in the crown ether is bound to the uranyl oxo group located out of the calixarene cavity, resulting in the formation of a neutral species which self-organizes to form a columnar assembly by auto-inclusion. In [{l_brace}K(30-crown-10){r_brace}{l_brace}UO{sub 2}K(L{sup 1})(H{sub 2}O){sub 3}{r_brace}]{sub 2}.6H{sub 2}O, the nesting-type subunit dimerizes around two oxo-bound potassium ions. Finally, the use of the coordinating solvent dimethylsulfoxide leads to the neutral complex [UO{sub 2}Ba(L{sup 3})(dmso){sub 2}(MeOH)]{sub 2} (L{sup 3}H{sub 4} = p-methyl[3.1.3.1] homo-oxa-calixarene), in which the crown ether is absent and two oxo-, phenoxo- and ether-bound barium atoms ensure the dimerization of the uranyl complex. (authors)

  15. ARTHROMETRIC EVALUATION OF STABILIZING EFFECT OF KNEE FUNCTIONAL BRACING AT DIFFERENT FLEXION ANGLES

    Directory of Open Access Journals (Sweden)

    Saeedeh Seyed Mohseni

    2009-06-01

    Full Text Available Previous in-vivo investigations on the stabilizing efficacy of knee bracing for ACL reconstructed patients have been often limited to 20-30 degrees of knee flexion. In this study, the effectiveness of a uniaxial hinged functional brace to improve the knee stability was assessed at 30, 60 and 90 degrees of knee flexion. Arthrometry tests were conducted on 15 healthy subjects before and following wearing the brace and the tibial displacements were measured at up to 150 N anterior forces. Results indicated that functional bracing has a significant stabilizing effect throughout the range of knee flexion examined (p < 0.05. The rate of effectiveness, however, was not consistent across the flexion range, e.g., 50% at 30 degrees and only 4% at 90 degrees. It was suggested that accurate sizing and fitting as well as attention to correct hinge placement relative to the femoral condyles can limit brace migration and improve its effectiveness in mid and deep knee flexion. With using adaptive limb fittings, through flexible pads, and a polycentric joint a more significant improvement of the overall brace performance and efficacy might be obtained

  16. An innovative seismic bracing system based on a superelastic shape memory alloy ring

    International Nuclear Information System (INIS)

    Gao, Nan; Jeon, Jong-Su; DesRoches, Reginald; Hodgson, Darel E

    2016-01-01

    Shape memory alloys (SMAs) have great potential in seismic applications because of their remarkable superelasticity. Seismic bracing systems based on SMAs can mitigate the damage caused by earthquakes. The current study investigates a bracing system based on an SMA ring which is capable of both re-centering and energy dissipation. This lateral force resisting system is a cross-braced system consisting of an SMA ring and four tension-only cable assemblies, which can be applied to both new construction and seismic retrofit. The performance of this bracing system is examined through a quasi-static cyclic loading test and finite element (FE) analysis. This paper describes the experimental design in detail, discusses the experimental results, compares the performance with other bracing systems based on SMAs, and presents an Abaqus FE model calibrated on the basis of experimental results to simulate the superelastic behavior of the SMA ring. The experimental results indicate that the seismic performance of this system is promising in terms of damping and re-centering. The FE model can be used in the simulation of building structures using the proposed bracing system. (paper)

  17. SEISMIC FRAGILITY ANALYSIS OF IMPROVED RC FRAMES USING DIFFERENT TYPES OF BRACING

    Directory of Open Access Journals (Sweden)

    HAMED HAMIDI JAMNANI

    2017-04-01

    Full Text Available Application of bracings to increase the lateral stiffness of building structures is a technique of seismic improvement that engineers frequently have recourse to. Accordingly, investigating the role of bracings in concrete structures along with the development of seismic fragility curves are of overriding concern to civil engineers. In this research, an ordinary RC building, designed according to the 1st edition of Iranian seismic code, was selected for examination. According to FEMA 356 code, this building is considered to be vulnerable. To improve the seismic performance of this building, 3 different types of bracings, which are Concentrically Braced Frames, Eccentrically Braced Frames and Buckling Restrained Frames were employed, and each bracing element was distributed in 3 different locations in the building. The researchers developed fragility curves and utilized 30 earthquake records on the Peak Ground Acceleration seismic intensity scale to carry out a time history analysis. Tow damage scale, including Inter-Story Drifts and Plastic Axial Deformation were also used. The numerical results obtained from this investigation confirm that Plastic Axial Deformation is more reliable than conventional approaches in developing fragility curves for retrofitted frames. In lieu of what is proposed, the researchers selected the suitable damage scale and developed and compared log-normal distribution of fragility curves first for the original and then for the retrofitted building.

  18. Introduction to the "Scoliosis" Journal Brace Technology Thematic Series: increasing existing knowledge and promoting future developments

    Directory of Open Access Journals (Sweden)

    Grivas Theodoros B

    2010-01-01

    Full Text Available Abstract Bracing is the main non-surgical intervention in the treatment of idiopathic scoliosis during growth, in hyperkyphosis (and Scheuermann disease and occasionally for spondylolisthesis; it can be used in adult scoliosis, in the elderly when pathological curves lead to a forward leaning posture or in adults after traumatic injuries. Bracing can be defined as the application of external corrective forces to the trunk; rigid supports or elastic bands can be used and braces can be custom-made or prefabricated. The state of research in the field of conservative treatment is insufficient and while it can be stated that there is some evidence to support bracing, we must also acknowledge that today we do not have a common and generally accepted knowledge base, and that instead, individual expertise still prevails, giving rise to different schools of thought on brace construction and principles of correction. The only way to improve the knowledge and understanding of brace type and brace function is to establish a single and comprehensive source of information about bracing. This is what the Scoliosis Journal is going to do through the "Brace Technology" Thematic Series, where technical papers coming from the different schools will be published.

  19. Discrepancy in clinical versus radiological parameters describing deformity due to brace treatment for moderate idiopathic scoliosis

    Directory of Open Access Journals (Sweden)

    Szulc Andrzej

    2007-12-01

    Full Text Available Abstract Background The shape of the torso in patients with idiopathic scoliosis is considered to reflect the shape of the vertebral column, however the direct correlation between parameters describing clinical deformity and those characterizing radiological curvature was reported to be weak. It is not clear if the management proposed for scoliosis (physiotherapy, brace, surgery affects equally the shape of the axial skeleton and the surface of the body. The aim of the study was to compare clinical deformity of (1 idiopathic scoliosis girls being under brace treatment for radiological curves of 25 to 40 degrees and (2 non treated scoliotic girls matched for age and Cobb angle. Methods Cross-sectional study of 24 girls wearing the brace versus 26 girls without brace treatment, matched for age and Cobb angle. Hypothesis: Patients wearing the brace for more than 6 months, when comparing to patients without brace, may present different external morphology of the trunk, in spite of having similar Cobb angle. Material. Inclusion criteria: girls, idiopathic scoliosis, growing age (10–16 years, Cobb angle minimum 25°, maximum 40°. The braced group consisted of girls wearing a TLSO brace (Cheneau for more than 6 months with minimum of 16 hours per day. The non-braced group consisted of girls first seen for their spinal deformity, previously not treated. The groups presented similar curve pattern. Methods. Scoliometer exam: angle of trunk rotation at three levels of the spine: upper thoracic, main thoracic, lumbar or thoracolumbar. The maximal angle was noted at each level and the sum of three levels was calculated. Posterior trunk symmetry index (POTSI and Hump Sum were measured using surface topography. Results Cobb angle was 34.9° ± 4.8° in braced and 32.7° ± 4.9° in un-braced patients (difference not significant. The age was 14.1 ± 1.6 years in braced patients and 13.1 ± 1.9 years in un-braced group (p = 0.046. The value of angle of trunk

  20. Thermophysical properties of binary mixtures of {l_brace}ionic liquid 2-hydroxy ethylammonium acetate + (water, methanol, or ethanol){r_brace}

    Energy Technology Data Exchange (ETDEWEB)

    Alvarez, Victor H. [School of Chemical Engineering, State University of Campinas (UNICAMP), P.O. Box 6066, 13083-970 Campinas-SP (Brazil); Chemical Engineering Department, ETSE, University of Santiago de Compostela (USC), P.O. Box 15782, Santiago de Compostela (Spain); Mattedi, Silvana [Chemical Engineering Department, Polytechnic School, Federal University of Bahia (UFBA), 40210-630 Salvador-BA (Brazil); Martin-Pastor, Manuel [Unidade de Resonancia Magnetica, RIAIDT, edif. CACTUS, University of Santiago de Compostela (USC), P.O. Box 15706, Santiago de Compostela (Spain); Aznar, Martin [School of Chemical Engineering, State University of Campinas (UNICAMP), P.O. Box 6066, 13083-970 Campinas-SP (Brazil); Iglesias, Miguel, E-mail: miguel.iglesias@usc.es [Chemical Engineering Department, ETSE, University of Santiago de Compostela (USC), P.O. Box 15782, Santiago de Compostela (Spain)

    2011-07-15

    Research highlights: > This paper reports the density and speed of sound data of binary mixtures {l_brace}2-hydroxy ethylammonium acetate + (water, or methanol, or ethanol){r_brace} measured between the temperatures (298.15 and 313.15) K at atmospheric pressure. > The aggregation, dynamic behavior, and hydrogen-bond network were studied using thermo-acoustic, X-ray, and NMR techniques. > The Peng-Robinson equation of state, coupled with the Wong-Sandler mixing rule using the COSMO-SAC model predicted the density of the solutions with relative mean deviations below than 3.0%. - Abstract: In this work, density and speed of sound data of binary mixtures of an ionic liquid consisting of {l_brace}2-hydroxy ethylammonium acetate (2-HEAA) + (water, methanol, or ethanol){r_brace} have been measured throughout the entire concentration range, from the temperature of (288.15 to 323.15) K at atmospheric pressure. The excess molar volumes, variations of the isentropic compressibility, the apparent molar volume, isentropic apparent molar compressibility, and thermal expansion coefficient were calculated from the experimental data. The excess molar volumes were negative throughout the whole composition range. Compressibility data in combination with low angle X-ray scattering and NMR measurements proved that the presence of micelles formed due to ion pair interaction above a critical concentration of the ionic liquid in the mixtures. The Peng-Robinson equation of state coupled with the Wong-Sandler mixing rule and COSMO-SAC model was used to predict densities and the calculated deviations were lower than 3%, for binary mixtures in all composition range.

  1. Control of a flexible bracing manipulator: Integration of current research work to realize the bracing manipulator

    Science.gov (United States)

    Kwon, Dong-Soo

    1991-01-01

    All research results about flexible manipulator control were integrated to show a control scenario of a bracing manipulator. First, dynamic analysis of a flexible manipulator was done for modeling. Second, from the dynamic model, the inverse dynamic equation was derived, and the time domain inverse dynamic method was proposed for the calculation of the feedforward torque and the desired flexible coordinate trajectories. Third, a tracking controller was designed by combining the inverse dynamic feedforward control with the joint feedback control. The control scheme was applied to the tip position control of a single link flexible manipulator for zero and non-zero initial condition cases. Finally, the contact control scheme was added to the position tracking control. A control scenario of a bracing manipulator is provided and evaluated through simulation and experiment on a single link flexible manipulator.

  2. Twitter analysis of the orthodontic patient experience with braces vs Invisalign.

    Science.gov (United States)

    Noll, Daniel; Mahon, Brendan; Shroff, Bhavna; Carrico, Caroline; Lindauer, Steven J

    2017-05-01

    To examine the orthodontic patient experience having braces compared with Invisalign by means of a large-scale Twitter sentiment analysis. A custom data collection program was created that collected tweets containing the words "braces" or "Invisalign" for a period of 5 months. A hierarchal Naïve Bayes sentiment analysis classifier was developed to sort the tweets into five categories: positive, negative, neutral, advertisement, or not applicable. Each category was then analyzed for specific content. A total of 419,363 tweets applicable to orthodontics were collected. Users posted significantly more positive tweets (61%) than they did negative tweets (39%; P ≤ .0001). There was no significant difference in the distribution of positive and negative sentiment between braces and Invisalign tweets (P = .4189). Positive orthodontics-related tweets often highlighted gratitude for a great smile accompanied with selfies. Negative orthodontic tweets frequently focused on pain. Twitter users expressed more positive than negative sentiment about orthodontic treatment with no significant difference in sentiment between braces and Invisalign tweets.

  3. An Experimental Study on Non-Compression X-Bracing Systems Using Carbon Fiber Composite Cable for Seismic Strengthening of RC Buildings

    Directory of Open Access Journals (Sweden)

    Kang Seok Lee

    2015-09-01

    Full Text Available Cross-bracing (X-bracing is one of the most popular methods of seismic retrofitting, and has been shown to significantly increase the structural stiffness and strength of buildings. Conventional steel X-bracing methods typically exhibit brittle failure at the connection between the brace and the building, or buckling failure of the braces. This study investigated the structural properties of a new type of non-compression X-bracing system using carbon fiber composite cable (CFCC. This non-compression X-bracing system uses CFCC bracing and bolt connections between structural members and the terminal fixer of the CFCC, instead of conventional steel bracing. The aim is to overcome the brittle and buckling failures that can occur at the connection and bracings with conventional steel X-bracing methods. We carried out cyclic loading tests, and the maximum load carrying capacity and deformation were investigated, as well as hysteresis in the lateral load–drift relations. The test results revealed that the CFCC X-bracing system installed in reinforced concrete frames enhanced the strength markedly, and buckling failure of the bracing was not observed.

  4. Effectiveness of an Outside-the-Boot Brace in Reducing Parachuting Related Ankle Injuries

    National Research Council Canada - National Science Library

    Schmidt, M. D; Sulsky, S. I; Amoroso, P. J

    2005-01-01

    .... Multiple logistic regression analysis estimated adjusted odds ratios (OR) and 95% confidence intervals for injury outcomes, comparing pre and post brace periods to the brace protocol period. Setting...

  5. Gait comparison of subjects with hemiplegia walking unbraced, with ankle-foot orthosis, and with Air-Stirrup brace.

    Science.gov (United States)

    Burdett, R G; Borello-France, D; Blatchly, C; Potter, C

    1988-08-01

    The effects of the Air-Stirrup (AS) standard ankle brace on the gait of 19 subjects with hemiplegia resulting from a cerebrovascular accident who exhibited excessive subtalar joint motion were studied. Videotaped trials and footprint analyses were used to measure subjects' hip, knee, and ankle sagittal plane angles; inversion and eversion of the calcaneus; and time-distance gait characteristics. A one-way analysis of variance for repeated measures was used to compare the gait of 19 subjects with the AS brace and unbraced and 11 subjects with the AS brace, unbraced, and with an ankle-foot orthosis. The AS brace was associated with more calcaneal stability during standing than the unbraced condition. The ankle-foot orthosis was associated with less plantar flexion at foot-strike than either the AS brace or unbraced condition. Both the AS brace and the ankle-foot orthosis were associated with less mid-swing plantar flexion and increased step length on the paretic side compared with no brace. These results support the effectiveness of the AS brace in controlling inversion and eversion instability in patients with hemiplegia.

  6. Chinese Adaptation of the Bad Sobernheim Stress Questionnaire for Patients With Adolescent Idiopathic Scoliosis Under Brace Treatment.

    Science.gov (United States)

    Xu, Ximing; Wang, Fei; Yang, Mingyuan; Huang, Qikai; Chang, Yifan; Wei, Xianzhao; Bai, Yushu; Li, Ming

    2015-08-01

    Bad Sobernheim Stress Questionnaire (BSSQ)-Deformity and BSSQ-Brace are the most widely used instruments for evaluating stress levels in adolescent idiopathic scoliosis (AIS) patients under brace treatment, and good reliability and validity have been demonstrated across different cultures. Great stress has been found among many adolescents, becoming a major concern for professionals. However, no previous research has addressed the cultural adaptations and psychometric testing of BSSQ-Deformity and BSSQ-Brace in China or the stress levels in AIS patients. The purposes of our study were to evaluate the cross-cultural adaptation and validation of the BSSQ-Deformity and BSSQ-Brace and to investigate stress levels in Chinese (AIS) patients under brace treatment.The original (German) versions of BSSQ-Deformity and BSSQ-Brace were cross-culturally translated according to international guidelines. Psychometric properties such as reliability and construct validity were tested. Eighty-six AIS patients were included in our study, and 50 patients paid a second visit 3 to 7 days later to test reproducibility. Cronbach α and the intraclass coefficient were determined to assess internal consistency and reproducibility. Scoliosis Research Society patient questionnaire-22 (SRS-22) was applied to evaluate construct validity.The mean BSSQ-Deformity and BSSQ-Brace scores were 15.3 and 13.4 points, respectively. Severe stress was observed in 12% of patients due to brace treatment. Item analysis demonstrated that each item was scored under a normal distribution with no redundancy. Psychometric analysis revealed excellent internal consistency (Cronbach α = 0.85 and 0.80, respectively) and reproducibility (intraclass correlation coefficient = 0.85 and 0.90, respectively) for BSSQ-Deformity and BSSQ-Brace. The correlation coefficients of BSSQ-Deformity, BSSQ-Brace and SRS-22 were 0.48 and 0.63, respectively.In conclusion, BSSQ-Deformity and BSSQ-Brace have been successfully

  7. Low-Cost Alternative External Rotation Shoulder Brace and Review of Treatment in Acute Shoulder Dislocations

    Directory of Open Access Journals (Sweden)

    Lacy, Kyle

    2015-01-01

    Full Text Available Traumatic dislocations of the shoulder commonly present to emergency departments (EDs. Immediate closed reduction of both anterior and posterior glenohumeral dislocations is recommended and is frequently performed in the ED. Recurrence of dislocation is common, as anteroinferior labral tears (Bankart lesions are present in many anterior shoulder dislocations.14,15,18,23 Immobilization of the shoulder following closed reduction is therefore recommended; previous studies support the use of immobilization with the shoulder in a position of external rotation, for both anterior and posterior shoulder dislocations.7-11,19 In this study, we present a technique for assembling a low-cost external rotation shoulder brace using materials found in most hospitals: cotton roll, stockinette, and shoulder immobilizers. This brace is particularly suited for the uninsured patient, who lacks the financial resources to pay for a pre-fabricated brace out of pocket. We also performed a cost analysis for our low-cost external rotation shoulder brace, and a cost comparison with pre-fabricated brand name braces. At our institution, the total materials cost for our brace was $19.15. The cost of a pre-fabricated shoulder brace at our institution is $150 with markup, which is reimbursed on average at $50.40 according to our hospital billing data. The low-cost external rotation shoulder brace is therefore a more affordable option for the uninsured patient presenting with acute shoulder dislocation. [West J Emerg Med. 2015;16(1:114–120.

  8. "Brace Technology" Thematic Series - The Lyon approach to the conservative treatment of scoliosis

    Directory of Open Access Journals (Sweden)

    Lecante Cyril

    2011-03-01

    Full Text Available Abstract The Lyon Brace, or adjustable multi-shell brace, has been used for more than 60 years. The use and function of the Lyon Brace includes: - The utilization of one or two corrective plaster casts, which enables a true lengthening of the concave ligaments. - An oriented CAD-CAM moulding in 3D auto correction after the removal of the plaster cast. - A blueprint adapted to Lenke's classification. - A specific physiotherapy program. Background Pierre Stagnara created the Lyon Brace in 1947. The brace has the following characteristics: - It adjusts to allow for a child's growth of up to seven centimetres and for an increase in weight of up to seven kilograms. - It is 'active' in that the rigidity of the PMM (polymetacrylate of methyl structure stimulates the user to auto-correct. The active axial auto-correction decreases the pressures of the brace on the trunk. - It is decompressive in that the effect of extension between the two pelvic and scapular girdles decreases the pressure on the intervertebral disc allowing for more effective pushes in the other planes. - It is symmetrical making it both more aesthetically pleasing and easier to build. - It is stable at both shoulders and pelvic girdle, facilitating the intermediate 3D corrections. - It is transparent. The pressure of the shells on the skin can be directly controlled so "pads" are usually not necessary. Brace description Two metal bars are fixed vertically, one anterior the other posterior and all shells are attached from the bottom to the top in this order: - Two pelvic shells ensure an optimal stability of the brace. - One lumbar shell T12-L4, which can be either independent or extending, at the abdominal chondrocostal level. - One thoracic shell at the level of the thoracic convexity. - One opposite thoracic shell used as a counter push. - One shoulder balance shell on the side of the thoracic convexity. Long term follow up results This is a retrospective study of 1,338 completed

  9. A Survey of Parachute Ankle Brace Breakages

    National Research Council Canada - National Science Library

    Knapik, Joseph J; Spiess, Anita; Darakjy, Salima; Grier, Tyson; Manning, Fred; Livingston, Elaine; Swedler, David; Amoroso, Paul; Jones, Bruce H

    2008-01-01

    ...) of the Defense Safety Oversight Council (DSOC) to evaluate the parachute ankle brace (PAB). Information provided by the questionnaire identified potential injury risk factors and comments on the PAB...

  10. Upgrading the seismic capacity of existing RC buildings using buckling restrained braces

    Directory of Open Access Journals (Sweden)

    Hamdy Abou-Elfath

    2017-06-01

    Full Text Available Many existing RC buildings do not meet the lateral strength requirements of current seismic codes and are vulnerable to significant damage or collapse in the event of future earthquakes. In the past few decades, buckling-restrained braces have become increasingly popular as a lateral force resisting system because of their capability of improving the strength, the stiffness and the energy absorbing capacity of structures. This study evaluates the seismic upgrading of a 6-story RC-building using single diagonal buckling restrained braces. Seismic evaluation in this study has been carried out by static pushover analysis and time history earthquake analysis. Ten ground motions with different PGA levels are used in the analysis. The mean plus one standard deviation values of the roof-drift ratio, the maximum story drift ratio, the brace ductility factors and the member strain responses are used as the basis for the seismic performance evaluations. The results obtained in this study indicate that strengthening of RC buildings with buckling restrained braces is an efficient technique as it significantly increases the PGA capacity of the RC buildings. The results also indicate the increase in the PGA capacity of the RC building with the increase in the amount of the braces.

  11. Efficacy, safety, and economics of bracing after spine surgery: a systematic review of the literature.

    Science.gov (United States)

    Zhu, Mary P; Tetreault, Lindsay A; Sorefan-Mangou, Fatimah; Garwood, Philip; Wilson, Jefferson R

    2018-01-31

    Bracing is often used after spinal surgery to immobilize the spine, improve fusion, and relieve pain. However, controversy exists regarding the efficacy, necessity, and safety of various bracing techniques in the postsurgical setting. In this systematic review, we aimed to compare the effectiveness, safety, and cost-effectiveness of postoperative bracing versus no postoperative bracing after spinal surgery in patients with several common operative spinal pathologies. A systematic review was carried out to compare postoperative bracing and no postoperative bracing. A systematic search was conducted of MEDLINE, Embase, and the Cochrane Collaboration Library from 1970 to May 2017, supplemented by manual searching of the reference list of relevant studies and previously published reviews. Studies were included if they compared disability, quality of life, functional impairment, radiographic outcomes, cost-effectiveness, or complications between patients treated with postoperative bracing and patients not receiving any postoperative bracing. Each article was critically appraised independently by two reviewers, and the overall body of evidence was rated using guidelines outlined by the Grading of Recommendation Assessment, Development and Evaluation (GRADE) Working Group. Of the 858 retrieved citations, 5 studies met the inclusion criteria and were included in this review, consisting of 4 randomized controlled trials and 1 prospective cohort study. Low to moderate evidence suggests that there are no significant differences in most measures of disability, pain, quality of life, functional impairment, radiographic outcomes, and safety between groups. Isolated studies reported statistically significant and inconsistent differences between groups with respect to Neck Disability Index at 6 weeks postoperatively or Short Form-36 Physical Component Score at 1.5, 3, 6, and 12 months postoperatively. Based on limited evidence, postoperative bracing does not result in improved

  12. An equivalent frequency approach for determining non-linear effects on pre-tensioned-cable cross-braced structures

    Science.gov (United States)

    Giaccu, Gian Felice

    2018-05-01

    Pre-tensioned cable braces are widely used as bracing systems in various structural typologies. This technology is fundamentally utilized for stiffening purposes in the case of steel and timber structures. The pre-stressing force imparted to the braces provides to the system a remarkable increment of stiffness. On the other hand, the pre-tensioning force in the braces must be properly calibrated in order to satisfactorily meet both serviceability and ultimate limit states. Dynamic properties of these systems are however affected by non-linear behavior due to potential slackening of the pre-tensioned brace. In the recent years the author has been working on a similar problem regarding the non-linear response of cables in cable-stayed bridges and braced structures. In the present paper a displacement-based approach is used to examine the non-linear behavior of a building system. The methodology operates through linearization and allows obtaining an equivalent linearized frequency to approximately characterize, mode by mode, the dynamic behavior of the system. The equivalent frequency depends on both the mechanical characteristics of the system, the pre-tensioning level assigned to the braces and a characteristic vibration amplitude. The proposed approach can be used as a simplified technique, capable of linearizing the response of structural systems, characterized by non-linearity induced by the slackening of pre-tensioned braces.

  13. Effect of hip braces on brake response time: Repeated measures designed study.

    Science.gov (United States)

    Dammerer, Dietmar; Waidmann, Cornelia; Huber, Dennis G; Krismer, Martin; Haid, Christian; Liebensteiner, Michael C

    2017-08-01

    The question whether or not a patient with a hip brace should drive a car is of obvious importance because the advice given to patients to resume driving is often anecdotal as few scientific data are available on this specific subject. To assess driving ability (brake response time) with commonly used hip braces. Repeated measures design. Brake response time was assessed under six conditions: (1) without a brace (control), (2) with a typical postoperative hip brace with adjustable range of motion and the settings: unrestricted, (3) flexion limited to 70°, (4) extension blocked at 20° hip flexion, (5) both flexion and extension limited (20°/70°) and (6) an elastic hip bandage. Brake response time was assessed using a custom-made driving simulator as used in previous studies. The participants were a convenience sample of able-bodied participants. A total of 70 participants (35 women and 35 men) participated in our study. Mean age was 31.1 (standard deviation: 10.6; range: 21.7-66.4) years. A significant within-subject effect for brake response time was found ( p = 0.009), but subsequent post hoc analyses revealed no significant differences between control and the other settings. Based on our findings, it does not seem mandatory to recommend driving abstinence for patients wearing a hip orthosis. We suggest that our results be interpreted with caution, because (1) an underlying pathological hip condition needs to be considered, (2) the ability to drive a car safely is multifactorial and brake response time is only one component thereof and (3) brake response time measurements were performed only with healthy participants. Clinical relevance Hip braces are used in the context of joint-preserving and prosthetic surgery of the hip. Therefore, clinicians are confronted with the question whether to allow driving a car with the respective hip brace or not. Our data suggest that hip braces do not impair brake response time.

  14. Light Steel-Timber Frame with Composite and Plaster Bracing Panels

    OpenAIRE

    Scotta, Roberto; Trutalli, Davide; Fiorin, Laura; Pozza, Luca; Marchi, Luca; Stefani, Lorenzo  De

    2015-01-01

    The proposed light-frame structure comprises steel columns for vertical loads and an innovative bracing system to efficiently resist seismic actions. This seismic force resisting system consists of a light timber frame braced with an Oriented Strand Board (OSB) sheet and an external technoprene plaster-infilled slab. Steel brackets are used as foundation and floor connections. Experimental cyclic-loading tests were conduced to study the seismic response of two shear-wall specimens. A numerica...

  15. Surface tension, density, and speed of sound for the ternary mixture {l_brace}diethyl carbonate + p-xylene + decane{r_brace}

    Energy Technology Data Exchange (ETDEWEB)

    Mosteiro, Laura; Casas, Lidia M. [Departamento de Fisica Aplicada, Facultad de Ciencias Experimentales, Universidad de Vigo, Lagoas Marcosende s/n, 36310 Vigo (Spain); Legido, Jose L. [Departamento de Fisica Aplicada, Facultad de Ciencias Experimentales, Universidad de Vigo, Lagoas Marcosende s/n, 36310 Vigo (Spain)], E-mail: xllegido@uvigo.es

    2009-05-15

    This paper reports the results of a new experimental study of thermophysical properties for the ternary mixture of {l_brace}diethyl carbonate + p-xylene + decane{r_brace}. Surface tension has been measured at 298.15 K and, density and speed of sound have been measured in the temperature range T = (288.15 to 308.15) K. Excess molar volumes, excess isentropic compressibilities, and surface tension deviations, have been calculated from experimental data. Surface tension deviations have been correlated with Cibulka equation and Nagata and Tamura equation was used for the other excess properties. Good accuracy has been obtained. These excess magnitudes are discussed qualitatively in terms of the nature and type of intermolecular interactions of the components involved.

  16. Evaluating the ductility characteristics of self-centering buckling-restrained shape memory alloy braces

    Science.gov (United States)

    Abou-Elfath, Hamdy

    2017-05-01

    Recently, self-centering earthquake resistant systems have attracted attention because of their promising potential in controlling the residual drifts and reducing repair costs after earthquake events. Considerable portion of self-centering research is based on using short-segment superelastic shape memory alloy (SMA) braces as strengthening technique because of the lower modulus of elasticity of SMA in comparison with that of steel. The goal of this study is to investigate the ductility characteristics of these newly proposed short-segment SMA braces to evaluate their safety levels against fracture failures under earthquake loading. This goal has been achieved by selecting an appropriate seismic performance criterion for steel frames equipped with SMA braces, defining the level of strain capacity of SMA and calculating the strain demands in the SMA braces by conducting a series of pushover and earthquake time history analyzes on typical frame structure. The results obtained in this study indicated the inability of short-segment SMA designs to provide adequate ductility to the lateral resistant systems. An alternative approach is introduced by using hybrid steel-SMA braces that are capable of controlling the residual drifts and providing the structure with adequate lateral stiffness.

  17. Prophylactic knee bracing alters lower-limb muscle forces during a double-leg drop landing.

    Science.gov (United States)

    Ewing, Katie A; Fernandez, Justin W; Begg, Rezaul K; Galea, Mary P; Lee, Peter V S

    2016-10-03

    Anterior cruciate ligament (ACL) injury can be a painful, debilitating and costly consequence of participating in sporting activities. Prophylactic knee bracing aims to reduce the number and severity of ACL injury, which commonly occurs during landing maneuvers and is more prevalent in female athletes, but a consensus on the effectiveness of prophylactic knee braces has not been established. The lower-limb muscles are believed to play an important role in stabilizing the knee joint. The purpose of this study was to investigate the changes in lower-limb muscle function with prophylactic knee bracing in male and female athletes during landing. Fifteen recreational athletes performed double-leg drop landing tasks from 0.30m and 0.60m with and without a prophylactic knee brace. Motion analysis data were used to create subject-specific musculoskeletal models in OpenSim. Static optimization was performed to calculate the lower-limb muscle forces. A linear mixed model determined that the hamstrings and vasti muscles produced significantly greater flexion and extension torques, respectively, and greater peak muscle forces with bracing. No differences in the timings of peak muscle forces were observed. These findings suggest that prophylactic knee bracing may help to provide stability to the knee joint by increasing the active stiffness of the hamstrings and vasti muscles later in the landing phase rather than by altering the timing of muscle forces. Further studies are necessary to quantify whether prophylactic knee bracing can reduce the load placed on the ACL during intense dynamic movements. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. Inelastic behavior of cold-formed braced walls under monotonic and cyclic loading

    Science.gov (United States)

    Gerami, Mohsen; Lotfi, Mohsen; Nejat, Roya

    2015-06-01

    The ever-increasing need for housing generated the search for new and innovative building methods to increase speed and efficiency and enhance quality. One method is the use of light thin steel profiles as load-bearing elements having different solutions for interior and exterior cladding. Due to the increase in CFS construction in low-rise residential structures in the modern construction industry, there is an increased demand for performance inelastic analysis of CFS walls. In this study, the nonlinear behavior of cold-formed steel frames with various bracing arrangements including cross, chevron and k-shape straps was evaluated under cyclic and monotonic loading and using nonlinear finite element analysis methods. In total, 68 frames with different bracing arrangements and different ratios of dimensions were studied. Also, seismic parameters including resistance reduction factor, ductility and force reduction factor due to ductility were evaluated for all samples. On the other hand, the seismic response modification factor was calculated for these systems. It was concluded that the highest response modification factor would be obtained for walls with bilateral cross bracing systems with a value of 3.14. In all samples, on increasing the distance of straps from each other, shear strength increased and shear strength of the wall with bilateral bracing system was 60 % greater than that with lateral bracing system.

  19. Seismic Response of Steel Braced Building Frame Considering Soil Structure Interaction (SSI): An Experimental Study

    Science.gov (United States)

    Hirave, Vivek; Kalyanshetti, Mahesh

    2018-02-01

    Conventional fixed-base analysis ignoring the effect of soil-flexibility may result in unsafe design. Therefore, to evaluate the realistic behavior of structure the soil structure interaction (SSI) effect shall be incorporated in the analysis. In seismic analysis, provision of bracing system is one of the important option for the structure to have sufficient strength with adequate stiffness to resist lateral forces. The different configuration of these bracing systems alters the response of buildings, and therefore, it is important to evaluate the most effective bracing systems in view point of stability against SSI effect. In present study, three RC building frames, G+3, G+5 and G+7 and their respective scaled down steel model with two types of steel bracing system incorporating the effect of soil flexibility is considered for experimental and analytical study. The analytical study is carried out using Elastic continuum approach and the experimental study is carried out using Shake Table. The influence of SSI on various seismic parameters is presented. The study reveals that, steel bracing system is beneficial to control SSI effect and it is observed that V bracing is more effective, in resisting seismic load considering SSI.

  20. An experimental investigation on the ultimate strength of epoxy repaired braced partial infilled RC frames

    Science.gov (United States)

    Dubey, Shailendra Kumar Damodar; Kute, Sunil

    2014-09-01

    Due to earthquake, buildings are damaged partially or completely. Particularly structures with soft storey are mostly affected. In general, such damaged structures are repaired and reused. In this regard, an experimental investigation was planned and conducted on models of single-bay, single-storey of partial concrete infilled reinforced concrete (RC) frames up to collapse with corner, central and diagonal steel bracings. Such collapsed frames were repaired with epoxy resin and retested. The initiative was to identify the behaviour, extent of restored ultimate strength and deflection of epoxy-retrofitted frames in comparison to the braced RC frames. The performance of such frames has been considered only for lateral loads. In comparison to bare RC frames, epoxy repaired partial infilled frames have significant increase in the lateral load capacity. Central bracing is more effective than corner and diagonal bracing. For the same load, epoxy repaired frames have comparable deflection than similar braced frames.

  1. A calorimetric and equilibrium investigation of the reaction {l_brace}methyl ferulate(aq) + H{sub 2}O(l) = methanol(aq) + ferulic acid(aq){r_brace}

    Energy Technology Data Exchange (ETDEWEB)

    Goldberg, Robert N., E-mail: robert.goldberg@nist.go [Biochemical Science Division, National Institute of Standards and Technology, Gaithersburg, MD 20876 (United States); Department of Chemistry and Biochemistry, University of Maryland, Baltimore County, Baltimore, MD 21250 (United States); Lang, Brian E., E-mail: brian.lang@nist.go [Biochemical Science Division, National Institute of Standards and Technology, Gaithersburg, MD 20876 (United States); Selig, Michael J., E-mail: michael.selig@nrel.go [National Renewable Energy Laboratory, Biosciences Center, 1617 Cole Boulevard, Golden, CO 80401 (United States); Decker, Stephen R., E-mail: steve.decker@nrel.go [National Renewable Energy Laboratory, Biosciences Center, 1617 Cole Boulevard, Golden, CO 80401 (United States)

    2011-03-15

    Microcalorimetry and high-performance liquid chromatography (HPLC) have been used to conduct a thermodynamic investigation of the reaction: {l_brace}methyl ferulate(aq) + H{sub 2}O(l) = methanol(aq) + ferulic acid(aq){r_brace}, as catalyzed by feruloyl esterase. Values of the apparent equilibrium constant K' = (29.6 {+-} 0.7) (T = 298.15 K, citrate buffer at pH 4.98, ionic strength I = 0.39 mol {center_dot} kg{sup -1}) and of the calorimetrically determined enthalpy of reaction {Delta}{sub r}H(cal) = (4.0 {+-} 0.9) kJ {center_dot} mol{sup -1} (T = 298.15 K and citrate buffer at pH 4.81, I = 0.36 mol {center_dot} kg{sup -1}) were measured. A chemical equilibrium model, together with pKs and standard enthalpies of reaction {Delta}{sub r}H{sup 0} for the H{sup +}(aq) binding reactions of the reactants and products, was then used to calculate the values K = (1.89 {+-} 0.06) . 10{sup -4}, {Delta}{sub r}H{sup o} = (7.3 {+-} 1.7) kJ {center_dot} mol{sup -1}, {Delta}{sub r}G{sup o} = (21.25 {+-} 0.07) kJ {center_dot} mol{sup -1}, and {Delta}{sub r}S{sup o} = - (46.8 {+-} 5.7) J {center_dot} K{sup -1} {center_dot} mol{sup -1} for the chemical reference reaction {l_brace}methyl ferulate(aq) + H{sub 2}O(l) = methanol(aq) + ferulic acid{sup -}(aq) + H{sup +}(aq){r_brace}. These values of K and {Delta}{sub r}H{sup o} are similar in magnitude to the corresponding values reported for the reaction {l_brace}propyl gallate(aq) + H{sub 2}O(l) = 3,4,5-trihydroxybenzoic acid{sup -}(aq) + 1-propanol(aq) + H{sup +}(aq){r_brace}. The results obtained in this study can be used in a chemical equilibrium model to calculate how K' and other standard transformed properties such as the standard transformed enthalpy {Delta}{sub r}H'{sup o}, standard transformed Gibbs free energy {Delta}{sub r}G'{sup o}, and the change in binding of H{sup +}(aq), {Delta}{sub r}N(H{sup +}), vary with the independent variables T, pH, and I.

  2. A displacement-based approach for determining non-linear effects on pre-tensioned-cable cross-braced structures

    Science.gov (United States)

    Giaccu, Gian Felice; Caracoglia, Luca

    2017-04-01

    Pre-tensioned-cable bracing systems are widely employed in structural engineering to limit lateral deflections and stabilize structures. A suitable configuration of the pre-tensioned-cable bracing systems in a structure is an important issue since the internal force distribution, emerging from the interaction with the existing structure, significantly affects the structural dynamic behavior. The design, however, is often based on the intuition and the previous experience of the engineer. In recent years, the authors have been investigating the non-linear dynamic response of cable systems, installed on cable-stayed bridges, and in particular the so-called "cable-cross-tie systems" forming a cable network. The bracing cables (cross-ties) can exhibit slackening or snapping. Therefore, a non-linear unilateral model, combined with the taut-cable theory, is required to simulate the incipient slackening conditions in the stays. Capitalizing from this work on non-linear cable dynamics, this paper proposes a new approach to analyze, in laterally- braced truss structures, the unilateral effects and dynamic response accounting for the loss in the pre-tensioning force imparted to the bracing cables. This effect leads to non-linear vibration of the structure. In this preliminary study, the free vibrations of the structure are investigated by using the "Equivalent Linearization Method". A performance coefficient, a real positive number between 0.5 and 1.0, is defined and employed to monitor the relative reduction in the apparent stiffness of the braces during structural vibration, "mode by mode". It is shown that the system can exhibit alternate unilateral behavior of the cross-braces. A reduction of the performance coefficient close to fifty percent is observed in the braces when the initial pre-tensioning force is small. On the other hand the performance coefficient tends to one in the case of a high level of pre-stress. It is concluded that the performance coefficient may

  3. Determination of brace forces caused by construction loads and wind loads during bridge construction.

    Science.gov (United States)

    2014-04-01

    The first objective of this study was to develop procedures for determining bracing forces during bridge construction. : Numerical finite element models and analysis techniques were developed for evaluating brace forces induced by construction loads ...

  4. Light Steel-Timber Frame with Composite and Plaster Bracing Panels

    Directory of Open Access Journals (Sweden)

    Roberto Scotta

    2015-11-01

    Full Text Available The proposed light-frame structure comprises steel columns for vertical loads and an innovative bracing system to efficiently resist seismic actions. This seismic force resisting system consists of a light timber frame braced with an Oriented Strand Board (OSB sheet and an external technoprene plaster-infilled slab. Steel brackets are used as foundation and floor connections. Experimental cyclic-loading tests were conduced to study the seismic response of two shear-wall specimens. A numerical model was calibrated on experimental results and the dynamic non-linear behavior of a case-study building was assessed. Numerical results were then used to estimate the proper behavior factor value, according to European seismic codes. Obtained results demonstrate that this innovative system is suitable for the use in seismic-prone areas thanks to the high ductility and dissipative capacity achieved by the bracing system. This favorable behavior is mainly due to the fasteners and materials used and to the correct application of the capacity design approach.

  5. Light Steel-Timber Frame with Composite and Plaster Bracing Panels.

    Science.gov (United States)

    Scotta, Roberto; Trutalli, Davide; Fiorin, Laura; Pozza, Luca; Marchi, Luca; De Stefani, Lorenzo

    2015-11-03

    The proposed light-frame structure comprises steel columns for vertical loads and an innovative bracing system to efficiently resist seismic actions. This seismic force resisting system consists of a light timber frame braced with an Oriented Strand Board (OSB) sheet and an external technoprene plaster-infilled slab. Steel brackets are used as foundation and floor connections. Experimental cyclic-loading tests were conduced to study the seismic response of two shear-wall specimens. A numerical model was calibrated on experimental results and the dynamic non-linear behavior of a case-study building was assessed. Numerical results were then used to estimate the proper behavior factor value, according to European seismic codes. Obtained results demonstrate that this innovative system is suitable for the use in seismic-prone areas thanks to the high ductility and dissipative capacity achieved by the bracing system. This favorable behavior is mainly due to the fasteners and materials used and to the correct application of the capacity design approach.

  6. An Experimental Investigation on the Ultimate Strength of Partially Infilled: Braced Steel Frames

    Science.gov (United States)

    Dubey, Shailendra Kumar Damodar; Kute, Sunil Y.

    2017-12-01

    Infilled walls are usually, considered as non-structural elements. However, these walls are effective in carrying lateral loads. In this regard, an experimental investigation was planned and conducted to study the effect of braced and partially infilled steel frames with cement mortar and concrete in comparison to the bare frames. All these frames were tested up to collapse and subjected only to horizontal loads to obtain an effective and possible solution for soft storey which are generally not infilled. In comparison to bare steel frames, partially infilled frames have an increase of lateral load capacity by 45-60%. Central bracing is more effective than that of the corner bracing. For the same load partially infilled frames have significantly less deflection than that of the bare frames. A reduced load factor is suggested for the design of soft storey columns with the partial infills. A mathematical model has been proposed to calculate the theoretical ultimate load for the braced, cement mortar and concrete partial infilled frames.

  7. Influence of functional knee bracing on the isokinetic and functional tests of anterior cruciate ligament deficient patients.

    Directory of Open Access Journals (Sweden)

    Niyousha Mortaza

    Full Text Available Use of functional knee braces has been suggested to provide protection and to improve kinetic performance of the knee in Anterior cruciate ligament(ACL-injured patients. However, many athletes might refrain from wearing the braces because of the fear of performance hindrance in the playing field. The aim of this study was to examine the effect of three functional knee brace/sleeves upon the isokinetic and functional performance of ACL-deficient and healthy subjects. Six anterior cruciate ligament deficient (29.0 ± 5.3 yrs., 175.2 ± 5.4 cm, and 73.0 ± 10.0 kg and six healthy male subjects (27.2 ± 3.7 yrs., 176.4 ± 6.4 cm, and 70.3 ± 6.9 kg were selected. The effect of a custom-made functional knee brace, and two neoprene knee sleeves, one with four metal supports and one without support were examined via the use of isokinetic and functional tests in four sets (non-braced,wearing functional knee brace,and wearing the sleeves. Cross-over hop and single leg vertical jump test were performed and jump height, and hop distance were recorded. Peak torque to body weight ratio and average power in two isokinetic velocities(60°.s(-1,180°.s(-1 were recorded and the brace/sleeves effect was calculated as the changes in peak torque measured in the brace/sleeves conditions, expressed as a percentage of peak torque measured in non-braced condition. Frequency content of the isokinetic torque-time curves was also analyzed. Wilcoxon signed rank test was used to compare the measured values in four test conditions within each control and ACL-deficient group,and Mann-Whitney U test was used for the comparison between the two groups. No significant differences in peak torque, average power, torque-time curve frequency content, vertical-jump and hop measurements were found within the experimental and the non-braced conditions (p>0.05. Although the examined functional knee brace/sleeves had no significant effect on the knee muscle performance, there have been

  8. Treatment of the idiopathic scoliosis with brace and physiotherapy.

    Science.gov (United States)

    Hundozi-Hysenaj, Hajrije; Dallku, Iliriana Boshnjaku; Murtezani, Ardiana; Rrecaj, Shkurte

    2009-01-01

    Scoliosis is a three-dimensional deformation of the spine with a lateral curvature or deviation greater than 10 degrees and associated with vertebral rotation. Many conservative treatments are available for adolescents with idiopathic scoliosis, but the evidence for their effectiveness is still questioned. The objective of this study was to define the effectiveness of braces and individual physiotherapy for the comprehensive treatment of idiopathic scoliosis in adolescents. A retrospective study of 57 children with idiopathic thoracic dextroscoliosis with the magnitude of the thoracic curve between 20 degrees-35 degrees, treated in Orthopedic and Physiatrist Clinic as well as National Ortho-prosthetic Center within University Clinical Center of Kosova in Prishtina, during the period of 2003-2006. Inclusion of kinesitherapy in the comprehensive management of idiopathic scoliosis varied in the improvement of the muscle strength (satisfied and moderate) in almost 80% of the children while the correction of the curve was small in approximately 42.1% of cases. For children with idiopathic scoliosis, who require braces, an exercise program helps chest mobility, muscle strength, proper breathing flexibility in the spine, correct posture and keeps muscles in tone so that the transition period after brace removal is easier.

  9. [Influence of Ankle Braces on the Prevalence of Ankle Inversion Injuries in the Swiss Volleyball National League A].

    Science.gov (United States)

    Jaggi, J; Kneubühler, S; Rogan, S

    2016-06-01

    Ankle inversion is a common injury among volleyball players. The injury rate during a game is 2.1 times higher than during training. As a result, the preventive use of ankle braces is frequently observed in Swiss volleyball leagues. Studies have shown that ankle braces have a preventive effect on the prevalence of ankle inversion. In Switzerland there has been no investigation into the preventive use of braces and their influence on prevalence. For this reason, the goals of this study are 1) to determine when, why and by whom ankle braces are worn and 2) to evaluate the injury rate of users and non-users of ankle braces. A modified questionnaire was sent to 18 men's and women's teams of the Swiss National League A. The questionnaire included questions about injury rates and the circumstances of ankle inversion injuries. The data were statistically analysed with Microsoft Excel 2012 and SPSS Version 20. The overall response rate was 61 %, allowing data from 181 players to be analysed. 33 % (59 of 181) of the players used an ankle brace. There was a statistically significant difference in the prevalence of ankle inversion between users (12 injured) and non-users (8 injured) (p = 0.006). Wearing an ankle brace during training or during a game made no difference in the prevention of injuries (p = 0.356). More athletes were injured during training (n = 13) than during a game (n = 7). The results of the present study indicate that volleyball players preferably wear ankle braces to prevent injury. More than one third of the players in the study wore an ankle brace, 60 % for primary prevention and 40 % for secondary prevention due to a previous injury. The study shows that significantly more users than non-users of ankle braces were injured. This is contrary to literature. Furthermore it was shown that more injuries occur during training than during a game. This finding results from the fact that ankle braces were rarely worn during training. It is

  10. Bracing can partially limit tibial rotation during stressful activities after anterior crucial ligament reconstruction with a hamstring graft.

    Science.gov (United States)

    Giotis, D; Paschos, N K; Zampeli, F; Pappas, E; Mitsionis, G; Georgoulis, A D

    2016-09-01

    Hamstring graft has substantial differences with BPTB graft regarding initial mechanical strength, healing sequence, and vascularization, which may imply that a different approach during rehabilitation period is required. The purpose of this study was to investigate the influence of knee bracing on tibial rotation in ACL-reconstructed patients with a hamstring autograft during high loading activities. The hypothesis was that there would be a decrease in tibial rotation in the ACL-reconstructed braced knee as compared to the unbraced knee. Twenty male patients having undergone unilateral ACL reconstruction with a semitendinosus/gracilis autograft were assessed. Kinematic data were collected with an eight-camera optoelectronic system during two stressful tasks: (1) descending from a stair and subsequent pivoting; and (2) landing from a platform and subsequent pivoting. In each patient, three different experimental conditions were evaluated: (A) wearing a prophylactic brace (braced condition); (B) wearing a patellofemoral brace (sleeved condition); (C) without brace (unbraced condition). The intact knee without brace served as a control. Tibial rotation was significantly lower in the intact knee compared to all three conditions of the ACL-reconstructed knee (P≤0.01 for both tasks). Presence of a brace or sleeve resulted in lower tibial rotation than in the unbraced condition (p=0.003 for descending/pivot and P=0.0004 for landing/pivot). The braced condition resulted in lower rotation than the sleeved condition for descending/pivoting (P=0.031) while no differences were found for landing/pivoting (P=0.230). Knee bracing limited the excessive tibial rotation during pivoting under high loading activities in ACL-reconstructed knees with a hamstring graft. This partial restoration of normal kinematics may have a potential beneficial effect in patients recovering from ACL reconstruction with a hamstring autograft. Level III, case-control therapeutic study. Copyright

  11. Effects of prophylactic knee bracing on knee joint kinetics and kinematics during netball specific movements.

    Science.gov (United States)

    Sinclair, Jonathan K; Vincent, Hayley; Richards, Jim D

    2017-01-01

    To investigate the effects of a prophylactic knee brace on knee joint kinetics and kinematics during netball specific movements. Repeated measures. Laboratory. Twenty university first team level female netball players. Participants performed three movements, run, cut and vertical jump under two conditions (brace and no-brace). 3-D knee joint kinetics and kinematics were measured using an eight-camera motion analysis system. Knee joint kinetics and kinematics were examined using 2 × 3 repeated measures ANOVA whilst the subjective ratings of comfort and stability were investigated using chi-squared tests. The results showed no differences (p > 0.05) in knee joint kinetics. However the internal/external rotation range of motion was significantly (p < 0.05) reduced when wearing the brace in all movements. The subjective ratings of stability revealed that netballers felt that the knee brace improved knee stability in all movements. Further study is required to determine whether reductions in transverse plane knee range of motion serve to attenuate the risk from injury in netballers. Copyright © 2016 Elsevier Ltd. All rights reserved.

  12. The Application of Buckling Reinforced Bracing and Shear Wall in Retrofitting of Existing Concrete Building

    Directory of Open Access Journals (Sweden)

    Mahdi Izadi

    2015-06-01

    Full Text Available Vulnerable buildings and their rehabilitation are important problems for earthquake regions. In recent decades the goal of building rehabilitation and strengthening has gained different rehabilitation systems. However, most of these strengthening techniques disturb the occupants, who must vacate the building during renovation. Several retrofitting techniques such as addition masonry infill wall, application of buckling restrained braces and local modification of components has been studied in order to improve the overall seismic performance of such buildings. In response to many of the practical issues and economic considerations, engineers use often convergent unbuckling steel bracing frames as the lateral load resisting system during an earthquake.This kind of bracings increases the hardness and strength of concrete structures.The aim of the present study is the evaluation and comparison of seismic performance and retrofitting of an existing 7-storeys concrete structure with buckling restrained bracings and shear walls by nonlinear static procedure (NSP and accordance with cod-361. The results show that the buckling restrained bracing, decreased drift to acceptable levels and Structure behaves on the life safety of performance level.

  13. Seismic Response and Evaluation of SDOF Self-Centering Friction Damping Braces Subjected to Several Earthquake Ground Motions

    Directory of Open Access Journals (Sweden)

    Jong Wan Hu

    2015-01-01

    Full Text Available This paper mainly deals with seismic response and performance for self-centering friction damping braces (SFDBs subjected to several maximum- or design-leveled earthquake ground motions. The self-centering friction damping brace members consist of core recentering components fabricated with superelastic shape memory alloy wires and energy dissipation devices achieved through shear friction mechanism. As compared to the conventional brace members for use in the steel concentrically braced frame structure, these self-centering friction damping brace members make the best use of their representative characteristics to minimize residual deformations and to withstand earthquake loads without member replacement. The configuration and response mechanism of self-centering friction damping brace systems are firstly described in this study, and then parametric investigations are conducted through nonlinear time-history analyses performed on numerical single degree-of-freedom spring models. After observing analysis results, adequate design methodologies that optimally account for recentering capability and energy dissipation according to their comparative parameters are intended to be suggested in order to take advantage of energy capacity and to minimize residual deformation simultaneously.

  14. Supporting brace sizing in structures with added linear viscous fluid dampers: A filter design solution

    OpenAIRE

    Londono, J.M.; Wagg, D.; Neild, S.A.

    2014-01-01

    Viscous fluid dampers have proved to be effective in suppressing unwanted vibrations in a range of engineering structures. When dampers are fitted in a structure, a brace is typically used to attach them to the main structure. The stiffness of this brace can significantly alter the effectiveness of the damper, and in structures with multiple dampers, this can be a complex scenario to model. In this paper, we demonstrate that the effects of the brace compliance on the damper performance can be...

  15. A Review of Influence of Various Types of Structural Bracing to the Structural Performance of Buildings

    Science.gov (United States)

    Razak, S. M.; Kong, T. C.; Zainol, N. Z.; Adnan, A.; Azimi, M.

    2018-03-01

    Excessive lateral drift can contribute significantly towards crack formation, leading to structural damage. The structural damage will in turn reduce the capacity of the structure and weaken it from the intended design capacity. Generally, lateral drift is more pronounced in higher and longer structure, such as high rise buildings and bridges. A typical method employed to control lateral drift is structural bracing, which works by increasing stiffness and stability of structure. This paper reviews the influence of various types of structural bracing to structural performance of buildings. The history of structural bracing is visited and the differences between numerous structural bracing in term of suitability to different types of buildings and loading, mechanisms, technical details, advantages and limitations, and the overall effect on the structural behaviour and performance are dissected. Proper and efficient structural bracing is pertinent for each high rise building as this will lead towards safer, sustainable and more economical buildings, which are cheaper to maintain throughout the life of the buildings in the future.

  16. Delayed latency of peroneal reflex to sudden inversion with ankle taping or bracing.

    Science.gov (United States)

    Shima, N; Maeda, A; Hirohashi, K

    2005-01-01

    The purpose of the present study was to examine the effects of ankle taping and bracing based on the peroneal reflex in the hypermobile and normal ankle joints with and without history of ankle injury. Thirty-six ankle joints of 18 collegiate American football athletes with and without previous history of injury were studied. The angle of talar tilt (TT) was measured by stress radiograph for classifying normal (TT5 degrees ) ankles. They were tested with taping, bracing, and without any supports as a control. The latency of peroneus longus muscle was measured by a sudden inversion of 25 degrees using surface EMG signals. The results of the present study show no significant three-way Group (hypermobile or normal ankles) by History (previously injured or uninjured ankles) by Condition (control, taping, or bracing) interaction, while Condition main effect was significant (p0.05). In conclusion, ankle taping and bracing delayed the peroneal reflex latency not only for hypermobile ankles and/or injured ankle joints but also for intact ankle joints.

  17. Comparison of in-and outpatients protocols for providence night time only bracing in AIS patients -- compliance and satisfaction

    DEFF Research Database (Denmark)

    Al-Aubaidi, Zaid Tj; Tropp, Hans; Pedersen, Niels W

    2013-01-01

    BACKGROUND: Skeletally immature patients diagnosed with adolescent idiopathic scoliosis (AIS) and a Cobb angle above 25degrees is usually treated with a brace. Standard protocols in many centers include hospitalisation for a few days for the purpose of brace adaptation and fitting. The aim...... of this study is to compare compliance and satisfaction in hospitalization and out patient clinic protocols, at the initiation phase of brace treatment.Materials and methodsTwenty-four consecutive patients with AIS were initiated with the Providence night time only brace at our department between October 2008...

  18. Effects of Prophylactic Knee Bracing on Lower Limb Kinematics, Kinetics, and Energetics During Double-Leg Drop Landing at 2 Heights.

    Science.gov (United States)

    Ewing, Katie A; Begg, Rezaul K; Galea, Mary P; Lee, Peter V S

    2016-07-01

    Anterior cruciate ligament (ACL) injuries commonly occur during landing maneuvers. Prophylactic knee braces were introduced to reduce the risk of ACL injuries, but their effectiveness is debated. We hypothesized that bracing would improve biomechanical factors previously related to the risk of ACL injuries, such as increased hip and knee flexion angles at initial contact and at peak vertical ground-reaction force (GRF), increased ankle plantar flexion angles at initial contact, decreased peak GRFs, and decreased peak knee extension moment. We also hypothesized that bracing would increase the negative power and work of the hip joint and would decrease the negative power and work of the knee and ankle joints. Controlled laboratory study. Three-dimensional motion and force plate data were collected from 8 female and 7 male recreational athletes performing double-leg drop landings from 0.30 m and 0.60 m with and without a prophylactic knee brace. GRFs, joint angles, moments, power, and work were calculated for each athlete with and without a knee brace. Prophylactic knee bracing increased the hip flexion angle at peak GRF by 5.56° (P knee flexion angle at peak GRF by 4.75° (P = .001), and peak hip extension moment by 0.44 N·m/kg (P knee and ankle. No differences in peak GRFs and peak knee extension moment were observed with bracing. The application of a prophylactic knee brace resulted in improvements in important biomechanical factors associated with the risk of ACL injuries. Prophylactic knee braces may help reduce the risk of noncontact knee injuries in recreational and professional athletes while playing sports. Further studies should investigate different types of prophylactic knee braces in conjunction with existing training interventions so that the sports medicine community can better assess the effectiveness of prophylactic knee bracing. © 2016 The Author(s).

  19. Forces exerted during exercises by patients with adolescent idiopathic scoliosis wearing fiberglass braces

    OpenAIRE

    Romano Michele; Carabalona Roberta; Petrilli Silvia; Sibilla Paolo; Negrini Stefano

    2006-01-01

    Abstract Objective To quantify and compare the forces exerted by scoliosis patients in fiberglass braces during exercises usually prescribed in departments where casts are made. The exercises are intended to increase corrective forces, activate muscles, stimulate ventilation and help the patient psychologically. Setting Outpatient care. Patients 17 consecutive adolescent patients wearing fiberglass brace for idiopathic scoliosis. Interventions Exercises (kyphotization, rotation, "escape from ...

  20. Ankle brace attenuates the medial-lateral ground reaction force during basketball rebound jump

    Directory of Open Access Journals (Sweden)

    Alex Castro

    Full Text Available ABSTRACT Introduction: The jump landing is the leading cause for ankle injuries in basketball. It has been shown that the use of ankle brace is effective to prevent these injuries by increasing the mechanical stability of the ankle at the initial contact of the foot with the ground. Objective: To investigate the effects of ankle brace on the ground reaction force (GRF during the simulation of a basketball rebound jump. Method: Eleven young male basketball players randomly carried out a simulated basketball rebound jump under two conditions, with and without ankle brace (lace-up. Dynamic parameters of vertical GRF (take-off and landing vertical peaks, time to take-off and landing vertical peaks, take-off impulse peak, impulse at 50 milliseconds of landing, and jump height and medial-lateral (take-off and landing medial-lateral peaks, and time to reach medial-lateral peaks at take-off and landing were recorded by force platform during rebound jumps in each tested condition. The comparisons between the tested conditions were performed by paired t test (P0.05. Conclusion: The use of ankle brace during basketball rebound jumps attenuates the magnitude of medial-lateral GRF on the landing phase, without changing the vertical GRF. This finding indicates that the use of brace increases the medial-lateral mechanical protection by decreasing the shear force exerted on the athlete’s body without change the application of propulsive forces in the take-off and the impact absorption quality in the landing during the basketball rebound jump.

  1. Rehabilitation of adolescent idiopathic scoliosis: results of exercises and bracing from a series of clinical studies. Europa Medicophysica-SIMFER 2007 Award Winner.

    Science.gov (United States)

    Negrini, S; Atanasio, S; Zaina, F; Romano, M

    2008-06-01

    Rehabilitation of adolescent idiopathic scoliosis (AIS) requires a careful choice from among the possible treatments, such as bracing and exercises, according to the patient's needs. According to the literature, there is little evidence regarding the efficacy of these rehabilitation instruments. During the past few years, a full series of studies has been carried out to investigate their efficacy. The aim of this paper was to summarize all these results. Three systematic reviews (two on exercises and one on manual therapy), and four cohort prospective studies were performed. The prospective studies included two trials with a prospective control group on exercises (one to avoid bracing and one in preparation to bracing) and two trials with retrospective control group on a new brace developed by the Authors (Sforzesco brace and SPoRT concept of correction versus Lyon brace and Risser cast). Results show that in literature there is proof of level 1b on exercises but no studies on manual therapy. High quality exercises like Scientific Exercises Approach to Scoliosis (SEAS) have more efficacy than usual physiotherapy, significantly reducing brace prescription in one year from 25% of cases to 6%. Moreover, such exercises help to obtain the best results in bracing first correction. The Sforzesco brace has proved to have more efficacy than the Lyon brace, whereas it has the same efficacy--but reduced side effects and impact on quality of life--than the Risser brace. With an efficient management of data collection, it is possible to develop a set of studies aimed at verifying the efficacy of clinical daily rehabilitation approaches.

  2. Effect of Kınesıotapıng and Knee Brace on Functıonal Performance in Recreatıonal Athletes

    Science.gov (United States)

    Ulusoy, Burak; İldiz, Bülent; Tunay, Volga Bayrakçı

    2014-01-01

    Objectives: Kinesiotaping is a popular taping method that is used for both therapeutic and performance enchancement purposes. Knee braces are widely used for prevention in sport injuries but their performance effectiveness is still controversial. The aim of this study was to determine whether kinesiotape or brace was more effective on functional performance. Methods: A total twenty male recreational football players (Mean±Standart Deviation (SD) age: 22.5±0.68 years, height: 175.15±3.37 cm, body weight: 74.52±12.41 kg), voluntarily participated in this study. Participants were tested with kinesiotape, with brace and without kinesiotape and brace. Tests were applied one day after patellar kinesiotaping (correction technique). Balance property measured with Modified Y balance Test (dynamic test), agility measured by T test, muscle strength and anaerobic power assessed by vertical jump and triple hop tests. Wilcoxon signed rank test was employed for determining the statistical significance of tests with kinesiotape, with brace and without kinesiotape and brace. Results: In analysis; There were statistically significant differences found in Triple hop test with kinesiotaping and without kinesiotaping and brace, in T test with bracing and kinesiotaping, in vertical jump with kinesiotaping and without kinesiotaping and brace (pkinesiotaping in all tests) No statistically significant difference was found in modified Y balance test all groups (p> 0.05). Conclusion: Consequently, kinesiotaping had positive effects on agility and muscle strength but had no effects on balance in football players. On the other hand, brace had no effects on functional performance tests.

  3. Application of different measures of skeletal maturity in initiating weaning from a brace for scoliosis: two case reports

    Directory of Open Access Journals (Sweden)

    Rivett LouAnn

    2009-04-01

    Full Text Available Abstract Introduction Various measures of skeletal maturity are used to initiate weaning from a brace in patients suffering from idiopathic scoliosis, resulting in different outcomes. We present two cases with double major curves, treated with the Rigo System Cheneau brace, and weaned using different criteria. Case presentation Case 1 was a South African, Caucasian girl who was initially treated with a brace at 14.75 years and who began weaning at 16.25 years on the basis of the Greulich and Pyle Index. She was out of her brace in 6 months, at least 11 months before reaching skeletal maturity as shown by the Risser Sign. Case 2 was a South African, Caucasian girl, initially treated with a brace at 14.25 years and who began the weaning process at 17.67 years on the basis of skeletal maturity according to the Risser Sign and static height for a period of 6 months. She was out of the brace 12 months later. In Case 1, the thoracic Cobb angle progressed during weaning and scoliometer readings deteriorated. The iliac apophysis fused 11 months after the wrist. In Case 2, the therapeutic gains made during the period of bracing were maintained during weaning, that is the improvement in the lumbar Cobb angle was maintained until the brace was removed, and scoliometer readings improved. The iliac apophysis fused 8.5 months after the wrist. Conclusions In patients with idiopathic scoliosis, it would seem to be more appropriate to base the timing of weaning on the Risser Sign and static height measurements rather than on traditional methods such as the Greulich and Pyle Index.

  4. A Conceptual Design and Structural Analysis for ITER Mid-plane Brace Tools

    Energy Technology Data Exchange (ETDEWEB)

    Nam, Kyoung O; Park, Hyun Ki; Kim, Dong Jin [National Fusion Research Institute, Daejeon (Korea, Republic of); Lee, Jae Hyuk; Kim, Kyung kyu [SFA Engineering Corp., Changwon (Korea, Republic of); Im, Kihak; Robert, Shaw [ITER Organization, St Paul lez Durance Cedex (France)

    2010-10-15

    The ITER, International Thermonuclear Experimental Reactor, Tokamak machine is mainly composed of 9 vacuum vessel (VV)/toroidal field coils (TFCs)/vacuum vessel thermal shields (VVTS) 40 .deg. sectors. Each VV/TFCs/VVTS 40 .deg. sector is made up of one 40 .deg. VV, two 20 .deg. TFCs and associated VVTS segments. The ITER Tokamak assembly tools are purpose-built tools to assemble the ITER Tokamak machine which includes the cryostat and the components contained therein. Based on the design description document prepared by the IO (ITER international organization), Korea has carried out the conceptual design of assembly tools with IO cooperation. The 40 .deg. sector assemblies attached mid-plane brace tools sub-assembled at assembly hall are transferred to Tokamak hall using the lifting tool operated by Tokamak main cranes. The sector sub-assembly tools are composed of the upending tool, the sector sub-assembly tool, the sector lifting tool and the vacuum vessel support and mid-plane brace tools. The mid-plane brace tool is assembled to inner surface of VV and TFCs in phase of sector sub-assembly after completion of all sector components. VV, TFC and VVTS are separated fully before completion of 9 sectors at Tokamak in-pit. In this paper the mid-plane brace tools is introduced about function, structure and status of research and development are also described

  5. The effect of different skin-ankle brace application pressures on quiet single-limb balance and electromyographic activation onset of lower limb muscles

    Directory of Open Access Journals (Sweden)

    Papadakis Stamatios A

    2007-09-01

    Full Text Available Abstract Background Several studies have been carried out in order to investigate the effect of ankle bracing on ankle joint function and performance. However, no study so far has examined the role of skin-brace interface pressure in neuromuscular control. The aim of this study was to investigate the effect of different skin-ankle brace interface pressures on quiet single limb balance and the electromyographic (EMG activation sequence of four lower limb muscles. Methods Thirty three male physical education students who volunteered to take part in the study were measured under three ankle brace conditions: i without brace, ii with brace and 30 kPa application pressure and iii with brace and 60 kPa application pressure. Single limb balance (anteroposterior and mediolateral parameter was assessed on the dominant lower limb, with open and closed eyes, on a force platform, simultaneously with the EMG recording of four lower lower limb muscles' (gastrocnemius, peroneus longus, rectus femoris and biceps femoris activation onset. Results The results showed that overall balance (total stability parameter was not significantly affected in any of the three ankle brace conditions. However, the anteroposterior centre of pressure excursion and centre of pressure excursion velocity were significantly increased with the application of ankle brace, both with 30 and 60 kPa application pressures. Furthermore, it was found that single limb balance was significantly worse with closed eyes compared to open eyes. EMG measurements showed that the sequence of lower limb activation onset was not affected in any of the three ankle brace application conditions. The results of this study showed that the application of an ankle brace with two different skin-brace interface pressures had no effect on overall single limb balance and the sequence of lower limb muscle activation. Conclusion These findings suggest that peripheral joint receptors are either not adequately

  6. Fluoroscopic Analysis of Tibial Translation in Anterior Cruciate Ligament Injured Knees With and Without Bracing During Forward Lunge

    Science.gov (United States)

    Jalali, Maryam; Farahmand, Farzam; Mousavi, Seyed Mohammad Ebrahim; Golestanha, Seyed Ali; Rezaeian, Tahmineh; Shirvani Broujeni, Shahram; Rahgozar, Mehdi; Esfandiarpour, Fateme

    2015-01-01

    Background: Despite several studies with different methods, the effect of functional knee braces on knee joint kinematics is not clear. Direct visualization of joint components through medical imaging modalities may provide the clinicians with more useful information. Objectives: In this study, for the first time in the literature, video fluoroscopy was used to investigate the effect of knee bracing on the sagittal plane kinematics of anterior cruciate ligament (ACL) injured patients. Patients and Methods: For twelve male unilateral ACL deficient subjects, the anterior tibial translation was measured during lunge exercise in non-braced and braced conditions. Fluoroscopic images were acquired from the subjects using a digital fluoroscopy system with a rate of 10 fps. The image of each frame was scaled using a calibration coin and analyzed in AutoCAD environment. The angle between the two lines, tangent to the posterior cortexes of the femoral and tibial shafts was measured as the flexion angle. For the fluoroscopic images associated with 0°, 15°, 30°, 45° and 60° knee flexion angles, the relative anterior-posterior configuration of the tibiofemoral joint was assessed by measuring the position of landmarks on the tibia and femur. Results: Results indicated that the overall anterior translations of the tibia during the eccentric (down) and concentric (up) phases of lunge exercise were 10.4 ± 1.7 mm and 9.0 ± 2.2 mm for non-braced, and 10.1 ± 3.4 mm and 7.4 ± 2.5 mm, for braced conditions, respectively. The difference of the tibial anterior-posterior translation behaviors of the braced and non-braced knees was not statistically significant. Conclusion: Fluoroscopic imaging provides an effective tool to measure the dynamic behavior of the knee joint in the sagittal plane and within the limitations of this study, the pure mechanical stabilizing effect of functional knee bracing is not sufficient to control the anterior tibial translation of the ACL deficient

  7. Fluoroscopic Analysis of Tibial Translation in Anterior Cruciate Ligament Injured Knees With and Without Bracing During Forward Lunge.

    Science.gov (United States)

    Jalali, Maryam; Farahmand, Farzam; Mousavi, Seyed Mohammad Ebrahim; Golestanha, Seyed Ali; Rezaeian, Tahmineh; Shirvani Broujeni, Shahram; Rahgozar, Mehdi; Esfandiarpour, Fateme

    2015-07-01

    Despite several studies with different methods, the effect of functional knee braces on knee joint kinematics is not clear. Direct visualization of joint components through medical imaging modalities may provide the clinicians with more useful information. In this study, for the first time in the literature, video fluoroscopy was used to investigate the effect of knee bracing on the sagittal plane kinematics of anterior cruciate ligament (ACL) injured patients. For twelve male unilateral ACL deficient subjects, the anterior tibial translation was measured during lunge exercise in non-braced and braced conditions. Fluoroscopic images were acquired from the subjects using a digital fluoroscopy system with a rate of 10 fps. The image of each frame was scaled using a calibration coin and analyzed in AutoCAD environment. The angle between the two lines, tangent to the posterior cortexes of the femoral and tibial shafts was measured as the flexion angle. For the fluoroscopic images associated with 0°, 15°, 30°, 45° and 60° knee flexion angles, the relative anterior-posterior configuration of the tibiofemoral joint was assessed by measuring the position of landmarks on the tibia and femur. Results indicated that the overall anterior translations of the tibia during the eccentric (down) and concentric (up) phases of lunge exercise were 10.4 ± 1.7 mm and 9.0 ± 2.2 mm for non-braced, and 10.1 ± 3.4 mm and 7.4 ± 2.5 mm, for braced conditions, respectively. The difference of the tibial anterior-posterior translation behaviors of the braced and non-braced knees was not statistically significant. Fluoroscopic imaging provides an effective tool to measure the dynamic behavior of the knee joint in the sagittal plane and within the limitations of this study, the pure mechanical stabilizing effect of functional knee bracing is not sufficient to control the anterior tibial translation of the ACL deficient patients during lunge exercise.

  8. The predictive value of the extensor grip test for the effectiveness of bracing for tennis elbow

    NARCIS (Netherlands)

    Struijs, Peter A. A.; Assendelft, Willem J. J.; Kerkhoffs, Gino M. M. J.; Souer, Sebastiaan; van Dijk, C. Niek

    2005-01-01

    Background: Tennis elbow is a common complaint. Several treatment strategies, such as corticosteroid injections and physical therapy and braces, have been described. Hypothesis: The extensor grip test has predictive value in assessing the effectiveness of bracing in tennis elbow. Study Design:

  9. Evaluation of Brace Treatment for Infant Hip Dislocation in a Prospective Cohort: Defining the Success Rate and Variables Associated with Failure.

    Science.gov (United States)

    Upasani, Vidyadhar V; Bomar, James D; Matheney, Travis H; Sankar, Wudbhav N; Mulpuri, Kishore; Price, Charles T; Moseley, Colin F; Kelley, Simon P; Narayanan, Unni; Clarke, Nicholas M P; Wedge, John H; Castañeda, Pablo; Kasser, James R; Foster, Bruce K; Herrera-Soto, Jose A; Cundy, Peter J; Williams, Nicole; Mubarak, Scott J

    2016-07-20

    The use of a brace has been shown to be an effective treatment for hip dislocation in infants; however, previous studies of such treatment have been single-center or retrospective. The purpose of the current study was to evaluate the success rate for brace use in the treatment of infant hip dislocation in an international, multicenter, prospective cohort, and to identify the variables associated with brace failure. All dislocations were verified with use of ultrasound or radiography prior to the initiation of treatment, and patients were followed prospectively for a minimum of 18 months. Successful treatment was defined as the use of a brace that resulted in a clinically and radiographically reduced hip, without surgical intervention. The Mann-Whitney test, chi-square analysis, and Fisher exact test were used to identify risk factors for brace failure. A multivariate logistic regression model was used to determine the probability of brace failure according to the risk factors identified. Brace treatment was successful in 162 (79%) of the 204 dislocated hips in this series. Six variables were found to be significant risk factors for failure: developing femoral nerve palsy during brace treatment (p = 0.001), treatment with a static brace (p failure, whereas hips with 4 or 5 risk factors had a 100% probability of failure. These data provide valuable information for patient families and their providers regarding the important variables that influence successful brace treatment for dislocated hips in infants. Prognostic Level I. See Instructions for Authors for a complete description of levels of evidence. Copyright © 2016 by The Journal of Bone and Joint Surgery, Incorporated.

  10. The Effectiveness of a Functional Knee Brace on Joint-Position Sense in Anterior Cruciate Ligament-Reconstructed Individuals.

    Science.gov (United States)

    Sugimoto, Dai; LeBlanc, Jessica C; Wooley, Sarah E; Micheli, Lyle J; Kramer, Dennis E

    2016-05-01

    It is estimated that approximately 350,000 individuals undergo anterior cruciate ligament (ACL) reconstruction surgery in each year in the US. Although ACL-reconstruction surgery and postoperative rehabilitation are successfully completed, deficits in postural control remain prevalent in ACL-reconstructed individuals. In order to assist the lack of balance ability and reduce the risk of retear of the reconstructed ACL, physicians often provide a functional knee brace on the patients' return to physical activity. However, it is not known whether use of the functional knee brace enhances knee-joint position sense in individuals with ACL reconstruction. Thus, the effect of a functional knee brace on knee-joint position sense in an ACL-reconstructed population needs be critically appraised. After systematically review of previously published literature, 3 studies that investigated the effect of a functional knee brace in ACL-reconstructed individuals using joint-position-sense measures were found. They were rated as level 2b evidence in the Centre of Evidence Based Medicine Level of Evidence chart. Synthesis of the reviewed studies indicated inconsistent evidence of a functional knee brace on joint-position improvement after ACL reconstruction. More research is needed to provide sufficient evidence on the effect of a functional knee brace on joint-position sense after ACL reconstruction. Future studies need to measure joint-position sense in closed-kinetic-chain fashion since ACL injury usually occurs under weight-bearing conditions.

  11. Effect of a patella support brace on myoelectric activity of knee joint muscles during single leg landing

    Directory of Open Access Journals (Sweden)

    Fatemeh Salariesker

    2013-06-01

    Full Text Available Introduction: Patellfemoral pain syndrome is one of the most common knee joint problems that affect athletes and non-athletes. Knee brace is often used as a treatment method for patellar realignment. The aim of the present study was to determine the effects of a patella support brace on myoelectric activity of selected knee muscles during single leg landing in healthy females. Materials and Methods: 19 healthy female students (Mean age: 23.6±1.98 years, height: 163.5±5.88 cm, weight: 62.3±3.6 kg participated in this study. Myoelectric activity of biceps femoris, semitendinosus, vastus medialis and vastus lateralis were collected during single leg landing in with and without using the patella support brace conditions.Results: Use of the patella support brace had no significant effect on myoelectric activity for the semitendinosus (p=0.668, vastus medialis (VM (p=0.915 and vastus lateralis (VL (P=0.134, while myoelectric activity for biceps femoris (p=0.005 and ratio of VM/VL myoelectric activity significantly increased (p=0.045. Conclusion: Our results revealed that biceps femoris activity and vastus medialis/vastus lateralis ratio increased after using patella support brace during single leg landing. Further studies on kinematic and kinetic variables are needed to describe these changes in muscular activity when using the patella support brace.

  12. Structural analysis: Flexible receiver yoke brace for the 241SY101 mixer pump

    International Nuclear Information System (INIS)

    Jones, K.M.

    1994-01-01

    This report documents the structural analysis of the flexible-receiver yoke brace that will be used to maintain the mixer pump lifting yoke in a vertical position during the removal of the mixer pump from waste tank 241SY101. During the removal process, the crane is connected to a lifting yoke which is attached to the lifting on the mounting flange of the mixer pump. The pump then can be lifted from the tank. At one point in the removal procedure, the crane will be disconnected from the lifting yoke. At this time, it is possible for the lifting yoke to rotate around the pinned connection between it and the pump if it is subjected to a horizontal load. To prevent the rotation of the lifting yoke, the yoke brace was designed to maintain the yoke in a vertical position while it is disconnected from the crane. This analysis addressed the adequacy of the yoke brace to provide support for the lifting yoke during high winds and a seismic event. The results of this analysis show that, when subjected to a combined design wind and seismic load, the yoke brace design is acceptable to maintain the lifting yoke in a vertical position when the yoke is disconnected from the crane

  13. Mechanical stability of the subtalar joint after lateral ligament sectioning and ankle brace application: a biomechanical experimental study.

    Science.gov (United States)

    Kamiya, Tomoaki; Kura, Hideji; Suzuki, Daisuke; Uchiyama, Eiichi; Fujimiya, Mineko; Yamashita, Toshihiko

    2009-12-01

    The roles of each ligament supporting the subtalar joint have not been clarified despite several biomechanical studies. The effects of ankle braces on subtalar instability have not been shown. The ankle brace has a partial effect on restricting excessive motion of the subtalar joint. Controlled laboratory study. Ten normal fresh-frozen cadaveric specimens were used. The angular motions of the talus were measured via a magnetic tracking system. The specimens were tested while inversion and eversion forces, as well as internal and external rotation torques, were applied. The calcaneofibular ligament, cervical ligament, and interosseous talocalcaneal ligament were sectioned sequentially, and the roles of each ligament, as well as the stabilizing effects of the ankle brace, were examined. Complete sectioning of the ligaments increased the angle between the talus and calcaneus in the frontal plane to 51.7 degrees + or - 11.8 degrees compared with 35.7 degrees + or - 6.0 degrees in the intact state when inversion force was applied. There was a statistically significant difference in the angles between complete sectioning of the ligaments and after application of the brace (34.1 degrees + or - 7.3 degrees ) when inversion force was applied. On the other hand, significant differences in subtalar rotation were not found between complete sectioning of the ligaments and application of the brace when internal and external rotational torques were applied. The ankle brace limited inversion of the subtalar joint, but it did not restrict motion after application of internal or external rotational torques. In cases of severe ankle sprains involving the calcaneofibular ligament, cervical ligament, and interosseous talocalcaneal ligament injuries, application of an ankle brace might be less effective in limiting internal-external rotational instabilities than in cases of inversion instabilities in the subtalar joint. An improvement in the design of the brace is needed to restore

  14. A systematic review on the treatment of acute ankle sprain: brace versus other functional treatment types.

    Science.gov (United States)

    Kemler, Ellen; van de Port, Ingrid; Backx, Frank; van Dijk, C Niek

    2011-03-01

    Ankle injuries, especially ankle sprains, are a common problem in sports and medical care. Ankle sprains result in pain and absenteeism from work and/or sports participation, and can lead to physical restrictions such as ankle instability. Nowadays, treatment of ankle injury basically consists of taping the ankle. The purpose of this review is to evaluate the effectiveness of ankle braces as a treatment for acute ankle sprains compared with other types of functional treatments such as ankle tape and elastic bandages. A computerized literature search was conducted using PubMed, EMBASE, CINAHL and the Cochrane Clinical Trial Register. This review includes randomized controlled trials in English, German and Dutch, published between 1990 and April 2009 that compared ankle braces as a treatment for lateral ankle sprains with other functional treatments. The inclusion criteria for this systematic review were (i) individuals (sports participants as well as non-sports participants) with an acute injury of the ankle (acute ankle sprains); (ii) use of an ankle brace as primary treatment for acute ankle sprains; (iii) control interventions including any other type of functional treatment (e.g. Tubigrip™, elastic wrap or ankle tape); and (iv) one of the following reported outcome measures: re-injuries, symptoms (pain, swelling, instability), functional outcomes and/or time to resumption of sports, daily activities and/or work. Eight studies met all inclusion criteria. Differences in outcome measures, intervention types and patient characteristics precluded pooling of the results, so best evidence syntheses were conducted. A few individual studies reported positive outcomes after treatment with an ankle brace compared with other functional methods, but our best evidence syntheses only demonstrated a better treatment result in terms of functional outcome. Other studies have suggested that ankle brace treatment is a more cost-effective method, so the use of braces after acute

  15. Do Knee Bracing and Delayed Weight Bearing Affect Mid-Term Functional Outcome after Anterior Cruciate Ligament Reconstruction?

    Science.gov (United States)

    Di Miceli, Riccardo; Marambio, Carlotta Bustos; Zati, Alessandro; Monesi, Roberta; Benedetti, Maria Grazia

    2017-12-01

    Purpose  The aim of this study was to assess the effect of knee bracing and timing of full weight bearing after anterior cruciate ligament reconstruction (ACLR) on functional outcomes at mid-term follow-up. Methods  We performed a retrospective study on 41 patients with ACLR. Patients were divided in two groups: ACLR group, who received isolated ACL reconstruction and ACLR-OI group who received ACL reconstruction and adjunctive surgery. Information about age at surgery, bracing, full or progressive weight bearing permission after surgery were collected for the two groups. Subjective IKDC score was obtained at follow-up. Statistical analysis was performed to compare the two groups for IKDC score. Subgroup analysis was performed to assess the effect of postoperative regimen (knee bracing and weight bearing) on functional outcomes. Results  The mean age of patients was 30.8 ± 10.6 years. Mean IKDC score was 87.4 ± 13.9. The mean follow-up was 3.5 ± 1.8 years. Twenty-two (53.7%) patients underwent ACLR only, while 19 (46.3%) also received other interventions, such as meniscal repair and/or collateral ligament suture. Analysis of overall data showed no differences between the groups for IKDC score. Patients in the ACLR group exhibited a significantly better IKDC score when no brace and full weight bearing after 4 weeks from surgery was prescribed in comparison with patients who worn a brace and had delayed full weight bearing. No differences were found with respect to the use of brace and postoperative weight bearing regimen in the ACLR-OI group. Conclusion  Brace and delayed weight bearing after ACLR have a negative influence on long-term functional outcomes. Further research is required to explore possible differences in the patients operated on ACLR and other intervention with respect to the use of a brace and the timing of full weight bearing to identify optimal recovery strategies. Level of Evidence  Level III, retrospective observational

  16. SOSORT Award Winner 2015: a multicentre study comparing the SPoRT and ART braces effectiveness according to the SOSORT-SRS recommendations.

    Science.gov (United States)

    Zaina, Fabio; de Mauroy, Jean Claude; Donzelli, Sabrina; Negrini, Stefano

    2015-01-01

    Data comparing different braces for adolescent idiopathic scoliosis (AIS) are scant. The SRS criteria represent some guidelines for comparing results from different studies, but controlled studies are much more reliable. Recently, super-rigid braces have been introduced in clinical practice with the aim of replacing Risser and EDF casts. The aim of the present study is to compare the short-term radiographic results of two super-rigid braces, the ART and the SPORT (Sforzesco) brace. A group of consecutive patients with Cobb >40°, Risser 0-4, age >10 treated with the ART brace for 6 months were matched with a group of similar patients taken from a prospective database of patients treated with the Sforzesco brace. Patients were matched according to Cobb severity, pattern and localization of the curve. All patients had a full-time brace prescription (23-24 hours per day) and an indication to perform scoliosis-specific exercises and were assessed radiographically both immediately in the brace and after 6 months of treatment out of brace. Curves were analyzed according to the pattern and localization taking into consideration both the in-brace correction and the 6-month out-of-brace results. t-test, ANOVA, linear regression, alpha set at 0.05. Twenty-six patients were included in the ART brace group, and 26 in the Sforzesco brace group. At baseline, no differences were noted for gender (3 males for each group), age (14.1 ± 0.3 for ART vs 13.9 ± 0.3 for Sforzesco), ATR (11.8 ± 3.2 vs 11.5 ± 4.2 for thoracic curves and 7.8 ± 4.0 vs 7.1 ± 6.1 for lumbar/thoracolumbar), Cobb angle (44.8 ± 2 vs 45.5 ± 2 for thoracic; 43.8 ± 2 vs 46.0 ± 2 for lumbar/thoracolumbar) or Risser sign (median 2 for both groups). The in-brace correction was slightly better for the ART brace, but didn't reach statistical significance (24.3 ± 8.5 vs 28.0 ± 6.8 for thoracic; 23.7 ± 10.4 vs 29.9 ± 4.2 for lumbar/thoracolumbar). At 6

  17. An Experimental Study on Hybrid Noncompression CF Bracing and GF Sheet Wrapping Reinforcement Method to Restore Damaged RC Structures

    Directory of Open Access Journals (Sweden)

    Kang Seok Lee

    2015-01-01

    Full Text Available We describe a novel technique for restoration of reinforced concrete (RC structures that have sustained damage during an earthquake. The reinforcement scheme described here is a hybrid seismic retrofitting technique that combines noncompression X-bracing using CF with externally bonded GF sheets to strengthen RC structures that have sustained damage following an earthquake. The GF sheet is used to improve the ductility of columns, and the noncompression CF X-bracing system, which consists of CF bracing and anchors to replace the conventional steel bracing and bolt connections, is used to increase the lateral strength of the framing system. We report seismic restoration capacity, which enables reuse of the damaged RC frames via the hybrid CF X-bracing and GF sheet wrapping system. Cyclic loading tests were carried out to investigate hysteresis of the lateral load-drift relations, as well as the ductility. The GF sheet significantly improved the ductility of columns, resulting in a change in failure mode. The strengthening effect of conventional CF sheets used in columns is not sufficient with respect to lateral strength and stiffness. However, this study results in a significant increase in the strength of the structure due to the use of CF X-bracing and inhibited buckling failure of the bracing. This result can be exploited to develop guidelines for the application of the reinforcement system to restore damaged RC structures.

  18. Thermal Behavior of Cylindrical Buckling Restrained Braces at Elevated Temperatures

    Directory of Open Access Journals (Sweden)

    Elnaz Talebi

    2014-01-01

    Full Text Available The primary focus of this investigation was to analyze sequentially coupled nonlinear thermal stress, using a three-dimensional model. It was meant to shed light on the behavior of Buckling Restraint Brace (BRB elements with circular cross section, at elevated temperature. Such bracing systems were comprised of a cylindrical steel core encased in a strong concrete-filled steel hollow casing. A debonding agent was rubbed on the core’s surface to avoid shear stress transition to the restraining system. The numerical model was verified by the analytical solutions developed by the other researchers. Performance of BRB system under seismic loading at ambient temperature has been well documented. However, its performance in case of fire has yet to be explored. This study showed that the failure of brace may be attributed to material strength reduction and high compressive forces, both due to temperature rise. Furthermore, limiting temperatures in the linear behavior of steel casing and concrete in BRB element for both numerical and analytical simulations were about 196°C and 225°C, respectively. Finally it is concluded that the performance of BRB at elevated temperatures was the same as that seen at room temperature; that is, the steel core yields prior to the restraining system.

  19. Thermal behavior of cylindrical buckling restrained braces at elevated temperatures.

    Science.gov (United States)

    Talebi, Elnaz; Tahir, Mahmood Md; Zahmatkesh, Farshad; Yasreen, Airil; Mirza, Jahangir

    2014-01-01

    The primary focus of this investigation was to analyze sequentially coupled nonlinear thermal stress, using a three-dimensional model. It was meant to shed light on the behavior of Buckling Restraint Brace (BRB) elements with circular cross section, at elevated temperature. Such bracing systems were comprised of a cylindrical steel core encased in a strong concrete-filled steel hollow casing. A debonding agent was rubbed on the core's surface to avoid shear stress transition to the restraining system. The numerical model was verified by the analytical solutions developed by the other researchers. Performance of BRB system under seismic loading at ambient temperature has been well documented. However, its performance in case of fire has yet to be explored. This study showed that the failure of brace may be attributed to material strength reduction and high compressive forces, both due to temperature rise. Furthermore, limiting temperatures in the linear behavior of steel casing and concrete in BRB element for both numerical and analytical simulations were about 196°C and 225°C, respectively. Finally it is concluded that the performance of BRB at elevated temperatures was the same as that seen at room temperature; that is, the steel core yields prior to the restraining system.

  20. Informed consent for braces.

    Science.gov (United States)

    Jharwal, Vikas; Trehan, Mridula; Rathore, Nidhi; Rathee, Pooja; Agarwal, Deepesh; Mathur, Nikunj

    2014-05-01

    The influence of law on the orthodontic profession has greatly increased in the last few decades. Dental law has emerged today as a full-fedged specialty dealing with a variety of areas, like professional negligence, doctor-patient contracts, consumer protection laws, ethics, general and special health legislations and practice regulatory mechanisms. This article highlights the concept of informed consent which is based on the premise that each individual has a right to make decisions concerning his health, disease and treatment. How to cite this article: Jharwal V, Trehan M, Rathore N, Rathee P, Agarwal D, Mathur N. Informed Consent for Braces. Int J Clin Pediatr Dent 2014;7(2):105-108.

  1. Detorsion night-time bracing for the treatment of early onset idiopathic scoliosis.

    Science.gov (United States)

    Moreau, S; Lonjon, G; Mazda, K; Ilharreborde, B

    2014-12-01

    Management for early onset scoliosis has recently changed, with the development of new surgical procedures. However, multiple surgeries are often required and high complication rates are still reported. Conservative management remains an alternative, serial casting achieving excellent results in young children. Better compliance and improvement over natural history have been reported with night-time bracing in adolescent idiopathic scoliosis (AIS), but this treatment has never been reported in early onset idiopathic scoliosis (EIOS). All patients treated for progressive EOIS by detorsion night-time bracing (DNB), and meeting the Scoliosis Research Society (SRS) criteria for brace studies were reviewed. Recommendations were given to wear the DNB 8h/night and no restriction was given regarding sports activities. Radiological parameters were compared between referral and latest follow-up. Based on the SRS criteria defined for AIS, a similar classification was used as follows to analyze the course of the curves: success group: patients with a progression of 5° or less; unsuccess group (progression or failure): patients with a progression>5°, patients with curves exceeding 45° at maturity, or who have had recommendation for/undergone surgery, or patients who changed orthopaedic treatment, or who were lost to follow-up. Thirty-three patients were included (21 girls and 12 boys), with a median Cobb angle of 31° (Q1-Q3: 22-40). Age at brace initiation averaged 50months (Q1-Q3: 25-60). Median follow-up was 102-months (Q1-Q3: 63-125). Fifteen patients (45.5%) had reached skeletal maturity at last follow-up. The success rate was 67% (22 patients), with a median Cobb angle reduction of 15° (P<0.001). Four patients stopped DNB due to an important regression. Eleven patients were in the unsuccessful group (33%). Only one had surgery. All patients remained balanced in the frontal plane and normokyphotic. Initial curve magnitude and age at brace initiation appeared to be

  2. Effectiveness of Treatment of Idiopathic Scoliosis by SpineCor Dynamic Bracing with Special Physiotherapy Programme in SpineCor System.

    Science.gov (United States)

    Rożek, Karina; Potaczek, Tomasz; Zarzycka, Maja; Lipik, Ewa; Jasiewicz, Barbara

    2016-10-28

    The SpineCor dynamic brace for the treatment of idiopathic scoliosis is designed to maintain the correct position of the spine and a new movement strategy for 20 hours per day. The SpineCor exercise system intensifies and complements the brace treatment. This study evaluated the effectiveness of a comprehensive treatment of idiopathic scoliosis involving the SpineCor system. The study assessed a group of 40 patients (38 girls and 2 boys) with idiopathic scoliosis treated with the SpineCor brace. The average age at beginning of treatment was 13.1 yrs (10-15). Minimum treatment time was 18 months. 28 participants met the SRS criteria. Angles of the curve before and after bracing based on imaging studies were measured at the beginning and end of the treatment, analyzed and compared. Rehabilitation focused on teaching active corrective movement throughout the brace treatment. A control group was formed of 33 patients, including 21 meeting the SRS criteria, who used the SpineCor dynamic brace but did not participate in the associated exercise programme. Among patients from the exercise group who met the SRS criteria, 25% demonstrated reduced curve angles, 35.7% demonstrated curve progression and 39.3% showed stabilization (no change). Among patients meeting the SRS criteria from the control group, a decrease in curve angle was observed in 14.3% of the patients, curve progression in 57.1% and stabilization in 28.6%. 1. The addition of a dedicated physiotherapy programme to SpineCor dynamic bracing improves the chances of obtaining a positive outcome. 2. It is necessary to further analyse the course of the comprehensive treatment, also with regard to other types of braces and kinesiotherapy programmes.

  3. Displacement-Based Seismic Design Procedure for Framed Buildings with Dissipative Braces Part II: Numerical Results

    International Nuclear Information System (INIS)

    Mazza, Fabio; Vulcano, Alfonso

    2008-01-01

    For a widespread application of dissipative braces to protect framed buildings against seismic loads, practical and reliable design procedures are needed. In this paper a design procedure based on the Direct Displacement-Based Design approach is adopted, assuming the elastic lateral storey-stiffness of the damped braces proportional to that of the unbraced frame. To check the effectiveness of the design procedure, presented in an associate paper, a six-storey reinforced concrete plane frame, representative of a medium-rise symmetric framed building, is considered as primary test structure; this structure, designed in a medium-risk region, is supposed to be retrofitted as in a high-risk region, by insertion of diagonal braces equipped with hysteretic dampers. A numerical investigation is carried out to study the nonlinear static and dynamic responses of the primary and the damped braced test structures, using step-by-step procedures described in the associate paper mentioned above; the behaviour of frame members and hysteretic dampers is idealized by bilinear models. Real and artificial accelerograms, matching EC8 response spectrum for a medium soil class, are considered for dynamic analyses

  4. Ankle Bracing, Fatigue, and Time to Stabilization in Collegiate Volleyball Athletes

    Science.gov (United States)

    Shaw, Megan Y; Gribble, Phillip A; Frye, Jamie L

    2008-01-01

    Context: Fatigue has been shown to disrupt dynamic stability in healthy volunteers. It is not known if wearing prophylactic ankle supports can improve dynamic stability in fatigued athletes. Objective: To determine the type of ankle brace that may be more effective at providing dynamic stability after a jump-landing task during normal and fatigued conditions. Design: Two separate repeated-measures analyses of variance with 2 within-subjects factors (condition and time) were performed for each dependent variable. Setting: Research laboratory. Patients or Other Participants: Ten healthy female collegiate volleyball athletes participated (age  =  19.5 ± 1.27 years, height  =  179.07 ± 7.6 cm, mass  =  69.86 ± 5.42 kg). Intervention(s): Athletes participated in 3 separate testing sessions, applying a different bracing condition at each session: no brace (NB), Swede-O Universal lace-up ankle brace (AB), and Active Ankle brace (AA). Three trials of a jump-landing task were performed under each condition before and after induced functional fatigue. The jump-landing task consisted of a single-leg landing onto a force plate from a height equivalent to 50% of each participant's maximal jump height and from a starting position 70 cm from the center of the force plate. Main Outcome Measure(s): Time to stabilization in the anterior-posterior (APTTS) and medial-lateral (MLTTS) directions. Results: For APTTS, a condition-by-time interaction existed (F2,18  =  5.55, P  =  .013). For the AA condition, Tukey post hoc testing revealed faster pretest (2.734 ± 0.331 seconds) APTTS than posttest (3.817 ± 0.263 seconds). Post hoc testing also revealed that the AB condition provided faster APTTS (2.492 ± 0.271 seconds) than AA (3.817 ± 0.263 seconds) and NB (3.341 ± 0.339 seconds) conditions during posttesting. No statistically significant findings were associated with MLTTS. Conclusions: Fatigue increased APTTS for the AA condition. Because the

  5. Peculiarity of component interaction in {l_brace}Y, Dy{r_brace}-Mn-Sn ternary systems

    Energy Technology Data Exchange (ETDEWEB)

    Romaka, V.V. [Department of Materials Engineering and Applied Physics, Lviv Polytechnic National University, Ustyyanovycha Str. 5, 79013 Lviv (Ukraine); Konyk, M. [Inorganic Chemistry Department, Ivan Franko Lviv National University, Kyryla and Mefodiya Str. 6, 79005 Lviv (Ukraine); Romaka, L., E-mail: romakal@franko.lviv.ua [Inorganic Chemistry Department, Ivan Franko Lviv National University, Kyryla and Mefodiya Str. 6, 79005 Lviv (Ukraine); Pavlyuk, V. [Inorganic Chemistry Department, Ivan Franko Lviv National University, Kyryla and Mefodiya Str. 6, 79005 Lviv (Ukraine); Jan Dlugosz University, Institute of Chemistry, Environmental Protection and Biotechnology, al. Armii Krajowej 13/15, 42200 Czestochowa (Poland); Ehrenberg, H. [Institute for Complex Materials, IFW Dresden, Helmholtzstrasse 20, D-01069 Dresden (Germany); Tkachuk, A. [Inorganic Chemistry Department, Ivan Franko Lviv National University, Kyryla and Mefodiya Str. 6, 79005 Lviv (Ukraine)

    2011-07-14

    Highlights: > {l_brace}Y, Dy{r_brace}-Mn-Sn ternary systems at 770 K are characterized by formation of stannides with general compositions RMn{sub 6}Sn{sub 6} and R{sub 4}Mn{sub 4}Sn{sub 7}. > The crystal structure of YMn{sub 6}Sn{sub 6} was determined by single crystal and powder diffraction methods. > Structural analysis showed that Dy{sub 4}Mn{sub 4}Sn{sub 7} compound is disordered. > Isostructural R{sub 4}Mn{sub 4}Sn{sub 7} compounds were also found with Gd, Tb, Ho, Er, Tm(confirmed), Yb, and Lu. - Abstract: The phase equilibria in the Y-Mn-Sn and Dy-Mn-Sn ternary systems were studied at 770 K by means of X-ray and metallographic analyses in the whole concentration range. Both Y-Mn-Sn and Dy-Mn-Sn systems are characterized by formation of two ternary compounds RMn{sub 6}Sn{sub 6} (MgFe{sub 6}Ge{sub 6}-type, space group P6/mmm) and R{sub 4}Mn{sub 4}Sn{sub 7} (Zr{sub 4}Co{sub 4}Ge{sub 7}-type, space group I4/mmm). The disorder in Dy{sub 4}Mn{sub 4}Sn{sub 7} compound was found by single crystal method. Compounds with the same type of structure were also found with Gd, Tb, Ho, Er, Tm (confirmed), Yb, and Lu and their lattice parameters were determined.

  6. Body Image and Quality-of-Life in Untreated Versus Brace-Treated Females With Adolescent Idiopathic Scoliosis.

    Science.gov (United States)

    Schwieger, Traci; Campo, Shelly; Weinstein, Stuart L; Dolan, Lori A; Ashida, Sato; Steuber, Keli R

    2016-02-01

    The Bracing in Adolescent Idiopathic Scoliosis Trial (BrAIST) included skeletally immature high-risk patients with adolescent idiopathic scoliosis (AIS) with moderate curve sizes (20°- 40°). BrAIST was a multicenter, controlled trial using both randomized and preference treatment arms into either an observation group or a brace treatment group. The aim of this study was to analyze and compare body image and quality-of-life (QOL) in female AIS patients who were observed or treated with a brace. Brace treatment is an effective means for controlling progressive scoliosis and preventing the need for surgery, but there is no consensus regarding the effect of brace treatment on body image or on QOL in adolescents with AIS. Data from female BrAIST patients in the randomized (n = 132) or preference (n = 187) arms and were observed (n = 120) or brace treated (n = 199) were analyzed. Patients completed the Spinal Appearance Questionnaire (SAQ) and the Pediatric Quality of Life Inventory (PedsQOL) 4.0 Generic Scales at baseline and 6 month follow-up visits up to 2 years. Items on the SAQ measured three body image constructs (self, ideal, and overall). The PedsQOL measured health, activities, feelings, social factors, and school. . In general, there were no significant differences within or between study arms or treatments regarding body image or QOL through 2 years of follow-up. Poorer body image was significantly correlated with poorer QOL during the first 2 years of follow-up regardless of study arm or treatment. Patients who crossed-over to a different treatment and patients with largest Cobb angles ≥ 40 degrees had significantly poorer body image, in particular self-body image, compared with those that did not. This study does not support findings from previous research indicating that wearing a brace has a negative impact on or is negatively impacted by body image or QOL. 2.

  7. Team care to cure adolescents with braces (avoiding low quality of life, pain and bad compliance): a case–control retrospective study. 2011 SOSORT Award winner

    OpenAIRE

    Tavernaro, Marta; Pellegrini, Anna; Tessadri, Fabrizio; Zaina, Fabio; Zonta, Andrea; Negrini, Stefano

    2012-01-01

    Abstract Background Bracing could be efficacious, given good compliance and quality of braces. Recently the SOSORT Brace Treatment Management Guidelines (SBTMG) have highlighted the perceived importance of the professional teams surrounding braced patients. Purpose To verify the impact of a complete rehabilitation team in the adolescent patient with bracing. Materials and methods Design. Initial cross-sectional study, followed by a retrospective case–control study. Population: Thirty-eight pa...

  8. The effect of a dynamic PCL brace on patellofemoral compartment pressures in PCL-and PCL/PLC-deficient knees.

    Science.gov (United States)

    Welch, Tyler; Keller, Thomas; Maldonado, Ruben; Metzger, Melodie; Mohr, Karen; Kvitne, Ronald

    2017-12-01

    The natural history of posterior cruciate ligament (PCL) deficiency includes the development of arthrosis in the patellofemoral joint (PFJ). The purpose of this biomechanical study was to evaluate the hypothesis that dynamic bracing reduces PFJ pressures in PCL- and combined PCL/posterolateral corner (PLC)-deficient knees. Controlled Laboratory Study. Eight fresh frozen cadaveric knees with intact cruciate and collateral ligaments were included. PFJ pressures and force were measured using a pressure mapping system via a lateral arthrotomy at knee flexion angles of 30°, 60°, 90°, and 120° in intact, PCL-deficient, and PCL/PLC-deficient knees under a combined quadriceps/hamstrings load of 400 N/200 N. Testing was then repeated in PCL- and PCL/PLC-deficient knees after application of a dynamic PCL brace. Application of a dynamic PCL brace led to a reduction in peak PFJ pressures in PCL-deficient knees. In addition, the brace led to a significant reduction in peak pressures in PCL/PLC-deficient knees at 60°, 90°, and 120° of flexion. Application of the dynamic brace also led to a reduction in total PFJ force across all flexion angles for both PCL- and PCL/PLC-deficient knees. Dynamic bracing reduces PFJ pressures in PCL- and combined PCL/PLC-deficient knees, particularly at high degrees of knee flexion.

  9. The cost-effectiveness of semi-rigid ankle brace to facilitate return to work following first-time acute ankle sprains.

    Science.gov (United States)

    Fatoye, Francis; Haigh, Carol

    2016-05-01

    To examine the cost-effectiveness of semi-rigid ankle brace to facilitate return to work following first-time acute ankle sprains. Economic evaluation based on cost-utility analysis. Ankle sprains are a source of morbidity and absenteeism from work, accounting for 15-20% of all sports injuries. Semi-rigid ankle brace and taping are functional treatment interventions used by Musculoskeletal Physiotherapists and Nurses to facilitate return to work following acute ankle sprains. A decision model analysis, based on cost-utility analysis from the perspective of National Health Service was used. The primary outcomes measure was incremental cost-effectiveness ratio, based on quality-adjusted life years. Costs and quality of life data were derived from published literature, while model clinical probabilities were sourced from Musculoskeletal Physiotherapists. The cost and quality adjusted life years gained using semi-rigid ankle brace was £184 and 0.72 respectively. However, the cost and quality adjusted life years gained following taping was £155 and 0.61 respectively. The incremental cost-effectiveness ratio for the semi-rigid brace was £263 per quality adjusted life year. Probabilistic sensitivity analysis showed that ankle brace provided the highest net-benefit, hence the preferred option. Taping is a cheaper intervention compared with ankle brace to facilitate return to work following first-time ankle sprains. However, the incremental cost-effectiveness ratio observed for ankle brace was less than the National Institute for Health and Care Excellence threshold and the intervention had a higher net-benefit, suggesting that it is a cost-effective intervention. Decision-makers may be willing to pay £263 for an additional gain in quality adjusted life year. The findings of this economic evaluation provide justification for the use of semi-rigid ankle brace by Musculoskeletal Physiotherapists and Nurses to facilitate return to work in individuals with first-time ankle

  10. Boundary condition effect on response modification factor of X-braced steel frames

    Directory of Open Access Journals (Sweden)

    Walid A. Attia

    2018-04-01

    Full Text Available Design of the structures to resist seismic force depends on the theory of dissipation in elastic energy that already exists in response modification factor “R-factor”. The main problem in codes gives a constant value for R-factor, since change in boundary conditions of building change in behavior of braced steel frame structures and that effects on R-factor. This study is an attempt to assess overstrength, ductility and response modification factor of X-braced steel frame under change in boundary conditions, as change in the direction of strong axis of column and connection support type of column besides variation in storey and bays numbers to be 21 frames and each frame has 8 different boundary conditions as sum of 168 cases for analysis. These frames were analyzed by using nonlinear static “pushover” analysis. As results of this study change in support type and direction of strong axis of column give large change in value of R-factor; the minimum value was 4.37 and maximum value 10.97. Minimum value is close to code value that’s mean the code is more conservative in suggesting of R-factor and gives a large factor of safety. Change in the location of bracing gives change in value of R-factor for all boundary conditions. Change in direction of strong axis of columns and support type didn’t give change in value of fundamental period, all boundary conditions. Keywords: Response modification factor, Ductility reduction factor, Overstrength factor, Boundary conditions, Brace frame, Nonlinear static analysis “Pushover”

  11. The importance of trunk perception during brace treatment in moderate juvenile idiopathic scoliosis: What is the impact on self-image?

    Science.gov (United States)

    Paolucci, Teresa; Piccinini, Giulia; Iosa, Marco; Piermattei, Cristina; De Angelis, Simona; Zangrando, Federico; Saraceni, Vincenzo Maria

    2017-01-01

    The perception of body image and the deformity of the trunk in patients with adolescent idiopathic scoliosis (AIS) are a silver lining that has yet to be discussed in the relevant literature during brace rehabilitation treatment. To determine whether and how the use of the brace changes perception of the trunk in patients with AIS by the drawing test. We observed 32 subjects with AIS from our Rehabilitation outpatient clinic and divided them into the brace treatment (BG-16 subjects) and the non-brace treatment (CG-16 subjects). Trunk perception and quality of life were evaluated using the Trunk Appearance Perception Scale and Scoliosis Research Society-22 questionnaire, and the perception of one's back was measured by the drawing test. Pain was lower in BG versus CG (p= 0.095). Satisfaction with the treatment was higher in BG than in CG (p= 0.002). Self-image did not differ significantly between the groups in terms of TAPS. Drawings of the most severe cases of scoliosis were made by the group without the brace. The use of the brace corrects the function of the trunk and has a positive influence on its perception.

  12. [Conservative treatment of idiopathic scoliosis with effective braces: early response to trunk asymmetry may avoid curvature progress].

    Science.gov (United States)

    Matussek, J; Dingeldey, E; Wagner, F; Rezai, G; Nahr, K

    2014-07-01

    Vertical posture of the growing child requires minute central nervous control mechanisms in order to maintain symmetry of the torso in its various activities. Scoliosis describes a constant deviation in the frontal, transverse and sagittal planes from the dynamic symmetry of the trunk. Early intervention with effective bracing, physiotherapy and sports can reverse curve progression during growth spurts, once these are identified in screening. Modern braces have a derotating and reducing effect (mirror effect) on asymmetric body volumes, thus influencing the growing torso and restoring lasting symmetry. Recent data support the use of braces to reverse progressing scoliosis.

  13. Clinical Outcomes of a Pneumatic Unloader Brace for Kellgren-Lawrence Grades 3 to 4 Osteoarthritis: A Minimum 1-Year Follow-Up Study.

    Science.gov (United States)

    Chughtai, Morad; Bhave, Anil; Khan, Sabahat Z; Khlopas, Anton; Ali, Osman; Harwin, Steven F; Mont, Michael A

    2016-11-01

    The use of a pneumatic unloader brace has been shown in pilot studies to decrease pain and increase muscle strength in patients with knee osteoarthritis (OA). Therefore, we analyzed patients who had knee OA, and either received a pneumatic unloader brace and conventional treatment or conventional treatment alone. Specifically, we assessed: (1) use of pain relieving injections; (2) opioid consumption; and (3) the eventual need for total knee arthroplasty (TKA) in the above-mentioned cohort. We performed an analysis of a longitudinally maintained database of patients from a prospective, randomized, single center study. This study randomized patients who had Kellgren-Lawrence grades 3 to 4 to receive either a pneumatic unloader brace and conventional treatment or conventional treatment alone. The brace cohort comprised 11 patients with a mean age of 55 years (range, 37-70 years). The final matched cohort comprised 25 patients with a mean age of 63 years (range, 41-86 years). The minimum follow-up was 1 year. There was a lower proportion of patients who underwent an eventual TKA in the bracing cohort as compared with the nonbracing cohort (18 vs. 36%). The mean time to TKA was longer in the bracing cohort as compared with the nonbracing cohort (482 vs. 389 days). The proportion of patients who used opioids was similar in both groups (27 vs. 22%). There was a significantly lower number of patients who received injections in the bracing cohort as compared with the nonbracing cohort (46 vs. 83%, p  = 0.026). The bracing cohort had received a significantly lower number of injections and a lower rate of subsequent TKA as compared with the nonbracing cohort. The mean time to TKA was also longer among the bracing cohort. These results may demonstrate the potential of this brace to reduce the need for and prolonging the time to TKA. Performing larger prospective randomized studies, with built-in compliance monitors is warranted. This brace may be a valuable adjunct to the

  14. Overweight is not predictive of bracing failure in adolescent idiopathic scoliosis: results from a retrospective cohort study.

    Science.gov (United States)

    Zaina, Fabio; Donzelli, Sabrina; Negrini, Stefano

    2017-06-01

    Overweight was found to be a negative predictor of brace effectiveness for adolescent idiopathic scoliosis (AIS), with a threefold higher risk of progression than in normal weight patients. The aim of this study is to investigate overweight, as a predictor of brace results in AIS patients. Design: retrospective cohort study. 351 AIS patients (306 females), mean age 12.9 ± 1.4, mean Cobb 35.6 ± 11.4°, mean ATR 11 ± 4.3°, BMI 19.7 ± 3, median Risser: 2. no previous treatment, full-time prescription of brace at first visit (18-23 h per day), scoliosis physiotherapeutic exercise according to the SEAS protocol associated. improved, progressed, and stable according to the 5° Cobb agreed threshold. a stepwise linear regression was used to look for the effect of BMI as a predictor of result. A Chi-square test and logistic regression were used for the overweight category (BMI ≥ 85th percentile). Control for possible confounders was applied. BMI is poorly correlated with final results. Confounders' adjustment did not change the correlation, and the predictive model explained about 10% of the result. Brace results were not statistically different in overweight and normal weight: 44 vs 52% improved, 52 vs 41% stable, and 3 vs 7% worsened, respectively. Brace results were similar in overweight and normal weight subjects. These findings subvert the previous results and disprove the role of overweight as a negative predictor. Treatment management, brace type and effectiveness may play a major role in reducing the risks of scoliosis progression.

  15. The effect of Prophylactic knee bracing on selected performance ...

    African Journals Online (AJOL)

    The objective of this study was to determine if the wearing of a prophylactic knee brace by uninjured rugby players affected the following performance based parameters: speed, agility, strength, proprioception and economy of running. Thirty rugby players were subjected to a selected number of carefully monitored ...

  16. Assessment of behavior factor of eccentrically braced frame with ...

    African Journals Online (AJOL)

    Assessment of behavior factor of eccentrically braced frame with vertical link in cyclic loading. ... Journal of Fundamental and Applied Sciences ... In order to understand the behavior of these structures using non-linear static and dynamic analysis of building's behavior factor, eccentric and exocentric systems were calculated ...

  17. Brace treatment of lumber spondylolysis in growing age. Patient selection by RI scintigraphy and repair of spondylolysis

    Energy Technology Data Exchange (ETDEWEB)

    Abumi, Kuniyoshi; Hino, Hiroyuki; Sato, Shigeyoshi; Kaneda, Kiyoshi [Hokkaido Univ., Sapporo (Japan). School of Medicine

    1996-07-01

    From 1987 to 1994, brace treatment was prescribed to 29 patients with lumbar spondylolysis in growing age, ranging from nine to 18 years, in whom {sup 99m}Tc bone scintigraphy showed positive at the pars interarticularis. Single photon emission computed tomography was also conducted an recent cases. Spondylolysis was bilateral in 27 patients and unilateral in two. Polypropylene brace was applied for three to four months with restriction of sport activities. As a result, 46 out of 58 spondylolysis healed with a healing rate of 79%. Selection of patients using bone scintigraphy for brace treatment in lumbar spondylolysis in growing age would help to increase the union rate. (author)

  18. Brace treatment of lumber spondylolysis in growing age. Patient selection by RI scintigraphy and repair of spondylolysis

    International Nuclear Information System (INIS)

    Abumi, Kuniyoshi; Hino, Hiroyuki; Sato, Shigeyoshi; Kaneda, Kiyoshi

    1996-01-01

    From 1987 to 1994, brace treatment was prescribed to 29 patients with lumbar spondylolysis in growing age, ranging from nine to 18 years, in whom 99m Tc bone scintigraphy showed positive at the pars interarticularis. Single photon emission computed tomography was also conducted an recent cases. Spondylolysis was bilateral in 27 patients and unilateral in two. Polypropylene brace was applied for three to four months with restriction of sport activities. As a result, 46 out of 58 spondylolysis healed with a healing rate of 79%. Selection of patients using bone scintigraphy for brace treatment in lumbar spondylolysis in growing age would help to increase the union rate. (author)

  19. Conservative treatment of lateral epicondylitis: brace versus physical therapy or a combination of both: a randomized clinical trial

    NARCIS (Netherlands)

    Struijs, P. A. A.; Kerkhoffs, G. M. M. J.; Assendelft, W. J. J.; van Dijk, C. N.

    2004-01-01

    BACKGROUND: The authors evaluated the effectiveness of brace-only treatment, physical therapy, and the combination of these for patients with tennis elbow. METHODS: Patients were randomized over 3 groups: brace-only treatment, physical therapy, and the combination of these. Main outcome measures

  20. Optimum Design of Braced Steel Space Frames including Soil-Structure Interaction via Teaching-Learning-Based Optimization and Harmony Search Algorithms

    OpenAIRE

    Ayse T. Daloglu; Musa Artar; Korhan Ozgan; Ali İ. Karakas

    2018-01-01

    Optimum design of braced steel space frames including soil-structure interaction is studied by using harmony search (HS) and teaching-learning-based optimization (TLBO) algorithms. A three-parameter elastic foundation model is used to incorporate the soil-structure interaction effect. A 10-storey braced steel space frame example taken from literature is investigated according to four different bracing types for the cases with/without soil-structure interaction. X, V, Z, and eccentric V-shaped...

  1. Thermophysical properties and phase equilibria study of the binary systems {l_brace}N-hexylquinolinium bis(trifluoromethylsulfonyl)imide + aromatic hydrocarbons, or an alcohol{r_brace}

    Energy Technology Data Exchange (ETDEWEB)

    Domanska, Urszula, E-mail: ula@ch.pw.edu.p [Department of Physical Chemistry, Faculty of Chemistry, Warsaw University of Technology, Noakowskiego 3, 00-664 Warsaw (Poland); Thermodynamic Research Unit, School of Chemical Engineering, University of KwaZulu-Natal, Howard College Campus, King George V Avenue, Durban 4001 (South Africa); Zawadzki, Maciej [Department of Physical Chemistry, Faculty of Chemistry, Warsaw University of Technology, Noakowskiego 3, 00-664 Warsaw (Poland); Zwolinska, Magdalena [Department of Ergonomics, Laboratory of Thermal Loads, Central Institute for Labour Protection-National Research Institute, Czerniakowska 16, 00-701 Warsaw (Poland)

    2011-05-15

    Research highlights: We synthesized new ionic liquid, [HQuin][NTf{sub 2}] with low viscosity, and low density. We found high heat capacity, high enthalpy of melting and low melting temperature. HQuin][NTf{sub 2}] is proposed for possible use in the phase change materials (PCM). We examine phase equilibrium changes, SLE and LLE with hydrocarbons and alcohols. [HQuin][NTf{sub 2}] may be proposed as entrainer for the separation proceses. - Abstract: The new quinolinium ionic liquid has been synthesised as a continuation of our work with quinolinium-based ionic liquids (ILs). The work includes specific basic characterisation of synthesized compounds: N-hexylquinolinium bromide, [HQuin][Br] and N-hexylquinolinium bis{l_brace}(trifluoromethyl)sulfonyl{r_brace}imide [HQuin][NTf{sub 2}] by NMR spectra, elementary analysis and water content. The basic thermal properties of the pure [HQuin][NTf{sub 2}] i.e. melting and glass-transition temperatures, the enthalpy of fusion as well as heat capacity have been measured using a differential scanning microcalorimetry technique (DSC) and thermal analysis instrument (TA). Densities and viscosities were determined as a function of temperature. Phase equilibria for the binary systems: {l_brace}[HQuin][NTf{sub 2}]) + aromatic hydrocarbon (benzene, or toluene, or ethylbenzene, or n-propylbenzene), or an alcohol (1-butanol, or 1-hexanol, or 1-octanol, or 1-decanol){r_brace} have been determined at ambient pressure. A dynamic method was used over a broad range of mole fractions and temperatures from (270 to 320) K. For all the binary systems with benzene and alkylbenzenes, the eutectic diagrams were observed with immiscibility gap in the liquid phase beginning from (0.13 to 0.28) mole fraction of the IL with very high an upper critical solution temperature (UCST). For mixtures with alcohols, the complete miscibility was observed for 1-butanol and immiscibility with UCST in the liquid phase for the remaining alcohols. The typical

  2. The Sforzesco brace can replace cast in the correction of adolescent idiopathic scoliosis: A controlled prospective cohort study

    Directory of Open Access Journals (Sweden)

    Zaina Fabio

    2008-10-01

    Full Text Available Abstract Background The conservative treatment of adolescent idiopathic scoliosis (AIS has traditionally been divided into two phases–correction and stabilisation–and casts, even if less used today, can be considered the best standard in the correction phase. Till the present, however, no comparison between cast and brace efficacy has been proposed. Methods This is a prospective cohort study with a retrospective control group. The aim was to verify if it is possible to obtain with a specifically developed rigid brace results comparable to a cast. We considered fifty AIS patients who had refused surgery, aged 14.1 ± 1.5 years, with 46.7 ± 7.8° Cobb scoliosis. Thirty-two consecutive patients (with no drop-outs were prospectively followed up with the Sforzesco brace (SBG, and compared against a retrospective group of eighteen patients treated with the Risser cast (RCG. The treatment time (the total correction phase was 19 ± 3 months. Out-of-brace x-rays were compared, as well as clinical results. Results Compliance and hours of treatment were higher in the RCG while all the other parameters were not different. We observed a reduction of 6° Cobb and an important aesthetic gain in both groups (P Conclusion In the corrective phase of AIS treatment it is possible with a specific rigid brace (Sforzesco – SPoRT concept to obtain scoliosis correction similar to cast. Due to the human and social costs of casting, and worst sagittal profile results, Sforzesco brace should be the preferred method wherever possible.

  3. The B-Lynch uterine brace suture, and a bit of this and a bit of that...

    Science.gov (United States)

    Karoshi, Mahantesh

    2010-03-01

    The widespread application of the B-Lynch brace suture to control postpartum hemorrhage has sparked interest in a variety of adjunctive methods, used alone or in combination, to control uterine bleeding. Although the B-Lynch brace suture has been used with good results throughout the world, failures can and do occur in rare instances, especially when the suture is incorrectly placed for use for an inappropriate indication. Four reports of additional methods to control postpartum hemorrhage are published in this issue of IJGO. Three use the B-Lynch brace suture combined with other techniques. The need for additional techniques reminds the reader of the importance of proper suture application for proper indication. Potential reasons for failure of the B-Lynch suture are provided.

  4. Supine Lateral Bending Radiographs Predict the Initial In-brace Correction of the Providence Brace in Patients With Adolescent Idiopathic Scoliosis

    DEFF Research Database (Denmark)

    Ohrt-Nissen, Søren; Hallager, Dennis Winge; Gehrchen, Poul Martin

    2016-01-01

     ± 10°). Mean difference for thoracic curves was 0.2° (LOA ± 8°), for thoracolumbar/lumbar curves 0.9° (LOA ± 10°) and for double major curves 0.4° (LOA ± 16). CONCLUSION: SLBR provide a close estimation to the expected in-brace correction with a mean difference of less than one degree. SLRB could...

  5. Automatic locking knee brace joint

    Science.gov (United States)

    Weddendorf, Bruce (Inventor)

    1995-01-01

    This invention is an apparatus for controlling the pivotal movement of a knee brace comprising a tang-and-clevis joint that has been uniquely modified. Both the tang and the clevis have a set of teeth that, when engaged, can lock the tang and the clevis together. In addition, the tang is biased away from the clevis. Consequently, when there is no axial force (i.e., body weight) on the tang, the tang is free to pivot within the clevis. However, when an axial force is exerted on the tang, the tang is pushed into the clevis, both sets of teeth engage, and the tang and the clevis lock together.

  6. 'SOSORT consensus paper on brace action: TLSO biomechanics of correction (investigating the rationale for force vector selection'

    Directory of Open Access Journals (Sweden)

    Maruyama T

    2006-07-01

    Full Text Available Abstract Background The effectiveness of orthotic treatment continues to be controversial in international medical literature due to differences in the reported results and conclusions of various studies. Heterogeneity of the samples has been suggested as a reason for conflicting results. Besides the obvious theoretical differences between the brace concepts, the variability in the technical factors can also explain the contradictory results between same brace types. This paper will investigate the degree of variability among responses of scoliosis specialists from the Brace Study Ground of the International Society on Scoliosis Orthopedic and Rehabilitation Treatment SOSORT. Ultimately, this information could be a foundation for establishing a consensus and framework for future prospective controlled studies. Methods A preliminary questionnaire on the topic of 'brace action' relative to the theory of three-dimensional scoliosis correction and brace treatment was developed and circulated to specialists interested in the conservative treatment of adolescent idiopathic scoliosis. A particular case was presented (main thoracic curve with minor lumbar. Several key points emerged and were used to develop a second questionnaire which was discussed and full filed after the SOSORT consensus meeting (Milano, Italy, January 2005. Results Twenty-one questionnaires were completed. The Chêneau brace was the most frequently recommended. The importance of the three point system mechanism was stressed. Options about proper pad placement on the thoracic convexity were divided 50% for the pad reaching or involving the apical vertebra and 50% for the pad acting caudal to the apical vertebra. There was agreement about the direction of the vector force, 85% selecting a 'dorso lateral to ventro medial' direction but about the shape of the pad to produce such a force. Principles related to three-dimensional correction achieved high consensus (80%–85%, but suggested

  7. Thermodynamics of {l_brace}zNaCl+(1-z)Na{sub 2}SO{sub 4}{r_brace}(aq) from T=278.15 K to T=318.15 K, and representation with an extended ion-interaction (Pitzer) model

    Energy Technology Data Exchange (ETDEWEB)

    Rard, Joseph A. E-mail: rard1@llnl.gov; Clegg, Simon L.; Platford, Robert

    2003-06-01

    In 1968, R.F. Platford reported the results from extensive isopiestic vapor-pressure measurements for the {l_brace}zNaCl+(1-z)Na{sub 2}SO{sub 4}{r_brace}(aq) system at T=298.15 K, using NaCl(aq) as the isopiestic reference standard [R.F. Platford, J. Chem. Eng. Data 13 (1968) 46-48]. However, only derived quantities were reported, and the experimental isopiestic equilibrium molalities were not given. The complete set of original isopiestic molalities from that study is tabulated in the present report. In addition, published thermodynamic information for this system is reviewed and the isopiestic equilibrium molalities, electromotive force measurements for five different types of electrochemical cells, and enthalpies of mixing from these other studies are critically assessed and recalculated consistently. These combined results are used to evaluate at T=298.15 K the two mixing parameters of Pitzer's ion-interaction model, {sup S}{theta}(Cl,SO{sub 4})=(1.236{+-}0.032{sub 5}){center_dot}10{sup -2} kg{center_dot}mol{sup -1} and {psi}(Na,Cl,SO{sub 4})=(1.808{+-}0.086){center_dot}10{sup -3} kg{sup 2}{center_dot}mol{sup -2}, and their temperature derivatives {l_brace}{partial_derivative}{sup S}{theta}(Cl,SO{sub 4})/{partial_derivative}T{r_brace}{sub p}=(2.474{+-}0.460){center_dot}10{sup -5} kg{center_dot}mol{sup -1}{center_dot}K{sup -1} and {l_brace}{partial_derivative}{psi}(Na,Cl,SO{sub 4})/{partial_derivative}T{r_brace}{sub p}=-(6.228{+-}0.186){center_dot}10{sup -5} kg{sup 2}{center_dot}mol{sup -2}{center_dot}K{sup -1}. Also reported are parameters for an extended ion-interaction model for Na{sub 2}SO{sub 4}(aq), valid from T=(273.15 to 323.15) K, that were required for this mixed electrolyte solution analysis.

  8. Comfort and acceptability of various immobilization positions using a shoulder external rotation and abduction brace.

    Science.gov (United States)

    Hatta, Taku; Yamamoto, Nobuyuki; Sano, Hirotaka; Itoi, Eiji

    2017-03-01

    Immobilization with shoulder braces is used for conservative treatment of an initial shoulder dislocation. Various arm positions have been investigated to determine optimal position in terms of the anatomical reduction of the Bankart lesion. Recently, the effect of immobilization in shoulder abduction as well as in external rotation has been reported. However, there are few studies assessing subjects' acceptability of the brace in various arm positions. We hypothesized that a certain arm position regarding abduction or external rotation for immobilization would induce significant discomfort during activities of daily living. A dominant arm of 20 healthy participants was immobilized with a shoulder brace in 4 different positions; adduction and internal rotation (Add-IR), adduction and external rotation (Add-ER), 30° of abduction and 30° of external rotation (Abd-30ER), and 30° of abduction and 60° of external rotation (Abd-60ER). After completing immobilization for 24 h, subjects were asked to assess the discomfort of bracing for overall and individual activities, using a visual analogue scale. Data were compared among the four positions. For overall activities and several activities (eating, reading books, and removing and putting on pants), Abd-60ER was significantly more uncomfortable than adducted arm positions. Abd-30ER did not show any differences compared to the other arm positions. Immobilization in abduction and external rotation seems to be acceptable although the arm position in 30° of abduction and 60° of external rotation is less comfortable than the others. Our results might be useful in determining and developing the ideal shoulder brace which could keep patients' compliance and improve their outcomes. Copyright © 2016 The Japanese Orthopaedic Association. Published by Elsevier B.V. All rights reserved.

  9. Osmotic and activity coefficients of {l_brace}y Na{sub 2}SO{sub 4} + (1 - y) ZnSO{sub 4}{r_brace}(aq) at T = 298.15 K

    Energy Technology Data Exchange (ETDEWEB)

    Marjanovic, V. [High Technical School, Trg Svetog Save 34, 31 000 Uzice (Serbia and Montenegro); Ninkovic, R. [Faculty of Technology and Metallurgy, University of Belgrade, Karnegijeva 4, 11 000 Belgrade (Serbia and Montenegro); Miladinovic, J. [Faculty of Technology and Metallurgy, University of Belgrade, Karnegijeva 4, 11 000 Belgrade (Serbia and Montenegro)]. E-mail: duma@elab.tmf.bg.ac.yu; Todorovic, M. [Faculty of Technology and Metallurgy, University of Belgrade, Karnegijeva 4, 11 000 Belgrade (Serbia and Montenegro); Pavicevic, V. [Faculty of Technology and Metallurgy, University of Belgrade, Karnegijeva 4, 11 000 Belgrade (Serbia and Montenegro)

    2005-02-01

    The osmotic coefficients of the mixed electrolyte solution {l_brace}y Na{sub 2}SO{sub 4} + (1 - y) ZnSO{sub 4}{r_brace}(aq) have been measured by the isopiestic method, at T = 298.5 K. The experimental results were treated by Scatchard's, Pitzer-Kim's and Clegg-Pitzer-Brimblecombe's methods for mixed-electrolyte solutions. By these methods, the activity coefficients for Na{sub 2}SO{sub 4} and ZnSO{sub 4} were calculated and compared. The Scatchard interaction parameters are used for calculation of the excess Gibbs free energy as a function of ionic strength and ionic-strength fraction of Na{sub 2}SO{sub 4}. Also, the Zdanovskii's rule of linearity is tested.

  10. Outcome of humeral shaft fractures treated by functional cast brace

    Directory of Open Access Journals (Sweden)

    Jitendra Nath Pal

    2015-01-01

    Conclusion: Modified functional cast brace is one of the options in treatment for humeral shaft fractures as it can be applied on the 1 st day of the presentation in most of the situations. Simple objective scoring system was useful particularly in uneducated patients.

  11. Effectiveness of Chêneau brace treatment for idiopathic scoliosis: prospective study in 79 patients followed to skeletal maturity

    Directory of Open Access Journals (Sweden)

    Kotwicki Tomasz

    2011-01-01

    Full Text Available Abstract Background Progressive idiopathic scoliosis can negatively influence the development and functioning of 2-3% of adolescents, with health consequences and economic costs, placing the disease in the centre of interest of the developmental medicine. The aim of this study was to evaluate the effectiveness of Chêneau brace in the management of idiopathic scoliosis. Methods A prospective observational study according to SOSORT and SRS recommendations comprised 79 patients (58 girls and 21 boys with progressive idiopathic scoliosis, treated with Chêneau brace and physiotherapy, with initial Cobb angle between 20 and 45 degrees, no previous brace treatment, Risser 4 or more at the final evaluation and minimum one year follow-up after weaning the brace. Achieving 50° of Cobb angle was considered surgical recommendation. Results At follow-up 20 patients (25.3% improved, 18 patients (22.8% were stable, 31 patients (39.2% progressed below 50 degrees and 10 patients (12.7% progressed beyond 50 degrees (2 of these 10 patients progressed beyond 60 degrees. Progression concerned the younger and less skeletally mature patients. Conclusion Conservative treatment with Chêneau orthosis and physiotherapy was effective in halting scoliosis progression in 48.1% of patients. The results of this study suggest that bracing is effective in reducing the incidence of surgery in comparison with natural history.

  12. Bracing Regular Polygons as We Race into the Future

    Science.gov (United States)

    Frederickson, Greg N.

    2012-01-01

    How many rods does it take to brace a square in the plane? Once Martin Gardner's network of readers got their hands on it, it turned out to be fewer than Raphael Robinson, who originally posed the problem, thought. And who could have predicted the stunning solutions found subsequently for various generalizations of the problem?

  13. Design method of redundancy of brace-anchor sharing supporting based on cooperative deformation

    Science.gov (United States)

    Liu, Jun-yan; Li, Bing; Liu, Yan; Cai, Shan-bing

    2017-11-01

    Because of the complicated environment requirement, the support form of foundation pit is diversified, and the brace-anchor sharing support is widely used. However, the research on the force deformation characteristics and the related aspects of the cooperative response of the brace-anchor sharing support is insufficient. The application of redundancy theory in structural engineering has been more mature, but there is little theoretical research on redundancy theory in underground engineering. Based on the idea of collaborative deformation, the paper calculates the ratio of the redundancy degree of the cooperative deformation by using the local reinforcement design method and the structural component redundancy parameter calculation formula based on Frangopol. Combined with the engineering case, through the calculation of the ratio of cooperative deformation redundancy in the joint of brace-anchor sharing support. This paper explores the optimal anchor distribution form under the condition of cooperative deformation, and through the analysis and research of displacement field and stress field, the results of the collaborative deformation are validated by comparing the field monitoring data. It provides theoretical basis for the design of this kind of foundation pit in the future.

  14. Team care to cure adolescents with braces (avoiding low quality of life, pain and bad compliance: a case–control retrospective study. 2011 SOSORT Award winner

    Directory of Open Access Journals (Sweden)

    Tavernaro Marta

    2012-09-01

    Full Text Available Abstract Background Bracing could be efficacious, given good compliance and quality of braces. Recently the SOSORT Brace Treatment Management Guidelines (SBTMG have highlighted the perceived importance of the professional teams surrounding braced patients. Purpose To verify the impact of a complete rehabilitation team in the adolescent patient with bracing. Materials and methods Design. Initial cross-sectional study, followed by a retrospective case–control study. Population: Thirty-eight patients (15.8 ± 1.6 years; 26 females; 10 hyperkyphosis, 28 scoliosis of 29.2 ± 7.9° Cobb extracted from a single orthotist database (between January 1, 2008 and September 1, 2009 and treated by the same physician; brace wearing at least 15 hours/day for a minimum of 6 months; age 10 or more. Treatment: Braces: Sforzesco, Sibilla, Lapadula or Maguelone. Exercises: SEAS. Methods: Two questionnaires filled in blindly by patients: SRS-22 and one especially developed and validated with 25 questions on adherence to treatment. Groups (main risk factor: TEAM (private institute: satisfied 44/44 SOSORT criteria; grade of teamwork, “excellent” included 13 patients and NOT 25 (National Health Service Rehabilitation Department: 35/44 SOSORT criteria respected; grade, “insufficient”. Results TEAM was more compliant to bracing than NOT (97 ± 6% vs. 80 ± 24% and performed nearly double the exercises (38 ± 12 vs. 20 ± 13 minutes/session. The self-reduction of bracing was significant in NOT (from 16.8 ± 3.7 to 14.8 ± 4.9 hours/day, , P Conclusions Provided the limits of this first study on the topic, the SBTMG seems to be important for brace treatment, influencing pain, QoL and compliance (and so, presumably, final results. Future studies on the topic are advisable.

  15. Hysteretic Behavior of Tubular Steel Braces Having Carbon Fiber Reinforced Polymer Reinforcement Around End Net Sections

    Directory of Open Access Journals (Sweden)

    Cem Haydaroğlu

    2015-12-01

    Full Text Available This study presents an experimental investigation into the seismic retrofit of tubular steel braces using carbon fiber reinforced polymer (CFRP members. CFRP retrofitting of net sections for compact tubes are proposed for delaying potential local net section failure. A total of almost full-scale three (TB-1, TB-2, and TB-3 compact steel tubular specimens were designed per AISC specifications, constructed, and cyclically tested to fracture. Retrofitted braces, when compared to the reference specimen, developed fuller hysteretic curves. Increase in cumulative hysteretic energy dissipation and the elongation in fracture life in the specimen retrofitted with CFRP plates and CFRP sheet wraps at net sections are observed during testing. This resulted in a maximum of 82.5% more dissipated energy for compact tube specimens. Also, this retrofit provided a longer experimental fracture life (maximum 59% more. Due to fracture initiation during the last cycles, significant reductions in strength and stiffness have been obtained. No significant change (maximum 10% in the brace stiffness was observed, which could be desirable in seismic retrofit applications. Pushover analysis per FEMA 356 for the bare specimen shows that FEMA does not represent actual brace behavior in the compression side although pushover and experimental results are in good agreement in the tension side.

  16. Treatment of adolescent lumber spondylolysis with modified Boston brace. Selection of the patients with bone scintigraphy and repair of the part defects

    International Nuclear Information System (INIS)

    Hino, Hiroyuki; Abumi, Kuniyoshi; Kaneda, Kiyoshi; Sato, Eishu

    1996-01-01

    Results of brace treatment of 29 spondylolysis patients were reported. Patients were those who were diagnosed by scout roentgenography and accumulated 99m Tc at spondylolytic site by bone scintigraphy or by single photon emission computed tomography (SPECT) which being found more convenient to see the accumulation than the scintigraphy. Coaptation after brace treatment was observed by flat and tomographic roentgenography. Under limited sports activity, the hard brace was used for about 4 months and then soft one, for 2 months. Coaptation and repair were observed for 46 (79%) of 58 part defects in the 29 patients. Since lumber spine spondylolysis is mostly caused by fatigue fracture and bone metabolism is activated at the lesional site, 99m Tc accumulation can be seen at the spondylolytic site by bone scintigraphy with high frequency. Therefore, the rate of repair can be increased when brace treatment was applied for patients with positive bone scintigraphy findings. The scintigraphy was thus useful far selecting patients suitable for brace treatment. (K.H.)

  17. Experimental Investigation on the Behavior of Bracing Damper Systems by Utilizing Metallic Yielding and Recentering Material Devices

    Directory of Open Access Journals (Sweden)

    Jong Wan Hu

    2018-01-01

    Full Text Available With the aim of effectively reducing the structural damage caused by earthquake events, bracing systems equipped with retrofitting damper devices, which take advantage of the energy dissipation and impact absorption, have been widely used in practical construction sites. These bracing dampers, however, have been recognized as expendable supplies for easily replacing the damaged ones after a strong earthquake because they are commonly designed to undergo concentrated force and deformation for the purpose of protecting the main structural members such as the columns and beams. In this paper, the use of new superelastic shape memory alloy (SMA dampers that can partially recover their original configuration is proposed to decrease the repair cost. In addition, the conventional steel dampers used for improving the energy dissipation arising due to metallic yielding are additionally integrated into the bracing member. The behaviors of such bracing systems with the damper devices were reproduced in experimental tests with the cyclic loading history, and then their strength capacity and recentering capability were estimated based on the experiment results. Finally, additional experimental tests were performed by imposing cyclic loading histories with different loading speeds on the superelastic SMA and steel plate damper specimens.

  18. Combined versus individual effects of a valgus knee brace and lateral wedge foot orthotic during stair use in patients with knee osteoarthritis.

    Science.gov (United States)

    Moyer, Rebecca; Birmingham, Trevor; Dombroski, Colin; Walsh, Robert; Giffin, J Robert

    2017-05-01

    The aim of this study was to investigate the combined and individual biomechanical effects of a valgus knee brace and a lateral wedge foot orthotic during stair ascent and descent in patients with knee osteoarthritis (OA). Thirty-five patients with varus alignment and medial knee OA were prescribed a custom valgus knee brace and lateral wedge foot orthotic. Knee angles and moments in the frontal and sagittal planes were determined from 3D gait analysis completed under four randomized conditions: (1) control (no knee brace or foot orthotic), (2) knee brace, (3) foot orthotic, and (4) combined knee brace and foot orthotic. Additional measures included the vertical ground reaction force, trunk lean, toe out and gait speed. During the combined use of a knee brace and foot orthotic, significant decreases in the knee adduction angle (2.17, 95%CI: 0.50-3.84, p=0.013) and 2nd peak EKAM (0.35, 95%CI: 0.17-0.52, pstair descent; and significant increases in the EKFM were observed during stair ascent (0.54, 95%CI: 0.30-0.78, pstair descent compared to ascent, except for toe out. Findings suggest greater effects on gait when both knee brace and foot orthotic are used together, resulting in a more normal gait pattern. However, whether or not a true change in knee joint load can be inferred when using these orthoses remains unclear. Further research is required to determine the clinical importance of the observed changes. Copyright © 2017. Published by Elsevier B.V.

  19. Optimum Design of Braced Steel Space Frames including Soil-Structure Interaction via Teaching-Learning-Based Optimization and Harmony Search Algorithms

    Directory of Open Access Journals (Sweden)

    Ayse T. Daloglu

    2018-01-01

    Full Text Available Optimum design of braced steel space frames including soil-structure interaction is studied by using harmony search (HS and teaching-learning-based optimization (TLBO algorithms. A three-parameter elastic foundation model is used to incorporate the soil-structure interaction effect. A 10-storey braced steel space frame example taken from literature is investigated according to four different bracing types for the cases with/without soil-structure interaction. X, V, Z, and eccentric V-shaped bracing types are considered in the study. Optimum solutions of examples are carried out by a computer program coded in MATLAB interacting with SAP2000-OAPI for two-way data exchange. The stress constraints according to AISC-ASD (American Institute of Steel Construction-Allowable Stress Design, maximum lateral displacement constraints, interstorey drift constraints, and beam-to-column connection constraints are taken into consideration in the optimum design process. The parameters of the foundation model are calculated depending on soil surface displacements by using an iterative approach. The results obtained in the study show that bracing types and soil-structure interaction play very important roles in the optimum design of steel space frames. Finally, the techniques used in the optimum design seem to be quite suitable for practical applications.

  20. The influence of elastic orthotic belt on sagittal profile in adolescent idiopathic thoracic scoliosis: a comparative radiographic study with Milwaukee brace

    Directory of Open Access Journals (Sweden)

    Qian Bangping

    2010-09-01

    Full Text Available Abstract Background The effectiveness of bracing on preventing curve progression in coronal plane for mild and moderate adolescent idiopathic scoliosis (AIS patients has been confirmed by previous radiographic researches. However, a hypokyphotic effect on the sagittal plane has been reported by a few studies. A relatively increasing number of AIS patients were noticed to wear a new kind of elastic orthotic belt for the treatments of scoliosis without doctors' instructions. We postulate the correcting mechanism of this new appliance may cause flattening of the spine. To our knowledge, no study has investigated the effects of this new orthosis on the sagittal profile of AIS patients. The aim of this study was to evaluate and compare the effects of elastic orthotic belt and Milwaukee brace on the sagittal alignment in AIS patients. Methods Twenty-eight female AIS patients with mild or moderate thoracic curves were included in this study. Standing full-length lateral radiographs were obtained in three conditions: natural standing posture without any treatment, with elastic orthotic belt and with Milwaukee brace. Thoracic kyphosis (TK, lumber lordosis (LL and pelvic incidence (PI were measured and compared between the above three conditions. Results Both elastic orthotic belt and Milwaukee brace can lead to significant decrease of TK, however, the decrease of TK after wearing elastic orthotic belt is significantly larger than that after wearing Milwaukee brace. Compared with no treatment, LL was found to be significantly smaller after wearing Milwaukee brace, however, such significant decrease was not noted after wearing elastic orthotic belt. No significant changes were observed for the PI between 3 conditions. Conclusions The elastic orthotic belt could lead to more severe thoracic hypokyphosis when compared with Milwaukee brace. This belt may not be a suitable conservative method for the treatment of mild and moderate AIS patients.

  1. Long-term results after Boston brace treatment in adolescent idiopathic scoliosis

    Directory of Open Access Journals (Sweden)

    Steen Harald

    2009-08-01

    Full Text Available Abstract Background Few studies have evaluated long-term outcome after bracing using validated health related quality of life outcome measures. The aim of the present study was to evaluate the long-term outcome in adolescent idiopathic scoliosis (AIS 12 years or more after treatment with the Boston brace. Methods 109 (80% of 135 patients (7 men with AIS treated with the Boston brace at a mean of 19.2 (range 12–28 years previously responded to long-term follow-up examination. All patients (n = 109 answered a standardised questionnaire including demographics, work status, treatment, Global Back Disability Question, Oswestry Disability Index (ODI (100-worst possible, General Function Score (GFS (100 – worst possible, EuroQol (EQ-5D (1 – best possible, EQ-VAS (100 – best possible and Scoliosis Research Society -22 (SRS – 22 (5 – best possible. Clinical and radiological examination was obtained in 86 patients. Results The magnitude of the primary prebrace major curve was in average 33.4° (range 20 – 52. At weaning and at the last follow-up the corresponding values were 28.3° (9–56 and 34.2° (8 – 87, respectively. The mean age at follow-up was 35 (27 – 46 years. Work status was: full time (80%, on sick-leave (3%, on rehabilitation (4%, disability pension (4%, homemaker (7%, students (2%, 7% had changed their job because of back pain. 88% had had delivered a baby, 55% of them had pain in pregnancy. Global back status was excellent or good in 81%. The mean (standard deviation ODI was 6.4 (9.8, GFS 5.4 (10.5, EQ-5D 0.84 (0.2, SRS-22: pain 4.2 (0.8, mental health 4.2 (0.7, self-image 3.9 (0.7, function 4.1 (0.6, satisfaction with treatment 3.7 (1.0. 28% had taken physiotherapy for back pain the last year and 12% had visited a doctor. Conclusion Long-term results were satisfactory in most patients with AIS treated with the Boston brace.

  2. Treatment of adolescent lumber spondylolysis with modified Boston brace. Selection of the patients with bone scintigraphy and repair of the part defects

    Energy Technology Data Exchange (ETDEWEB)

    Hino, Hiroyuki; Abumi, Kuniyoshi; Kaneda, Kiyoshi; Sato, Eishu [Hokkaido Univ., Sapporo (Japan). School of Medicine

    1996-06-01

    Results of brace treatment of 29 spondylolysis patients were reported. Patients were those who were diagnosed by scout roentgenography and accumulated {sup 99m}Tc at spondylolytic site by bone scintigraphy or by single photon emission computed tomography (SPECT) which being found more convenient to see the accumulation than the scintigraphy. Coaptation after brace treatment was observed by flat and tomographic roentgenography. Under limited sports activity, the hard brace was used for about 4 months and then soft one, for 2 months. Coaptation and repair were observed for 46 (79%) of 58 part defects in the 29 patients. Since lumber spine spondylolysis is mostly caused by fatigue fracture and bone metabolism is activated at the lesional site, {sup 99m}Tc accumulation can be seen at the spondylolytic site by bone scintigraphy with high frequency. Therefore, the rate of repair can be increased when brace treatment was applied for patients with positive bone scintigraphy findings. The scintigraphy was thus useful far selecting patients suitable for brace treatment. (K.H.)

  3. Effect of Prophylactic Ankle-Brace Use During a High School Competitive Basketball Season on Dynamic Postural Control.

    Science.gov (United States)

    Crockett, Nathan J; Sandrey, Michelle A

    2015-08-01

    Few studies have evaluated the long-term effects of prophylactic ankle-brace use during a sport season. To determine the effects of prophylactic ankle-brace use during a high school basketball season on dynamic postural control and functional tests. Prospective repeated-measures design. High school athletic facility. 21 healthy high school basketball athletes (13 girls, 8 boys). The order of testing was randomized using the Star Excursion Balance Test (SEBT) for posteromedial (PM), medial (M), and anteromedial (AM) directions and 3 functional tests (FT) consisting of the single-leg crossover hop, single-leg vertical jump, and the single-leg 6-m hop for time at pre-, mid-, and postseason. After pretesting, the ankle brace was worn on both limbs during the entire 16-wk competitive basketball season. SEBT for PM, M, and AM and 3 single-leg FTs. Dynamic postural control using the SEBT and the 3 FTs improved over time, notably from pretest to posttest. The left limb was different from the right limb during the single-leg vertical jump. Effect sizes were large for pretest to posttest for the 3 SEBT directions and 2 of the 3 FTs. The 16-wk basketball prophylactic ankle-brace intervention significantly improved dynamic postural control and single-limb FTs over time.

  4. Polish adaptation of Bad Sobernheim Stress Questionnaire-Brace and Bad Sobernheim Stress Questionnaire-Deformity.

    Science.gov (United States)

    Misterska, Ewa; Głowacki, Maciej; Harasymczuk, Jerzy

    2009-12-01

    Bad Sobernheim Stress Questionnaire-Brace and Bad Sobernheim Stress Questionnaire-Deformity are relatively new tools aimed at facilitating the evaluation of long-term results of therapy in persons with idiopathic scoliosis undergoing conservative treatment. To use these tools properly in Poland, they must be translated into Polish and adapted to the Polish cultural settings. The process of cultural adaptation of the questionnaires was compliant with the guidelines of International Quality of Life Assessment (IQOLA) Project. In the first stage, two independent translators converted the originals into Polish. Stage two, consisted of a comparison of the originals and two translated versions. During that stage, the team of two translators and authors of the project identified differences in those translations and created a combination of the two. In the third stage, two independent translators, who were native speakers of German, translated the adjusted version of the Polish translation into the language of the original document. At the last stage, a commission composed of: specialists in orthopedics, translators, a statistician and a psychologist reviewed all translations and drafted a pre-final version of the questionnaires. Thirty-five adolescent girls with idiopathic scoliosis who were treated with Cheneau brace were subjected to the questionnaire assessment. All patients were treated in an out-patient setting by a specialist in orthopedics at the Chair and Clinic of Orthopedics and Traumatology. Median age of patients was 14.8 SD 1.5, median value of the Cobb's angle was 27.8 degrees SD 7.4. 48.6% of patients had thoracic scoliosis, 31.4% had thoracolumbar scoliosis, and 20% patients had lumbar scoliosis. Median results obtained by means of the Polish version of BSSQ-Brace and BSSQ-Deformity questionnaires were 17.9 SD 5.0 and 11.3 SD 4.7, respectively. Internal consistency of BSSQ-Brace and BSSQ-Deformity was at the level of 0.80 and 0.87, whereas the value of

  5. Healing of the Acutely Injured Anterior Cruciate Ligament: Functional Treatment with the ACL-Jack, a Dynamic Posterior Drawer Brace

    Directory of Open Access Journals (Sweden)

    Matthias Jacobi

    2016-01-01

    Full Text Available Background. The injured anterior cruciate ligament (ACL has a limited healing capacity leading to persisting instability. Hypothesis/Purpose. To study if the application of a brace, producing a dynamic posterior drawer force, after acute ACL injury reduces initial instability. Study Design. Cohort study. Methods. Patients treated with the ACL-Jack brace were compared to controls treated with primary ACL reconstruction und controls treated nonsurgically with functional rehabilitation. Measurements included anterior laxity (Rolimeter, clinical scores (Lysholm, Tegner, and IKDC, and MRI evaluation. Patients were followed up to 24 months. Results. Patients treated with the ACL-Jack brace showed a significant improvement of anterior knee laxity comparable to patients treated with ACL reconstruction, whereas laxity persisted after nonsurgical functional rehabilitation. The failure risk (secondary reconstruction necessary of the ACL-Jack group was however 21% (18 of 86 within 24 months. Clinical scores were similar in all treatment groups. Conclusion. Treatment of acute ACL tears with the ACL-Jack brace leads to improved anterior knee laxity compared to nonsurgical treatment with functional rehabilitation.

  6. Comparison of the effect of semi-rigid ankle bracing on performance ...

    African Journals Online (AJOL)

    Objective. To determine the comparative proprioceptive performance of injured v. non-injured adolescent female hockey players wearing an ankle brace. Methods. Data were collected from 100 high school players who belonged to the Highway Secondary School Hockey League, KwaZulu- Natal, via voluntary parental ...

  7. Curve progression after long-term brace treatment in adolescent idiopathic scoliosis: comparative results between over and under 30 Cobb degrees - SOSORT 2017 award winner

    Directory of Open Access Journals (Sweden)

    Angelo G. Aulisa

    2017-10-01

    Full Text Available Abstract Background The factors influencing curve behavior following bracing are incompletely understood and there is no agreement if scoliotic curves stop progressing with skeletal maturity. The aim of this study was to evaluate the loss of the scoliotic curve correction in patients treated with bracing during adolescence and to compare patient outcomes of under and over 30 Cobb degrees, 10 years after brace removal. Methods We reviewed 93 (87 female of 200 and nine patients with adolescent idiopathic scoliosis (AIS who were treated with the Lyon or PASB brace at a mean of 15 years (range 10–35. All patients answered a simple questionnaire (including work status, pregnancy, and pain and underwent clinical and radiological examination. The population was divided into two groups based on Cobb degrees ( 30°. Statistical analysis was performed to test the efficacy of our hypothesis. Results The patients underwent a long-term follow-up at a mean age of 184.1 months (±72.60 after brace removal. The pre-brace scoliotic mean curve was 32.28° (± 9.4°; after treatment, the mean was 19.35° and increased to a minimum of 22.12° in the 10 years following brace removal. However, there was no significant difference in the mean Cobb angle between the end of weaning and long term follow-up period (p = 0.105. The curve angle of patients who were treated with a brace from the beginning was reduced by 13° during the treatment, but the curve size lost 3° at the follow-up period. The groups over 30° showed a pre-brace scoliotic mean curve of 41.15°; at the end of weaning, the mean curve angle was 25.85° and increased to a mean of 29.73° at follow-up; instead, the groups measuring ≤ 30° showed a pre-brace scoliotic mean curve of 25.58°; at the end of weaning, it was reduced to a mean of 14.24° and it increased to 16.38° at follow-up. There was no significant difference in the mean progression of curve magnitude between the ≤ 30° and

  8. Team care to cure adolescents with braces (avoiding low quality of life, pain and bad compliance): a case-control retrospective study. 2011 SOSORT Award winner.

    Science.gov (United States)

    Tavernaro, Marta; Pellegrini, Anna; Tessadri, Fabrizio; Zaina, Fabio; Zonta, Andrea; Negrini, Stefano

    2012-09-20

    Bracing could be efficacious, given good compliance and quality of braces. Recently the SOSORT Brace TREATMENT Management Guidelines (SBTMG) have highlighted the perceived importance of the professional teams surrounding braced patients. To verify the impact of a complete rehabilitation team in the adolescent patient with bracing. Design. Initial cross-sectional study, followed by a retrospective case-control study. Thirty-eight patients (15.8 ± 1.6 years; 26 females; 10 hyperkyphosis, 28 scoliosis of 29.2 ± 7.9° Cobb) extracted from a single orthotist database (between January 1, 2008 and September 1, 2009) and treated by the same physician; brace wearing at least 15 hours/day for a minimum of 6 months; age 10 or more. Braces: Sforzesco, Sibilla, Lapadula or Maguelone. Exercises: SEAS. Two questionnaires filled in blindly by patients: SRS-22 and one especially developed and validated with 25 questions on adherence to treatment. Groups (main risk factor): TEAM (private institute: satisfied 44/44 SOSORT criteria; grade of teamwork, "excellent") included 13 patients and NOT 25 (National Health Service Rehabilitation Department: 35/44 SOSORT criteria respected; grade, "insufficient"). TEAM was more compliant to bracing than NOT (97 ± 6% vs. 80 ± 24%) and performed nearly double the exercises (38 ± 12 vs. 20 ± 13 minutes/session). The self-reduction of bracing was significant in NOT (from 16.8 ± 3.7 to 14.8 ± 4.9 hours/day, , Pversus 7% of TEAM (P < 0.05). The populations did not differ at the baseline studied outcomes. The absence of a good team surrounding the patient increases by five times the risk of reduced compliance to bracing (odds ratio OR 5.5 - 95% confidence interval 95CI 3.6-7.4), along with more than 15 times that of QoL problems (OR 15.7 - 95CI 13.6-17.9) and pain (OR 16.8 - 95CI 14.5-19.1). Provided the limits of this first study on the topic, the SBTMG seems to be important for brace treatment

  9. Effect of K?nes?otap?ng and Knee Brace on Funct?onal Performance in Recreat?onal Athletes

    OpenAIRE

    Ulusoy, Burak; ?ldiz, B?lent; Tunay, Volga Bayrak??

    2014-01-01

    Objectives: Kinesiotaping is a popular taping method that is used for both therapeutic and performance enchancement purposes. Knee braces are widely used for prevention in sport injuries but their performance effectiveness is still controversial. The aim of this study was to determine whether kinesiotape or brace was more effective on functional performance. Methods: A total twenty male recreational football players (Mean?Standart Deviation (SD) age: 22.5?0.68 years, height: 175.15?3.37 cm, b...

  10. Soft braces in the treatment of Adolescent Idiopathic Scoliosis (AIS – Review of the literature and description of a new approach

    Directory of Open Access Journals (Sweden)

    Weiss Hans-Rudolf

    2012-05-01

    Full Text Available Abstract Background The use of soft braces to treat scoliosis has been described by Fischer as early as 1876. With the help of elastic straps, as the authors suggested, a corrective movement for individual curve patterns should be maintained in order to inhibit curve progression. Today this concept has been revived besides soft 3 point pressure systems. Some shortcomings have been revealed in literature in comparison with hard braces, however the concept of improving quality of life of a patient while under brace treatment should furtherly be considered as valuable. Purpose of this review is to gather the body of evidence existent for the use of soft braces and to present recent developments. Method A review of literature as available on Pub Med was performed using the key words ‘scoliosis’ and ‘soft brace’ at first. The search was expanded using ‘scoliosis’ and the known trademarks (1 ‘scoliosis’ and ‘SpineCor’, (2 ‘scoliosis’ and ‘TriaC’, (3 ‘scoliosis’ and ‘St. Etienne brace’, (4 ‘scoliosis’ and ‘Olympe’. The papers considered for inclusion were new technical descriptions, preliminary results, cohort studies and controlled studies. Results When searching for the terms ‘scoliosis’ and ‘SpineCor’: 20 papers have been found, most of them investigating a soft brace, for ‘scoliosis’ and ‘TriaC’: 7 papers displayed, for ‘scoliosis’ and ‘St. Etienne brace’: one paper displayed but not meeting the topic and for ‘scoliosis’ and ‘Olympe’: No paper displayed. Four papers found on the SpineCor™ were of prospective controlled or prospective randomized design. These papers partly presented contradictory results. Two papers were on soft Boston braces used in patients with neuromuscular scoliosis. Discussion There is a small but consistent body of evidence for the use of soft braces in the treatment of scoliosis. Contradictory results have been published for samples treated during

  11. Evaluation of Seismic Behavior of Steel Braced Frames with Controlled Rocking System and Energy Dissipating Fuses

    Directory of Open Access Journals (Sweden)

    Hassan Amirzehni

    2016-12-01

    Full Text Available The self-centering rocking steel braced frames are new type of seismic lateral-force resisting systems that are developed with aim to limiting structural damages, minimizing residual drifts on systems and creating easy and inexpensive reconstruction capability, after sever earthquakes. In Steel braced frames with controlled rocking system, column bases on seismic resisting frame are not attached to the foundation and the frame allowed to rock freely. The task of restoring the rotated frame to its initial location is on post-tensioned cables, which attaches top of the frame to foundation. The design of post tensioned stands and braced frame members is such that during earthquakes they remain in elastic region. Seismic energy, dissipates by plastic deformations in replaceable elements on each rock of frame. In current research work, the seismic behavior of this type of lateral resisting systems is evaluated. The research conducted on a one bay steel braced frame with controlled rocking system that is analyzed using nonlinear dynamic time history analysis (NLTHA procedure. The frame is subjected to JMA-Kobe and Northridge ground motions records that are scaled to unit, 1.2 and 1.5 times of maximum considered earthquake (MCE ground motion level intensity. Extracted results show that seismic behavior of this type of lateral force resisting systems are so desirable even under MCE ground motion levels. The only anxiety is about occurring fatigue in post-tensioned strands that endangers overall stability of system.

  12. Risk Factors for Parachute Injuries and Airborne Student Observations on the Parachute Ankle Brace

    National Research Council Canada - National Science Library

    Knapik, Joseph J; Spiess, Anita; Darakjy, Salima; Grier, Tyson; Manning, Fred; Livingston, Elaine; Swedler, David; Amoroso, Paul; Jones, Bruce H

    2007-01-01

    ...) of the Defense Safety Oversight Council (DSOC) to evaluate the parachute ankle brace (PAB). Information provided by the questionnaire identified potential injury risk factors and comments on the PAB...

  13. The Effects of Counterforce Brace Size on the Wrist Range of Motility, Pain, Grip & Wrist Extension Sterngth in Normal Subjects and Patients with Tennis Elbow

    Directory of Open Access Journals (Sweden)

    Ali Asghar Jameh-Bozorgi

    2006-04-01

    Full Text Available Objective: Counter force brace is one of the most usefull treatments for lateral opicondylitis (Tennis elbow because it decreases grip pain and increases the power of grip, power of wrist extension and Wrist Range of Motility. The purpose of this quasi experimental (repeated measurementsstudy was to determine the effect of 3 counterforce brace sizes on the wrist R.O.M, grip and wrist extension strength and pain intensity in two groups of healthy subjects and patients with tennis elbow. Materials & Methods: 18 normal subjects & 18 patients with tennis elbow were selected simple conveniently and were tested with no brace and 3 size of counterforce (1,2 and 3 inches. The R.O.M , strength and pain intensity were measured by jamar goniometry and Nicholas MMT dynamometry & VAS, respectively. Results: 1 With all sizes there was a significant decrease of R.O.M on normal subjects but no significant difference in patients. 2 There was a significant decrease of grip strength with 1-inch brace in normal subjects but a significant increase of grip strength with 2 and 3-inch brace in patiens. 3 All sizes of brace caused significant decrease of extension strength in normal subjects but increase in patients. 4All size caused significant decrease of pain intensity that was more considerable in the case of 2 and 3 inch size. Conclusion: The results shows that the counterforce brace may be considered as an effective treatment for increasing strength and decreasing pain in patients with tennis elbow.

  14. Soft-plastic brace for lower limb fractures in patients with spinal cord injury.

    Science.gov (United States)

    Uehara, K; Akai, M; Kubo, T; Yamasaki, N; Okuma, Y; Tobimatsu, Y; Iwaya, T

    2013-04-01

    Retrospective study at a rehabilitation center. Patients with spinal cord injury, even if they are wheelchair users, sometimes suffer from fractures of the lower limb bones. As their bones are too weak to have surgery, and because a precise reduction is not required for restoration, such patients are often indicated for conservative treatment. This case series study investigated the use of a hinged, soft-plastic brace as a conservative approach to treating fractures of the lower extremities of patients with spinal cord injury. National Rehabilitation Center, Japan. Fifteen patients (male, n=10; female, n=5; average age, 52.7 years) with 19 fractures of the femur or the tibia who were treated with a newly-developed hinged, soft-plastic brace were studied. All of them used wheelchairs. We analyzed the time taken for fracture union and for wearing orthotics, degree of malalignment, femorotibial angle and side effects. The fractures in this series were caused by relatively low-energy impact. The average time taken for fracture union was 80.1 (37-189) days, and the average amount of time spent wearing orthotics was 77.9 (42-197) days. On final X-ray imaging, the average femorotibial angle was 176.9° (s.d. ±8.90), and 15° of misalignment in the sagittal plane occurred in one patient. A hinged, soft-plastic brace is a useful option as a conservative approach for treating fractures of the lower extremities in patients with spinal cord injury.

  15. Specific exercises reduce brace prescription in adolescent idiopathic scoliosis: a prospective controlled cohort study with worst-case analysis.

    Science.gov (United States)

    Negrini, Stefano; Zaina, Fabio; Romano, Michele; Negrini, Alessandra; Parzini, Silvana

    2008-06-01

    To compare the effect of Scientific Exercises Approach to Scoliosis (SEAS) exercises with "usual care" rehabilitation programmes in terms of the avoidance of brace prescription and prevention of curve progression in adolescent idiopathic scoliosis. Prospective controlled cohort observational study. Seventy-four consecutive outpatients with adolescent idiopathic scoliosis, mean 15 degrees (standard deviation 6) Cobb angle, 12.4 (standard deviation 2.2) years old, at risk of bracing who had not been treated previously. Thirty-five patients were included in the SEAS exercises group and 39 in the usual physiotherapy group. The primary outcome included the number of braced patients, Cobb angle and the angle of trunk rotation. There were 6.1% braced patients in the SEAS exercises group vs 25.0% in the usual physiotherapy group. Failures of treatment in the worst-case analysis were 11.5% and 30.8%, respectively. In both cases the differences were statistically significant. Cobb angle improved in the SEAS exercises group, but worsened in the usual physiotherapy group. In the SEAS exercises group, 23.5% of patients improved and 11.8% worsened, while in the usual physiotherapy group 11.1% improved and 13.9% worsened. These data confirm the effectiveness of exercises in patients with scoliosis who are at high risk of progression. Compared with non-adapted exercises, a specific and personalized treatment (SEAS) appears to be more effective.

  16. Cost effectiveness of brace, physiotherapy, or both for treatment of tennis elbow

    NARCIS (Netherlands)

    Struijs, P. A. A.; Korthals-de Bos, I. B. C.; van Tulder, M. W.; van Dijk, C. N.; Bouter, L. M.; Assendelft, W. J. J.

    2006-01-01

    BACKGROUND: The annual incidence of tennis elbow in the general population is high (1-3%). Tennis elbow often leads to limitation of activities of daily living and work absenteeism. Physiotherapy and braces are the most common treatments. OBJECTIVES: The hypothesis of the trial was that no

  17. Design Optimization of Long-Span Cold-Formed Steel Portal Frames Accounting for Effect of Knee Brace Joint Configuration

    OpenAIRE

    Thanh Duoc Phan; James B. P. Lim; Meheron Selowara Joo; Hieng-Ho Lau

    2017-01-01

    The application of cold-formed steel channel sections for portal frames becomes more popular for industrial and residential purposes. Experimental tests showed that such structures with long-span up to 20 m can be achieved when knee brace joints are included. In this paper, the influence of knee brace configuration on the optimum design of long-span cold-formed steel portal frames is investigated. The cold-formed steel portal frames are designed using Eurocode 3 under ultimate limit states. A...

  18. Efficacy of b-lynch brace suture in postpartum haemorrhage

    International Nuclear Information System (INIS)

    Tarique, S.; Wazir, S.; Moeen, G.

    2011-01-01

    Massive uncontrolled haemorrhage after childbirth is the leading cause of maternal death in developing countries. Postpartum haemorrhage is traditionally defined as blood loss of more than 500 ml after vaginal delivery and more than 1000 ml after caesarean section, but intraoperative estimation of blood loss is inaccurate. Uterine atony alone accounts for 75 - 90% of PPH. To estimate the effectiveness and safety of B-Lynch brace Suture in the management of primary postpartum haemorrhage (PPH). (author)

  19. Behavior of concentrically loaded CFT braces connections

    Directory of Open Access Journals (Sweden)

    Maha M. Hassan

    2014-03-01

    Full Text Available Concrete filled tubes (CFTs composite columns have many economical and esthetic advantages, but the behavior of their connections is complicated. Through this study, it is aimed to investigate the performance and behavior of different connection configurations between concrete filled steel tube columns and bracing diagonals through an experimental program. The study included 12 connection subassemblies consisting of a fixed length steel tube and gusset plate connected to the tube end with different details tested under half cyclic loading. A notable effect was observed on the behavior of the connections due to its detailing changes with respect to capacity, failure mode, ductility, and stress distribution.

  20. Human occupants in low-speed frontal sled tests: effects of pre-impact bracing on chest compression, reaction forces, and subject acceleration.

    Science.gov (United States)

    Kemper, Andrew R; Beeman, Stephanie M; Madigan, Michael L; Duma, Stefan M

    2014-01-01

    The purpose of this study was to investigate the effects of pre-impact bracing on the chest compression, reaction forces, and accelerations experienced by human occupants during low-speed frontal sled tests. A total of twenty low-speed frontal sled tests, ten low severity (∼2.5g, Δv=5 kph) and ten medium severity (∼5g, Δv=10 kph), were performed on five 50th-percentile male human volunteers. Each volunteer was exposed to two impulses at each severity, one relaxed and the other braced prior to the impulse. A 59-channel chestband, aligned at the nipple line, was used to quantify the chest contour and anterior-posterior sternum deflection. Three-axis accelerometer cubes were attached to the sternum, 7th cervical vertebra, and sacrum of each subject. In addition, three linear accelerometers and a three-axis angular rate sensor were mounted to a metal mouthpiece worn by each subject. Seatbelt tension load cells were attached to the retractor, shoulder, and lap portions of the standard three-point driver-side seatbelt. In addition, multi-axis load cells were mounted to each interface between the subject and the test buck to quantify reaction forces. For relaxed tests, the higher test severity resulted in significantly larger peak values for all resultant accelerations, all belt forces, and three resultant reaction forces (right foot, seatpan, and seatback). For braced tests, the higher test severity resulted in significantly larger peak values for all resultant accelerations, and two resultant reaction forces (right foot and seatpan). Bracing did not have a significant effect on the occupant accelerations during the low severity tests, but did result in a significant decrease in peak resultant sacrum linear acceleration during the medium severity tests. Bracing was also found to significantly reduce peak shoulder and retractor belt forces for both test severities, and peak lap belt force for the medium test severity. In contrast, bracing resulted in a significant

  1. Radiographic evaluation of acute distal radius fracture stability: A comparative cadaveric study between a thermo-formable bracing system and traditional fiberglass casting.

    Science.gov (United States)

    Santoni, Brandon G; Aira, Jazmine R; Diaz, Miguel A; Kyle Stoops, T; Simon, Peter

    2017-08-01

    Distal radius fractures are common musculoskeletal injuries and many can be treated non-operatively with cast immobilization. A thermo-formable brace has been developed for management of such fractures, but no data exist regarding its comparative stabilizing efficacy to fiberglass casting. A worst-case distal radius fracture was created in 6 cadaveric forearms. A radiolucent loading fixture was created to apply cantilever bending/compression loads ranging from 4.5N to 66.7N across the simulated fracture in the: (1) non-stabilized, (2) braced; and (3) casted forearms, each forearm serving as its own control. Fracture fragment translations and rotations were measured radiographically using orthogonal radiographs and a 2D-3D, CT-based transformation methodology. Under 4.5N of load in the non-stabilized condition, average sagittal plane rotation and 3D center of mass translation of the fracture fragment were 12.3° and 5.3mm, respectively. At the 4.5N load step, fragment rotation with the brace (avg. 0.0°) and cast (0.1°) reduced sagittal plane rotation compared to the non-stabilized forearm (Pthermo-formable brace stabilized the fracture in a manner that was not radiographically or biomechanically different from traditional fiberglass casting. Study results support the use of the thermo-formable brace clinically. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. Bracing in adult with scoliosis: experience in diagnosis and classification from a 15 year prospective study of 739 patients

    Directory of Open Access Journals (Sweden)

    Jean Claude de Mauroy

    2016-10-01

    Full Text Available Abstract Background Despite the frequency of adult scoliosis, very few publications concern the conservative orthopaedic treatments. The indications have not been defined to date. The experience of a department specialized in rigid bracing allows us to consolidate and clarify diagnosis and indications as well. Methods Individual observational prospective cohort study from a database started in 1998, with selection of all 739 adult scoliosis patients for which conservative orthopaedic treatment has been proposed to, even in case of drop-out. Scoliosis treated during adolescence and monitored in adulthood are included if a new brace is prescribed. A first descriptive study of the main parameters was performed: gender, age, Cobb angle. A tentative classification according to aetiology, age and angulation is proposed. Results 1 Descriptive Data: The Ratio Female/Male is 88 %, the mean age: 56.97 ± 15.82, the mean Cobb angle: 35.58 ± 17.35. The rate of non-adherent patients not wearing the brace is 17 % (but the plaster cast before bracing was routinely proposed at the time. 2 All patients can be grouped into five diagnoses, all statistically different, according to the age and the initial Cobb angle: Rotatory dislocation: 361 cases, age: 59.73 ± 13.52 (p = 0.05, (Cobb 39.08 ± 16.59 (p = 0.02* Instability and disc disease: 150 cases, age: 46.03 ± 15.49 (p = 0.00*, Cobb: 25.29 ± 12.29 (p = 0.00* Camptocormia: 68 cases, age: 69.78 ± 12.19 (p = 0.00*, Cobb: 38.09 ± 14.23 (p = 0.25 Kyphosis TL or T: 62 cases, age: 60.73 ± 15.51 (p = 0.07, Cobb: 43.34 ± (21.48 (p = 0.00* Disabling pain: 33 cases, age: 48.36 ± 13.73 (p = 0.02*, Cobb: 36.45 ± 25.21 (p = 0.78 Treatment after surgery and in the context of a lumbar stenosis and spondylolisthesis are independent groups. Despite the wide variety of etiologies, nearly 2/3 of patients have a discal pathology like

  3. Measurements of the critical parameters for {l_brace}xNH{sub 3} + (1 - x)H{sub 2}O{r_brace} with x = (0.9098, 0.7757, 0.6808)

    Energy Technology Data Exchange (ETDEWEB)

    Sakabe, A.; Arai, D. [Centre for Multiscale Mechanics and Mechanical Systems, Keio University, Yokohama 223-8522 (Japan); Miyamoto, H. [Department of Mechanical Systems Engineering, Toyama Prefectural University, Imizu 939-0398 (Japan)], E-mail: miyamoto@pu-toyama.ac.jp; Uematsu, M. [Centre for Multiscale Mechanics and Mechanical Systems, Keio University, Yokohama 223-8522 (Japan)

    2008-10-15

    Measurements of the critical parameters for {l_brace}xNH{sub 3} + (1 - x)H{sub 2}O{r_brace} with x = (0.9098, 0.7757, 0.6808) were carried out by using a metal-bellows variable volumometer with an optical cell. The expanded uncertainties (k = 2) in temperature, pressure, density, and composition measurements have been estimated to be less than 3.2 mK, 3.2 kPa, 0.3 kg . m{sup -3}, and 8.8 . 10{sup -4}, respectively. In each mole fraction, the critical temperature T{sub c} was first determined on the basis of the intensity of the critical opalescence. The critical pressure p{sub c} and critical density {rho}{sub c} were then determined as the point at which the meniscus disappears on the isotherm at T = T{sub c}. The expanded uncertainties (k = 2) in the present critical parameters have also been estimated. Comparisons of the present values with the literature data as well as the calculated values afforded using the equation of state are also presented.

  4. Fabrication of a new samarium(III) ion-selective electrode based on 3-{l_brace}[2-oxo-1(2h)-acenaphthylenyliden]amino{r_brace}-2-thioxo -1,3-thiazolidin-4-one

    Energy Technology Data Exchange (ETDEWEB)

    Zamani, Hassan Ali [Islamic Azad University, Quchan (Iran, islamic Republic of). Quchan Branch. Dept. of Chemistry]. E-mail: haszamani@yahoo.com; Ganjali, Mohammad Reza [Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of). Endocrine and Metabolism Research Center; Adib, Mehdi [University of Tehran, Tehran (Iran, Islamic Republic of). Faculty of Chemistry. Center of Excellence in Electrochemistry

    2007-07-01

    This paper introduces the development of an original PVC membrane electrode, based on 3-{l_brace}[2-oxo-1(2H)-acenaphthylenyliden]amino{r_brace}-2-thioxo-1,3-thiazolidin-4-one (ATTO) which has revealed to be a suitable carrier for Sm{sup 3+} ions. The resulting data illustrated that the electrode shows a Nernstian slope of 19.3 {+-} 0.6 mV per decade for Sm{sup 3+} ions over a broad working concentration range of 1.0 X 10{sup -6} to 1.0 X 10{sup -1} mol L{sup -1}. The lower detection limit was found to be equal to (5.5{+-} 0.3) X 10{sup -7} mol L{sup -}'1 in the pH range of 3.5-7.5, and the response time was very short ({approx}10 s). The potentiometric sensor displayed good selectivities for a number of cations such as alkali, alkaline earth, transition and heavy metal ions. (author)

  5. Benefit-Risk Assessment, Communication, and Evaluation (BRACE) throughout the life cycle of therapeutic products: overall perspective and role of the pharmacoepidemiologist.

    Science.gov (United States)

    Radawski, Christine; Morrato, Elaine; Hornbuckle, Kenneth; Bahri, Priya; Smith, Meredith; Juhaeri, Juhaeri; Mol, Peter; Levitan, Bennett; Huang, Han-Yao; Coplan, Paul; Li, Hu

    2015-12-01

    Optimizing a therapeutic product's benefit-risk profile is an on-going process throughout the product's life cycle. Different, yet related, benefit-risk assessment strategies and frameworks are being developed by various regulatory agencies, industry groups, and stakeholders. This paper summarizes current best practices and discusses the role of the pharmacoepidemiologist in these activities, taking a life-cycle approach to integrated Benefit-Risk Assessment, Communication, and Evaluation (BRACE). A review of the medical and regulatory literature was performed for the following steps involved in therapeutic benefit-risk optimization: benefit-risk evidence generation; data integration and analysis; decision making; regulatory and policy decision making; benefit-risk communication and risk minimization; and evaluation. Feedback from International Society for Pharmacoepidemiology members was solicited on the role of the pharmacoepidemiologist. The case example of natalizumab is provided to illustrate the cyclic nature of the benefit-risk optimization process. No single, globally adopted benefit-risk assessment process exists. The BRACE heuristic offers a way to clarify research needs and to promote best practices in a cyclic and integrated manner and highlight the critical importance of cross-disciplinary input. Its approach focuses on the integration of BRACE activities for risk minimization and optimization of the benefit-risk profile. The activities defined in the BRACE heuristic contribute to the optimization of the benefit-risk profile of therapeutic products in the clinical world at both the patient and population health level. With interdisciplinary collaboration, pharmacoepidemiologists are well suited for bringing in methodology expertise, relevant research, and public health perspectives into the BRACE process. Copyright © 2015 John Wiley & Sons, Ltd.

  6. Clinical assessment of the efficacy of SpineCor brace in the correction of postural deformities in the course of idiopathic scoliosis.

    Science.gov (United States)

    Plewka, Barbara; Sibiński, Marcin; Synder, Marek; Witoński, Dariusz; Kołodziejczyk-Klimek, Katarzyna; Plewka, Michał

    2013-03-26

    The objective of the study was to perform a clinical, comparative assessment of the degree of postural deformities before and after the treatment of idiopathic scoliosis in patients treated with SpineCor brace compared to the control group. A group of 90 children with idiopathic scoliosis (including 74 girls) at the average age of 12.2 was subject to prospective observation. Average pre-treatment Cobb angle was 24.9° in the thoracic spine and 25.8° in the lumbar spine. The group actively treated with the SpineCor brace consisted of 45 children, while the control group consisted of the remaining 45 children with the natural course of the disease. Both groups did not differ significantly in terms of age, gender, height, body weight, Risser sign of skeletal maturity and baseline clinical and radiological parameters of scoliosis. Significant reduction of rib hump was observed upon 2-year SpineCor brace treatment (P=0.04) compared to the group treated by physiotherapy only (P=0.91). Similarly, improvement in lumbar prominence was observed in the actively treated group (P=0.009), with a trend towards worse results in the control group (P=0.07) In the group treated with the SpineCor brace, significant reduction in pectoral and hamstring muscle contractures as well as reduction in shoulder asymmetry and reduction in anterior and posterior vertical deviation were observed. Treatment using the SpineCor dynamic brace leads to a clinical improvement in posture, particularly to reduction in rib hump, lumbar prominence and muscular contractures.

  7. Evaluating the Ergonomic Benefit of a Wrist Brace on Wrist Posture, Muscle Activity, Rotational Stiffness, and Peak Shovel-Ground Impact Force During a Simulated Tree-Planting Task.

    Science.gov (United States)

    Sheahan, Peter J; Cashaback, Joshua G A; Fischer, Steven L

    2017-09-01

    Background Tree planters are at a high risk for wrist injury due to awkward postures and high wrist loads experienced during each planting cycle, specifically at shovel-ground impact. Wrist joint stiffness provides a measure that integrates postural and loading information. Objective The purpose of this study was to evaluate wrist joint stiffness requirements at the instant of shovel-ground impact during tree planting and determine if a wrist brace could alter muscular contributions to wrist joint stiffness. Method Planters simulated tree planting with and without wearing a brace on their planting arm. Surface electromyography (sEMG) from six forearm muscles and wrist kinematics were collected and used to calculate muscular contributions to joint rotational stiffness about the wrist. Results Wrist joint stiffness increased with brace use, an unanticipated and negative consequence of wearing a brace. As a potential benefit, planters achieved a more neutrally oriented wrist angle about the flexion/extension axis, although a less neutral wrist angle about the ulnar/radial axis was observed. Muscle activity did not change between conditions. Conclusion The joint stiffness analysis, combining kinematic and sEMG information in a biologically relevant manner, revealed clear limitations with the interface between the brace grip and shovel handle that jeopardized the prophylactic benefits of the current brace design. This limitation was not as evident when considering kinematics and sEMG data independently. Application A neuromechanical model (joint rotational stiffness) enhanced our ability to evaluate the brace design relative to kinematic and sEMG parameter-based metrics alone.

  8. Effect of Semi-Rigid and Soft Ankle Braces on Static and Dynamic Postural Stability in Young Male Adults

    Directory of Open Access Journals (Sweden)

    Noriaki Maeda, Yukio Urabe, Shogo Tsutsumi, Shuhei Numano, Miho Morita, Takuya Takeuchi, Shou Iwata, Toshiki Kobayashi

    2016-06-01

    Full Text Available Ankle braces have been suggested to protect ankle joints from a sprain by restricting inversion and improving proprioception. However, the difference in effects between a semi-rigid brace and a soft brace regarding dynamic postural control after landing is not known. The aim of the present study was to compare the effect of soft (SB and semi-rigid (SRB ankle braces on static and dynamic postural stability in healthy young men. Altogether, 21 male adults (mean age 24.0 ± 1.5 years were assessed for one leg while wearing non-brace (NB, SB or SRB. Balance in single-limb stance on a single-force platform with open eyes and closed eyes were assessed for the non-dominant leg under SB, SRB, and NB conditions. Locus length/second (mm/s and the enveloped area (mm·s-2 surrounded by the circumference of the wave pattern during postural sway were calculated. For assessing dynamic postural stability, the participant jumped and landed on one leg on a force platform, and the Dynamic Postural Stability Index (DPSI and the maximum vertical ground reaction force (vGRFmax were measured. The data were compared among the three conditions with repeated-measures analysis of variance. The correlations between locus length/second, enveloped area, DPSI values (DPSI, Anterior-Posterior Stability Index, Medial-Lateral Stability Index, and Vertical Stability Index, and vGRFmax were then calculated. The results indicated that locus length/second and enveloped area with open eyes and closed eyes were not significantly different for each condition. However, a significant lower in the DPSI and Vertical Stability Index were observed with the SRB in comparison to the SB and NB. A significant improvement in vGRFmax was also observed with the SRB in comparison to NB. SRB demonstrated a positive effect on dynamic postural stability after landing on a single leg and may improve balance by increasing dynamic postural stability.

  9. Bracing system of the reflecting sheets making up an insulating pile

    International Nuclear Information System (INIS)

    Carr, R.W.

    1976-01-01

    In order to reduce heat and radiation losses, the body of nuclear reactors and the connected pipe work are encased in reflecting and insulating piles of thin spaced sheets of aluminium or stainless steel. These spaced sheets are then encased in thicker and more solid internal and external shells. The piles and shells are generally shaped to follow the contour of the reactor and connected piping. It is therefore necessary to have available a study bracing system to keep the pile intact during the various handling and assembly operations. The fastening system must also exert an effect on the edge of the pile to prevent the sheets making it up from shifting in relation to each other. The description is given of a fastening system that includes an oblong section to be fitted along the edges of the piles up sheets; bracing substantially perpendicular to the oblong section, to space the sheets of the stack in pairs; and a maintaining system, normally perpendicular to the oblong section, to enable the fastener to be clipped to the edge of the sheets by bending it around the edge of each sheet of the pile [fr

  10. 50 CFR Figure 15 to Part 223 - Weedless TED Brace Bar Description

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Weedless TED Brace Bar Description 15 Figure 15 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 15 Figure 15 to Part 223...

  11. Design, testing and control of a magnetorheological actuator for assistive knee braces

    International Nuclear Information System (INIS)

    Chen, J Z; Liao, W H

    2010-01-01

    This paper is aimed at developing a smart actuator for assistive knee braces to provide assistance to disabled or elderly people with mobility problems. A magnetorheological (MR) actuator is developed to be used in assistive knee braces to provide controllable torque. The MR actuator can work as a brake or a clutch. When active torque is needed, the DC motor works and the MR actuator functions as a clutch to transfer the torque generated by the motor to the leg; when passive torque is desired, the DC motor is turned off and the MR actuator functions as a brake to provide controllable passive torque. The prototype of the developed MR actuator is fabricated and experiments are carried out to investigate the characteristics of the MR actuator. The results show that the MR actuator is able to provide sufficient torque needed for normal human activities. Adaptive control is proposed for controlling the MR actuator. Anti-windup strategy is used to achieve better control performance. Experiments on the MR actuator under control are also performed to study the torque tracking ability of the system

  12. Outcome in adolescent idiopathic scoliosis after brace treatment and surgery assessed by means of the Scoliosis Research Society Instrument 24.

    Science.gov (United States)

    Weigert, Karen Petra; Nygaard, Linda Marie; Christensen, Finn Bjarke; Hansen, Ebbe Stender; Bünger, Cody

    2006-07-01

    A retrospectively designed long-term follow-up study of adolescent idiopathic scoliosis (AIS) patients who had completed treatment, of at least 2 years, by means of brace, surgery, or both brace and surgery. This study is to assess the outcome after treatment for AIS by means of the Scoliosis Research Society Outcome Instrument 24 (SRS 24). One hundred and eighteen AIS patients (99 females and 19 males), treated at the Aarhus University Hospital from January 1, 1987 to December 31, 1997, were investigated with at least 2 years follow-up at the time of receiving a posted self-administered questionnaire. Forty-four patients were treated with Boston brace (B) only, 41 patients had surgery (S), and 33 patients were treated both with brace and surgery (BS). The Cobb angles of the three treatment groups did not differ significantly after completed treatment. The outcome in terms of the total SRS 24 score was not significantly different among the three groups. B patients had a significantly better general (not treatment related) self-image and higher general activity level than the total group of surgically treated patients, while surgically treated patients scored significantly better in post-treatment self-image and satisfaction. Comparing B with BS we found a significantly higher general activity level in B patients, while the BS group had significantly higher satisfaction. There were no significant differences between BS and S patients in any of the domain scores. All treatment groups scored "fair or better" in all domain scores of the SRS 24 questionnaire, except in post-treatment function, where all groups scored worse than "fair". Improvement of appearance by means of surgical correction increases mean scores for post-treatment self-image and post-treatment satisfaction. Double-treatment by brace and surgery does not appear to jeopardize a good final outcome.

  13. Conservative treatment for pediatric lumbar spondylolysis to achieve bone healing using a hard brace: what type and how long?: Clinical article.

    Science.gov (United States)

    Sairyo, Koichi; Sakai, Toshinori; Yasui, Natsuo; Dezawa, Akira

    2012-06-01

    Various kinds of trunk braces have been used to achieve bone healing in cases of pediatric lumbar spondylolysis. However, the optimal brace for achieving bone healing is unclear. The purpose of the present study was to determine in what types of spondylolysis bone healing can be achieved and how long it takes. In this prospective study, 63 pars interarticularis defects (spondylolysis) among 37 patients who were younger than 18 years (mean 13.5 ± 2.7 years) were treated using a hard brace. The youngest patient was 8 years old. Based on the results of CT scanning, the lyses were classified into 3 categories: early, progressive, and terminal defects. Progressive defects were further divided into 2 types according to STIR MRI findings: those with high signal intensity at the adjacent pedicle and those with low signal intensity (that is, a normal appearance). A hard brace, such as a molded plastic thoracolumbosacral orthosis, was used to immobilize the trunk. Approximately every 3 months, CT scanning was performed to evaluate bone healing until approximately 6 months. The union rates were 94%, 64%, 27%, and 0% for the early, progressive with high signal intensity, progressive with low signal intensity, and terminal defects, respectively. It was noted that no terminal defect was healed using conservative treatment. The mean time to healing among the defects that showed bone healing was 3.2, 5.4, and 5.7 months for the early, progressive with high signal intensity, and progressive with low signal intensity groups, respectively. Patients with early-stage defects are the best candidates for conservative treatment with a hard brace because more than 90% of such cases can be healed in 3 months.

  14. Effect of kinesiotaping, non-elastic taping and bracing on segmental foot kinematics during drop landing in healthy subjects and subjects with chronic ankle instability.

    Science.gov (United States)

    Kuni, B; Mussler, J; Kalkum, E; Schmitt, H; Wolf, S I

    2016-09-01

    To evaluate the effects of kinesiotape, non-elastic tape, and soft brace on segmental foot kinematics during drop landing in subjects with chronic ankle instability and healthy subjects. Controlled study with repeated measurements. Three-dimensional motion analysis laboratory. Twenty participants with chronic ankle instability and 20 healthy subjects. The subjects performed drop landings with 17 retroreflective markers on the foot and lower leg in four conditions: barefoot, with kinesiotape, with non-elastic tape and with a soft brace. Ranges of motion of foot segments using a foot measurement method. In participants with chronic ankle instability, midfoot movement in the frontal plane (inclination of the medial arch) was reduced significantly by non-elastic taping, but kinesiotaping and bracing had no effect. In healthy subjects, both non-elastic taping and bracing reduced that movement. In both groups, non-elastic taping and bracing reduced rearfoot excursion in inversion/eversion significantly, which indicates a stabilisation effect. No such effect was found with kinesiotaping. All three methods reduced maximum plantar flexion significantly. Non-elastic taping stabilised the midfoot best in patients with chronic ankle instability, while kinesiotaping did not influence foot kinematics other than to stabilise the rearfoot in the sagittal plane. ClinicalTrials.gov NCT01810471. Copyright © 2015 Chartered Society of Physiotherapy. Published by Elsevier Ltd. All rights reserved.

  15. Outcome in adolescent idiopathic scoliosis after brace treatment and surgery assessed by means of the Scoliosis Research Society Instrument 24

    OpenAIRE

    Weigert, Karen Petra; Nygaard, Linda Marie; Christensen, Finn Bjarke; Hansen, Ebbe Stender; Bünger, Cody

    2005-01-01

    A retrospectively designed long-term follow-up study of adolescent idiopathic scoliosis (AIS) patients who had completed treatment, of at least 2 years, by means of brace, surgery, or both brace and surgery. This study is to assess the outcome after treatment for AIS by means of the Scoliosis Research Society Outcome Instrument 24 (SRS 24). One hundred and eighteen AIS patients (99 females and 19 males), treated at the Aarhus University Hospital from January 1, 1987 to December 31, 1997, were...

  16. Use of a shoulder abduction brace after arthroscopic rotator cuff repair: A study on gait performance and falls.

    Science.gov (United States)

    Sonoda, Yuma; Nishioka, Takashi; Nakajima, Ryo; Imai, Shinji; Vigers, Piers; Kawasaki, Taku

    2018-04-01

    Fall prevention is essential in patients after arthroscopic rotator cuff repair because of the high risk of re-rupture. However, there are no reports related to falls that occur during the early postoperative period, while the affected limb is immobilized. This study assessed gait performance and falls in patients using a shoulder abduction brace after arthroscopic rotator cuff repair. Prospective cohort and postoperative repeated measures. This study included 29 patients (mean age, 67.1 ± 7.4 years) who underwent arthroscopic rotator cuff repair followed by rehabilitation. The timed up and go test, Geriatric Depression Scale, and Falls Efficacy Scale were measured, and the numbers of falls were compared between those shoulder abduction brace users and patients who had undergone total hip or knee arthroplasty. In arthroscopic rotator cuff repair patients, there were significant improvements in timed up and go test and Geriatric Depression Scale, but no significant differences in Falls Efficacy Scale, between the second and fifth postoperative weeks ( p rotator cuff repair patients fell more often than patients with total hip arthroplasty or total knee arthroplasty during the same period. The findings suggest that rehabilitation in arthroscopic rotator cuff repair patients is beneficial, but decreased gait performance due to the immobilizing shoulder abduction brace can lead to falls. Clinical relevance Although rehabilitation helps motor function and mental health after arthroscopic rotator cuff repair, shoulder abduction brace use is associated with impaired gait performance, high Falls Efficacy Scale scores, and risk of falls, so awareness of risk factors including medications and lower limb dysfunctions is especially important after arthroscopic rotator cuff repair.

  17. Design Optimization of Long-Span Cold-Formed Steel Portal Frames Accounting for Effect of Knee Brace Joint Configuration

    Directory of Open Access Journals (Sweden)

    Thanh Duoc Phan

    2017-12-01

    Full Text Available The application of cold-formed steel channel sections for portal frames becomes more popular for industrial and residential purposes. Experimental tests showed that such structures with long-span up to 20 m can be achieved when knee brace joints are included. In this paper, the influence of knee brace configuration on the optimum design of long-span cold-formed steel portal frames is investigated. The cold-formed steel portal frames are designed using Eurocode 3 under ultimate limit states. A novel method in handling design constraints integrated with genetic algorithm is proposed for searching the optimum design of cold-formed steel portal frames. The result showed that the proposed routine for design optimization effectively searched the near global optimum solution with the computational time is approximate 50% faster than methods being popularly used in literature. The optimum configuration for knee brace joint can reduce the section size of rafter and so the lighter frame could be obtained especially for long-span portal frame. The minimum weight of main frame obtained from optimization process is approximate 19.72% lighter than a Benchmark Frame used in the full-scale experimental test.

  18. NaPdPS{sub 4} and RbPdPS{sub 4}: systems with infinite straight ((1)/({infinity}))[PdPS{sub 4}]{sup -} chains soluble in polar solvents and the structure of cubic RbPdPS{sub 4}{l_brace}Rb{sub 0.33}P{sub 0.4}S{sub 2.23}O{sub x}{r_brace}

    Energy Technology Data Exchange (ETDEWEB)

    Coste, Servane; Hanko, Jason; Bujoli-Doeuff, Martine; Louarn, Guy; Evain, Michel; Brec, Raymond; Alonso, Bruno; Jobic, S; Kanatzidis, Mercouri G

    2003-11-01

    The synthesis, crystal structures, chemical and spectroscopic properties of NaPdPS{sub 4}, RbPdPS{sub 4}, and RbPdPS{sub 4}{l_brace}Rb{sub 0.33}P{sub 0.4}S{sub 2.23}O{sub x}{r_brace} are described. NaPdPS{sub 4}, RbPdPS{sub 4}, are isostructural and crystallize in the tetragonal system I4/mcm with cell parameters a=7.3074(8) A, c=12.2308(14) A and a=8.2954(3) A, c=12.2284(4) A respectively. RbPdPS{sub 4}{l_brace}Rb{sub 0.33}P{sub 0.4}S{sub 2.23}O{sub x}{r_brace} is cubic, space group Pm-3n and a=12.0042(2) A. All compounds contain the same ((1)/({infinity}))[PdPS{sub 4}]{sup -} chains made of alternating square planar Pd{sup 2+} cations and tetrahedral [PS{sub 4}]{sup 3-} anions. RbPdPS{sub 4}{l_brace}Rb{sub 0.33}P{sub 0.4}S{sub 2.23}O{sub x}{r_brace} contains co-crystallized highly disordered molecular species encapsulated within [Rb{sub 8}] cubic cavities. Spectroscopic solid state {sup 31}P NMR, infrared and Raman data as well as elemental analysis suggest that these species could be S{sub n}{sup 2-} (n=3 or 4) anions and possibly cationic [P{sub 4}S{sub 6}O]{sup 6+} fragments. NaPdPS{sub 4} and RbPdPS{sub 4} exhibit exfoliative dissolution in polar solvents giving rise to solutions that show signs of complex fluid behavior.

  19. SUPER-CAPACITOR APPLICATION IN ELECTRICAL POWER CABLE TESTING FACILITIES IN THERMAL ENDURANCE AND MECHANICAL BRACING TESTS

    Directory of Open Access Journals (Sweden)

    I. V. Oleksyuk

    2015-01-01

    Full Text Available The current-carrying cores of the electrical power cables should be resistant to effects of short-circuit currents whose values depend on the material of the core, its cross-sectional area, cable insulation properties, environment temperature, and the duration of the short-circuit current flow (1 and 3–4 sec. when tested for thermal endurance and mechanical bracing. The facilities for testing the 10 kV aluminum core cables with short-circuit current shall provide mechanical-bracing current 56,82 kA and thermal endurance current 11,16 kA. Although capacitors provide such values of the testing currents to the best advantage, utilizing conventional capacitor-units will involve large expenditures for erecting and  running a separate building. It is expedient to apply super-capacitors qua the electric power supply for testing facilities, as they are capacitors with double-electrical layer and involve the current values of tens of kilo-amperes.The insulation voltage during short-circuit current testing being not-standardized, it is not banned to apply voltages less than 10 kV when performing short-circuit thermal endurance and mechanical bracing tests for electrical power cables of 10 kV. The super-capacitor voltage variation-in-time graph consists of two regions: capacitive and resistive. The capacitive part corresponds to the voltage change consequent on the energy change in the super-capacitors. The resistive part shows the voltage variation due to the active resistance presence in the super-capacitor.The author offers the algorithm determining the number of super capacitors requisite for testing 10 kV-electrical power cables with short-circuit currents for thermal endurance and mechanical bracing. The paper shows that installation of super-capacitors in the facilities testing the cables with short-circuit currents reduces the area needed for the super-capacitors in comparison with conventional capacitors more than by one order of magnitude.

  20. Synthesis, crystal structure and characterization of a 1D polyoxometalate-based compound: {l_brace}[Pr(H{sub 2}O){sub 7}][CrMo{sub 6}H{sub 6}O{sub 24}]{r_brace} . 4H{sub 2}O

    Energy Technology Data Exchange (ETDEWEB)

    Zhao Lijie; Shen Shuchang; Yu Haiming [Qiqihar Univ., HL (China). Dept. of Chemistry and Chemical Engineering

    2008-07-15

    A novel polyoxometalated-based compound, {l_brace}[Pr(H{sub 2}O){sub 7}][CrMo{sub 6}H{sub 6}O{sub 24}]{r_brace} . 4H{sub 2}O, was prepared and characterized by elemental analysis, infrared and ultraviolet spectroscopy, TG measurement and single crystal X-ray diffraction. A chain-like coordination polymer is formed from a heteropolyanion [CrMo{sub 6}H{sub 6}O{sub 24}]{sup 3} as a building unit and [Pr(H{sub 2}O){sub 7}]{sup 3+} cations as linker. The chains are linked into an extensive three-dimensional supramolecular network through hydrogen bonding. The synthesis of 1 is accomplished only from pre-synthesized Anderson clusters, but not from simple starting materials. (orig.)

  1. A new brace treatment similar for adolescent scoliosis and kyphosis based on restoration of thoracolumbar lordosis. Radiological and subjective clinical results after at least one year of treatment

    Directory of Open Access Journals (Sweden)

    van Loon Piet JM

    2012-10-01

    Full Text Available Abstract Study design A prospective treatment study with a new brace was conducted Objective. To evaluate radiological and subjective clinical results after one year conservative brace treatment with pressure onto lordosis at the thoracolumbar joint in children with scoliosis and kyphosis. Summary of background data Conservative brace treatment of adolescent scoliosis is not proven to be effective in terms of lasting correction. Conservative treatment in kyphotic deformities may lead to satisfactory correction. None of the brace or casting techniques is based on sagittal forces only applied at the thoracolumbar spine (TLI= thoracolumbar lordotic intervention. Previously we showed in patients with scoliosis after forced lordosis at the thoracolumbar spine a radiological instantaneous reduction in both coronal curves of double major scoliosis. Methods A consecutive series of 91 children with adolescent scoliosis and kyphosis were treated with a modified symmetric 30 degrees Boston brace to ensure only forced lordosis at the thoracolumbar spine. Scoliosis was defined with a Cobb angle of at least one of the curves [greater than or equal to] 25 degrees and kyphosis with or without a curve Results Before treatment start ‘in brace’ radiographs showed a strong reduction of the Cobb angles in different curves in kyphosis and scoliosis groups (sagittal n = 5 all p Conclusion Conservative treatment using thoracolumbar lordotic intervention in scoliotic and kyphotic deformities in adolescence demonstrates a marked improvement after one year also in clinical and postural criteria. An effect not obtained with current brace techniques.

  2. Long-term effects of conservative treatment of Milwaukee brace on body image and mental health of patients with idiopathic scoliosis.

    Science.gov (United States)

    Misterska, Ewa; Głowacki, Jakub; Głowacki, Maciej; Okręt, Adam

    2018-01-01

    We aimed to provide a complex assessment of adult females with adolescent idiopathic scoliosis (AIS) after a minimum of 23 years after completed Milwaukee brace treatment. In the present study, a comparison between healthy female and AIS patients' perception of trunk disfigurement, self-image, mental health, pain level and everyday activity was made. Thirty AIS patients with a mean of 27.77 yrs (SD 3.30) after the treatment were included in the study. The control group consisted of 42 females, matching the age profile of the patient group. Study participants from both groups were examined using the same protocol, except for the radiological evaluation. Patients and healthy controls completed the Polish versions of the Scoliosis Research Society (SRS-22) and Spinal Appearance Questionnaire (SAQ). Patients additionally filled the Bad Sobberheim Stress Questionnaire-Deformity (BSSQ-Deformity) and Bad Sobberheim Stress Questionnaire-Brace (BSSQ-Brace). The study group's SAQ results differ significantly in regard to the total score and all individual domains, indicating better functioning among healthy controls. Except for the General domain (p = 0.002), among the remaining subscales the study group's results differed significantly at p<0.001. Considering SRS-22 results, it was revealed that the patient group scored higher, signaling better functioning with reference to pain level (p = 0.016), function/activity (p<0.001) and the total score (p<0.001). The findings add to the complexity of long-term effect evaluations of AIS, particularly amongst females treated with a Milwaukee brace. Long-term results were not conclusive in terms of nonverbal assessment of body image and emotional tension regarding the experiences of brace-wearing. Future patients can be reassured that scoliosis treated conservatively does not negatively affect everyday activity, pain level, childbearing and mental health. Subjects who declared to have psychological problems due to scoliosis had a

  3. Long-term effects of conservative treatment of Milwaukee brace on body image and mental health of patients with idiopathic scoliosis.

    Directory of Open Access Journals (Sweden)

    Ewa Misterska

    Full Text Available We aimed to provide a complex assessment of adult females with adolescent idiopathic scoliosis (AIS after a minimum of 23 years after completed Milwaukee brace treatment. In the present study, a comparison between healthy female and AIS patients' perception of trunk disfigurement, self-image, mental health, pain level and everyday activity was made. Thirty AIS patients with a mean of 27.77 yrs (SD 3.30 after the treatment were included in the study. The control group consisted of 42 females, matching the age profile of the patient group. Study participants from both groups were examined using the same protocol, except for the radiological evaluation. Patients and healthy controls completed the Polish versions of the Scoliosis Research Society (SRS-22 and Spinal Appearance Questionnaire (SAQ. Patients additionally filled the Bad Sobberheim Stress Questionnaire-Deformity (BSSQ-Deformity and Bad Sobberheim Stress Questionnaire-Brace (BSSQ-Brace. The study group's SAQ results differ significantly in regard to the total score and all individual domains, indicating better functioning among healthy controls. Except for the General domain (p = 0.002, among the remaining subscales the study group's results differed significantly at p<0.001. Considering SRS-22 results, it was revealed that the patient group scored higher, signaling better functioning with reference to pain level (p = 0.016, function/activity (p<0.001 and the total score (p<0.001. The findings add to the complexity of long-term effect evaluations of AIS, particularly amongst females treated with a Milwaukee brace. Long-term results were not conclusive in terms of nonverbal assessment of body image and emotional tension regarding the experiences of brace-wearing. Future patients can be reassured that scoliosis treated conservatively does not negatively affect everyday activity, pain level, childbearing and mental health. Subjects who declared to have psychological problems due to scoliosis

  4. Influence of the Soil-Structure Interaction on the Design of Steel-Braced Building Foundation

    International Nuclear Information System (INIS)

    Azarbakht, Alireza; Ashtiany, Mohsen Ghafory

    2008-01-01

    The modeling and analysis of the superstructure and the foundation for the seismic lateral loads are traditionally done separately. This assumption is an important issue in the design/rehabilitate procedures especially for the short period structures, i.e. steel braced or shear wall systems, which may result to a conservative design. By using more advance procedures, i.e. nonlinear static method, and the incorporation of the soil-structure interaction (SSI), the seismic demand in the lateral resisting system decreases and the design will become more economic. This paper includes an investigation about the influence of the SSI effect on the design of the steel-braced building foundation. The presented example is a three-bay three-storey steel braced frame. Three design methods based on the FEMA 356 guideline and the UBC 97 code are taken in to consideration. The three methods are: (1) linear static analysis based on the UBC 97 code assuming the fixed based condition; (2) linear static analysis based on the FEMA 356 guideline assuming the fixed based condition; and (3) nonlinear static analysis assuming both fixed and flexible based assumptions. The results show that the influence of the SSI on the input demand of the short period building foundations is significant and the foundation design based on the linear static method with the fixed base assumption is so conservative. A simple method is proposed to take the SSI effect in to consideration in the linear static procedure with the fixed base assumption, which is a common method for the engineers. The advantage of this proposed method is the simplicity and the applicability for the engineering purposes

  5. A radial holding device for the bundle and brace plates envelope in a vapor generator, by the means of enclosed screw stops

    International Nuclear Information System (INIS)

    Comic, G.

    1995-01-01

    With the aim to protect the envelopes and bundles against seisms or other constraints, without causing interference with the water flow or being too complicated to install, as with previous systems, a holding system is proposed which uses screw stops fixed to the envelope and to the brace; the screw, enclosed in one of the two parts, ensures, during the assembly, the displacement of the second part for good contact with the brace plate. 6 fig

  6. Expecting ankle tilts and wearing an ankle brace influence joint control in an imitated ankle sprain mechanism during walking.

    Science.gov (United States)

    Gehring, Dominic; Wissler, Sabrina; Lohrer, Heinz; Nauck, Tanja; Gollhofer, Albert

    2014-03-01

    A thorough understanding of the functional aspects of ankle joint control is essential to developing effective injury prevention. It is of special interest to understand how neuromuscular control mechanisms and mechanical constraints stabilize the ankle joint. Therefore, the aim of the present study was to determine how expecting ankle tilts and the application of an ankle brace influence ankle joint control when imitating the ankle sprain mechanism during walking. Ankle kinematics and muscle activity were assessed in 17 healthy men. During gait rapid perturbations were applied using a trapdoor (tilting with 24° inversion and 15° plantarflexion). The subjects either knew that a perturbation would definitely occur (expected tilts) or there was only the possibility that a perturbation would occur (potential tilts). Both conditions were conducted with and without a semi-rigid ankle brace. Expecting perturbations led to an increased ankle eversion at foot contact, which was mediated by an altered muscle preactivation pattern. Moreover, the maximal inversion angle (-7%) and velocity (-4%), as well as the reactive muscle response were significantly reduced when the perturbation was expected. While wearing an ankle brace did not influence muscle preactivation nor the ankle kinematics before ground contact, it significantly reduced the maximal ankle inversion angle (-14%) and velocity (-11%) as well as reactive neuromuscular responses. The present findings reveal that expecting ankle inversion modifies neuromuscular joint control prior to landing. Although such motor control strategies are weaker in their magnitude compared with braces, they seem to assist ankle joint stabilization in a close-to-injury situation. Copyright © 2013 Elsevier B.V. All rights reserved.

  7. An investigation on the effect of gusset plate connection rigidity on the seismic behavior of special concentrically braced frames

    Directory of Open Access Journals (Sweden)

    Ali Esnaashari

    2016-12-01

    Full Text Available Special concentrically braced frames (SCBFs are commonly used to resist lateral loads in buildings. The bracing system sustains large deformations due to inelastic behavior in bracing members (buckling and yielding in tension. Generally, in the conventional modeling strategy, the effect of gusset plates in providing beam-column connections rigidity and hence, improving the post-buckling performance of these frames is not taken into account. This paper deals with the effect of gusset plate rigidity on the seismic behavior of SCBFs using Roeder’s proposed model in the literature. In this paper, four 3, 6, 9 and 12-story SCBFs were designed and modeled using two distinct methods: conventional method with hinged connections and Roeder’s method with semi-rigid connections. Then, the models behavior was investigated with both pushover analysis and nonlinear time-history analysis using OpenSees software. The results showed that lateral load capacity of the frames modeled with the Roeder’s proposed model are about 10% larger than the conventional method’s capacity. Also, it was found that the semi-rigid model leads to a less drift ratios and more overstrength factors.

  8. The effect of knee brace and knee sleeve on the proprioception of the knee in young non-professional healthy sportsmen.

    Science.gov (United States)

    Bottoni, G; Herten, A; Kofler, P; Hasler, M; Nachbauer, W

    2013-12-01

    Proprioception has been defined as the capacity to feel the position of a joint in space as sensed by the central nervous system. Prophylactic knee braces are supposed to help in knee injury prevention not just with a mechanical support of the joint but also improving proprioception. The main aim of this study was to determine the effects of a knee brace and a knee sleeve on knee proprioception. The secondary aim was to determine if different starting angles of the knee and different movement directions influence knee proprioception. We tested a group of twenty healthy male sport students without knee injuries. They were tested with the brace, with the sleeve and without support. The threshold of detection of passive knee movement with a starting knee angle of 30° and 60°, both in flexion and extension was determined. We did not find any statistically significant change in the threshold of detection of passive knee movement wearing the brace or the sleeve compared to the unsupported condition (p=0.462, α=0.05). We found a significantly lower proprioceptive sensitivity starting at the more flexed knee angle (p=0.005, α=0.05) and moving in extension than in the other test situations (p=0.001, α=0.05). Movement direction and starting position appear to influence the threshold of detection of passive knee movement. The results of this study also suggest that knee supports do not influence either positively or negatively knee proprioception of uninjured active subjects. Copyright © 2013 Elsevier B.V. All rights reserved.

  9. The classical and a modified Boston brace: description and results.

    Science.gov (United States)

    Grivas, Theodoros B; Kaspiris, Angelos

    2011-01-01

    Idiopathic scoliosis (IS) is characterized by the lateral deviation of the spine and constitutes a three-dimensional distortion that leads to geometric and morphological lesions in the spine and thoracic cage. The most widespread method of conservative management is to use spinal orthoses or body braces. These are usually recommended in patients with skeletal immaturity with a Risser sign 2 or less and with curves ranging from 25° to 45°. Of these, perhaps one of the most popular in recent years is the Boston Brace. It was developed in the early 1970s, and its design is based on symmetry, consisting of extensions and pads, with each of them exerting corrective forces and has a specific role depending on the type of scoliosis. It is important that the treatment group, the patient, and the family environment should work as a team consistently and be well trained to achieve the best result. Various studies published in international literature have observed beneficial effects from the use of the Boston system. Nevertheless, there are still issues that need further investigation regarding its effectiveness depending on the type of curves, the duration of application, the gender, and BMI of patients to whom it is applied. However, without question, if all these factors are taken into account and with the compliance of the therapy group with the instructions, the main goal can be achieved, which is the stability of the spine, and the ultimate result of clinical-radiological and aesthetic improvement, which is directly linked to the psychological satisfaction of the patient.

  10. Is the effectiveness of patellofemoral bracing modified by patellofemoral alignment and trochlear morphology?

    Science.gov (United States)

    Zhang, Xi; Eyles, Jillian P; Makovey, Joanna; Williams, Matthew J; Hunter, David J

    2017-04-21

    This study was performed to determine if the effectiveness of patellofemoral bracing as a treatment for patellofemoral osteoarthritis is influenced by patellofemoral joint alignment and trochlear morphology. We hypothesized that those with more extreme patellar malalignment would benefit more from bracing. Thirty-eight patients who had received bracing as part of a comprehensive treatment plan for patellofemoral osteoarthritis were selected for this study. Ten measures of patellar alignment were taken from X-rays. These alignment measures were divided into percentile groups (tertiles) for contingency table analysis. Treatment outcome was measured by Western Ontario and Macmasters Universities Osteoarthritis Index (WOMAC) scores and these were dichotomised into two groups according to "Improved" or "Not Improved" according to the minimum clinically important difference (MCID). Spearman's rho test was performed for continuous variables and Fisher's exact test was performed for correlation between tertile groups and MCID categories. Thirty-eight patients (9 male and 29 female) between the ages of 51 to 89 were included in this study. WOMAC scores ranged from -25 to 41.67, with a mean change of -3.97, 31.6, 44.7 and 31.6% of patients falling into the "Improved" group for Global, Pain and Function scores respectively. We found a non-significant trend shown (p = 0.058, correlation coefficient 0.31) between bisect offset and change in WOMAC global, indicating a trend for higher change in WOMAC scores with increasing bisect offset. Statistically significant correlations were found between mean MCID categories for the WOMAC global and function groups when analysed against percentile groups for bisect offset (p < 0.01) and patellar subluxation distance (p < 0.05), indicating those in higher percentile groups were more likely not to improve after six months. Higher bisect offset and patellar subluxation distance measures were associated with poorer outcomes

  11. Combining valgus knee brace and lateral foot wedges reduces external forces and moments in osteoarthritis patients

    NARCIS (Netherlands)

    Jafarnezhadgero, Amir Ali; Oliveira, Anderson S.; Mousavi, Seyed Hamed; Madadi-Shad, Morteza

    Osteoarthritis progression can be related to the external knee adduction and flexion moments during walking. Lateral foot wedges and knee braces have been used as treatment for osteoarthritis, but little is known about their influence on knee joint moments generated in the sagittal and frontal

  12. Aging effect in CaLaBa{l_brace}Cu{sub 1 - x}Fe{sub x}{r_brace}{sub 3}O{sub 7 - {delta}} with 0 {<=} x {<=} 0.07 studied by Moessbauer spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Bustamante, Angel, E-mail: angelbd1@gmail.com [Universidad Nacional Mayor de San Marcos, Laboratorio de Ceramicos y Nanomateriales, Facultad de Ciencias Fisicas (Peru); Santos Valladares, Luis De Los, E-mail: ld301@cam.ac.uk [University of Cambridge, Cavendish Laboratory (United Kingdom); Flores, Jesus [Universidad Nacional Mayor de San Marcos, Laboratorio de Ceramicos y Nanomateriales, Facultad de Ciencias Fisicas (Peru); Barnes, Crispin H. W. [University of Cambridge, Cavendish Laboratory (United Kingdom); Majima, Yutaka [Tokyo Institute of Technology, Materials and Structures Laboratory (Japan)

    2011-11-15

    In this work, we study the long-term aging effect caused by Fe atoms in the superconductor CaLaBa{l_brace}Cu{sub 1 - x}Fe{sub x}{r_brace}{sub 3}O{sub 7 - {delta}} with 0 {<=} x {<=} 0.07. XRD confirms that this system has a YBCO-like structure. The critical temperature (T{sub c}) is strongly affected by aging and depends on the amount of Fe in the structure. Room temperature Moessbauer spectroscopy reveals the presence of the typical species A, B-B Prime , C and new species E Prime and F. Interestingly; A, which corresponds to the Fe{sup 3 + } atom located in the Cu(1) of the chains with spin S{sub z} = 3/2, shows a drastic reduction which means migration to the species B, B Prime and C. Species B and B Prime correspond to the Fe{sup 3 + } in the Cu(2) site forming planar quasi-octahedral and planar square pyramidal, while the C specie is a square pyramidal with O(5) respectively (spin S{sub z} = 3/2 in all these cases). Aging causes loss of superconductivity in the samples with 5 and 7% of iron content.

  13. Reliability assessment of serviceability performance of braced retaining walls using a neural network approach

    Science.gov (United States)

    Goh, A. T. C.; Kulhawy, F. H.

    2005-05-01

    In urban environments, one major concern with deep excavations in soft clay is the potentially large ground deformations in and around the excavation. Excessive movements can damage adjacent buildings and utilities. There are many uncertainties associated with the calculation of the ultimate or serviceability performance of a braced excavation system. These include the variabilities of the loadings, geotechnical soil properties, and engineering and geometrical properties of the wall. A risk-based approach to serviceability performance failure is necessary to incorporate systematically the uncertainties associated with the various design parameters. This paper demonstrates the use of an integrated neural network-reliability method to assess the risk of serviceability failure through the calculation of the reliability index. By first performing a series of parametric studies using the finite element method and then approximating the non-linear limit state surface (the boundary separating the safe and failure domains) through a neural network model, the reliability index can be determined with the aid of a spreadsheet. Two illustrative examples are presented to show how the serviceability performance for braced excavation problems can be assessed using the reliability index.

  14. Ankles back in randomized controlled trial (ABrCt): braces versus neuromuscular exercises for the secondary prevention of ankle sprains. Design of a randomised controlled trial.

    Science.gov (United States)

    Janssen, Kasper W; van Mechelen, Willem; Verhagen, Evert Alm

    2011-09-27

    Ankle sprains are the most common sports and physical activity related injury. There is extensive evidence that there is a twofold increased risk for injury recurrence for at least one year post injury. In up to 50% of all cases recurrences result in disability and lead to chronic pain or instability, requiring prolonged medical care. Therefore ankle sprain recurrence prevention in athletes is essential. This RCT evaluates the effect of the combined use of braces and neuromuscular training (e.g. proprioceptive training/sensorimotor training/balance training) against the individual use of either braces or neuromuscular training alone on ankle sprain recurrences, when applied to individual athletes after usual care. This study was designed as three way randomized controlled trial with one year follow-up. Healthy individuals between 12 and 70 years of age, who were actively participating in sports and who had sustained a lateral ankle sprain in the two months prior to inclusion, were eligible for inclusion. After subjects had finished ankle sprain treatment by means of usual care, they were randomised to any of the three study groups. Subjects in group 1 received an eight week neuromuscular training program, subjects in group 2 received a sports brace to be worn during all sports activities for the duration of one year, and group 3 received a combination of the neuromuscular training program and a sports brace to be worn during all sports activities for the duration of eight weeks. Outcomes were assessed at baseline and every month for 12 months therafter. The primary outcome measure was incidence of ankle sprain recurrences. Secondary outcome measures included the direct and indirect costs of recurrent injury, the severity of recurrent injury, and the residual complaints during and after the intervention. The ABrCt is the first randomized controlled trial to directly compare the secondary preventive effect of the combined use of braces and neuromuscular training

  15. Improving the seismic performance of eccentrically braced frames by using a ductile element

    OpenAIRE

    Morteza Naghipour; Seyed Reza Salim Bahrami

    2017-01-01

    Stability of structures against earthquake is much important to prevent total or partial failure of structures and loss of financial and human investments of people and country. Eccentrically braced frames, as one of the most commonly used earthquake resistant systems, with good ductility and toughness, have different arrangements; one of them is Link beam-to-column connection. This type of connection was considered as bending form before the North Ridge earthquake (1994). But conducted resea...

  16. Strength and Functional Improvement Using Pneumatic Brace with Extension Assist for End-Stage Knee Osteoarthritis: A Prospective, Randomized trial.

    Science.gov (United States)

    Cherian, Jeffrey J; Bhave, Anil; Kapadia, Bhaveen H; Starr, Roland; McElroy, Mark J; Mont, Michael A

    2015-05-01

    Pneumatic unloader bracing with extension assists have been proposed as a non-operative modality that may delay the need for knee surgery by reducing pain and improving function. This prospective, randomized trial evaluated 52 patients who had knee osteoarthritis for changes in: (1) muscle strength; (2) objective functional improvements; (3); subjective functional improvements; (4) pain; (5) quality of life; and (6) conversion to total knee arthroplasty (TKA) compared to standard of care. Patient outcomes were evaluated at a minimum 3 months. Braced patient's demonstrated significant improvements in muscle strength, several functional tests, and patient reported outcomes when compared to the matched cohort. These results are encouraging and suggest that this device may represent a promising alternative to standard treatment methods for knee osteoarthritis. Copyright © 2014 Elsevier Inc. All rights reserved.

  17. The effect of taping versus semi-rigid bracing on patient outcome and satisfaction in ankle sprains: a prospective, randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Lardenoye Sacha

    2012-05-01

    Full Text Available Abstract Background Functional treatment is a widely used and generally accepted treatment for ankle sprain. A meta-analysis comparing the different functional treatment options could not make definitive conclusions regarding the effectiveness, and until now, little was known about patient satisfaction in relation to the outcome. Methods Patients with acute ankle sprain received rest, ice, compression and elevation with an compressive bandage at the emergency department. After 5-7 days, 100 patients with grade II and III sprains were randomized into two groups: one group was treated with tape and the other with a semi-rigid ankle brace, both for 4 weeks. Post-injury physical and proprioceptive training was standardized. As primary outcome parameter patient satisfaction and skin complications were evaluated using a predefined questionnaire and numeric rating scale. As secondary outcome parameter the ankle joint function was assessed using the Karlsson scoring scale and range of motion. Results Patient-reported comfort and satisfaction during treatment with a semi-rigid brace was significantly increased. The rate of skin complication in this group was significantly lower compared to the tape group (14.6% versus 59.1%, P  Conclusion Treatment of acute ankle sprain with semi-rigid brace leads to significantly higher patient comfort and satisfaction, both with similar good outcome.

  18. Treatment of thoraco-lumbar curves in adolescent females affected by idiopathic scoliosis with a progressive action short brace (PASB: assessment of results according to the SRS committee on bracing and nonoperative management standardization criteria

    Directory of Open Access Journals (Sweden)

    Perisano Carlo

    2009-09-01

    Full Text Available Abstract Background The effectiveness of conservative treatment of scoliosis is controversial. Some studies suggest that brace is effective in stopping curve progression, whilst others did not report such an effect. The purpose of the present study was to effectiveness of Progressive Action Short Brace (PASB in the correction of thoraco-lumbar curves, in agreement with the Scoliosis Research Society (SRS Committee on Bracing and Nonoperative Management Standardisation Criteria. Methods Fifty adolescent females (mean age 11.8 ± 0.5 years with thoraco-lumbar curve and a pre-treatment Risser score ranging from 0 to 2 have been enrolled. The minimum duration of follow-up was 24 months (mean: 55.4 ± 44.5 months. Antero-posterior radiographs were used to estimate the curve magnitude (CM and the torsion of the apical vertebra (TA at 5 time points: beginning of treatment (t1, one year after the beginning of treatment (t2, intermediate time between t1 and t4 (t3, end of weaning (t4, 2-year minimum follow-up from t4 (t5. Three situations were distinguished: curve correction, curve stabilisation and curve progression. The Kruskal Wallis and Spearman Rank Correlation tests have been used as statistical tests. Results CM mean value was 29,30 ± 5,16 SD at t1 and 14,67 ± 7,65 SD at t5. TA was 12.70 ± 6,14 SD at t1 and 8,95 ± 5,82 at t5. The variation between measures of Cobb and Perdriolle degrees at t1,2,3,4,5 and between CM t5-t1 and TA t5-t1 were significantly different. Curve correction was accomplished in 94% of patients, whereas a curve stabilisation was obtained in 6% of patients. Conclusion The PASB, due to its peculiar biomechanical action on vertebral modelling, is highly effective in correcting thoraco-lumbar curves.

  19. Performance Based Plastic Design of Concentrically Braced Frame attuned with Indian Standard code and its Seismic Performance Evaluation

    Directory of Open Access Journals (Sweden)

    Sejal Purvang Dalal

    2015-12-01

    Full Text Available In the Performance Based Plastic design method, the failure is predetermined; making it famous throughout the world. But due to lack of proper guidelines and simple stepwise methodology, it is not quite popular in India. In this paper, stepwise design procedure of Performance Based Plastic Design of Concentrically Braced frame attuned with the Indian Standard code has been presented. The comparative seismic performance evaluation of a six storey concentrically braced frame designed using the displacement based Performance Based Plastic Design (PBPD method and currently used force based Limit State Design (LSD method has also been carried out by nonlinear static pushover analysis and time history analysis under three different ground motions. Results show that Performance Based Plastic Design method is superior to the current design in terms of displacement and acceleration response. Also total collapse of the frame is prevented in the PBPD frame.

  20. Stride length: the impact on propulsion and bracing ground reaction force in overhand throwing.

    Science.gov (United States)

    Ramsey, Dan K; Crotin, Ryan L

    2018-03-26

    Propulsion and bracing ground reaction force (GRF) in overhand throwing are integral in propagating joint reaction kinetics and ball velocity, yet how stride length effects drive (hind) and stride (lead) leg GRF profiles remain unknown. Using a randomised crossover design, 19 pitchers (15 collegiate and 4 high school) were assigned to throw 2 simulated 80-pitch games at ±25% of their desired stride length. An integrated motion capture system with two force plates and radar gun tracked each throw. Vertical and anterior-posterior GRF was normalised then impulse was derived. Paired t-tests identified whether differences between conditions were significant. Late in single leg support, peak propulsion GRF was statistically greater for the drive leg with increased stride. Stride leg peak vertical GRF in braking occurred before acceleration with longer strides, but near ball release with shorter strides. Greater posterior shear GRF involving both legs demonstrated increased braking with longer strides. Conversely, decreased drive leg propulsion reduced both legs' braking effects with shorter strides. Results suggest an interconnection between normalised stride length and GRF application in propulsion and bracing. This work has shown stride length to be an important kinematic factor affecting the magnitude and timing of external forces acting upon the body.

  1. Isopiestic determination of the osmotic and activity coefficients of the {l_brace}yKCl + (1 - y)K{sub 2}HPO{sub 4}{r_brace}(aq) system at T = 298.15 K

    Energy Technology Data Exchange (ETDEWEB)

    Popovic, Daniela Z. [Faculty of Technology and Metallurgy, University of Belgrade, Karnegijeva 4, 11 001 Belgrade (Serbia); Miladinovic, Jelena, E-mail: duma@tmf.bg.ac.rs [Faculty of Technology and Metallurgy, University of Belgrade, Karnegijeva 4, 11 001 Belgrade (Serbia); Todorovic, Milica D.; Zrilic, Milorad M. [Faculty of Technology and Metallurgy, University of Belgrade, Karnegijeva 4, 11 001 Belgrade (Serbia); Rard, Joseph A., E-mail: solution_chemistry2@comcast.net [4363 Claremont Way, Livermore, CA 94550 (United States)

    2011-12-15

    Highlights: > Isopiestic measurements were made for {l_brace}yKCl + (1 - y)K{sub 2}HPO{sub 4}{r_brace}(aq) at T = 298.15 K. > The resulting osmotic coefficients were represented by three thermodynamic models. > Activity coefficients from Pitzer model with Scatchard mixing terms are recommended. - Abstract: The osmotic coefficients of aqueous mixtures of KCl and K{sub 2}HPO{sub 4} have been measured at T = (298.15 {+-} 0.01) K by the isopiestic vapor pressure method over the range of ionic strengths from (2.3700 to 11.250) mol . kg{sup -1} using CaCl{sub 2}(aq) as the reference solution. Our new experimental results were modeled with an extended form of Pitzer's ion-interaction model equations, both with the usual mixing terms and with Scatchard's neutral-electrolyte mixing terms, and with the Clegg-Pitzer-Brimblecombe equations based on the mole-fraction-composition scale. There is a dearth of previously published isopiestic data for mixtures containing salts of HPO{sub 4}{sup 2-}(aq) and, consequently, no previous measurements are available for comparison with the present results. The present study yields Cl{sup -}HPO{sub 4}{sup 2-} mixing parameters for these three models that are needed for modeling the thermodynamic activities of solute components of natural waters and other complex aqueous electrolyte mixtures.

  2. Ankles back in randomized controlled trial (ABrCt: braces versus neuromuscular exercises for the secondary prevention of ankle sprains. Design of a randomised controlled trial

    Directory of Open Access Journals (Sweden)

    Verhagen Evert ALM

    2011-09-01

    Full Text Available Abstract Background Ankle sprains are the most common sports and physical activity related injury. There is extensive evidence that there is a twofold increased risk for injury recurrence for at least one year post injury. In up to 50% of all cases recurrences result in disability and lead to chronic pain or instability, requiring prolonged medical care. Therefore ankle sprain recurrence prevention in athletes is essential. This RCT evaluates the effect of the combined use of braces and neuromuscular training (e.g. proprioceptive training/sensorimotor training/balance training against the individual use of either braces or neuromuscular training alone on ankle sprain recurrences, when applied to individual athletes after usual care. Methods/Design This study was designed as three way randomized controlled trial with one year follow-up. Healthy individuals between 12 and 70 years of age, who were actively participating in sports and who had sustained a lateral ankle sprain in the two months prior to inclusion, were eligible for inclusion. After subjects had finished ankle sprain treatment by means of usual care, they were randomised to any of the three study groups. Subjects in group 1 received an eight week neuromuscular training program, subjects in group 2 received a sports brace to be worn during all sports activities for the duration of one year, and group 3 received a combination of the neuromuscular training program and a sports brace to be worn during all sports activities for the duration of eight weeks. Outcomes were assessed at baseline and every month for 12 months therafter. The primary outcome measure was incidence of ankle sprain recurrences. Secondary outcome measures included the direct and indirect costs of recurrent injury, the severity of recurrent injury, and the residual complaints during and after the intervention. Discussion The ABrCt is the first randomized controlled trial to directly compare the secondary preventive

  3. Accounting for multiple sources of uncertainty in impact assessments: The example of the BRACE study

    Science.gov (United States)

    O'Neill, B. C.

    2015-12-01

    Assessing climate change impacts often requires the use of multiple scenarios, types of models, and data sources, leading to a large number of potential sources of uncertainty. For example, a single study might require a choice of a forcing scenario, climate model, bias correction and/or downscaling method, societal development scenario, model (typically several) for quantifying elements of societal development such as economic and population growth, biophysical model (such as for crop yields or hydrology), and societal impact model (e.g. economic or health model). Some sources of uncertainty are reduced or eliminated by the framing of the question. For example, it may be useful to ask what an impact outcome would be conditional on a given societal development pathway, forcing scenario, or policy. However many sources of uncertainty remain, and it is rare for all or even most of these sources to be accounted for. I use the example of a recent integrated project on the Benefits of Reduced Anthropogenic Climate changE (BRACE) to explore useful approaches to uncertainty across multiple components of an impact assessment. BRACE comprises 23 papers that assess the differences in impacts between two alternative climate futures: those associated with Representative Concentration Pathways (RCPs) 4.5 and 8.5. It quantifies difference in impacts in terms of extreme events, health, agriculture, tropical cyclones, and sea level rise. Methodologically, it includes climate modeling, statistical analysis, integrated assessment modeling, and sector-specific impact modeling. It employs alternative scenarios of both radiative forcing and societal development, but generally uses a single climate model (CESM), partially accounting for climate uncertainty by drawing heavily on large initial condition ensembles. Strengths and weaknesses of the approach to uncertainty in BRACE are assessed. Options under consideration for improving the approach include the use of perturbed physics

  4. Functional knee brace use effect on peak vertical ground reaction forces during drop jump landing.

    Science.gov (United States)

    Rishiraj, Neetu; Taunton, Jack E; Lloyd-Smith, Robert; Regan, William; Niven, Brian; Woollard, Robert

    2012-12-01

    The aim of the study was to investigate the landing strategies used by non-injured athletes while wearing functional knee braces (FKB, BR condition) during a drop jump task compared with non-injured, non-braced (NBR condition) subjects and also to ascertain whether accommodation to a FKB was possible by non-injured BR subjects. Twenty-three healthy male provincial and national basketball and field hockey athletes (age, 19.4 ± 3.0 years) were tested. Each subject was provided with a custom-fitted FKB. Five NBR testing sessions were performed over 3 days followed by five BR testing sessions also over 3 days, for a total of 17.5 h of testing per condition. Each subject performed eight trials of the drop jump task during each testing session per condition. Single-leg peak vertical ground reaction forces (PVGRF) and the time to PVGRF were recorded for each NBR and BR trail. The BR group mean PVGRF at landing was significantly lower (1,628 ± 405 N, 2.1 ± 0.5 BW versus 1,715 ± 403 N, 2.2 ± 0.5 BW, F (1,22) = 6.83, P = 0.01) compared with NBR subjects, respectively. The group mean time to PVGRF was not statistically longer during the BR condition (F (1,22) = 0.967, P = 0.3). Further, an accommodation trend was noted as percent performance difference decreased with continued FKB use. The significantly lower group mean PVGRF while using a FKB could keep traumatic forces from reaching the ACL until the active neuromuscular restraints are activated to provide protection to the knee joint ligaments. Also, accommodation to FKB is possible after approximately 14.0 h of brace use. The results of this paper will assist clinicians in providing information to their patients regarding a FKB ability to offer protection to an ACL-deficient knee or to address concerns about early muscle fatigue, energy expenditure, heart rate, and decrease in performance level. Prospective study, Level I.

  5. Outcome of intensive outpatient rehabilitation and bracing in an adult patient with Scheuermann’s disease evaluated by radiologic imaging—a case report

    Directory of Open Access Journals (Sweden)

    Hagit Berdishevsky

    2016-10-01

    Full Text Available Abstract Background No studies examine the efficacy of intensive specific physical therapy (PT exercises along with brace for the adult with Scheuermann’s kyphosis (SK. The aim of this study was to examine the effects of intensive PT based on the Barcelona Scoliosis Physical Therapy School (BSPTS and SpinoMed brace on a 76-year-old female with SK. Case Description A 76-year-old female, diagnosed with SK as an adolescent, presented in October 2014 with thoracic hyperkyphosis T1 to T12 Cobb angle of 85° and lumbar hyper lordosis L1 to L5 Cobb angle of 70°. Lumbar scoliosis T12-L5 with 21° Cobb and vertebral rotation 2. Trunk translation in the sagittal plan was 4.5 cm. Intermittent low back pain 6/10 at worst. Quality-of-life score was 3.8 (SRS 22 questionnaire. Method The PT regimen included one-hour Schroth exercise sessions three times per week for 6 months. In addition, a home exercise program (HEP was recommended. Patient also wore a SpinoMed brace for 2 h per day. All tests and measurements were recorded before and after treatment. Results After a six-month treatment period the kyphosis Cobb angle was reduced to 70° and the lordosis Cobb angle improved to 57°. A recent x-ray (October 2015 showed another improvement in the sagittal plane with thoracic kyphosis measuring 64° and lumbar lordosis 55°. Lumbar curvature decreased to 12° and vertebral rotation to 1. The quality-of-life score showed improvement with a score of 4.5 on the SRS 22. Pain score diminished to 2. Trunk deviation improved by 2.2 cm. Conclusion These findings suggest that intensive and specific PT and bracing were successful for the treatment of this adult patient with SK.

  6. A user`s guide to LUGSAN II. A computer program to calculate and archive lug and sway brace loads for aircraft-carried stores

    Energy Technology Data Exchange (ETDEWEB)

    Dunn, W.N. [Sandia National Labs., Albuquerque, NM (United States). Mechanical and Thermal Environments Dept.

    1998-03-01

    LUG and Sway brace ANalysis (LUGSAN) II is an analysis and database computer program that is designed to calculate store lug and sway brace loads for aircraft captive carriage. LUGSAN II combines the rigid body dynamics code, SWAY85, with a Macintosh Hypercard database to function both as an analysis and archival system. This report describes the LUGSAN II application program, which operates on the Macintosh System (Hypercard 2.2 or later) and includes function descriptions, layout examples, and sample sessions. Although this report is primarily a user`s manual, a brief overview of the LUGSAN II computer code is included with suggested resources for programmers.

  7. Peculiarities of component interaction in {l_brace}Gd, Er{r_brace}-V-Sn Ternary systems at 870 K and crystal structure of RV{sub 6}Sn{sub 6} stannides

    Energy Technology Data Exchange (ETDEWEB)

    Romaka, L., E-mail: romakal@franko.lviv.ua [Inorganic Chemistry Department, Ivan Franko Lviv National University, Kyryla and Mefodiya str. 6, 79005 Lviv (Ukraine); Stadnyk, Yu. [Inorganic Chemistry Department, Ivan Franko Lviv National University, Kyryla and Mefodiya str. 6, 79005 Lviv (Ukraine); Romaka, V.V. [Department of Materials Engineering and Applied Physics, Lviv Polytechnic National University, Ustyyanovycha Str. 5, 79013 Lviv (Ukraine); Demchenko, P.; Stadnyshyn, M.; Konyk, M. [Inorganic Chemistry Department, Ivan Franko Lviv National University, Kyryla and Mefodiya str. 6, 79005 Lviv (Ukraine)

    2011-09-08

    Highlights: > {l_brace}Gd, Er{r_brace}-V-Sn ternary systems at 870 K are characterized by formation of stannides with general compositions RV{sub 6}Sn{sub 6}. > Isostructural RV{sub 6}Sn{sub 6} compounds were also found with Y, Dy, Ho, Tm, and Lu. > The crystal structure of RV{sub 6}Sn{sub 6} compounds was determined by powder diffraction method. > Structural analysis showed that RV{sub 6}Sn{sub 6} compounds (R = Gd, Dy-Tm, Lu) are disordered; YV{sub 6}Sn{sub 6} is characterized by structure ordering. - Abstract: The phase equilibria in the Gd-V-Sn and Er-V-Sn ternary systems were studied at 870 K by means of X-ray and metallographic analyses in the whole concentration range. Both Gd-V-Sn and Er-V-Sn systems are characterized by formation of one ternary compound at investigated temperature, with stoichiometry RV{sub 6}Sn{sub 6} (SmMn{sub 6}Sn{sub 6}-type, space group P6/mmm, a = 0.55322(3) nm, c = 0.91949(7) nm for Gd, a = 0.55191(2) nm, c = 0.91869(8) nm for Er). Solubility of the third component in the binary compounds was not observed. Compounds with the SmMn{sub 6}Sn{sub 6}-type were also found with Dy, Ho, Tm, and Lu, while YV{sub 6}Sn{sub 6} compound crystallizes in HfFe{sub 6}Ge{sub 6} structure type. All investigated compounds are the first ternary stannides with rare earth elements and vanadium.

  8. The effect of taping versus semi-rigid bracing on patient outcome and satisfaction in ankle sprains: a prospective, randomized controlled trial.

    Science.gov (United States)

    Lardenoye, Sacha; Theunissen, Ed; Cleffken, Berry; Brink, Peter Rg; de Bie, Rob A; Poeze, Martijn

    2012-05-28

    Functional treatment is a widely used and generally accepted treatment for ankle sprain. A meta-analysis comparing the different functional treatment options could not make definitive conclusions regarding the effectiveness, and until now, little was known about patient satisfaction in relation to the outcome. Patients with acute ankle sprain received rest, ice, compression and elevation with an compressive bandage at the emergency department. After 5-7 days, 100 patients with grade II and III sprains were randomized into two groups: one group was treated with tape and the other with a semi-rigid ankle brace, both for 4 weeks. Post-injury physical and proprioceptive training was standardized. As primary outcome parameter patient satisfaction and skin complications were evaluated using a predefined questionnaire and numeric rating scale. As secondary outcome parameter the ankle joint function was assessed using the Karlsson scoring scale and range of motion. Patient-reported comfort and satisfaction during treatment with a semi-rigid brace was significantly increased. The rate of skin complication in this group was significantly lower compared to the tape group (14.6% versus 59.1%, P ankle joint was similar between the two treatment groups, as well as reported pain. Treatment of acute ankle sprain with semi-rigid brace leads to significantly higher patient comfort and satisfaction, both with similar good outcome.

  9. Improving the seismic performance of eccentrically braced frames by using a ductile element

    Directory of Open Access Journals (Sweden)

    Morteza Naghipour

    2017-11-01

    Full Text Available Stability of structures against earthquake is much important to prevent total or partial failure of structures and loss of financial and human investments of people and country. Eccentrically braced frames, as one of the most commonly used earthquake resistant systems, with good ductility and toughness, have different arrangements; one of them is Link beam-to-column connection. This type of connection was considered as bending form before the North Ridge earthquake (1994. But conducted research after the North Ridge Earthquake showed that the link beam-to-column connections were subjected to brittle failure, similar to connections which were located in Moment frames. So, after the North Ridge Earthquake, researchers began looking for ways to improve these types of connections, which indicates necessity of research in this field more than before. In this study, a new type of Energy absorption was introduced.  This absorption consists of a ring which increases the ductility and energy absorption of earthquake and a box to increase the bearing capacity which is connected to the ring through connection plates. for evaluating the performance of the proposed elements in steel frames with eccentrically braces, under nonlinear time history analysis, the OpenSees software has been used. The obtained Hysteresis curves suggest that introduced element can act as an energy absorbing member and a fuse to Reducing damage to structures with reduced rotation of link-beam, Cutting base and Relative story displacement in addition to providing the necessary ductility.

  10. Effect of Group Exercising and Adjusting the Brace at Shorter Intervals on Cobb Angle and Quality of Life of Patients with Idiopathic Scoliosis

    Directory of Open Access Journals (Sweden)

    Zahra Hedayati

    2016-01-01

    Full Text Available Objective: Bracing along with exercising is the most effective protocol in patients with idiopathic scoliosis which have Cobb angles of 25 to 45 degrees. However, since the psychological aspects of scoliosis treatment may affect the quality of life, and the exact time for adjusting the pads of Milwaukee brace is unknown; Therefore the aim of this study was evaluating the effect of exercising in a group, with adjusting the brace in shorter intervals, in compare to routine protocol, in the treatment of idiopathic scoliosis. Matterials & Methods: Thirty-four patients with idiopathic scoliosis which had Cobb angles of 50 to 15 degrees were included in this study and were divided into experimental and control groups. The patients of two groups participated in an eleven-week treatment program, differ between the two groups. Quality of life scores of both groups were evaluated before and after intervention using SRS-22 questionnaire, as well as scoliosis angles before and after the intervention according to the primary and secondary radiographic X-rays. Results: Statistical analysis was performed using Paired T-Test in each group, and Independent T-Test between the two groups before and after treatment. The severity of scoliosis curvature and satisfaction domain of the experimental group was reduced significantly in compared with the control group, after intervention (P=0.04. Moreover in the case of  the quality of life in patients with Cobb angles less than 30 degrees, compared with patients with Cobb angles greater than 31 degrees, in the domains of self-image, satisfaction, and total score, the difference was significant (P<0.05. Conclusion: Adjusting the brace at shorter intervals along with exercising as a group, during the eleven weeks of treatment, has increased satisfaction and reduced the scoliosis Cobb angles of patients.

  11. Studies on the relationship between Pitzer's equation and medium effect: the system of HCl + H{sub 2}SO{sub 4} in {l_brace}0.06455C{sub 2}H{sub 5}OH + 0.93545H{sub 2}O{r_brace}

    Energy Technology Data Exchange (ETDEWEB)

    Lu Xingmei E-mail: lxmqt@sohu.com; Xu Weiguo; Chang Xiaohong; Lu Dianzhen; Yang Jiazhen

    2004-03-01

    The second ionization constant of sulfuric acid in mixed solvent, K{sub 2}, was determined by e.m.f. of cell without liquid junction: (Pt,H{sub 2}(101.325 kPa) vertical bar HCl(m{sub 1}),H{sub 2}SO{sub 4}(m{sub 2}),{l_brace}ethanol(x=0.06455)+water(x=0.93545){r_brace} vertical bar AgCl-Ag))over the temperatures (278.15 to 318.15) K, where x is mole fraction. Combining Owen's definition of medium effect with Pitzer's equations, the values of combination parameters: ({lambda}{sub nHS}+{lambda}{sub nCl}-{lambda}{sub nS})+(3/2)m{sub n}({mu}{sub nnHS}+{mu}{sub nnC=} l-{mu}{sub nnS}),(1/2)({xi}{sub nHHS}+{xi}{sub nHCl}-{xi}{sub nHS}), that represent the interactions between ions and ethanol were obtained at 298.15 K.

  12. Speeds of sound in {l_brace}(1 - x)CH{sub 4} + xN{sub 2}{r_brace} with x = (0.10001, 0.19999, and 0.5422) at temperatures between 170 K and 400 K and pressures up to 30 MPa

    Energy Technology Data Exchange (ETDEWEB)

    Estela-Uribe, J.F. [Facultad de Ingenieria, Universidad Javeriana-Cali, Calle 18, 118-250 Cali (Colombia); Trusler, J.P.M. [Department of Chemical Engineering, Imperial College London, London SW7 2AZ (United Kingdom)]. E-mail: m.trusler@imperial.ac.uk; Chamorro, C.R. [Grupo de Termodinamica y Calibracion (TERMOCAL), Dpto. Ingenieria Energetica y Fluidomecanica, E.T.S. de Ingenieros Industriales, Universidad de Valladolid, E-47071 Valladolid (Spain); Segovia, J.J. [Grupo de Termodinamica y Calibracion (TERMOCAL), Dpto. Ingenieria Energetica y Fluidomecanica, E.T.S. de Ingenieros Industriales, Universidad de Valladolid, E-47071 Valladolid (Spain); Martin, M.C. [Grupo de Termodinamica y Calibracion (TERMOCAL), Dpto. Ingenieria Energetica y Fluidomecanica, E.T.S. de Ingenieros Industriales, Universidad de Valladolid, E-47071 Valladolid (Spain); Villamanan, M.A. [Grupo de Termodinamica y Calibracion (TERMOCAL), Dpto. Ingenieria Energetica y Fluidomecanica, E.T.S. de Ingenieros Industriales, Universidad de Valladolid, E-47071 Valladolid (Spain)

    2006-07-15

    The speed of sound in {l_brace}(1 - x)CH{sub 4} + xN{sub 2}{r_brace} has been measured with a spherical acoustic resonator. Two mixtures with x = (0.10001 and 0.19999) were studied along isotherms at temperatures between 220 K and 400 K with pressures up to 20 MPa; a few additional measurements at p = (25 and 30) MPa are also reported. A third mixture with x = 0.5422 was studied along pseudo-isochores at amount-of-substance densities between 0.2 mol . dm{sup -3} and 5 mol . dm{sup -3}. Corrections for molecular vibrational relaxation are discussed in detail and relaxation times are reported. The overall uncertainty of the measured speeds of sound is estimated to be not worse than {+-}0.02%, except for those measurements in the mixture with x = 0.5422 that lie along the pseduo-isochore at the highest amount-of-substance density. The results have been compared with the predictions of several equations of state used for natural gas systems.

  13. Bracing superior to neuromuscular training for the prevention of self-reported recurrent ankle sprains: a three-arm randomised controlled trial

    NARCIS (Netherlands)

    Janssen, K.W.; van Mechelen, W.; Verhagen, E.A.L.M.

    2014-01-01

    Background Ankle sprain is the most common sportsrelated injury with a high rate of recurrence and associated costs. Recent studies have emphasised the effectiveness of both neuromuscular training and bracing for the secondary prevention of ankle sprains. Aim To evaluate the effectiveness of

  14. Long-term results after Boston brace treatment in late-onset juvenile and adolescent idiopathic scoliosis

    Directory of Open Access Journals (Sweden)

    Gunderson Ragnhild

    2011-08-01

    Full Text Available Abstract Background It is recommended that research in patients with idiopathic scoliosis should focus on short- and long-term patient-centred outcome. The aim of the present study was to evaluate outcome in patients with late-onset juvenile or adolescent idiopathic scoliosis 16 years or more after Boston brace treatment. Methods 272 (78% of 360 patients, 251 (92% women, responded to follow-up examination at a mean of 24.7 (range 16 - 32 years after Boston brace treatment. Fifty-eight (21% patients had late-onset juvenile and 214 had adolescent idiopathic scoliosis. All patients had clinical and radiological examination and answered a standardised questionnaire including work status, demographics, General Function Score (GFS (100 - worst possible and Oswestry Disability Index (ODI (100 - worst possible, EuroQol (EQ-5D (1 - best possible, EQ-VAS (100 - best possible, and Scoliosis Research Society - 22 (SRS - 22 (5 - best possible. Results The mean age at follow-up was 40.4 (31-48 years. The prebrace major curve was in average 33.2 (20 - 57°. At weaning and at the last follow-up the corresponding values were 28.3 (1 - 58° and 32.5 (7 - 80°, respectively. Curve development was similar in patients with late-onset juvenile and adolescent start. The prebrace curve increased > 5° in 31% and decreased > 5° in 26%. Twenty-five patients had surgery. Those who did not attend follow-up (n = 88 had a lower mean curve at weaning: 25.4 (6-53°. Work status was 76% full-time and 10% part-time. Eighty-seven percent had delivered a baby, 50% had pain in pregnancy. The mean (SD GFS was 7.4 (10.8, ODI 9.3 (11.0, EQ-5D 0.82 (0.2, EQ-VAS 77.6 (17.8, SRS-22: pain 4.1 (0.8, mental health 4.1 (0.6, self-image 3.7 (0.7, function 4.0 (0.6, satisfaction with treatment 3.7 (1.0. Surgical patients had significantly reduced scores for SRS-physical function and self-image, and patients with curves ≥ 45° had reduced self-image. Conclusion Long-term results were

  15. Dose, image quality and spine modeling assessment of biplanar EOS micro-dose radiographs for the follow-up of in-brace adolescent idiopathic scoliosis patients.

    Science.gov (United States)

    Morel, Baptiste; Moueddeb, Sonia; Blondiaux, Eleonore; Richard, Stephen; Bachy, Manon; Vialle, Raphael; Ducou Le Pointe, Hubert

    2018-05-01

    The aim of this study was to compare the radiation dose, image quality and 3D spine parameter measurements of EOS low-dose and micro-dose protocols for in-brace adolescent idiopathic scoliosis (AIS) patients. We prospectively included 25 consecutive patients (20 females, 5 males) followed for AIS and undergoing brace treatment. The mean age was 12 years (SD 2 years, range 8-15 years). For each patient, in-brace biplanar EOS radiographs were acquired in a standing position using both the conventional low-dose and micro-dose protocols. Dose area product (DAP) was systematically recorded. Diagnostic image quality was qualitatively assessed by two radiologists for visibility of anatomical structures. The reliability of 3D spine modeling between two operators was quantitatively evaluated for the most clinically relevant 3D radiological parameters using intraclass correlation coefficient (ICC). The mean DAP for the posteroanterior and lateral acquisitions was 300 ± 134 and 433 ± 181 mGy cm 2 for the low-dose radiographs, and 41 ± 19 and 81 ± 39 mGy cm 2 for micro-dose radiographs. Image quality was lower with the micro-dose protocol. The agreement was "good" to "very good" for all measured clinical parameters when comparing the low-dose and micro-dose protocols (ICC > 0.73). The micro-dose protocol substantially reduced the delivered dose (by a factor of 5-7 compared to the low-dose protocol) in braced children with AIS. Although image quality was reduced, the micro-dose protocol proved to be adapted to radiological follow-up, with adequate image quality and reliable clinical measurements. These slides can be retrieved under Electronic Supplementary Material.

  16. Corrosion studies of thermally sensitised AGR fuel element brace in pH7 and pH9.2 borate solutions

    International Nuclear Information System (INIS)

    Tyfield, S.P.; Smith, C.A.

    1987-04-01

    Brace and cladding of AGR fuel elements sensitised in reactor are susceptible to intergranular and crevice corrosion, which may initiate in the pH7 borate pond storage environment of CEGB/SSEB stations. This report considers the benefit in corrosion control that is provided by raising the pond solution pH to 9.2, whilst maintaining the boron level at 1250 gm -3 . The greater corrosion protection provided by pH9.2 solution compared to the pH7 borate solution is demonstrated by a series of tests with non-active laboratory sensitised brace samples exposed to solutions dosed with chloride or sulphate in order to promote localised corrosion. The corrosion tests undertaken consisted of 5000 hour immersions at 32 0 C and shorter term electrochemically monitored experiments (rest potential, impedance, anodic current) generally conducted at 22 0 C. The pH9.2 solution effectively inhibited the initiation of crevice and intergranular corrosion in the presence of low levels of chloride and sulphate, whereas the pH7 solution did not always do so. However, the pH9.2 solution, dosed with 40 gm -3 chloride, failed to suppress fully crevice corrosion initiated in unborated 40 gm -3 chloride solution at 22 0 C. Fluoride is not deleterious at low levels ∼ 10 gm -3 in the borate solutions. The significant improvement in corrosion control demonstrated for the change from pH7 to pH9.2 borate solution on laboratory sensitised brace samples should ideally be confirmed using complete irradiated AGR fuel elements. (U.K.)

  17. Evaluation of seismic behavior of a braced tubular steel structure by pseudodynamic testing

    International Nuclear Information System (INIS)

    Shiny, P.B.; Javadian-Gilani, A.S.; Mahin, S.A.

    1984-01-01

    The inelastic seismic behavior of an X-braced, tubular steel frame is studied experimentally by means of pseudodynamic testing. The pseudodynamic method, which utilizes a numerical algorithm in the on-line computer control of a test specimen, can realistically simulate the seismic response of a structural model. This paper presents a brief outline of the experimental procedure and the results of the tubular frame tests, including the global responses, the inelastic energy-dissipation capabilities, and the failure mechanism of the frame at various excitation levels. Correlation of these results with previous experimental studies illustrates the feasibility and accuracy of the new test method

  18. Physical, chemical and antimicrobial evaluation of a composite material containing quaternary ammonium salt for braces cementation

    International Nuclear Information System (INIS)

    Sugii, Mari Miura; Ferreira, Fábio Augusto de Souza; Müller, Karina Cogo; Lima, Debora Alves Nunes Leite; Groppo, Francisco Carlos; Imasato, Hidetake; Rodrigues-Filho, Ubirajara Pereira

    2017-01-01

    The antibiofilm effect of iodide quaternary ammonium methacryloxy silicate (IQAMS) in Transbond XT Light Cure Adhesive resin used for braces cementation was evaluated. Fourier Transform Infrared (FTIR) spectroscopy confirmed IQAMS formation and Scanning Electron Microscopy coupled to Energy-Dispersive X-ray Spectroscopy (SEM-EDS) revealed that as coating, the quaternary ammonium groups from IQAMS were homogeneously dispersed throughout the surface. When incorporated, the composite material presented homogeneous dispersion throughout the resin. Assays with Streptococcus mutans demonstrated enhanced antibiofilm effect for the IQAMS coated resin, with much lower colony-forming units (CFU), in comparison to incorporated IQAMS. Such a difference was assigned to low availability of quaternary ammonium groups at the surface of resin when IQAMS was incorporated, hindering its antibiofilm effect. Additionally, the incorporation of IQAMS led to slight decrease in ultimate bond strength (UBS) and shear bond strength (SBS), in comparison to the neat commercial resin. Thus, the synthesized IQAMS displays great potential as antibiofilm coating or sealant to prevent oral infections in brackets during orthodontic treatment. - Highlights: • Synthesis of ORMOSIL-based material with antibiofilm activity is performed. • Antibiofilm activity of the ORMOSIL-based material on commercial available resin for braces cementation is evaluated. • Antibiofilm ORMOSIL-based coating with potential application as varnish or sealant in orthodontic appliances is presented.

  19. Physical, chemical and antimicrobial evaluation of a composite material containing quaternary ammonium salt for braces cementation

    Energy Technology Data Exchange (ETDEWEB)

    Sugii, Mari Miura [Departamento de Odontologia Restaurativa, Faculdade de Odontologia de Piracicaba – Universidade de Campinas, Piracicaba, SP 13414-903 (Brazil); Ferreira, Fábio Augusto de Souza, E-mail: ferreira.fabio.a.s@gmail.com [Grupo de Química de Materiais Híbridos e Inorgânicos, Instituto de Química de São Carlos – Universidade de São Paulo, São Carlos, SP 13563-120 (Brazil); Müller, Karina Cogo [Departamento de Ciências Fisiológicas, Área de Farmacologia, Anestesiologia e Terapeutica, Faculdade de Odontologia de Piracicaba – Universidade de Campinas, Piracicaba, SP 13414-903 (Brazil); Lima, Debora Alves Nunes Leite [Departamento de Odontologia Restaurativa, Faculdade de Odontologia de Piracicaba – Universidade de Campinas, Piracicaba, SP 13414-903 (Brazil); Groppo, Francisco Carlos [Departamento de Ciências Fisiológicas, Área de Farmacologia, Anestesiologia e Terapeutica, Faculdade de Odontologia de Piracicaba – Universidade de Campinas, Piracicaba, SP 13414-903 (Brazil); Imasato, Hidetake; Rodrigues-Filho, Ubirajara Pereira [Grupo de Química de Materiais Híbridos e Inorgânicos, Instituto de Química de São Carlos – Universidade de São Paulo, São Carlos, SP 13563-120 (Brazil); and others

    2017-04-01

    The antibiofilm effect of iodide quaternary ammonium methacryloxy silicate (IQAMS) in Transbond XT Light Cure Adhesive resin used for braces cementation was evaluated. Fourier Transform Infrared (FTIR) spectroscopy confirmed IQAMS formation and Scanning Electron Microscopy coupled to Energy-Dispersive X-ray Spectroscopy (SEM-EDS) revealed that as coating, the quaternary ammonium groups from IQAMS were homogeneously dispersed throughout the surface. When incorporated, the composite material presented homogeneous dispersion throughout the resin. Assays with Streptococcus mutans demonstrated enhanced antibiofilm effect for the IQAMS coated resin, with much lower colony-forming units (CFU), in comparison to incorporated IQAMS. Such a difference was assigned to low availability of quaternary ammonium groups at the surface of resin when IQAMS was incorporated, hindering its antibiofilm effect. Additionally, the incorporation of IQAMS led to slight decrease in ultimate bond strength (UBS) and shear bond strength (SBS), in comparison to the neat commercial resin. Thus, the synthesized IQAMS displays great potential as antibiofilm coating or sealant to prevent oral infections in brackets during orthodontic treatment. - Highlights: • Synthesis of ORMOSIL-based material with antibiofilm activity is performed. • Antibiofilm activity of the ORMOSIL-based material on commercial available resin for braces cementation is evaluated. • Antibiofilm ORMOSIL-based coating with potential application as varnish or sealant in orthodontic appliances is presented.

  20. Seismic Retrofit of Reinforced Concrete Frame Buildings with Hysteretic Bracing Systems: Design Procedure and Behaviour Factor

    Directory of Open Access Journals (Sweden)

    Antonio Di Cesare

    2017-01-01

    Full Text Available This paper presents a design procedure to evaluate the mechanical characteristics of hysteretic Energy Dissipation Bracing (EDB systems for seismic retrofitting of existing reinforced concrete framed buildings. The proposed procedure, aiming at controlling the maximum interstorey drifts, imposes a maximum top displacement as function of the seismic demand and, if needed, regularizes the stiffness and strength of the building along its elevation. In order to explain the application of the proposed procedure and its capacity to involve most of the devices in the energy dissipation with similar level of ductility demand, a simple benchmark structure has been studied and nonlinear dynamic analyses have been performed. A further goal of this work is to propose a simplified approach for designing dissipating systems based on linear analysis with the application of a suitable behaviour factor, in order to achieve a widespread adoption of the passive control techniques. At this goal, the increasing of the structural performances due to the addition of an EDB system designed with the above-mentioned procedure has been estimated considering one thousand case studies designed with different combinations of the main design parameters. An analytical formulation of the behaviour factor for braced buildings has been proposed.

  1. Synthesis and evaluation of 1-[l brace]1-[5-(2'-[[sup 18]F]fluoroethyl)-2-thienyl]cyclohexyl[r brace]piperidine as a potential in vivo radioligand for the NMDA receptor-channel complex. [N-methyl-D-aspartate receptor

    Energy Technology Data Exchange (ETDEWEB)

    Orita, Kazuhiro; Sasaki, Shigeki; Maeda, Minoru [Kyushu Univ., Fukuoka (Japan). Faculty of Pharmaceutical Sciences; Hashimoto, Atsushi; Nishikawa, Toru [National Inst. of Neuroscience, Tokyo (Japan); Yugami, Tomoko; Umezu, Kohei [Mitsubishi Kasei Corp., Yokohama (Japan). Research Center

    1993-10-01

    1-[l brace]1-[5-(2'-[[sup 18]F]Fluoroethyl)-2-thienyl]cyclohexyl[r brace]piperidine ([sup 18]FE-TCP) was prepared a fluorine-substituted analogue of the potent NMDA receptor channel blocker, 1-[1-(2-thienyl)cyclohexyl]piperidine (TCP), by the mesylate displacement with [[sup 18]F]fluoride ion with isolated radiochemical yields of 6-12%, and the synthesis time including a two step HPLC purification was 120 min. The regional distribution in rat brain after i.v. injection of [sup 18]FE-TCP was heterogeneous and similar to the known distribution of phencyclidine recognition sites, with hippocampus-cerebellum, striatum-cerebellum and cerebral cortex-cerebellum concentration ratios of 2.08, 1.7 and 1.54, respectively, 15 min post-injection. Furthermore, this localized regional cerebral distribution was blocked by co-injection with the unlabelled FE-TCP or pretreatment with cis-2-hydroxymethyl-r-1-(N-piperidyl)-1-(2-thienyl)cyclohexane, with the greatest reductions seen in the hippocampus followed by the striatum and cerebral cortex. However, relatively low receptor binding affinity and high non-specific binding due to its high lipophilicity suggest that [sup 18]FE-TCP may not be a suitable radioligand for in vivo PET investigations of the NMDA receptor-channel complex. (Author).

  2. Effect of bracing and other conservative interventions in the treatment of idiopathic scoliosis in adolescents : A systematic review of clinical trials

    NARCIS (Netherlands)

    Lenssinck, MLB; Frijlink, AC; Berger, MY; Bierma-Zeinstra, SMA; Verkerk, K; Verhagen, AP

    2005-01-01

    Background and Purpose. Many conservative treatments are available for adolescents with idiopathic scoliosis, but the evidence for their accepted use is still unclear. The purpose of this study was to evaluate the effectiveness of braces and other conservative treatments of idiopathic scoliosis in

  3. Treatment of the Developmental Dysplasia of the Hip with an Abduction Brace in Children up to 6 Months Old

    Directory of Open Access Journals (Sweden)

    Raphaël Wahlen

    2015-01-01

    Full Text Available Introduction. Use of Pavlik harness for the treatment of DDH can be complicated for parents. Any misuse or failure in the adjustments may lead to significant complications. An abduction brace was introduced in our institution, as it was thought to be easier to use. Aim. We assess the results for the treatment of DDH using our abduction brace in children of 0–6 months old and compare these results with data on treatments using the Pavlik harness. Method. Retrospective analysis of patients with DDH from 0 to 6 months old at diagnosis, performed from 2004 to 2009. Outcomes were rates of reduction of the hip and avascular necrosis of the femoral head (AVN. Follow-up was at one year and up to 4 years old. Results. Hip reduction was successful in 28 of 33 patients (85%, with no AVN. Conclusion. Our results in terms of hip reduction rate and AVN rate are similar to those found in literature assessing Pavlik harness use, with a simpler and comfortable treatment procedure.

  4. Eccentric exercises for the management of tendinopathy of the main body of the Achilles tendon with or without the AirHeel Brace. A randomized controlled trial. A: effects on pain and microcirculation.

    Science.gov (United States)

    Knobloch, Karsten; Schreibmueller, Louisa; Longo, Umile Giuseppe; Vogt, Peter M

    2008-01-01

    To compare eccentric training and the combination of eccentric training with the AirHeel Brace for the management of tendinopathy of the main body of the Achilles tendon. We recruited 116 subjects with unilateral tendinopathy of the main body of the Achilles tendon, who were randomized in two groups. Group A performed a regimen of daily eccentric training associated with the AirHeel Brace (Donjoy Orthopedics, Vista, CA, USA). Group B performed the same eccentric training without the AirHeel Brace. Tendon microcirculatory mapping was performed using combined Laser-Doppler and spectrophotometry. Pre- and post-operative FAOS score and VAS score were used to evaluate the patients. The FAOS score and the VAS score showed significant improvements from pre-operative to post-operative values in both groups (A 5.1 +/- 2 vs. 2.9 +/- 2.4, 43% reduction and B: 5.4 +/- 2.1 vs. 3.6 +/- 2.4, 33% reduction, both p = 0.0001). There were no statistically significant differences in FAOS score and VAS score when comparing the two groups after the end of the intervention. In Group A, tendon oxygen saturation in the main body of the Achilles tendon showed significant increase from pre- to post-management values (68 +/- 12 vs.74 +/- 8%, p = 0.003). Post-capillary venous filling pressures showed significant reduction from pre- to post-intervention values. Eccentric training, associated or not with the AirHeel Brace, produces the same effect in patients with tendinopathy of the main body of the Achilles tendon. The combination of eccentric training with the AirHeel Brace can optimize tendon microcirculation, but these micro-circulator advantages do not translate into superior clinical performance when compared with eccentric training alone.

  5. Evaluation of seismic reliability of steel moment resisting frames rehabilitated by concentric braces with probabilistic models

    Directory of Open Access Journals (Sweden)

    Fateme Rezaei

    2017-08-01

    Full Text Available Probability of structure failure which has been designed by "deterministic methods" can be more than the one which has been designed in similar situation using probabilistic methods and models considering "uncertainties". The main purpose of this research was to evaluate the seismic reliability of steel moment resisting frames rehabilitated with concentric braces by probabilistic models. To do so, three-story and nine-story steel moment resisting frames were designed based on resistant criteria of Iranian code and then they were rehabilitated based on controlling drift limitations by concentric braces. Probability of frames failure was evaluated by probabilistic models of magnitude, location of earthquake, ground shaking intensity in the area of the structure, probabilistic model of building response (based on maximum lateral roof displacement and probabilistic methods. These frames were analyzed under subcrustal source by sampling probabilistic method "Risk Tools" (RT. Comparing the exceedance probability of building response curves (or selected points on it of the three-story and nine-story model frames (before and after rehabilitation, seismic response of rehabilitated frames, was reduced and their reliability was improved. Also the main effective variables in reducing the probability of frames failure were determined using sensitivity analysis by FORM probabilistic method. The most effective variables reducing the probability of frames failure are  in the magnitude model, ground shaking intensity model error and magnitude model error

  6. Results from the BRACE 1.5 study: Climate change impacts of 1.5 C and 2 C warming

    Science.gov (United States)

    O'Neill, B. C.; Anderson, B.; Monaghan, A. J.; Ren, X.; Sanderson, B.; Tebaldi, C.

    2017-12-01

    In 2015, 195 countries negotiated the Paris Agreement on climate change, which set long-term goals of limiting global mean warming to well below 2 C and possibly 1.5 C. This event stimulated substantial scientific interest in climate outcomes and impacts on society associated with those levels of warming. Recently, the first set of global climate model simulations explicitly designed to meet those targets were undertaken with the Community Earth System Model (CESM) for use by the research community (Sanderson et al, accepted). The BRACE 1.5 project models societal impacts from these climate outcomes, combined with assumptions about future socioeconomic conditions according to the Shared Socioeconomic Pathways. These analyses build on a recently completed study of the Benefits of Reduced Anthropogenic Climate changE (BRACE), published as a set of 20 papers in Climatic Change, which examined the difference in impacts between two higher scenarios resulting in about 2.5 C and 3.7 C warming by late this century. BRACE 1.5 consists of a set of six papers to be submitted to a special collection in Environmental Research Letters that takes a similar approach but focuses on impacts at 1.5 and 2 C warming. We ask whether impacts differ substantially between the two climate scenarios, accounting for uncertainty in climate outcomes through the use of initial condition ensembles of CESM simulations, and in societal conditions by using alternative SSP-based development pathways. Impact assessment focuses on the health and agricultural sectors; modeling approaches include the use of a global mutli-region CGE model for economic analysis, both a process-based and an empirical crop model, a model of spatial population change, a model of climatic suitability for the aedes aegypti mosquito, and an epidemiological model of heat-related mortality. A methodological analysis also evaluates the use of climate model emulation techniques for providing climate information sufficient to

  7. Thermodynamics of the amalgam cells {l_brace}Cs-amalgam|CsX (m)|AgX|Ag{r_brace} (X=Cl, Br, I) and primary medium effects in (methanol+water) (acetonitrile+water), and (1,4-dioxane+water) solvent mixtures

    Energy Technology Data Exchange (ETDEWEB)

    Falciola, Luigi [Department of Physical Chemistry and Electrochemistry, University of Milan, Via Golgi 19, I-20133 Milan (Italy)]. E-mail: luigi.falciola@unimi.it; Longoni, Giorgio [Department of Physical Chemistry and Electrochemistry, University of Milan, Via Golgi 19, I-20133 Milan (Italy); Mussini, Patrizia R. [Department of Physical Chemistry and Electrochemistry, University of Milan, Via Golgi 19, I-20133 Milan (Italy)]. E-mail: patrizia.mussini@unimi.it; Mussini, Torquato [Department of Physical Chemistry and Electrochemistry, University of Milan, Via Golgi 19, I-20133 Milan (Italy)]. E-mail: torquato.mussini@unimi.it

    2006-06-15

    The potential difference E of the amalgam cell {l_brace}Cs{sub x}Hg{sub 1-x}|CsX (m)|AgX|Ag{r_brace} (X=Cl, Br, I) has been measured as a function of the mole fraction x{sub Cs} of Cs metal in amalgams and of the molality m of CsX in (methanol+water) (acetonitrile+water), and (1,4-dioxane+water) solvent mixtures containing up to 0.75 mass fraction of the organic component, at the temperature 298.15K. The respective standard molal potential differences E{sub m}{sup o} have been determined together with the relevant activity coefficients {gamma}{sub +}/- as functions of the CsX molality. The found E{sub m}{sup o} values show a parabolic decrease with increasing proportion of the organic component in the solvent mixture. Analysis of the relevant primary medium effects upon CsX shows that the CsX transfer from the standard state in water to the standard state in the (aqueous+organic) mixture is always unfavoured, and the acetonitrile is the least unfavoured co-solvent studied. Analysis of the primary medium effect upon CsI in terms of Feakins and French's theory leads to a primary hydration number close to zero, which is consistent with the results of supplementary EXAFS experiments on Cs{sup +} and I{sup -} in (acetonitrile+water) solvent mixtures.

  8. How to improve aesthetics in patients with Adolescent Idiopathic Scoliosis (AIS: a SPoRT brace treatment according to SOSORT management criteria

    Directory of Open Access Journals (Sweden)

    Fusco Claudia

    2009-09-01

    Full Text Available Abstract Background Aesthetics is a main goal of both conservative and surgical treatments in adolescent idiopathic scoliosis (AIS. Previously, we developed and validated a clinical scale - the Aesthetic Index (AI--in order to measure aesthetic impairment and changes during treatment. Aim To verify the efficacy of bracing on aesthetics in AIS. Study Design Prospective Cohort Study. Population Thirty-four consecutive patients, age 13.2 ± 3.7, initial Cobb Angle 32 ± 12°, ATR 10 ± 4° Bunnel, 11 males. Methods Patients with AI scores of at least 5/6 were included. Each of them had a brace prescription (18 to 23 hours per day, according to the SPoRT concept. AI was measured again after six months and at the end of treatment, and then the pre- and post-treatment scores compared. The Wilcoxon test was performed. Results Twenty-nine patients out of the 34 included completed the treatment and had six-month and final results; four patients were lost during the treatment, and one was fused. At baseline, median AI was 6 (95% IC 5-6 but the score decreased to 3 (95% IC 0-5; p Conclusion Aesthetics can be improved in a clinically significant way when the brace treatment is performed according to the SPoRT concept and by following the SOSORT management criteria. This is a relevant result for patients and a major goal of scoliosis treatment, be it conservative or surgical. The use of a more sensitive tool like TRACE could more easily detect the clinical changes; nevertheless, AI proved sensible enough that its use in everyday clinical practice can be suggested.

  9. Analysis of Limit Cycle Oscillation Data from the Aeroelastic Test of the SUGAR Truss-Braced Wing Model

    Science.gov (United States)

    Bartels, Robert E.; Funk, Christie; Scott, Robert C.

    2015-01-01

    Research focus in recent years has been given to the design of aircraft that provide significant reductions in emissions, noise and fuel usage. Increases in fuel efficiency have also generally been attended by overall increased wing flexibility. The truss-braced wing (TBW) configuration has been forwarded as one that increases fuel efficiency. The Boeing company recently tested the Subsonic Ultra Green Aircraft Research (SUGAR) Truss-Braced Wing (TBW) wind-tunnel model in the NASA Langley Research Center Transonic Dynamics Tunnel (TDT). This test resulted in a wealth of accelerometer data. Other publications have presented details of the construction of that model, the test itself, and a few of the results of the test. This paper aims to provide a much more detailed look at what the accelerometer data says about the onset of aeroelastic instability, usually known as flutter onset. Every flight vehicle has a location in the flight envelope of flutter onset, and the TBW vehicle is not different. For the TBW model test, the flutter onset generally occurred at the conditions that the Boeing company analysis said it should. What was not known until the test is that, over a large area of the Mach number dynamic pressure map, the model displayed wing/engine nacelle aeroelastic limit cycle oscillation (LCO). This paper dissects that LCO data in order to provide additional insights into the aeroelastic behavior of the model.

  10. Bracing can reduce high degree curves and improve aesthetics immediately after the end of growth. Final results of a retrospective case series.

    Science.gov (United States)

    Negrini, Stefano; Donzelli, Sabrina; Lusini, Monia; Zaina, Fabio

    2012-01-01

    Recently it has been shown that idiopathic scoliosis (IS) curves can be reduced with bracing, and it has been proposed that this could be useful in non-surgically treated high degree curves even after Risser 3. Moreover, bracing has been shown to be able to improve aesthetics, and this could be another reason to treat some patients with cosmetic needs. Our aim is to preliminary check if results can be obtained in IS patients after Risser 3. Design. Retrospective uncontrolled cohort study. Inclusion criteria. All IS patients treated on a voluntary basis for aesthetic reasons and/or for curve reduction; Risser 4-5 at start; end of treatment reached. Population. 34 females and 2 males, age 16.2±1.6 years, Cobb angle 27.6°±8.9°. Treatment. Lyon or SPoRT braces 18 to 24 hours/day, specific SEAS exercises, rapid weaning (2-3 hours every 6 months). Outcome criteria: SRS (unchanged; worsened over 6°; over 45° at the end of treatment; surgically treated), radiographic and clinical. Statistics. ANOVA and chi-test. The reported compliance during the 2.8 ± 1.1 treatment years was 95.1%, while residual growth was 0.9 ± 1.1 cm. Improvements were found in 39% of this cohort, (46% in curves over 30°). Only 1 patient progressed 6°. We found highly statistically significant reductions of maximal (-4.4°), thoracic (-6.0°) and thoracolumbar (-6.6°) curves. Statistically significant improvements were found for Aesthetic Index. Before 20 years of age, even in skeletally mature patients, it is possible to reach radiographic and aesthetic improvements, although not as good as during growth. Correction is based on bone growth, but ligaments and neuromuscular control of posture can also be involved.

  11. On the effect of the near field records on the steel braced frames equipped with energy dissipating devices

    Directory of Open Access Journals (Sweden)

    Mahmoud Bayat

    Full Text Available The behavior of braced steel frame structures is of special importance due to its extensive use. Also the application of active and semi-active control systems, regarding to their benefits in obtaining better seismic performance has increased significantly. The majority of the works on steel structures and steel connections has been done under far field records, and the behavior of steel frame structures equipped with yielding dampers under these circumstances has not yet been fully analyzed. The main purpose of this paper is to determine the behavior of structures equipped with yielding dampers, located in near field based on energy concepts. In order to optimize their seismic behavior, the codes and solutions are also presented.The selected system is a braced steel frame system which is equipped with yielding dampers and the analysis is performed using the "Perform 3D V.4" software and the conclusions are drawn upon energy criterion. The effect of PGA variation and height of the frames are also considered in the study .Finally, using the above mentioned results, a proper solution is presented for typical systems in order to increase the energy damping ability and reduce the destructive effects in structures on an earthquake event, so that a great amount of induced energy is damped and destruction of the structure is prevented as much as possible.

  12. Numerical Model of a Hybrid Damping System Composed of a Buckling Restrained Brace with a Magneto Rheological Damper

    Directory of Open Access Journals (Sweden)

    Filip-Vacarescu Norin

    2016-03-01

    Full Text Available This paper discusses the concept of a hybrid damper made from a combination of two dissipative devices. A passive hysteretic device like steel Buckling Restrained Brace (BRB can be combined with a magneto-rheological (MR Fluid Damper in order to obtain a hybrid dissipative system. This system can work either as a semi-active system, if the control unit is available, or as a passive system, tuned for working according to performance based seismic engineering (PBSE scale of reference parameters (i.e. interstory drift.

  13. Comparison of Initial Effect of Taping Techniqe and Counterforce Brace on Pain and Grip Strength of Patients with Lateral Epicondylitis

    Directory of Open Access Journals (Sweden)

    Ali Reza Shamsoddini

    2006-04-01

    Full Text Available Objective: In patients with lateral epicondylitis present of pain and decrease of grip strength are essential problems. Use of splint have major rule in treatment these patients that causes relief of pain and increase of grip strength. Both taping technique and counterforce brace are two methods of treatments of lateral epicondylitis patients but we were not sure which method could be more useful and Answer of this question is magor aim of this study. Materials & Methods: This study is a Quasi experimental. We selected 30 patients between 30-55 years conveniently and divided them in two groups simple randomized.  Results: In grip strength test, the average difference between two methods was t = 1/92 which showed there is not significant. So, there isn't any difference between two methods on grip strength. In assessment of pain, we tested patients in two positions: first patient's hand was in comfort position, second in which when wrist of hand was in extension position. In both of position, that average difference between two methods (first t = 3/78 and secondary t = 3/2 found to be significant. Choose of method in such treatment is considered to be important. Conclusion: taping technique is more effective than counterforce brace to relief of pain of patients with lateral epicondylitis, but in grip strength no difference between two methods.

  14. Reserve seismic capacity determination of a nuclear power plant braced frame with piping

    International Nuclear Information System (INIS)

    Nelson, T.A.

    1979-01-01

    A typical diagonal braced steel frame was developed to determine the amount of reserve capacity that is available beyond elastic design levels. The frame was analyzed first using elastic static and dynamic analyses. The loadings included dead and live load, an equivalent static lateral earthquake load, two response spectra and a suite of eight earthquake time history records. The response spectra used were the Housner and Regulatory Guide 1.60. The time histories represented different site conditions, distances to causative faults and magnitudes. The lateral static load and Housner spectrum represent vintage design criteria, while the R.G. 1.60 and time history analyses reflect current methodology. The elastic limit responses of the structure were determined along with the accompanying threshold peak ground accelerations (threshold g values). The frame was then analyzed using the program DRAIN-2D to perform two-dimensional elastic--plastic analyses for the eight time histories

  15. Floors number influence on the instability parameter of reinforced concrete wall- or core-braced buildings

    Directory of Open Access Journals (Sweden)

    R. J. Ellwanger

    Full Text Available This work aims to investigate the floors number influence on the instability parameter limit α1 of buildings braced by reinforced concrete walls and/or cores. Initially, it is showed how the Beck and König discrete and continuous models are utilized in order to define when a second order analysis is needed. The treatment given to this subject by the Brazilian code for concrete structures design (NBR 6118 is also presented. It follows a detailed analytical study that led to the derivation of equations for the limit α1 as functions of the floors number; a series of examples is presented to check their accuracy. Results are analyzed, showing the precision degree achieved and topics for continuity of research in this field are indicated.

  16. The interdigital brace and other grips for termite nest perforation by chimpanzees of the Goualougo Triangle, Republic of Congo.

    Science.gov (United States)

    Lesnik, Julie J; Sanz, Crickette M; Morgan, David B

    2015-06-01

    Studies of chimpanzee termite foraging enlighten our understanding of early hominin tool use not only by modeling the cognitive ability of our ancestors but also by emphasizing the possible role of social insects in the hominin diet. The chimpanzees of the Goualougo Triangle are known to have one of the largest and most complex tool repertoires reported for wild chimpanzees. One tool set habitually used by this population includes a perforating tool to penetrate the hard outer crust of elevated termite nests before fishing for termite prey with an herbaceous stem. Here, we report the variation present in the grips used on the perforating tool. Our analysis of video recordings of chimpanzee visitation to termite nests over a 3-year period shows that these chimpanzees use a variety of grips to navigate the challenges encountered in opening a termite nest. For situations in which the soil is most hardened, perforating requires force and a power grip is often used. When the soil in the passageway is loose, precision grips are suitable for the task. One of the preferred grips reported here is an interdigital brace, which has previously been described in studies of how some people hold a pencil. In this study, for the first time, the interdigital brace has been thoroughly described for chimpanzees. The various strategies and grips used during perforation emphasize the importance of termites as a nutritional resource that should be considered more strongly as a food used by early hominins. © 2015 Wiley Periodicals, Inc.

  17. Conceptualizing community resilience to natural hazards - the emBRACE framework

    Science.gov (United States)

    Kruse, Sylvia; Abeling, Thomas; Deeming, Hugh; Fordham, Maureen; Forrester, John; Jülich, Sebastian; Nuray Karanci, A.; Kuhlicke, Christian; Pelling, Mark; Pedoth, Lydia; Schneiderbauer, Stefan

    2017-12-01

    The level of community is considered to be vital for building disaster resilience. Yet, community resilience as a scientific concept often remains vaguely defined and lacks the guiding characteristics necessary for analysing and enhancing resilience on the ground. The emBRACE framework of community resilience presented in this paper provides a heuristic analytical tool for understanding, explaining and measuring community resilience to natural hazards. It was developed in an iterative process building on existing scholarly debates, on empirical case study work in five countries and on participatory consultation with community stakeholders where the framework was applied and ground-tested in different contexts and for different hazard types. The framework conceptualizes resilience across three core domains: (i) resources and capacities, (ii) actions and (iii) learning. These three domains are conceptualized as intrinsically conjoined within a whole. Community resilience is influenced by these integral elements as well as by extra-community forces comprising disaster risk governance and thus laws, policies and responsibilities on the one hand and on the other, the general societal context, natural and human-made disturbances and system change over time. The framework is a graphically rendered heuristic, which through application can assist in guiding the assessment of community resilience in a systematic way and identifying key drivers and barriers of resilience that affect any particular hazard-exposed community.

  18. Back and neck pain and function in females with adolescent idiopathic scoliosis: A follow-up at least 23 years after conservative treatment with a Milwaukee brace

    Science.gov (United States)

    2017-01-01

    We aimed to explore the long-term outcomes of back and neck pain and functionality in adult females with adolescent idiopathic scoliosis (AIS), who had been treated with a Milwaukee brace, in a follow-up study a minimum of 23 years after the completion of the treatment, using radiological, clinical and socio-demographical data. Thirty AIS patients (scoliosis group–SG), were included in the study based on an extensive search of Pediatric Orthopedics and Traumatology Clinic charts. All treatments were successfully completed between 1974 and 1990. In all cases, scoliosis had not been detected before the age of 10 and was not combined with any major spinal deformities at the time when the brace treatment was implemented. In those patients, the Risser sign 4 and minimum two years post-menarche was defined as a maturity, after that time the brace treatment was completed. Patients were excluded from the study if they, at the time of the follow-up examinations, suffered from any other disease leading to trunk deformity. Forty patients met the criteria for inclusion, but due to change some personal details, not all of them were contacted. Finally, 30 women returned for a follow-up evaluation. Patients’ follow-up period was mean 27.77 yrs. ± SD 3.30 (range 23–35). Curvature change from the end of the treatment until the present day was mean 9.1 degrees ± SD 7.64 (range 0–27). A control group of 42 healthy females (healthy controls group—HG) matching the age profile of the patient group was randomly selected for comparative purposes.Both SG and HG completed the Polish versions of the Revised Oswestry Lower Back Pain Disability Index (RODI), the Rolland-Morris Questionnaire (RMQ), the Quebec Back Pain Disability Scale (QDS), the Neck Disability Index (NDI) and the Copenhagen Neck Functional Disability Scale (CNFDS). Descriptive statistics were calculated for demographics and baseline questionnaire scores. To determine if the investigated sample sizes are equivalent

  19. Conceptualizing community resilience to natural hazards – the emBRACE framework

    Directory of Open Access Journals (Sweden)

    S. Kruse

    2017-12-01

    Full Text Available The level of community is considered to be vital for building disaster resilience. Yet, community resilience as a scientific concept often remains vaguely defined and lacks the guiding characteristics necessary for analysing and enhancing resilience on the ground. The emBRACE framework of community resilience presented in this paper provides a heuristic analytical tool for understanding, explaining and measuring community resilience to natural hazards. It was developed in an iterative process building on existing scholarly debates, on empirical case study work in five countries and on participatory consultation with community stakeholders where the framework was applied and ground-tested in different contexts and for different hazard types. The framework conceptualizes resilience across three core domains: (i resources and capacities, (ii actions and (iii learning. These three domains are conceptualized as intrinsically conjoined within a whole. Community resilience is influenced by these integral elements as well as by extra-community forces comprising disaster risk governance and thus laws, policies and responsibilities on the one hand and on the other, the general societal context, natural and human-made disturbances and system change over time. The framework is a graphically rendered heuristic, which through application can assist in guiding the assessment of community resilience in a systematic way and identifying key drivers and barriers of resilience that affect any particular hazard-exposed community.

  20. Back and neck pain and function in females with adolescent idiopathic scoliosis: A follow-up at least 23 years after conservative treatment with a Milwaukee brace.

    Directory of Open Access Journals (Sweden)

    Ewa Misterska

    Full Text Available We aimed to explore the long-term outcomes of back and neck pain and functionality in adult females with adolescent idiopathic scoliosis (AIS, who had been treated with a Milwaukee brace, in a follow-up study a minimum of 23 years after the completion of the treatment, using radiological, clinical and socio-demographical data. Thirty AIS patients (scoliosis group-SG, were included in the study based on an extensive search of Pediatric Orthopedics and Traumatology Clinic charts. All treatments were successfully completed between 1974 and 1990. In all cases, scoliosis had not been detected before the age of 10 and was not combined with any major spinal deformities at the time when the brace treatment was implemented. In those patients, the Risser sign 4 and minimum two years post-menarche was defined as a maturity, after that time the brace treatment was completed. Patients were excluded from the study if they, at the time of the follow-up examinations, suffered from any other disease leading to trunk deformity. Forty patients met the criteria for inclusion, but due to change some personal details, not all of them were contacted. Finally, 30 women returned for a follow-up evaluation. Patients' follow-up period was mean 27.77 yrs. ± SD 3.30 (range 23-35. Curvature change from the end of the treatment until the present day was mean 9.1 degrees ± SD 7.64 (range 0-27. A control group of 42 healthy females (healthy controls group-HG matching the age profile of the patient group was randomly selected for comparative purposes.Both SG and HG completed the Polish versions of the Revised Oswestry Lower Back Pain Disability Index (RODI, the Rolland-Morris Questionnaire (RMQ, the Quebec Back Pain Disability Scale (QDS, the Neck Disability Index (NDI and the Copenhagen Neck Functional Disability Scale (CNFDS. Descriptive statistics were calculated for demographics and baseline questionnaire scores. To determine if the investigated sample sizes are equivalent

  1. Initial arch wires for alignment of crooked teeth with fixed orthodontic braces.

    Science.gov (United States)

    Wang, Yan; Jian, Fan; Lai, Wenli; Zhao, Zhihe; Yang, Zhi; Liao, Zhengyu; Shi, Zongdao; Wu, Taixiang; Millett, Declan T; McIntyre, Grant T; Hickman, Joy

    2010-04-14

    The initial arch wire is the first arch wire to be inserted into the fixed appliance at the beginning of orthodontic treatment and is used mainly for correcting crowding and rotations of teeth. With a number of orthodontic arch wires available for initial tooth alignment, it is important to understand which wire is most efficient, as well as which wires cause the least amount of root resorption and pain during the initial aligning stage of treatment. To identify and assess the evidence for the effects of initial arch wires for alignment of teeth with fixed orthodontic braces in relation to alignment speed, root resorption and pain intensity. We searched the following electronic databases: the Cochrane Oral Health Group's Trials Register (30th November 2009), CENTRAL (The Cochrane Library 2009, Issue 4), MEDLINE (1950 to 30th November 2009) and EMBASE (1980 to 30th November 2009). Reference lists of articles were also searched. There was no restriction with regard to publication status or language of publication. We contacted all authors of included studies to identify additional studies. Randomised controlled trials (RCTs) of initial arch wires to align crooked teeth with fixed orthodontic braces were selected. Only studies involving patients with upper and/or lower full arch fixed orthodontic appliances were included. Two review authors were responsible for study selection, validity assessment and data extraction. All disagreements were resolved by discussion amongst the review team. Corresponding authors of included studies were contacted to obtain missing information. Seven RCTs, with 517 participants, provided data for this review. Among them, five trials investigated the speed of initial tooth alignment comparing: 0.016 inch ion-implanted A-NiTi wire versus 0.016 inch A-NiTi versus 0.0175 multistrand stainless steel wire; 0.016x0.022 inch medium force active M-NiTi wire versus 0.016x0.022 inch graded force active M-NiTi wire versus 0.0155 inch multistrand

  2. Redundancy Factors for the Seismic Design of Ductile Reinforced Concrete Chevron Braced Frames

    Directory of Open Access Journals (Sweden)

    Eber Alberto Godínez-Domínguez

    Full Text Available Abstract In this paper the authors summarize the results of a study devoted to assess, using nonlinear static analyses, the impact of increasing the structural redundancy in ductile moment-resisting reinforced concrete concentric braced frames structures (RC-MRCBFs. Among the studied variables were the number of stories and the number of bays. Results obtained were compared with the currently proposed values in the Manual of Civil Structures (MOC-08, a model code of Mexico. The studied frames have 4, 8, 12 and 16-story with a story height h=3.5 m. and a fixed length L=12 m., where 1, 2, 3 or 4 bays have to be located. RC-MRCBFs were assumed to be located in soft soil conditions in Mexico City and were designed using a capacity design methodology adapted to general requirements of the seismic, reinforced concrete and steel guidelines of Mexican Codes. From the results obtained in this study it is possible to conclude that a different effect is observed in overstrength redundancy factors respect to ductility redundancy factors due to an increase of the bay number considered. Also, the structural redundancy factors obtained for this particular structural system varies respect to the currently proposed in MOC-08.

  3. Optimal placement of active braces by using PSO algorithm in near- and far-field earthquakes

    Science.gov (United States)

    Mastali, M.; Kheyroddin, A.; Samali, B.; Vahdani, R.

    2016-03-01

    One of the most important issues in tall buildings is lateral resistance of the load-bearing systems against applied loads such as earthquake, wind and blast. Dual systems comprising core wall systems (single or multi-cell core) and moment-resisting frames are used as resistance systems in tall buildings. In addition to adequate stiffness provided by the dual system, most tall buildings may have to rely on various control systems to reduce the level of unwanted motions stemming from severe dynamic loads. One of the main challenges to effectively control the motion of a structure is limitation in distributing the required control along the structure height optimally. In this paper, concrete shear walls are used as secondary resistance system at three different heights as well as actuators installed in the braces. The optimal actuator positions are found by using optimized PSO algorithm as well as arbitrarily. The control performance of buildings that are equipped and controlled using the PSO algorithm method placement is assessed and compared with arbitrary placement of controllers using both near- and far-field ground motions of Kobe and Chi-Chi earthquakes.

  4. Subsonic Ultra Green Aircraft Research. Phase II - Volume I; Truss Braced Wing Design Exploration

    Science.gov (United States)

    Bradley, Marty K.; Droney, Christopher K.; Allen, Timothy J.

    2015-01-01

    This report summarizes the Truss Braced Wing (TBW) work accomplished by the Boeing Subsonic Ultra Green Aircraft Research (SUGAR) team, consisting of Boeing Research and Technology, Boeing Commercial Airplanes, General Electric, Georgia Tech, Virginia Tech, NextGen Aeronautics, and Microcraft. A multi-disciplinary optimization (MDO) environment defined the geometry that was further refined for the updated SUGAR High TBW configuration. Airfoil shapes were tested in the NASA TCT facility, and an aeroelastic model was tested in the NASA TDT facility. Flutter suppression was successfully demonstrated using control laws derived from test system ID data and analysis models. Aeroelastic impacts for the TBW design are manageable and smaller than assumed in Phase I. Flutter analysis of TBW designs need to include pre-load and large displacement non-linear effects to obtain a reasonable match to test data. With the updated performance and sizing, fuel burn and energy use is reduced by 54% compared to the SUGAR Free current technology Baseline (Goal 60%). Use of the unducted fan version of the engine reduces fuel burn and energy by 56% compared to the Baseline. Technology development roadmaps were updated, and an airport compatibility analysis established feasibility of a folding wing aircraft at existing airports.

  5. Analysis of the steel braced frames equipped with ADAS devices under the far field records

    Directory of Open Access Journals (Sweden)

    Mahmoud Bayat

    Full Text Available The usefulness of supplementary energy dissipation devices is now quite well-known in earthquake structural engineering for reducing the earthquake-induced response of structural systems. The seismic behavior of structures with supplemental ADAS devices is concerned in this study. In this paper, the ratio of the hysteretic energy to input energy is compared in different structural systems. The main purpose of this paper is to evaluate the behavior of structures equipped with yielding dampers (ADAS, located in far fields based on energy concepts. In order to optimize their seismic behavior, the codes and solutions are also presented. Three cases including five, ten and fifteen-story three-bay Concentric Braced Frames (CBF with and without ADAS were selected. The PERFORM 3D.V4 software along with three earthquake records (Northridge, Imperial Valley and Tabas is used for nonlinear time history analysis and the conclusions are drawn upon energy criterion. The effect of PGA variation and height of the frames are also considered in the study. Finally, to increase the energy damping ability and reduce the destructive effects in structures on an earthquake event, so that a great amount of induced energy is damped and destruction of the structure is prevented as much as possible by using ADAS dampers.

  6. Subsonic Ultra Green Aircraft Research: Phase II- Volume III-Truss Braced Wing Aeroelastic Test Report

    Science.gov (United States)

    Bradley, Marty K.; Allen, Timothy J.; Droney, Christopher

    2014-01-01

    This Test Report summarizes the Truss Braced Wing (TBW) Aeroelastic Test (Task 3.1) work accomplished by the Boeing Subsonic Ultra Green Aircraft Research (SUGAR) team, which includes the time period of February 2012 through June 2014. The team consisted of Boeing Research and Technology, Boeing Commercial Airplanes, Virginia Tech, and NextGen Aeronautics. The model was fabricated by NextGen Aeronautics and designed to meet dynamically scaled requirements from the sized full scale TBW FEM. The test of the dynamically scaled SUGAR TBW half model was broken up into open loop testing in December 2013 and closed loop testing from January 2014 to April 2014. Results showed the flutter mechanism to primarily be a coalescence of 2nd bending mode and 1st torsion mode around 10 Hz, as predicted by analysis. Results also showed significant change in flutter speed as angle of attack was varied. This nonlinear behavior can be explained by including preload and large displacement changes to the structural stiffness and mass matrices in the flutter analysis. Control laws derived from both test system ID and FEM19 state space models were successful in suppressing flutter. The control laws were robust and suppressed flutter for a variety of Mach, dynamic pressures, and angle of attacks investigated.

  7. A general strategy for synthesis of cyclophane-braced peptide macrocycles via palladium-catalysed intramolecular sp3 C-H arylation

    Science.gov (United States)

    Zhang, Xuekai; Lu, Gang; Sun, Meng; Mahankali, Madhu; Ma, Yanfei; Zhang, Mingming; Hua, Wangde; Hu, Yuting; Wang, Qingbing; Chen, Jinghuo; He, Gang; Qi, Xiangbing; Shen, Weijun; Liu, Peng; Chen, Gong

    2018-05-01

    New methods capable of effecting cyclization, and forming novel three-dimensional structures while maintaining favourable physicochemical properties are needed to facilitate the development of cyclic peptide-based drugs that can engage challenging biological targets, such as protein-protein interactions. Here, we report a highly efficient and generally applicable strategy for constructing new types of peptide macrocycles using palladium-catalysed intramolecular C(sp3)-H arylation reactions. Easily accessible linear peptide precursors of simple and versatile design can be selectively cyclized at the side chains of either aromatic or modified non-aromatic amino acid units to form various cyclophane-braced peptide cycles. This strategy provides a powerful tool to address the long-standing challenge of size- and composition-dependence in peptide macrocyclization, and generates novel peptide macrocycles with uniquely buttressed backbones and distinct loop-type three-dimensional structures. Preliminary cell proliferation screening of the pilot library revealed a potent lead compound with selective cytotoxicity toward proliferative Myc-dependent cancer cell lines.

  8. PARAMETRIC STUDY OF OUTER-BRACE SCFS IN RIGHTANGLE TWO-PLANAR TUBULAR DKT-JOINTS OF OFFSHORE JACKET STRUCTURES

    Directory of Open Access Journals (Sweden)

    H. AHMADI

    2015-03-01

    Full Text Available In the present paper, a set of parametric FE stress analyses is carried out for two-planar welded tubular DKT-joints under two different axial load cases. Analysis results are used to present general remarks on the effect of geometrical parameters on the stress concentration factors (SCFs at the inner saddle, outer saddle, crown toe, and crown heel positions on the main (outer brace. Based on the results of finite element analyses which are verified against the experimental data, a complete set of SCF database is constructed. Then a new set of SCF parametric equations is developed through nonlinear regression analysis for the fatigue design of two-planar DKT-joints under axial loads. An assessment study of these equations is conducted against the experimental data and the satisfaction of criteria regarding the acceptance of parametric equations is checked. Significant effort has been devoted by researchers to the study of SCFs in various uni-planar tubular connections. Nevertheless, for multi-planar joints covering the majority of practical applications, very few investigations have been reported due to the complexity and high cost involved.

  9. Sequence-specific DNA binding activity of the cross-brace zinc finger motif of the piggyBac transposase

    Science.gov (United States)

    Morellet, Nelly; Li, Xianghong; Wieninger, Silke A; Taylor, Jennifer L; Bischerour, Julien; Moriau, Séverine; Lescop, Ewen; Bardiaux, Benjamin; Mathy, Nathalie; Assrir, Nadine; Bétermier, Mireille; Nilges, Michael; Hickman, Alison B; Dyda, Fred; Craig, Nancy L; Guittet, Eric

    2018-01-01

    Abstract The piggyBac transposase (PB) is distinguished by its activity and utility in genome engineering, especially in humans where it has highly promising therapeutic potential. Little is known, however, about the structure–function relationships of the different domains of PB. Here, we demonstrate in vitro and in vivo that its C-terminal Cysteine-Rich Domain (CRD) is essential for DNA breakage, joining and transposition and that it binds to specific DNA sequences in the left and right transposon ends, and to an additional unexpectedly internal site at the left end. Using NMR, we show that the CRD adopts the specific fold of the cross-brace zinc finger protein family. We determine the interaction interfaces between the CRD and its target, the 5′-TGCGT-3′/3′-ACGCA-5′ motifs found in the left, left internal and right transposon ends, and use NMR results to propose docking models for the complex, which are consistent with our site-directed mutagenesis data. Our results provide support for a model of the PB/DNA interactions in the context of the transpososome, which will be useful for the rational design of PB mutants with increased activity. PMID:29385532

  10. Functional bracing for delayed union of a femur fracture associated with Paget's disease of the bone in an Asian patient: a case report

    Directory of Open Access Journals (Sweden)

    Fukuta Masashi

    2010-05-01

    Full Text Available Abstract Paget's disease of the bone is a common metabolic bone disease in most European countries, Australia, New Zealand, and North America. Conversely, this disease is rare in Scandinavia, Asia, and Africa. In Japan, it is extremely rare, with a prevalence of 0.15/100000. Paget's disease is a localized disorder of bone remodeling. Excessive bone resorption and abnormal bone formation result in biomechanically weakened bone and predispose patients to fracture. Delayed union and non-union of fractures have been reported in patients with Paget's disease. Therefore, open reduction and internal fixation of fractures has been recommended to prevent such complications. Here we report an unusual case of a 63-year-old Asian woman with delayed union of a femur fracture secondary to Paget's disease, which was treated successfully by functional bracing.

  11. Energy-Based Design Criterion of Dissipative Bracing Systems for the Seismic Retrofit of Frame Structures

    Directory of Open Access Journals (Sweden)

    Gloria Terenzi

    2018-02-01

    Full Text Available Direct sizing criteria represent useful tools in the design of dissipative bracing systems for the advanced seismic protection of existing frame structures, especially when incorporated dampers feature a markedly non-linear behaviour. An energy-based procedure is proposed herein to this aim, focusing attention on systems including fluid viscous devices. The procedure starts by assuming prefixed reduction factors of the most critical response parameters in current conditions, which are evaluated by means of a conventional elastic finite element analysis. Simple formulas relating the reduction factors to the equivalent viscous damping ratio of the dampers, ξeq, are proposed. These formulas allow calculating the ξeq values that guarantee the achievement of the target factors. Finally, the energy dissipation capacity of the devices is deduced from ξeq, finalizing their sizing process. A detailed description of the procedure is presented in the article, by distinguishing the cases where the prevailing structural deficiencies are represented by poor strength of the constituting members, from the cases having excessive horizontal displacements. A demonstrative application to the retrofit design of a reinforced concrete gym building is then offered to explicate the steps of the sizing criterion in practice, as well as to evaluate the enhancement of the seismic response capacities generated by the installation of the dissipative system.

  12. Surface self-diffusion of adatom on Pt cluster with truncated octahedron structure

    Energy Technology Data Exchange (ETDEWEB)

    Yang Jianyu, E-mail: wuliyangjianyu@yahoo.com.c [Department of Maths and Physics, Hunan Institute of Engineering, Xiangtan 411104 (China); Hu Wangyu, E-mail: wangyuhu2001@yahoo.com.c [Department of Applied Physics, Hunan University, Changsha 410082 (China); Chen Shuguang [Department of Applied Physics, Hunan University, Changsha 410082 (China)

    2010-05-03

    Surface diffusion of single Pt adatom on Pt cluster with truncated octahedron structure is investigated through a combination of molecular dynamics and nudged elastic band method. Using an embedded atom method to describe the atomic interactions, the minimum energy paths are determined and the energy barriers for adatom diffusion across and along step are evaluated. The diffusion of adatom crossing step edge between {l_brace}111{r_brace} and {l_brace}100{r_brace} facets has a surprisingly low barrier of 0.03 eV, which is 0.12 eV lower than the barrier for adatom diffusion from {l_brace}111{r_brace} to neighboring {l_brace}111{r_brace} facet. Owing to the small barrier of adatom diffusion across the step edge between {l_brace}111{r_brace} and {l_brace}100{r_brace} facets, the diffusion of adatom along the step edge cannot occur. The molecular dynamics simulations at low temperatures also support these results. Our results show that mass transport will prefer step with {l_brace}100{r_brace} microfacet and the Pt clusters can have only {l_brace}111{r_brace} facets in epitaxial growth.

  13. Pregnancy-associated osteoporosis with eight fractures in the vertebral column treated with kyphoplasty and bracing: a case report.

    Science.gov (United States)

    Bonacker, J; Janousek, M; Kröber, M

    2014-02-01

    Pregnancy-associated osteoporosis is a rare condition, which imposes multiple symptoms in the musculoskeletal system. Common complaints announced by patients are severe pain in the lower back, hips and the joints of the lower extremities with a reduced and less mobility status in general. Most of the patients' problems occur in the last trimester of pregnancy or postpartum and are often not diagnosed as side effects of osteoporosis but as problems associated with pregnancy. Although vertebral fractures are rare complications of pregnancy-associated osteoporosis, they should be always considered in women presenting with an acute pain syndrome in peripregnancy period. This case presents a 40-year-old primagravid woman who developed pain in hips and severe pain in the lower back causing an immobilization diagnosed with a pregnancy-associated osteoporosis with eight compression fractures in the thoracic and lumbar spine. Because of sagittal imbalance of the spine, she was treated with kyphoplasty at the four lumbar fractures and with bracing for the upper, thoracic ones, additional to the conservative anti-osteoporotic therapy. The authors discuss pregnancy-associated osteoporosis and its clinical presentation, as well as the indications of kyphoplasty, spinal alignment and the risk of single conservative treatment.

  14. Photoinduced self-assembly to lanthanide-containing molybdenum-blue superclusters and molecular design

    Energy Technology Data Exchange (ETDEWEB)

    Yamase, Toshihiro [Chemical Resources Laboratory, Tokyo Institute of Technology, R1-21, 4259 Nagatsuta, Midori-ku, Yokohama 226-8503 (Japan) and Core Research for Evolutional Science and Technology (CREST), Japan Science and Technology Agency (JST), 4-1-8 Honcho, Kawaguchi 332-0012 (Japan)]. E-mail: tyamase@res.titech.ac.jp; Ishikawa, Eri [Chemical Resources Laboratory, Tokyo Institute of Technology, R1-21, 4259 Nagatsuta, Midori-ku, Yokohama 226-8503 (Japan); Core Research for Evolutional Science and Technology (CREST), Japan Science and Technology Agency (JST), 4-1-8 Honcho, Kawaguchi 332-0012 (Japan); Abe, Yohko [Chemical Resources Laboratory, Tokyo Institute of Technology, R1-21, 4259 Nagatsuta, Midori-ku, Yokohama 226-8503 (Japan); Core Research for Evolutional Science and Technology (CREST), Japan Science and Technology Agency (JST), 4-1-8 Honcho, Kawaguchi 332-0012 (Japan); Yano, Yutaka [Chemical Resources Laboratory, Tokyo Institute of Technology, R1-21, 4259 Nagatsuta, Midori-ku, Yokohama 226-8503 (Japan); Core Research for Evolutional Science and Technology (CREST), Japan Science and Technology Agency (JST), 4-1-8 Honcho, Kawaguchi 332-0012 (Japan)

    2006-02-09

    The prolonged photolysis of aqueous solutions containing [Mo{sub 36}O{sub 112}(H{sub 2}O){sub 16}]{sup 8-}, [ {sup i}PrNH{sub 3}]{sup +} (or [p-CH{sub 3}C{sub 6}H{sub 4}SO{sub 2}]{sup -}), and LaCl{sub 3} at pH = 1 leads to the formation of 28-electron reduced [Mo{sub 28} {sup V}Mo{sub 122} {sup VI}O{sub 452}H{sub 2}(H{sub 2}O){sub 66}{l_brace}La(H{sub 2}O){sub 5}{r_brace}{sub 2}]{sup 24-} ({identical_to}{l_brace}Mo{sub 15}(La){sub 2}{r_brace}) or 24-electron reduced [Mo{sub 24} {sup V}Mo{sub 96} {sup VI}O{sub 366}H{sub 14}(H{sub 2}O){sub 48}{l_brace}La(H{sub 2}O){sub 5}{r_brace}{sub 6}]{sup 4-} ({identical_to}{l_brace}Mo{sub 12}(La){sub 6}{r_brace}) molybdenum-blue nano-ring which depends on the electron donor species. The former is of the ellipsoidal structure with approximately 35 and 32 A for the outer ring diameters and 25 and 20 A for the inner ring diameters. The latter is of the Japanese rice-ball shape with approximately 30 and 17 A for outer and inner ring diameters, respectively. All the La{sup 3+} sites are coordinated into the inner rings with replacement of [Mo(H{sub 2}O)O{sub 2}({mu}-O)Mo(H{sub 2}O)O{sub 2}]{sup 2+} ({identical_to}{l_brace}Mo{sub 2}{r_brace}-linker) groups. Each LaO{sub 9} site exhibits the distorted tricapped-trigonal-prismatic geometry which consists of four two-coordinate oxygen atoms from {l_brace}Mo{sub 15}{r_brace} and {l_brace}Mo{sub 12}{r_brace} frameworks and five aqua oxygen atoms, with 2.46-2.62 A of La-O bond-lengths. The topology of {l_brace}Mo{sub 15}(La){sub 2}{r_brace} and {l_brace}Mo{sub 12}(La){sub 6}{r_brace} structures shows that the Ln{sup 3+}-incorporated sub-blocks {l_brace}Mo{sub 1}(La){r_brace}and {l_brace}Mo{sub 11}(La){r_brace} in rings possess large molecular curvature with {omega} {sub 1} {approx} 157{sup o} and {omega} {sub 3} {approx} 154{sup o} compared to {l_brace}Mo{sub 1}{r_brace}and {l_brace}Mo{sub 11}{r_brace} with {omega} {sub 1} {approx} 158-159{sup o} and {omega} {sub 3} {approx} 158{sup o

  15. Investigating effects of boundary conditions on the evaluation of R-factor of un-braced steel frames

    Directory of Open Access Journals (Sweden)

    Masood M.M. Irheem

    2017-08-01

    Full Text Available Design of Structures to resist seismic load depends on the theory of dissipation in elastic of energy that already exists in response modification factor “R-factor”. The main problem in codes gives a constant value for R-factor, since change in boundary conditions of building change in behavior of steel frame structures and that effect on R-factor. This study is an attempt to assess overstrength, ductility and response modification factor of un-braced steel frames under change in boundary conditions as change in the direction of strong axis of column and support type beside to variation in story and bay number to be 9 frame and each frame has 8 different boundary conditions as sum of 72 case for analysis. These frames were analyzed by using nonlinear static “pushover” analysis using SAP2000 program. As a result of this study R-factor does not has a constant value, when change in boundary conditions R-factor directly changes, minimum value of 8 boundary conditions is close to the code value that is mean the code is more conservative and give a large factor of safety. Ductility reduction factor increases with increasing number of story for all boundary conditions, but overstrength has different rule. Response modification factor, overstrength factor and ductility reduction factor decrease when fundamentals period increasing for the studied frames.

  16. The TVT Glass Pavilion: Theoretical Study on a Highly Transparent Building Made with Long-Spanned TVT Portals Braced with Hybrid Glass-Steel Panels

    Directory of Open Access Journals (Sweden)

    Maurizio Froli

    2017-06-01

    Full Text Available In contemporary buildings, the architectural demand for a complete dematerialisation of load bearing structures can be satisfied only in limited cases with the exclusive structural use of glass. Otherwise, for challenging applications such as long spanned or high-rise structures, the use of hybrid glass-steel systems is mandatory. Glass, fragile but highly compressive resistant, is associated with steel, ductile and tensile resistant. The present research shows the feasibility study for a fully glazed pavilion made of six TVT (Travi Vitree Tensegrity portal frames longitudinally braced by pre-stressed hybrid glass panels. The frames are about 20 m in span and 8 m in height. Appropriate multiscalar FEM numerical analyses, calibrated on the collapse tests performed on previous TVT large-scale prototypes, stated that the structural performance would be able to withstand heavy static and dynamic loads and stated the observance of the Fail-Safe Design principles.

  17. 可変剛性ブレース付骨組の復元力特性

    OpenAIRE

    金夛, 潔; 中山, 昭夫

    1988-01-01

    The elasto- plastic behavior of braced frame becomes very complicated on the onfluence ofthe slender's ratio and the shape of cross section, etc. of bracing members. This is mainly be-cause of the instability of compression member. The braced frame is commonly used as K-braced or X braced frame. In such a case, the restoring force characteristics of the frame largelydepend upon the slender's ratio of the braces as following.(1) When the slender's ratio of the braces x is less than 30, the exp...

  18. Trinuclear Schiff base complexes with uranium(V) and copper(II) or zinc(II) ions

    Energy Technology Data Exchange (ETDEWEB)

    Salmon, L.; Thuery, P.; Ephritikhine, M. [CEA Saclay, DSM, DRECAM, Serv Chim Mol, Lab Claude Frejacques, CNRS URA 331, F-91191 Gif Sur Yvette, (France)

    2007-07-01

    Treatment of the uranium(IV) complexes [{l_brace}ML{sup 1}(py){r_brace}{sub 2}U(IV)] (M = Cu, Zn; L{sup 1} = N, N'-bis(3-hydroxy-salicylidene)-1,3-propane-diamine) with silver nitrate in pyridine led to the formation of the corresponding cationic uranium(V) species which were found to be thermally unstable and were converted back into the parent U(IV) complexes; no electron transfer was observed in solution between the U(IV) and U(V) compounds. In the crystals of [{l_brace}ML{sup 1}(py){r_brace}{sub 2}U(IV)][{l_brace}ML{sup 1}(py){r_brace}{sub 2}U(V)][NO{sub 3}], the neutral U(IV) and cationic U(V) species are clearly identified by the distinct U-O distances. Similar reaction of [{l_brace}ZnL{sup 2}(py){r_brace}{sub 2}U(IV)] [L{sup 2} N,N'-bis(3-hydroxy-salicylidene)-1,4-butane-diamine] with AgNO{sub 3} gave crystals of [{l_brace}ZnL{sup 2}(py){r_brace}U(V){l_brace}ZnL{sup 2}(py){sub 2}{r_brace}][NO{sub 3}] but the copper counterpart was not isolated. Crystals of [{l_brace}ZnL{sup 1}(py){r_brace}{sub 2}U(V)][OTf].THF (OTf = OSO{sub 2}CF{sub 3}) were obtained fortuitously from the reaction of [Zn(H{sub 2}L{sup 1})] and U(OTf){sub 3}. (authors)

  19. Effect of rolling reduction on the development of rolling and recrystallization textures in Al-Mg alloys

    Energy Technology Data Exchange (ETDEWEB)

    Endou, S; Inagaki, H [Shonan Inst. of Tech., Fujisawashi (Japan)

    2002-07-01

    In order to investigate the effect of Mg content on the development of the rolling textures in Al pure Al, Al-3% Mg alloy and Al-5% Mg alloy were cold rolled by varying rolling reductions up to 97%. Their rolling textures were investigated by the orientation distribution function analysis. The extent of work hardening introduced by cold rolling was estimated by the hardness measurements. It was found that, at all rolling reductions, the main orientations of the rolling textures depended strongly on the Mg content. In pure Al, {l_brace}123{r_brace} left angle 634 right angle was always the main orientation, whereas {l_brace}112{r_brace} left angle 111 right angle was most strong in the Al-3%Mg alloy. In the Al-5% Mg alloy, the development of both {l_brace}123{r_brace} left angle 634 right angle and {l_brace}112{r_brace} left angle 111 right angle were strongly suppressed, whereas {l_brace}110{r_brace} left angle 112 right angle developed remarkably. In pure Al, most of the texture development occurred at the later half of work hardening, i.e. at rolling reductions above 70%. With increasing Mg content, rolling texture tended to develop already at lower rolling reductions. Dynamic recovery, which occurred at very high rolling reductions, suppressed the development of the rolling textures. All these results strongly suggested that the formation of dislocation cell structures and shear banding are origins of the formation of these rolling textures. On annealing these specimens at 450 C for 30 min, recrystallization textures developed only in specimens having strong rolling textures, i. e. in the specimens cold rolled more than 70%. {l_brace}100{r_brace} left angle 001 right angle developed only in pure Al and in the Al-3% Mg ally, in which {l_brace}123{r_brace} left angle 634 right angle and {l_brace}112{r_brace} left angle 111 right angle were strong in the rolling textures. Recrystallization textures of the Al-5% Mg alloy was wather random. Its main orientation, {l_brace

  20. Effect of compressive force on aeroelastic stability of a strut-braced wing

    Science.gov (United States)

    Sulaeman, Erwin

    2002-01-01

    Recent investigations of a strut-braced wing (SBW) aircraft show that, at high positive load factors, a large tensile force in the strut leads to a considerable compressive axial force in the inner wing, resulting in a reduced bending stiffness and even buckling of the wing. Studying the influence of this compressive force on the structural response of SBW is thus of paramount importance in the early stage of SBW design. The purpose of the this research is to investigate the effect of compressive force on aeroelastic stability of the SBW using efficient structural finite element and aerodynamic lifting surface methods. A procedure is developed to generate wing stiffness distribution for detailed and simplified wing models and to include the compressive force effect in the SBW aeroelastic analysis. A sensitivity study is performed to generate response surface equations for the wing flutter speed as functions of several design variables. These aeroelastic procedures and response surface equations provide a valuable tool and trend data to study the unconventional nature of SBW. In order to estimate the effect of the compressive force, the inner part of the wing structure is modeled as a beam-column. A structural finite element method is developed based on an analytical stiffness matrix formulation of a non-uniform beam element with arbitrary polynomial variations in the cross section. By using this formulation, the number of elements to model the wing structure can be reduced without degrading the accuracy. The unsteady aerodynamic prediction is based on a discrete element lifting surface method. The present formulation improves the accuracy of existing lifting surface methods by implementing a more rigorous treatment on the aerodynamic kernel integration. The singularity of the kernel function is isolated by implementing an exact expansion series to solve an incomplete cylindrical function problem. A hybrid doublet lattice/doublet point scheme is devised to reduce

  1. The Role of Correction in the Conservative Treatment of Adolescent Idiopathic Scoliosis.

    Science.gov (United States)

    Ng, Shu-Yan; Nan, Xiao-Feng; Lee, Sang-Gil; Tournavitis, Nico

    2017-01-01

    Physiotherapeutic Scoliosis-Specific Exercises (PSSE) and bracing have been found to be effective in the stabilization of curves in patients with Adolescent Idiopathic Scoliosis (AIS). Yet, the difference among the many PSSEs and braces has not been studied. The present review attempts to investigate the role of curve correction in the outcome of treatment for PSSEs and braces. A PubMed manual search has been conducted for studies on the role of correction in the effectiveness of PSSE and bracing. For the PSSEs, the key words used were "adolescent idiopathic scoliosis, correction, physiotherapy, physical therapy, exercise, and rehabilitation." For bracing, the key words used were "adolescent idiopathic scoliosis, correction and brace". Only papers that were published from 2001-2017 were included and reviewed, as there were very few relevant papers dating earlier than 2001. The search found no studies on the role of correction on the effectiveness of different PSSEs. The effectiveness of different PSSEs might or might not be related to the magnitude of curve correction during the exercises. However, many studies showed a relationship between the magnitude of in-brace correction and the outcome of the brace treatment. The role of correction on the effectiveness of PSSE has not been studied. In-brace correction, however, has been found to be associated with the outcome of brace treatment. An in-brace correction of 40-50% was associated with an increased rate of brace treatment success ( i.e . stabilization or improvement of curves). Thus, in the treatment of AIS, patients should be advised to use highly corrective braces, in conjunction with PSSE since exercises have been found to help stabilize the curves during weaning of the brace. Presently, no specific PSSE can be recommended. Braces of high in-brace correction should be used in conjunction with PSSEs in the treatment of AIS. No specific PSSE can be recommended as comparison studies of the effectiveness of

  2. Phase equilibrium data and thermodynamic modeling of the system (CO{sub 2} + biodiesel + methanol) at high pressures

    Energy Technology Data Exchange (ETDEWEB)

    Pinto, Leandro F.; Segalen da Silva, Diogo Italo [Department of Chemical Engineering, Federal University of Parana, CEP 81531-990, Curitiba, PR (Brazil); Rosa da Silva, Fabiano; Ramos, Luiz P. [Department of Chemistry, Federal University of Parana, CEP 81531-990, Curitiba, PR (Brazil); Ndiaye, Papa M. [Department of Chemical Engineering, Federal University of Parana, CEP 81531-990, Curitiba, PR (Brazil); Corazza, Marcos L., E-mail: corazza@ufpr.br [Department of Chemical Engineering, Federal University of Parana, CEP 81531-990, Curitiba, PR (Brazil)

    2012-01-15

    Highlights: > We measured phase behavior for the system involving {l_brace}CO{sub 2} + biodiesel + methanol{r_brace}. > The saturation pressures were obtained using a variable-volume view cell. > The experimental data were modeled using PR-vdW2 and PR-WS equations of state. - Abstract: The main objective of this work was to investigate the high pressure phase behavior of the binary systems {l_brace}CO{sub 2}(1) + methanol(2){r_brace} and {l_brace}CO{sub 2}(1) + soybean methyl esters (biodiesel)(2){r_brace} and the ternary system {l_brace}CO{sub 2}(1) + biodiesel(2) + methanol(3){r_brace} were determined. Biodiesel was produced from soybean oil, purified, characterized and used in this work. The static synthetic method, using a variable-volume view cell, was employed to obtain the experimental data in the temperature range of (303.15 to 343.15) K and pressures up to 21 MPa. The mole fractions of carbon dioxide were varied according to the systems as follows: (0.2383 to 0.8666) for the binary system {l_brace}CO{sub 2}(1) + methanol(2){r_brace}; (0.4201 to 0.9931) for the binary system {l_brace}CO{sub 2}(1) + biodiesel(2){r_brace}; (0.4864 to 0.9767) for the ternary system {l_brace}CO{sub 2}(1) + biodiesel(2) + methanol(3){r_brace} with a biodiesel to methanol molar ratio of (1:3); and (0.3732 to 0.9630) for the system {l_brace}CO{sub 2} + biodiesel + methanol{r_brace} with a biodiesel to methanol molar ratio of (8:1). For these systems, (vapor + liquid), (liquid + liquid), (vapor + liquid + liquid) transitions were observed. The phase equilibrium data obtained for the systems were modeled using the Peng-Robinson equation of state with the classical van der Waals (PR-vdW2) and Wong-Sandler (PR-WS) mixing rules. Both thermodynamic models were able to satisfactorily correlate the phase behavior of the systems investigated and the PR-WS presented the best performance.

  3. A modeling of radiation induced microstructural evolution under applied stress in austenitic alloys

    Energy Technology Data Exchange (ETDEWEB)

    Tanigawa, Hiroyasu; Kohyama, Akira [Kyoto Univ., Uji (Japan). Inst. of Advanced Energy; Katoh, Yutai; Kohno, Yutaka

    1996-10-01

    Effects of applied stress on interstitial type Frank loop evolution at early stages of irradiation were investigated by both numerical calculation and irradiation experiments. In the experimental part of this work, microstructural inspection has been made by transmission electron microscopy with a special emphasis on Frank loops and perfect loops on every {l_brace}111{r_brace} plane. The results of the TEM observation revealed that Frank loop concentration on a {l_brace}111{r_brace} plane increased as the resolved normal stress to a {l_brace}111{r_brace} plane increased and that small perfect loops were more likely produced on {l_brace}111{r_brace} planes where larger resolved shear stress was applied. The model of a stress effect on Frank loop unfaulting was provided, which is triggered by nucleation of a Shockley partial dislocation loop in a Frank loop, was proposed. The results of the numerical calculation was successful to predict the strong dependence of Frank loop concentration on the resolved normal stress to {l_brace}111{r_brace} plane, which was the characteristic feature seen in the irradiation experiments. (author)

  4. Patellar Tendon Repair Augmentation With a Knotless Suture Anchor Internal Brace: A Biomechanical Cadaveric Study.

    Science.gov (United States)

    Rothfeld, Alex; Pawlak, Amanda; Liebler, Stephenie A H; Morris, Michael; Paci, James M

    2018-04-01

    Patellar tendon repair with braided polyethylene suture alone is subject to knot slippage and failure. Several techniques to augment the primary repair have been described. Purpose/Hypothesis: The purpose was to evaluate a novel patellar tendon repair technique augmented with a knotless suture anchor internal brace with suture tape (SAIB). The hypothesis was that this technique would be biomechanically superior to a nonaugmented repair and equivalent to a standard augmentation with an 18-gauge steel wire. Controlled laboratory study. Midsubstance patellar tendon tears were created in 32 human cadaveric knees. Two comparison groups were created. Group 1 compared #2 supersuture repair without augmentation to #2 supersuture repair with SAIB augmentation. Group 2 compared #2 supersuture repair with an 18-gauge stainless steel cerclage wire augmentation to #2 supersuture repair with SAIB augmentation. The specimens were potted and biomechanically loaded on a materials testing machine. Yield load, maximum load, mode of failure, plastic displacement, elastic displacement, and total displacement were calculated for each sample. Standard statistical analysis was performed. There was a statistically significant increase in the mean ± SD yield load and maximum load in the SAIB augmentation group compared with supersuture alone (mean yield load: 646 ± 202 N vs 229 ± 60 N; mean maximum load: 868 ± 162 N vs 365 ± 54 N; P augmented repairs (mean yield load: 495 ± 213 N vs 566 ± 172 N; P = .476; mean maximum load: 737 ± 210 N vs 697 ± 130 N; P = .721). Patellar tendon repair augmented with SAIB is biomechanically superior to repair without augmentation and is equivalent to repair with augmentation with an 18-gauge stainless steel cerclage wire. This novel patellar tendon repair augmentation is equivalent to standard 18-gauge wire augmentation at time zero. It does not require a second surgery for removal, and it is biomechanically superior to primary repair alone.

  5. Experimental and theoretical aspects of the growth and equilibrium morphology of NaNO{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Benages Vilau, R.; Cuevas-Diarte, M.A.; Calvet i Pallas, T. [Dept. Cristallografia, Mineralogia i Diposits Minerals, Facultat de Geologia, Universitat de Barcelona (Spain); Costa, E.; Bruno, M.; Aquilano, D. [Dipartimento di Scienze Mineralogiche e Petrologiche, Torino Univ. (Italy)

    2011-08-15

    Sodium nitrate (mineral nitratine, NaNO{sub 3}, space group R anti 3c at room temperature) is a material used in a great variety of fields, such as the molten salt technology. It is also of very interest from a crystallographic point of view, being iso-structural with calcite (CaCO{sub 3}). We performed several growth experiments in aqueous solution, near-equilibrium, with the aim of finding the ideal conditions for investigating both face-by-face growth kinetics and surface characterization, as well as the influence of K{sup +} and Li{sup +} ions on the growth morphology. Single {l_brace}10.4{r_brace} rhombohedral crystals have been systematically grown from pure aqueous solution, while {l_brace}00.1{r_brace} truncated rhombohedra were obtained in the presence of K{sup +} and Li{sup +} ions in the mother solution. When determining the theoretical equilibrium morphology of NaNO{sub 3} crystals, the {l_brace}00.1{r_brace} and {l_brace}10.4{r_brace} surfaces were studied by using the 2D-slab model and relaxed and athermal surface energies (surfaces energies at T = 0 K) were evaluated at DFT level (B3LYP Hamiltonian) by using the CRYSTAL06 package. The {l_brace}00.1{r_brace} dipolar surfaces were reconstructed by the octopolar Hartman-Lacmann's model, already proposed for NaCl-like lattices. This type of reconstruction is the only one which respects the bulk symmetry of the crystal. The octopolar Na{sup +} terminated {l_brace}00.1{r_brace} form resulted to be more stable than the NO{sub 3}{sup -} terminated one. However, the {l_brace}00.1{r_brace} form does not enter the theoretical athermal equilibrium shape of nitratine crystals, being {gamma}{sub (10.4)Na}=160, {gamma}{sub (00.1)Na}= 695 and {gamma}{sub (00.1)NO3}=1535 erg/cm{sup 2}. Finally, a simple 2D-epitaxy model is proposed to explain the appearance of NaNO{sub 3}{l_brace}00.1{r_brace} truncated rhombohedra in the presence of K{sup +} and Li{sup +} ions. (copyright 2011 WILEY-VCH Verlag GmbH and Co. KGa

  6. Lattice location studies of deuterium in Pdsub(0.8)Ausub(0.2) and Ta crystals by ion channeling

    International Nuclear Information System (INIS)

    Takahashi, J.; Yamaguchi, S.; Koiwa, M.; Fujino, Y.; Yoshinari, O.; Hirabayashi, M.

    1978-01-01

    The channelling of 300 to 400 KeV deuterons combined with the D(d,p)T reaction has been used to study the lattice location of deuterium in a fcc crystal of (Pdsub(0.8)Ausub(0.2))Dsub(0.04) and a bcc crystal of TaDsub(0.10). The channelling angular distributions are measured for , , axial and brace 100 brace, brace 110 brace, brace 111 brace planar directions. It is concluded that deuterium in Pdsub(0.8)Ausub(0.2) occupies the octahedral interstice of the fcc lattice, while that in Ta occupies the tetrahedral interstice of the bcc lattice. (author)

  7. Phase equilibrium properties of binary aqueous solutions containing ethanediamine, 1,2-diaminopropane, 1,3-diaminopropane, or 1,4-diaminobutane at several temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Ahmed, Nouria Chiali-Baba [LATA2M, Laboratoire de Thermodynamique Appliquee et Modelisation Moleculaire, University AbouBekr Belkaid of Tlemcen, P.O. Box 119, Tlemcen 13000 (Algeria); Negadi, Latifa, E-mail: l_negadi@mail.univ-tlemcen.d [LATA2M, Laboratoire de Thermodynamique Appliquee et Modelisation Moleculaire, University AbouBekr Belkaid of Tlemcen, P.O. Box 119, Tlemcen 13000 (Algeria); Mokbel, Ilham; Jose, Jacques [LSA, Laboratoire des Sciences Analytiques, CNRS-UMR 5180, Universite Claude Bernard - Lyon I. 43, Bd du 11 Novembre 1918, Villeurbanne Cedex 69622 (France)

    2011-05-15

    Research highlights: Vapour pressures of ethanediamine (EDA), 1,2-diaminopropane, 1,3-diaminopropane (1,3-DAP), or 1,4-diaminobutane (1,4-DAB) aqueous solutions are reported between (293 and 363) K. The two first mixtures show negative azeotropic behaviour. The aqueous solutions of EDA, 1,2-DAP, or 1,3-DAP exhibit negative G{sup E} whereas the one containing 1,4-DAB shows either negative G{sup E} or sinusoidal shape for G{sup E}. - Abstract: The vapour pressures of {l_brace}ethanediamine (EDA) + water{r_brace}, {l_brace}1,2-diaminopropane (1,2-DAP) + water{r_brace}, {l_brace}1,3-diaminopropane (1,3-DAP) + water{r_brace} or {l_brace}1,4-diaminobutane (1,4-DAB) + water{r_brace} binary mixtures, and of pure EDA, 1,2-DAP, 1,3-DAP, 1,4-DAB, and water components were measured by means of two static devices at temperatures between (293 and 363) K. The data were correlated with the Antoine equation. From these data, the excess Gibbs function (G{sup E}) was calculated for several constant temperatures and fitted to a fourth-order Redlich-Kister equation using the Barker's method. The {l_brace}ethanediamine (EDA) + water{r_brace}, and {l_brace}1,2-diaminopropane (1,2-DAP) + water{r_brace} binary systems show negative azeotropic behaviour. The aqueous solutions of EDA, 1,2-DAP, or 1,3-DAP exhibit negative deviations in G{sup E} for all investigated temperatures over the whole composition range whereas the (1,4-DAB + water) binary mixture shows negative G{sup E} for temperatures (293.15 < T/K < 353.15) and a sinusoidal shape for G{sup E} at T = 363.15 K.

  8. Influência da utilização da órtese de tornozelo durante atividades do voleibol: avaliação eletromiográfica Influencia de la utilización de la ortesis del tobillo durante las actividades del voleibol: evaluación electromiográfica Use of ankle bracing for volleyball activities

    Directory of Open Access Journals (Sweden)

    Jefferson Rosa Cardoso

    2005-10-01

    évias en el miembro dominante. Fué colectada la contracción isométrica voluntaria máxima (CIVM de cada músculo y, en seguida, la actividad electromiográfica en diferentes situaciones con y sin la ortesis, en orden aleatoria. La ortesis utilizada poseía apoyos laterales. La señal electromiográfico fué cuantificado por la raiz cuadrada de la média (RMS y normalizado por la CIVM. Se realizó un análisis de la varianza de las medidas repetidas para verificar la diferencia de la actividad eléctrica de los músculos envueltos en cada actividad, con o sin ortesis, con significación estadística de 5% (p The ankle sprain is the most frequently found acute injury in volleyball. Aiming to prevent the occurrence of ankle injuries, prophylactic equipment as the bracing had been developed. This study had the purpose to evaluate the performance of the ankle muscles (tibialis anterior, peroneous longus, and medial and lateral gastrocnemius by measuring the electrical activity in different volleyball activities (vertical jumping and lateral shuffling with and without using ankle bracing. Nine young female volleyball athletes with ages ranging from 14 to 17 years (: 15.8 ± 1.3 were evaluated, all of them without previous injuries in the dominant member. Maximal voluntary isometric contractions (MVIC of each muscle was collected, and after that, the electromyographic activity in different situations with and without using the bracing, randomly. The bracing used had two lateral supports. The electromyographic signal was quantified by the root mean square (RMS, and normalized by the MVIC. Analysis of the variance with repeated measurement was used to verify the difference of the electric activity of the muscles involved in each activity, with and without using the bracing, with 5% (p < 0.05 significance level. It was identified a statistically significant difference in phase I of the jumping in favor of the tibialis anterior (p < 0.001 and in phase II in favor of the three

  9. Idiopatiske skolioser behandlet med Boston-korset

    DEFF Research Database (Denmark)

    Andersen, M O; Andersen, G R; Kruuse, A M

    1993-01-01

    It is well known that Boston bracing may stop progression in many patients with minor curves. One hundred and thirty-eight patients were treated with the Boston brace for idiopathic scoliosis. Age was 14.1 +/- 1.6 years at the time of bracing, and the length of time spent in the brace was 2.6 +/- 1...

  10. Quaternionic representation of the Coxeter group W(H{sub 4}) and the polyhedra

    Energy Technology Data Exchange (ETDEWEB)

    Koca, Mehmet [Department of Physics, College of Science, Sultan Qaboos University, PO Box 36, Al-Khod 123, Muscat (Oman); Al-Ajmi, Mudhahir [Department of Physics, College of Science, Sultan Qaboos University, PO Box 36, Al-Khod 123, Muscat (Oman); Koc, Ramazan [Department of Physics, Faculty of Engineering, University of Gaziantep, 27310 Gaziantep (Turkey)

    2006-11-10

    The vertices of the four-dimensional polytope {l_brace}3, 3, 5{r_brace} and its dual {l_brace}5, 3, 3{r_brace} admitting the symmetry of the non-crystallographic Coxeter group W(H{sub 4}) of order 14,400 are represented in terms of quaternions with unit norm where the polytope {l_brace}3, 3, 5{r_brace} is represented by the elements of the binaryicosahedral group of quaternions of order 120. We projected the polytopes to three-dimensional Euclidean space where the quaternionic vertices are the orbits of the Coxeter group W(H{sub 3}), icosahedral group with inversion, where W(H{sub 3}) x Z{sub 2} is one of the maximal subgroups of the Coxeter group W(H{sub 4}). The orbits of the icosahedral group W(H{sub 3}) in the polytope {l_brace}3, 3, 5{r_brace} are the conjugacy classes of the binary icosahedral group and represent a number of icosahedrons, dodecahedrons and one icosidodecahedron in three dimensions. The 15 orbits of the icosahedral group W(H{sub 3}) in the polytope {l_brace}5, 3, 3{r_brace} represent the dodecahedrons, icosidodecahedrons, small rhombicosidodecahedrons and some convex solids possessing the icosahedral symmetry. One of the convex solids with 60 vertices is very similar to the truncated icosahedron (soccer ball) but with two different edge lengths which can be taken as a realistic model of the C{sub 60} molecule at extreme temperature and pressure.

  11. Radiochemical synthesis of etomoxir

    Energy Technology Data Exchange (ETDEWEB)

    Abbas, Hafiz G. [Institute of Nuclear Medicine and Oncology (INMOL), New Campus Road, Lahore (Pakistan); Yunus, M. [University of the Punjab, New Campus Road, Lahore (Pakistan); Feinendegen, Ludwig E., E-mail: feinendegen@gmx.ne [Department of Nuclear Medicine, Heinrich-Heine University Duesseldorf, Wannental 45, 88131 Lindau (Germany)

    2011-02-15

    Sodium 2-{l_brace}6-(4-chlorophenoxy)hexyl{r_brace}oxirane-2-carboxylate (Etomoxir) inhibits transport of fatty acids via the carnitine shuttle into mitochondria of muscle cells and prevents long chain fatty acids from providing energy through {beta}-oxidation especially for muscle contraction. The objective of this synthesis is to develop a method for radioiodination of Etomoxir in order to explore its potential in diagnostic metabolic studies and molecular imaging. Thus, a method is described for the radiochemical synthesis and purification of ethyl 2-{l_brace}6-(4-[{sup 131}I]iodophenoxy)hexyl{r_brace}oxirane-2-carboxylate (3) and 2-{l_brace}6-(4-[{sup 131}I]iodo-phenoxy)hexyl{r_brace}oxirane-2-carboxylic acid (4). For the synthesis of these new agents, ethyl 2-{l_brace}6-(4-bromophenoxy)hexyl{r_brace}oxirane-2-carboxylate (1) and 2-{l_brace}6-(4-bromophenoxy)hexyl{r_brace}oxirane-2-carboxylic acid (2) were refluxed with [{sup 131}I]NaI in the presence of anhydrous acetone at a temperature of 80 {sup o}C and 90 {sup o}C for a period of 3-4 hours, respectively. The method of radiolabeling, based on the nucleophilic exchange reaction, resulted in a radiochemical yield of 43% and 67% for compounds 3 and 4, respectively. This paper reports on the labeling of etomoxir with radioiodine as {sup 124}I labeled etomoxir may be of great importance in molecular imaging.

  12. Novel N-benzoyltyramines of Swinglea glutinosa (Rutaceae); Novas N-benzoiltiraminas de Swinglea glutinosa (Rutaceae).

    Energy Technology Data Exchange (ETDEWEB)

    Cerqueira, Cristovam do Nascimento; Santos, Djalma A.P. dos; Malaquias, Karla da Silva; Lima, Murilo Marinho de Castro; Silva, Maria Fatima das Gracas Fernandes da; Fernandes, Joao Batista; Vieira, Paulo Cezar, E-mail: dmfs@ufscar.br [Universidade Federal de Sao Carlos (UFSCAR), SP (Brazil). Dept. de Quimica

    2012-07-01

    Phytochemical studies of the leaves and fruits have led to the identification of the known amides (E)-N-methyl-cinnamamide, N-benzoyltyramine, N-benzoyl-O-geranyl tyramine, N-benzoyl-O-(4-acetoxyl)-geranyl tyramine, in addition to the new N-{l_brace}2-[4-(butoxyl-3-one)phenyl]ethyl{r_brace}benzamide, N-{l_brace}2-[4-(2,3-dihydroxy-2-methyl-butoxylanal)phenyl]ethyl{r_brace}benzamide, N-{l_brace}2-[4-(2,3-dihydroxy-2-methyl-butoxyloic) phenyl]ethyl{r_brace}benzamide, N-benzoyl-O-(4-acetoxyl-6,7-epoxy)-geranyltyramine, N-benzoyl-O-(4-acetoxyl-6,7-dihydroxy)-geranyltyramine and N-benzoyl-O-(6-acetoxyl-4,7-dihydroxy)-geranyltyramine. The isolated compounds clearly point to Swinglea phytochemical affinities with other Aurantioideae species. (author)

  13. Restoring force characteristics of the steel frames of nuclear power station buildings, (1)

    International Nuclear Information System (INIS)

    Nakamura, N.; Tomura, H.; Takahashi, Y.; Saeki, T.; Tanaka, N.; Inada, Y.; Hirotani, T.

    1991-01-01

    In this paper, by using data obtained in experiments on reduced scale specimens of actual size of X type braces and by analyzing data previously obtained from K type brace experiments, we will propose simple and practical restoring force characteristics models of both types of the braces in the steel framed buildings. X and K type braces are the principal earthquake resistant elements in the steel frames of nuclear power station buildings. Therefore the results of past research and experiments were examined, and 11 reduced scale models simulating actual X type braced frames were subjected to static lateral loading tests. The simple and practical restoring force characteristics models were proposed for the design of the X and K braces. (J.P.N.)

  14. Novel morphology of chemical vapor deposited diamond films

    Energy Technology Data Exchange (ETDEWEB)

    Tang, C.J. [I3N and Department of Physics, University of Aveiro (Portugal); Jiangsu Key Laboratory for Advanced Functional Materials and Department of Physics, Changshu Institute of Technology, Changshu (China); TEMA and Department of Mechanical Engineering, University of Aveiro (Portugal); Fernandes, A.J.S.; Abe, I.; Pinto, J.L. [I3N and Department of Physics, University of Aveiro (Portugal); Gracio, J. [TEMA and Department of Mechanical Engineering, University of Aveiro (Portugal); Buijnsters, J.G. [Institute for Molecules and Materials (IMM), Radboud University Nijmegen (Netherlands)

    2010-04-15

    We have obtained simultaneously nanocrystalline and {l_brace}100{r_brace} faceted large-grained polycrystalline diamond films not only on different substrates but also on the same substrate in only one deposition run using a novel approach for substrate arrangement. Furthermore, interesting unusual morphologies and microstructures composed by non-faceted nanostructures and terminated with large smooth {l_brace}100{r_brace} facet-like belt are found near the edges of the top square sample. The morphology variation is likely caused by the so called edge effect, where a strong variation in temperature is also present. We have modelled the temperature distribution on the substrates by computer simulations using the finite element method. The novel feature, namely the coexistence of oval non-faceted nanocrystalline diamond grains and large smooth {l_brace}100{r_brace} facet-like belt in one diamond grain, is in the transition from {l_brace}100{r_brace} faceted polycrystalline diamond to cauliflower-like nanocrystalline diamond. The formation mechanism is discussed based on the temperature analysis and other simulation results described in the literature. (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  15. Severe psychogenic tremor of both wrists in a 13-year-old girl treated successfully with a customized wrist brace: a case report

    Directory of Open Access Journals (Sweden)

    Schafflhuber Caroline

    2011-04-01

    Full Text Available Abstract Introduction Psychogenic movement disorders in childhood have been little researched. As there are few courses of treatment which have been evaluated, further examination and case studies about the treatment and clinical course of this rare occurrence of severe psychogenic tremor in childhood and adolescence are much needed. Case presentation A 13-year-old Caucasian girl with tremor in both wrists, severe enough to prevent her from attending school, was sent to our hospital. After a complete neurological and psychiatric examination, in-patient child-psychotherapeutic treatment was started, with careful consideration given to both chronic and acute stress factors which constitute her performance and exam anxiety in school as well as the girl's parents' conflicted relationship. With the aid of a customized wrist brace our patient was able to go to school and write despite the presence of a marked tremor, which in turn reduced her avoidance behavior and exam anxiety. By the end of her in-patient treatment, the tremor was still noticeable, but markedly reduced in severity (reduction 80%. Two weeks after she was discharged from hospital, the tremor had completely disappeared. Conclusion After careful clinical diagnostics, this kind of dissociative disorder should be treated appropriately with age-adapted cognitive-behavioral therapy to achieve positive and lasting benefits.

  16. Deformation of wrought uranium: Experiments and modeling

    Energy Technology Data Exchange (ETDEWEB)

    McCabe, R.J., E-mail: rmccabe@lanl.gov [Materials Science and Technology Division, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Capolungo, L. [Materials Science and Technology Division, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)] [UMI 2958 Georgia Tech - CNRS, 57070 Metz (France); Marshall, P.E.; Cady, C.M.; Tome, C.N. [Materials Science and Technology Division, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)

    2010-09-15

    The room temperature deformation behavior of wrought polycrystalline uranium is studied using a combination of experimental techniques and polycrystal modeling. Electron backscatter diffraction is used to analyze the primary deformation twinning modes for wrought alpha-uranium. The {l_brace}1 3 0{r_brace}<3 1 0> twinning mode is found to be the most prominent twinning mode, with minor contributions from the '{l_brace}1 7 2{r_brace}'<3 1 2> and {l_brace}1 1 2{r_brace}'<3 7 2>' twin modes. Because of the large number of deformation modes, each with limited deformation systems, a polycrystalline model is employed to identify and quantify the activity of each mode. Model predictions of the deformation behavior and texture development agree reasonably well with experimental measures and provide reliable information about deformation systems.

  17. Stress concentration factors at saddle and crown positions on the central brace of two-planar welded CHS DKT-connections

    Science.gov (United States)

    Ahmadi, Hamid; Lotfollahi-Yaghin, Mohammad Ali; Aminfar, Mohammad H.

    2012-03-01

    A set of parametric stress analyses was carried out for two-planar tubular DKT-joints under different axial loading conditions. The analysis results were used to present general remarks on the effects of the geometrical parameters on stress concentration factors (SCFs) at the inner saddle, outer saddle, and crown positions on the central brace. Based on results of finite element (FE) analysis and through nonlinear regression analysis, a new set of SCF parametric equations was established for fatigue design purposes. An assessment study of equations was conducted against the experimental data and original SCF database. The satisfaction of acceptance criteria proposed by the UK Department of Energy (UK DoE) was also checked. Results of parametric study showed that highly remarkable differences exist between the SCF values in a multi-planar DKT-joint and the corresponding SCFs in an equivalent uni-planar KT-joint having the same geometrical properties. It can be clearly concluded from this observation that using the equations proposed for uni-planar KT-connections to compute the SCFs in multi-planar DKT-joints will lead to either considerably under-predicting or over-predicting results. Hence, it is necessary to develop SCF formulae specially designed for multi-planar DKT-joints. Good results of equation assessment according to UK DoE acceptance criteria, high values of correlation coefficients, and the satisfactory agreement between the predictions of the proposed equations and the experimental data guarantee the accuracy of the equations. Therefore, the developed equations can be reliably used for fatigue design of offshore structures.

  18. Assessing the standards of online oral hygiene instructions for patients with fixed orthodontic appliances

    NARCIS (Netherlands)

    Verhoef, Willem A.; Livas, Christos; Delli, Konstantina; Ren, Yijin

    Background. The authors conducted this study to assess the quality of the information available on the Web about oral hygiene for patients with fixed orthodontic appliances. Methods. The authors entered the search terms "cleaning braces," " brushing braces," and "oral hygiene and braces" into

  19. Precipitation in partially stabilized zirconia

    International Nuclear Information System (INIS)

    Bansal, G.K.

    1975-01-01

    Transmission electron microscopy was used to study the substructure of partially stabilized ZrO 2 (PSZ) samples, i.e., 2-phase systems containing both cubic and monoclinic modifications of zirconia, after various heat treatments. Monoclinic ZrO 2 exists as (1) isolated grains within the polycrystalline aggregate (a grain- boundary phase) and (2) small plate-like particles within cubic grains. These intragranular precipitates are believed to contribute to the useful properties of PSZ via a form of precipitation hardening. These precipitates initially form as tetragonal ZrO 2 , with a habit plane parallel to the brace 100 brace matrix planes. The orientation relations between the tetragonal precipitates and the cubic matrix are brace 100 brace/sub matrix/ 2 parallel brace 100 brace /sub precipitate/ or (001)/sub precipitate/ and broken bracket 100 broken bracket/sub matrix/ 2 parallel broken bracket 100 broken bracket/sub precipitate/ or [001]/sub precipitate/. (U.S.)

  20. A functional comparison of conventional knee-ankle-foot orthoses and a microprocessor-controlled leg orthosis system based on biomechanical parameters.

    Science.gov (United States)

    Schmalz, Thomas; Pröbsting, Eva; Auberger, Roland; Siewert, Gordon

    2016-04-01

    The microprocessor-controlled leg orthosis C-Brace enables patients with paretic or paralysed lower limb muscles to use dampened knee flexion under weight-bearing and speed-adapted control of the swing phase. The objective of the present study was to investigate the new technical functions of the C-Brace orthosis, based on biomechanical parameters. The study enrolled six patients. The C-Brace orthosis is compared with conventional leg orthoses (four stance control orthoses, two locked knee-ankle-foot orthoses) using biomechanical parameters of level walking, descending ramps and descending stairs. Ground reaction forces, joint moments and kinematic parameters were measured for level walking as well as ascending and descending ramps and stairs. With the C-Brace, a nearly natural stance phase knee flexion was measured during level walking (mean value 11° ± 5.6°). The maximum swing phase knee flexion angle of the C-Brace approached the normal value of 65° more closely than the stance control orthoses (66° ± 8.5° vs 74° ± 6.4°). No significant differences in the joint moments were found between the C-Brace and stance control orthosis conditions. In contrast to the conventional orthoses, all patients were able to ambulate ramps and stairs using a step-over-step technique with C-Brace (flexion angle 64.6° ± 8.2° and 70.5° ± 12.4°). The results show that the functions of the C-Brace for situation-dependent knee flexion under weight bearing have been used by patients with a high level of confidence. The functional benefits of the C-Brace in comparison with the conventional orthotic mechanisms could be demonstrated most clearly for descending ramps and stairs. The C-Brace orthosis is able to combine improved orthotic function with sustained orthotic safety. © The International Society for Prosthetics and Orthotics 2014.

  1. Hardness and depth-dependent microstructure of ion-irradiated MgAl2O4

    International Nuclear Information System (INIS)

    Zinkle, S.J.

    1988-01-01

    Stoichiometric polycrystalline magnesium aluminate spinel has been irradiated at 25 and 650/degree/C with 2.4 MeV Mg/sup plus/ ions to a fluence of 1.4 /times/ 10 21 ions/m 2 (/approximately/35 dpa peak damage level). Microindentation hardness measurements and transmission electron microscopy combined with energy dispersive X-ray spectroscopy measurements were used to characterize the irradiation effects. The room-temperature hardness of spinel increased by about 5% after irradiation at both temperatures. There was no evidence for amorphization at either irradiation temperature. Interstitial-type dislocations loops lying on /l brace/110/r brace/ and /l brace/111/r brace/ planes with Burgers vectors were observed at intermediate depths (/approximately/1 μm) along the ion range. The /l brace/111/r brace/ loops are presumably formed from /l brace/111/r brace/ loops as a result of a shear on the anion sublattice. Only about 0.05% of the calculated displacements were visible in the form of loops, which indicates that spinel has a high resistance to aggregate damage accumulation. The peak damage region contained a high density of dislocations tangles. There was no evidence for the formation of voids or vacancy loops. The specimen irradiated at 650/degree/C was denuded of dislocation loops within /approximately/1 μm of the surface. 25 refs., 16 figs., 5 tabs

  2. A study of semi-rigid support on ankle supination sprain kinematics.

    Science.gov (United States)

    Tang, Y M; Wu, Z H; Liao, W H; Chan, K M

    2010-12-01

    Ankle sprain injury is very common in sports and the use of ankle support is crucial. This research investigated the effect of an ankle brace in reducing the ankle angular displacement and angular velocity during sudden supination. In the experiment, 11 healthy males were tested. The bracing condition, semi-rigid ankle braces were investigated. The angular displacement and angular velocity of the ankle were computed. The motion-capture system was adopted to capture the three-dimensional coordinates of the reflective markers. The coordinates of the reflective markers were used to compute the ankle kinematics during simulated ankle supination. A mechanical supination platform was used to simulate the sprain motions. Experimental results showed that the semi-rigid brace tested significantly reduced the ankle angular displacement and angular velocity compared with control conditions during sudden supination. In conclusion, the semi-rigid-type brace can provide significant restriction to reduce the magnitudes of the angular displacement and angular velocity of the ankle during sudden supination sprain. The semi-rigid-type brace is suggested as the prophylactic bracing for the ankle. © 2009 John Wiley & Sons A/S.

  3. Quantum oscillations in quasi-two-dimensional conductors

    CERN Document Server

    Galbova, O

    2002-01-01

    The electronic absorption of sound waves in quasi-two-dimensional conductors in strong magnetic fields, is investigated theoretically. A longitudinal acoustic wave, propagating along the normal n-> to the layer of quasi-two-dimensional conductor (k-> = left brace 0,0,k right brace; u-> = left brace 0,0,u right brace) in magnetic field (B-> = left brace 0, 0, B right brace), is considered. The quasiclassical approach for this geometry is of no interest, due to the absence of interaction between electromagnetic and acoustic waves. The problem is of interest in strong magnetic field when quantization of the charge carriers energy levels takes place. The quantum oscillations in the sound absorption coefficient, as a function of the magnetic field, are theoretically observed. The experimental study of the quantum oscillations in quasi-two-dimensional conductors makes it possible to solve the inverse problem of determining from experimental data the extrema closed sections of the Fermi surface by a plane p sub z = ...

  4. A family of fractal sets with Hausdorff dimension 0.618

    Energy Technology Data Exchange (ETDEWEB)

    Zhong Ting [Information Management and Engineering Institute, Jishou University, Zhangjiajie 427000, Hunan (China)], E-mail: zhongting_2005@126.com

    2009-10-15

    In this paper, we introduce a class of fractal sets, which can be recursively constructed by two sequences {l_brace}n{sub k}{r_brace}{sub k{>=}}{sub 1} and {l_brace}c{sub k}{r_brace}{sub k{>=}}{sub 1}. We obtain the exact Hausdorff dimensions of these types of fractal sets using the continued fraction map. Connection of continued fraction with El Naschie's fractal spacetime is also illustrated. Furthermore, we restrict one sequence {l_brace}c{sub k}{r_brace}{sub k{>=}}{sub 1} to make every irrational number {alpha} element of (0, 1) correspond to only one of the above fractal sets called {alpha}-Cantor sets, and we found that almost all {alpha}-Cantor sets possess a common Hausdorff dimension of 0.618, which is also the Hausdorff dimension of the one-dimensional random recursive Cantor set and it is the foundation stone of E-infinity fractal spacetime theory.

  5. Structural archetypes in nickel(II) hybrid vanadates. Towards a directed hydrothermal synthesis

    Energy Technology Data Exchange (ETDEWEB)

    Luis, R. Fernandez de; Urtiaga, M.K. [Dpto. Mineralogia y Petrologia, Facultad de Ciencia y Tecnologia, Universidad del Pais Vasco/UPV/EHU, Apdo. 644, 48080 Bilbao (Spain); Mesa, J.L.; Rojo, T. [Dpto. Quimica Inorganica, Facultad de Ciencia y Tecnologia, Universidad del Pais Vasco UPV/EHU, Apdo. 644, 48080 Bilbao (Spain); Arriortua, M.I. [Dpto. Mineralogia y Petrologia, Facultad de Ciencia y Tecnologia, Universidad del Pais Vasco/UPV/EHU, Apdo. 644, 48080 Bilbao (Spain)], E-mail: maribel.arriortua@ehu.es

    2009-07-01

    In the present work, we relate the modifications of the initial synthesis parameters (pH value, stoichiometry and concentration) with the different structural archetypes obtained in the {l_brace}Ni/Bpy/VO{r_brace} and {l_brace}Ni/Bpe/VO{r_brace} systems (4,4'-bipyridine (Bpy), 1,2-di(4-pyridyl) ethylene (Bpe)). The vanadium coordination is partially controlled by the hydrothermal synthesis conditions, and the final crystal structures depend on the synergetic interaction between the metal-organic subnets and the vanadium oxide subunits.

  6. Controlled growth and shape formation of platinum nanoparticles and their electrochemical properties

    Energy Technology Data Exchange (ETDEWEB)

    Inaba, Minoru [Department of Molecular Science and Technology, Faculty of Engineering, Doshisha University, Kyotanabe, Kyoto 610-0321 (Japan)]. E-mail: minaba@mail.doshisha.ac.jp; Ando, Miwa [Department of Molecular Science and Technology, Faculty of Engineering, Doshisha University, Kyotanabe, Kyoto 610-0321 (Japan); Hatanaka, Aoi [Department of Molecular Science and Technology, Faculty of Engineering, Doshisha University, Kyotanabe, Kyoto 610-0321 (Japan); Nomoto, Akihiro [Kyoto Prefecture Collaboration of Regional Entities, Keihanna Interaction Plaza Inc., Seika-cho, Soraku-gun, Kyoto 619-0237 (Japan); Faculty of Engineering, Osaka Prefecture University, Sakai, Osaka 669-8531 (Japan); Matsuzawa, Koichi [Kyoto Prefecture Collaboration of Regional Entities, Keihanna Interaction Plaza Inc., Seika-cho, Soraku-gun, Kyoto 619-0237 (Japan); Tasaka, Akimasa [Department of Molecular Science and Technology, Faculty of Engineering, Doshisha University, Kyotanabe, Kyoto 610-0321 (Japan); Kinumoto, Taro [Graduate School of Engineering, Kyoto University, Nishikyo-ku, Kyoto 615-8510 (Japan); Iriyama, Yasutoshi [Graduate School of Engineering, Kyoto University, Nishikyo-ku, Kyoto 615-8510 (Japan); Ogumi, Zempachi [Graduate School of Engineering, Kyoto University, Nishikyo-ku, Kyoto 615-8510 (Japan)

    2006-12-01

    Cubic Pt nanoparticles were prepared from a solution of K{sub 2}PtCl{sub 4} containing sodium polyacrylate as a capping reagent. The effects of the Pt/polymer molar ratio, the average molecular weight (M {sub w}) of the polymer, and reaction temperature on the shape and size were investigated. When the polymer of M {sub w} = 5100 was added at a molar ratio of Pt/polymer = 1/12, cubic platinum nanoparticles of an average size of 10.3 nm were predominantly formed (ca. 50% in number) at 25 deg. C. The electron diffraction pattern of the cubic nanoparticles revealed that they are single crystals with Pt {l_brace}1 0 0{r_brace} faces on the surface. The cubic nanoparticles were electrochemically active, and showed strong features of Pt {l_brace}1 0 0{r_brace} faces on cyclic voltammogram under argon atmosphere. After repeated potential cycling in the range 0.05-1.4 V, the features of Pt {l_brace}1 0 0{r_brace} were gradually lost, and changed to those of polycrystalline Pt. Rotating ring disk electrode measurements in O{sub 2}-saturated H{sub 2}SO{sub 4} solution revealed that the cubic nanoparticles had a high catalytic activity for oxygen reduction reaction (ORR). After polycrystallization by repeated potential cycling, the activity for ORR and hydrogen peroxide formation decreased slightly, which were attributed to the surface structural change from Pt {l_brace}1 0 0{r_brace} to polycrystalline.

  7. High resolution transmission electron microscopy study on the development of nanostructured precipitates in Al-Cu obtained by mechanical alloying

    Energy Technology Data Exchange (ETDEWEB)

    Gomez-Villalba, L.S., E-mail: luzgomez@geo.ucm.es [Materials Science and Engineering Department, Universidad Carlos III de Madrid, Leganes, Madrid (Spain); Instituto de Geociencias-(CSIC-UCM), Madrid (Spain); Delgado, M.L.; Ruiz-Navas, E.M. [Materials Science and Engineering Department, Universidad Carlos III de Madrid, Leganes, Madrid (Spain)

    2012-01-16

    Highlights: Black-Right-Pointing-Pointer Development of defect structures and nanoprecipitates after 10 h of mechanical alloying in Al-Cu system. Black-Right-Pointing-Pointer Defects act as nucleation sites of the {epsilon}Al{sub 2}Cu{sub 3} phase. Black-Right-Pointing-Pointer Incoherent and semicoherent precipitates are identified by TEM-HRTEM. Black-Right-Pointing-Pointer Moire patterns are associated to the {epsilon}Al{sub 2}Cu{sub 3} phase. - Abstract: Aluminum alloy 2014 is used to obtain nanostructured powders via mechanical alloying. The evolution of the diffusion processes is observed by the development of defect structures and nanoprecipitates after 10 h of milling. The characterization includes analytical and high resolution transmission electron microscopy. Dislocations associated with different Al/Cu ratio affect the material. These defects act as nucleation sites where precipitates of the {epsilon}Al{sub 2}Cu{sub 3} hexagonal phase have been identified. Moire fringes show the interference of {l_brace}1 1 1{r_brace}{sub Al} with {l_brace}10{sup -}10{r_brace}{sub {epsilon}Al{sub 2Cu{sub 3}}} glide planes and locally small shifts of 1/3{l_brace}1 1 1{r_brace}{sub Al} and 1/3{l_brace}10{sup -}10{r_brace}{sub {epsilon}Al{sub 2Cu{sub 3}}}. Changes in the Al/Cu ratio lead to the formation of other solid solutions identified in the Cu rich area and could correspond to transition phases.

  8. Formation of recrystallization textures after hot working of AA2014 and AA6063

    Energy Technology Data Exchange (ETDEWEB)

    Geertruyden, W.H. van; Misiolek, W.Z. [Inst. for Metal Forming, Lehigh Univ., Bethlehem, PA (United States); Goncalves, M.; Szilagyi, G. [IPT-Dimet, Cidade Universitara, Sao Paulo-SP (Brazil); Nowell, M. [TSL/EDAX, Draper, UT (United States)

    2002-07-01

    This paper involves the investigation of the material response of two commercial aluminum alloys, 2014 and 6063, to thermo-mechanical processing parameters and the subsequent effects on the recrystallization behavior. Samples of the 2014 and 6063 alloys were hot rolled at 350, 400, 480, and 500 C to reductions of 50% and 75%. The samples were subsequently solutionized at 500 C (2014) and 525 C (6063) for 1 hour. Light optical microscopy (LOM) was performed which showed increased recrystallization kinetics in the 6063 alloy relative to the 2014 alloy. The solutionized samples of the 2014 alloy showed a banded microstructure indicating recrystallization was inhibited in the normal direction. The microtexture of the samples was characterized using electron backscatter diffraction (EBSD). Orientation distribution functions (ODF) and pole figures showed that the 6063 alloy displayed a copper rolling texture {l_brace}112{r_brace} left angle 111 right angle and an increasing cube recrystallization texture {l_brace}001{r_brace} left angle 100 right angle as the deformation temperature was increased. At low deformation temperatures, the 2014 alloy had a mixed Goss {l_brace}110{r_brace} left angle 001 right angle and Brass {l_brace}011{r_brace} left angle 211 right angle texture, while at higher temperatures and reductions the Brass component was very strong. The 2014 recrystallized texture was predominantly a cube texture rotated 45 degrees about the normal direction. (orig.)

  9. Does different duration of non-operative immobilization have an effect on the redislocation rate of primary patellar dislocation?

    DEFF Research Database (Denmark)

    Kaewkongnok, Bo; Bøvling, Anders; Milandt, Nikolaj

    2018-01-01

    BACKGROUND: Immobilization devices such as plaster splints, casts and braces have been used for first time patellar dislocation (FTPD) in order to prevent redislocation. This study evaluates different non-operative immobilization regimes upon rates of redislocation. METHODS: A retrospective cohort...... study with a study population of 1366 in which 601 subjects under 30years with FTPD were included from three hospitals. Exclusion criteria were osteochondral fracture, ligament injury and subluxation. Subjects were divided into five groups; unknown/none, two weeks of brace, two weeks of brace followed...... by bandage, four weeks of brace and six weeks of brace with increasing of range of motion. Radiographs were evaluated for trochlear dysplasia (TD), patella alta, trochlear depth and growth zone. Crude analysis and logistic regression adjusted for radiographic assessments, age, gender and rehabilitation...

  10. The predictive value of extensor grip test for the effectiveness of treatment for tennis elbow

    International Nuclear Information System (INIS)

    Zehtab, Mohammad J.; Mirghasemi, A.; Majlesara, A.; Siavashi, B.; Tajik, P.

    2008-01-01

    Objective was to compare the effectiveness of 5 different modalities and determine the usefulness of recently proposed extensor grip test (EGT) in predicting the response to treatment. In a randomized controlled clinical trial, 92 of 98 tennis elbow patients in Sina Hospital Tehran, Iran between 2006 and 2007 fulfilled the trial entry criteria. Among these patients 56 (60.9%) had positive EGT results, were randomly allocated to 5 treatment groups: brace, physiotherapy, brace plus physiotherapy, injection and injection plus physiotherapy. Patients with a positive EGT result had better response to treatments. Among them, injection plus physiotherapy was the most successful, then brace plus physiotherapy was the worst treatment modality. Response to treatment was comparable in all groups between EGT positive and negative patients except bracing, in which positive EGT was correlated with dramatic response to treatment. In all patients, injection plus physiotherapy and the brace plus physiotherapy is recommended, but in EGT negatives, bracing seems to be of no use. Injection alone is not recommended in either group. (author)

  11. Resistive effects on helicity-wave current drive generated by Alfven waves in tokamak plasmas

    Energy Technology Data Exchange (ETDEWEB)

    Bruma, C.; Cuperman, S.; Komoshvili, K. [Tel Aviv Univ. (Israel). Faculty of Exact Sciences

    1997-05-01

    This work is concerned with the investigation of non-ideal (resistive) MHD effects on the excitation of Alfven waves by externally launched fast-mode waves, in simulated tokamak plasmas; both continuum range, CR ({l_brace}{omega}{sub Alf}(r){r_brace}{sub min} < {omega} < {l_brace}{omega}{sub Alf}(r){r_brace}{sub max}) and discrete range, DR, where global Alfven eigenmodes, GAEs ({omega} < {l_brace}{sub Alf}(r){r_brace}{sub min}) exist, are considered. (Here, {omega}{sub Alf}(r) {identical_to} {omega}{sub Alf}[n(r), B{sub 0}(r)] is an eigenfrequency of the shear Alfven wave). For this, a cylindrical current carrying plasma surrounded by a helical sheet-current antenna and situated inside a perfectly conducting shell is used. Toroidicity effects are simulated by adopting for the axial equilibrium magnetic field component a suitable radial profile; shear and finite relative poloidal magnetic field are properly accounted for. A dielectric tensor appropriate to the physical conditions considered in this paper is derived and presented. (author).

  12. Adhesives for bonded molar tubes during fixed brace treatment.

    Science.gov (United States)

    Millett, Declan T; Mandall, Nicky A; Mattick, Rye Cr; Hickman, Joy; Glenny, Anne-Marie

    2017-02-23

    Orthodontic treatment involves using fixed or removable appliances (dental braces) to correct the positions of teeth. The success of a fixed appliance depends partly on the metal attachments (brackets and bands) being glued to the teeth so that they do not become detached during treatment. Brackets (metal squares) are usually attached to teeth other than molars, where bands (metal rings that go round each tooth) are more commonly used. Orthodontic tubes (stainless steel tubes that allow wires to pass through them), are typically welded to bands but they may also be glued directly (bonded) to molars. Failure of brackets, bands and bonded molar tubes slows down the progress of treatment with a fixed appliance. It can also be costly in terms of clinical time, materials and time lost from education/work for the patient. This is an update of the Cochrane review first published in 2011. A new full search was conducted on 15 February 2017 but no new studies were identified. We have only updated the search methods section in this new version. The conclusions of this Cochrane review remain the same. To evaluate the effectiveness of the adhesives used to attach bonded molar tubes, and the relative effectiveness of the adhesives used to attach bonded molar tubes versus adhesives used to attach bands, during fixed appliance treatment, in terms of: (1) how often the tubes (or bands) come off during treatment; and (2) whether they protect the bonded (or banded) teeth against decay. The following electronic databases were searched: Cochrane Oral Health's Trials Register (to 15 February 2017), the Cochrane Central Register of Controlled Trials (CENTRAL; 2017, Issue 1) in the Cochrane Library (searched 15 February 2017), MEDLINE Ovid (1946 to 15 February 2017), and Embase Ovid (1980 to 15 February 2017). We searched ClinicalTrials.gov and the World Health Organization International Clinical Trials Registry Platform for ongoing trials. No restrictions were placed on the language or

  13. Atomic structures and compositions of internal interfaces

    Energy Technology Data Exchange (ETDEWEB)

    Seidman, D.N. (Northwestern Univ., Evanston, IL (United States). Dept. of Materials Science and Engineering); Merkle, K.L. (Argonne National Lab., IL (United States))

    1992-03-01

    This research program addresses fundamental questions concerning the relationships between atomic structures and chemical compositions of metal/ceramic heterophase interfaces. The chemical composition profile across a Cu/MgO {l brace}111{r brace}-type heterophase interface, produced by the internal oxidation of a Cu(Mg) single phase alloy, is measured via atom-probe field-ion microscopy with a spatial resolution of 0.121 nm; this resolution is equal to the interplanar space of the {l brace}222{r brace} MgO planes. In particular, we demonstrate for the first time that the bonding across a Cu/MgO {l brace}111{r brace}-type heterophase interface, along a <111> direction common to both the Cu matrix and an MgO precipitate, has the sequence Cu{vert bar}O{vert bar}Mg{hor ellipsis} and not Cu{vert bar}Mg{vert bar}O{hor ellipsis}; this result is achieved without any deconvolution of the experimental data. Before determining this chemical sequence it was established, via high resolution electron microscopy, that the morphology of an MgO precipitate in a Cu matrix is an octahedron faceted on {l brace}111{r brace} planes with a cube-on-cube relationship between a precipitate and the matrix. First results are also presented for the Ni/Cr{sub 2}O{sub 4} interface; for this system selected area atom probe microscopy was used to analyze this interface; Cr{sub 2}O{sub 4} precipitates are located in a field-ion microscope tip and a precipitate is brought into the tip region via a highly controlled electropolishing technique.

  14. Atomic structures and compositions of internal interfaces. Progress report, September 1, 1991--August 31, 1992

    Energy Technology Data Exchange (ETDEWEB)

    Seidman, D.N. [Northwestern Univ., Evanston, IL (United States). Dept. of Materials Science and Engineering; Merkle, K.L. [Argonne National Lab., IL (United States)

    1992-03-01

    This research program addresses fundamental questions concerning the relationships between atomic structures and chemical compositions of metal/ceramic heterophase interfaces. The chemical composition profile across a Cu/MgO {l_brace}111{r_brace}-type heterophase interface, produced by the internal oxidation of a Cu(Mg) single phase alloy, is measured via atom-probe field-ion microscopy with a spatial resolution of 0.121 nm; this resolution is equal to the interplanar space of the {l_brace}222{r_brace} MgO planes. In particular, we demonstrate for the first time that the bonding across a Cu/MgO {l_brace}111{r_brace}-type heterophase interface, along a <111> direction common to both the Cu matrix and an MgO precipitate, has the sequence Cu{vert_bar}O{vert_bar}Mg{hor_ellipsis} and not Cu{vert_bar}Mg{vert_bar}O{hor_ellipsis}; this result is achieved without any deconvolution of the experimental data. Before determining this chemical sequence it was established, via high resolution electron microscopy, that the morphology of an MgO precipitate in a Cu matrix is an octahedron faceted on {l_brace}111{r_brace} planes with a cube-on-cube relationship between a precipitate and the matrix. First results are also presented for the Ni/Cr{sub 2}O{sub 4} interface; for this system selected area atom probe microscopy was used to analyze this interface; Cr{sub 2}O{sub 4} precipitates are located in a field-ion microscope tip and a precipitate is brought into the tip region via a highly controlled electropolishing technique.

  15. GA-based optimum design of a shape memory alloy device for seismic response mitigation

    International Nuclear Information System (INIS)

    Ozbulut, O E; Roschke, P N; Lin, P Y; Loh, C H

    2010-01-01

    Damping systems discussed in this work are optimized so that a three-story steel frame structure and its shape memory alloy (SMA) bracing system minimize response metrics due to a custom-tailored earthquake excitation. Multiple-objective numerical optimization that simultaneously minimizes displacements and accelerations of the structure is carried out with a genetic algorithm (GA) in order to optimize SMA bracing elements within the structure. After design of an optimal SMA damping system is complete, full-scale experimental shake table tests are conducted on a large-scale steel frame that is equipped with the optimal SMA devices. A fuzzy inference system is developed from data collected during the testing to simulate the dynamic material response of the SMA bracing subcomponents. Finally, nonlinear analyses of a three-story braced frame are carried out to evaluate the performance of comparable SMA and commonly used steel braces under dynamic loading conditions and to assess the effectiveness of GA-optimized SMA bracing design as compared to alternative designs of SMA braces. It is shown that peak displacement of a structure can be reduced without causing significant acceleration response amplification through a judicious selection of physical characteristics of the SMA devices. Also, SMA devices provide a recentering mechanism for the structure to return to its original position after a seismic event

  16. Electrochemical behavior of zirconium in the LiCl-KCl molten salt at Mo electrode

    Energy Technology Data Exchange (ETDEWEB)

    Chen Zeng; Li Yongjun [Key Laboratory of Photovoltaic Materials of Henan Province and School of Physics and Electronics, Henan, University, Kaifeng 475001 (China); Li Shengjun, E-mail: lishengjun@hrbeu.edu.cn [Key Laboratory of Photovoltaic Materials of Henan Province and School of Physics and Electronics, Henan, University, Kaifeng 475001 (China)

    2011-05-19

    Highlights: > The electrochemical reduction of Zr(II)/Zr and Zr(IV)/Zr(II) were both proved to be diffusion-controlled process. > In the 773 K-973 K range, the diffusion coefficients of Zr(II) and Zr(IV) were determined: D{sub Zr(II)} = 0.15567exp{l_brace}-69.65 x 10{sup 3}RT(K){r_brace} cm{sup 2}/s, D{sub Zr(IV)} = 1.09 x 10{sup -4}exp{l_brace}-44.39 x 10{sup 3}RT(K){r_brace} cm{sup 2}/s. > The activation energy values for the diffusion process were 69.65 kJ/mol and 44.39 kJ/mol, respectively. > This investigation will be useful for the further cognition of the molten salt electrolysis of zirconium. - Abstract: The electroreduction process of Zr(IV) was studied at molybdenum electrode in LiCl-KCl-K{sub 2}ZrF{sub 6} molten salt. The transient electrochemical techniques, such as cyclic voltammetry and chronopotenimetry were used. The experimental results showed that the electrochemical reduction of Zr(II)/Zr and Zr(IV)/Zr(II) were both diffusion-controlled process. In the 773-973 K range, the diffusion coefficients of Zr(ii) and Zr(IV) were determined: D{sub Zr(II)} = 0.15567exp{l_brace}-69.65 x 10{sup 3}RT(K){r_brace} cm{sup 2}/s, D{sub Zr(IV)} = 1.09 x 10{sup -4} exp{l_brace}-44.39 x 10{sup 3}RT(K){r_brace} cm{sup 2}/s. The activation energy values for the diffusion process were 69.65 kJ/mol and 44.39 kJ/mol, respectively.

  17. Analytic structure of solutions to multiconfiguration equations

    Energy Technology Data Exchange (ETDEWEB)

    Fournais, Soeren [Department of Mathematical Sciences, University of Aarhus, Ny Munkegade, Building 1530, DK-8000 Arhus C (Denmark); Hoffmann-Ostenhof, Maria [Fakultaet fuer Mathematik, Universitaet Wien, Nordbergstrasse 15, A-1090 Vienna (Austria); Hoffmann-Ostenhof, Thomas [Institut fuer Theoretische Chemie, Waehringerstrasse 17, Universitaet Wien, A-1090 Vienna (Austria); Soerensen, Thomas Oestergaard [Department of Mathematics, Imperial College London, Huxley Building, 180 Queen' s Gate, London SW7 2AZ (United Kingdom)], E-mail: fournais@imf.au.dk, E-mail: Maria.Hoffmann-Ostenhof@univie.ac.at, E-mail: thoffman@esi.ac.at, E-mail: t.sorensen@imperial.ac.uk

    2009-08-07

    We study the regularity at the positions of the (fixed) nuclei of solutions to (non-relativistic) multiconfiguration equations (including Hartree-Fock) of Coulomb systems. We prove the following: let {l_brace}{psi}{sub 1}, ..., {psi}{sub M}{r_brace} be any solution to the rank-M multiconfiguration equations for a molecule with L fixed nuclei at R{sub 1},...,R{sub L} element of R{sup 3}. Then, for any j in {l_brace}1, ..., M{r_brace}, k in {l_brace}1, ..., L{r_brace}, there exists a neighborhood U{sub j,k} subset or equal R{sup 3} of R{sub k}, and functions {psi}{sup (1)}{sub j,k}, {psi}{sup (2)}{sub j,k}, real analytic in U{sub j,k}, such that {phi}{sub j}(x)={phi}{sub j,k}{sup (1)}(x)+|x-R{sub k}|{phi}{sub j,k}{sup (2)}(x), x element of U{sub j,k}. A similar result holds for the corresponding electron density. The proof uses the Kustaanheimo-Stiefel transformation, as applied in [9] to the study of the eigenfunctions of the Schroedinger operator of atoms and molecules near two-particle coalescence points.

  18. Silver nanostructures with well-controlled shapes: synthesis, characterization and growth mechanisms

    Energy Technology Data Exchange (ETDEWEB)

    Kan Caixia [College of Science, Nanjing University of Aeronautics and Astronautics, Nanjing 211100 (China); Zhu Jiejun [Department of Physics, Nanjing University, Nanjing 210093 (China); Zhu Xiaoguang [Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China)], E-mail: cxkan@nuaa.edu.cn

    2008-08-07

    This paper describes a poly(vinylpyrollidone)-directed polyol synthesis method for the fabrication of silver (Ag) nanostructures with well-controlled shapes (such as nanorods and nanocubes) by adjusting the synthesizing parameters. The structure characterizations suggest that the Ag nanorods grow from the five-fold twinned decahedral crystal nuclei. The nature of the {l_brace}1 1 1{r_brace} planes of Ag crystal and the highly selective poly(vinylpyrollidone) adsorption on the {l_brace}100{r_brace} planes of Ag crystal nuclei are favourable for the formation of Ag nanorods and Ag nanowires. The single crystalline Ag nanocubes obtained at optimum conditions are perfect in shape and are enclosed by the {l_brace}1 0 0{r_brace} facets. The optical properties of the Ag nanostructures show an attractive plasma resonance, displaying a considerable dependence on the shape and size. The formation of the Ag nanostructures with well-defined shapes is probably due to the fact that the nanostructures are controlled thermodynamically and kinetically. The ability to generate shape-controlled Ag nanostructures also provides an opportunity to experimentally and systematically study the relationship between their properties and geometric shapes.

  19. Estimation of the stress related to conservative scoliosis therapy: an analysis based on BSSQ questionnaires

    Directory of Open Access Journals (Sweden)

    Szulc Andrzej

    2007-01-01

    Full Text Available Abstract Background Adolescent girls treated with a brace for scoliosis are submitted to prolonged stress related to both the disease and the therapy. Currently proposed quality of life questionnaires are focused on the outcome of therapy. Bad Sobernheim Stress Questionnaire (BSSQ enables monitoring of patients being under treatment with a brace or exercises. The aim of the study was to assess the stress level in conservatively managed scoliotic girls using BSSQ. Materials and methods 111 girls, aged 14,2 ± 2,2 years, mean Cobb angle of the primary curve 42,8° ± 17,0° and mean Bunnell angle of 11,4° ± 4,5° were examined with two versions of BSSQ (Deformity and Brace. The analysis considered the type of treatment, curve location, correlation of the total score with age, Cobb angle and Bunnell rotation angle. Results The BSSQ Deformity revealed the median of 17 points in patients managed with exercises (from 4 to 24 points, 18 in patients managed with a brace (from 8 to 24 points and 12 in patients before surgery (from 3 to 21 points. Braced patients who completed both questionnaires (n = 50 revealed significantly higher score with BSSQ Deformity (median = 18 comparing to BSSQ Brace (median = 9. There was a correlation between the total score of BSSQ Deformity and the Cobb angle (r = -0,34, Bunnell primary curve rotation (r = -0,34 and Bunnell sum of rotation (r = -0,33 but not with the age of patients. Conclusion Scoliotic adolescents managed with exercises and brace suffered little stress from the deformity. The brace increased the level of stress over the stress induced by the deformity. The stress level correlated with clinical deformity (Bunnell angle, radiological deformity (Cobb angle and the type of treatment (exercises, bracing, surgery. Bad Sobernheim Stress Questionnaires are simple and helpful in the management of girls treated conservatively for idiopathic scoliosis.

  20. Thermodynamics of the ternary systems: (water + glycine, L-alanine and L-serine + di-ammonium hydrogen citrate) from volumetric, compressibility, and (vapour + liquid) equilibria measurements

    Energy Technology Data Exchange (ETDEWEB)

    Sadeghi, Rahmat, E-mail: rahsadeghi@yahoo.co [Department of Chemistry, University of Kurdistan, Sanandaj (Iran, Islamic Republic of); Gholamireza, Afsaneh [Department of Chemistry, University of Kurdistan, Sanandaj (Iran, Islamic Republic of)

    2011-02-15

    The apparent molar volumes and isentropic compressibility of glycine, L-alanine and L-serine in water and in aqueous solutions of (0.500 and 1.00) mol . kg{sup -1} di-ammonium hydrogen citrate {l_brace}(NH{sub 4}){sub 2}HCit{r_brace} and those of (NH{sub 4}){sub 2}HCit in water have been obtained over the (288.15 to 313.15) K temperature range at 5 K intervals at atmospheric pressure from measurements of density and ultrasonic velocity. The apparent molar volume and isentropic compressibility values at infinite dilution of the investigated amino acids have been obtained and their variations with temperature and their transfer properties from water to aqueous solutions of (NH{sub 4}){sub 2}HCit have also been obtained. The results have been interpreted in terms of the hydration of the amino acids. In the second part of this work, water activity measurements by the isopiestic method have been carried out on the aqueous solutions of {l_brace}glycine + (NH{sub 4}){sub 2}HCit{r_brace}, {l_brace}alanine + (NH{sub 4}){sub 2}HCit{r_brace}, and {l_brace}serine + (NH{sub 4}){sub 2}HCit{r_brace} at T = 298.15 K at atmospheric pressure. From these measurements, values of vapour pressure, osmotic coefficient, activity coefficient and Gibbs free energy were obtained. The effect of the type of amino acids on the (vapour + liquid) equilibrium of the systems investigated has been studied. The experimental water activities have been correlated successfully with the segment-based local composition Wilson model. Furthermore, the thermodynamic behaviour of the ternary solutions investigated has been studied by using the semi-ideal hydration model and the linear concentration relations have been tested by comparing with the isopiestic measurements for the studied systems at T = 298.15 K.

  1. Dislocation Arrangements in Deformed and Neutron Irradiated Zirconium and Zircaloy-2

    Energy Technology Data Exchange (ETDEWEB)

    Roy, R B

    1963-12-15

    Dislocation arrangements in deformed and neutron irradiated Zr and Zircaloy-2 have been studied by thin film transmission electron microscopy. Results indicate that the prominent slip system, in both Zr and Zircaloy-2, is the {l_brace}1010{r_brace} 1/3 <1210> type; no evidence for basal slip was observed. Attractive and repulsive dislocation interactions seem to be more important than the intersection jog reactions. Elongated loops and dipoles were seen at higher deformations and it is suspected that such loops or dipoles are formed due to interactions between dislocations lying in parallel planes. Stacking fault ribbons lying in {l_brace}1010{r_brace} plane have been found in 15% cold rolled Zircaloy-2: a rough estimate of stacking fault energy indicates that it is {approx} 65 ergs/cm{sup 2}. Calculations show that the equilibrium separation of partials is {approx} 60 A and a stress as high as 19x10{sup -3} {mu} acting along {l_brace}0010{r_brace} direction is needed to separate them. It has been suggested that O{sub 2} and N{sub 2} in addition to their solid solution hardening effect may also cause a lowering of the stacking fault energy and Suzuki hardening.

  2. Exact asymptotics of probabilities of large deviations for Markov chains: the Laplace method

    Energy Technology Data Exchange (ETDEWEB)

    Fatalov, Vadim R [M. V. Lomonosov Moscow State University, Faculty of Mechanics and Mathematics, Moscow (Russian Federation)

    2011-08-31

    We prove results on exact asymptotics as n{yields}{infinity} for the expectations E{sub a} exp{l_brace}-{theta}{Sigma}{sub k=0}{sup n-1}g(X{sub k}){r_brace} and probabilities P{sub a}{l_brace}(1/n {Sigma}{sub k=0}{sup n-1}g(X{sub k})brace}, where {l_brace}{xi}{sub k}{r_brace}{sub k=1}{sup {infinity}} is a sequence of independent identically Laplace-distributed random variables, X{sub n}=X{sub 0}+{Sigma}{sub k=1}{sup n}{xi}{sub k}, n{>=}1, is the corresponding random walk on R, g(x) is a positive continuous function satisfying certain conditions, and d>0, {theta}>0, a element of R are fixed numbers. Our results are obtained using a new method which is developed in this paper: the Laplace method for the occupation time of discrete-time Markov chains. For g(x) one can take |x|{sup p}, log (|x|{sup p}+1), p>0, |x| log (|x|+1), or e{sup {alpha}|x|}-1, 0<{alpha}<1/2, x element of R, for example. We give a detailed treatment of the case when g(x)=|x| using Bessel functions to make explicit calculations.

  3. Lattice dynamic studies from {sup 151}Eu-Moessbauer spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Katada, Motomi [Tokyo Metropolitan Univ., Hachioji (Japan). Faculty of Science

    1997-03-01

    New complexes {l_brace}(Eu(napy){sub 2}(H{sub 2}O){sub 3})(Fe(CN){sub 6})4H{sub 2}O{r_brace}{sub x}, bpy({l_brace}(Eu(bpy)(H{sub 2}O){sub 4})(Fe(CN){sub 6})1.5bpy4H{sub 2}O{r_brace}{sub x}) and ({l_brace}(Eu(phen){sub 2}(H{sub 2}O){sub 2})(Fe(CN){sub 6})2phen{r_brace}{sub x}) etc were synthesized using phenanthroline and bipyridine. Lattice dynamic behaviors of Eu and Fe atom in the complexes were investigated by Moessbauer spectroscopy. By {sup 151}Eu-Moessbauer spectrum and parameters of new complexes, bpy complex showed the largest quadrupole splitting value, indicating bad symmetry of Eu ligand in the environment. Molecular structure of napy, bpy and phen complex were shown. These complexes are consisted of Eu atom coordinated with ligand and water molecule, of which (Fe(CN){sub 6}){sup 3-} ion formed one dimentional polymer chain and naphthyridines formed stacking structure. New complexes were observed by {sup 57}Fe-Moessbauer spectroscopy, too. The quadrupole splitting values were very different each other, indicating change of symmetry of Fe atom in the environment and three valence low spin state of Fe in the complex. (S.Y.)

  4. Morphological evolution of InAs/InP quantum wires through aberration-corrected scanning transmission electron microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Sales, D L; Molina, S I [Departamento de Ciencia de los Materiales e I. M. y Q. I., Universidad de Cadiz, Campus Rio San Pedro, E-11510 Puerto Real, Cadiz (Spain); Varela, M; Pennycook, S J [Materials Science and Technology Division, Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States); Galindo, P L [Departamento de Lenguajes y Sistemas Informaticos, Universidad de Cadiz, Campus Rio San Pedro, E-11510 Puerto Real, Cadiz (Spain); Gonzalez, L; Gonzalez, Y [Instituto de Microelectronica de Madrid (CNM, CSIC), Isaac Newton 8, E-28760 Tres Cantos, Madrid (Spain); Fuster, D, E-mail: david.sales@uca.es [UMDO - Unidad Asociada al CSIC-IMM, Instituto de Ciencia de Materiales, Universidad de Valencia, PO Box 22085, 4607 Valencia (Spain)

    2010-08-13

    Evolution of the size, shape and composition of self-assembled InAs/InP quantum wires through the Stranski-Krastanov transition has been determined by aberration-corrected Z-contrast imaging. High resolution compositional maps of the wires in the initial, intermediate and final formation stages are presented. (001) is the main facet at their very initial stage of formation, which is gradually reduced in favour of {l_brace}114{r_brace} or {l_brace}118{r_brace}, ending with the formation of mature quantum wires with {l_brace}114{r_brace} facets. Significant changes in wire dimensions are measured when varying slightly the amount of InAs deposited. These results are used as input parameters to build three-dimensional models that allow calculation of the strain energy during the quantum wire formation process. The observed morphological evolution is explained in terms of the calculated elastic energy changes at the growth front. Regions of the wetting layer close to the nanostructure perimeters have higher strain energy, causing migration of As atoms towards the quantum wire terraces, where the structure is partially relaxed; the thickness of the wetting layer is reduced in these zones and the island height increases until the (001) facet is removed.

  5. Gene : CBRC-HSAP-06-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-06-0003 Novel 6 D UNKNOWN CN165_HUMAN 2e-21 63% dbj|BAC85887.1| unnamed protein product [Homo sapi...ens] 7e-35 68% gnl|UG|Hs#S28297950 DA109160 BRACE3 Homo sapiens cDNA clone BRACE302...5623 5', mRNA sequence /clone=BRACE3025623 /clone_end=5' /gb=DA109160 /gi=80475782 /ug=Hs.690917 /len=598 1e-39 69% MAPI...YRHMPPYPTNFCIFSRDRLSLCWPGWSPFLISGDPAALVSQSAGITGVSHGTWPFDCFSSFELGLFLPPHSPIAILEILGYQILPGQVSAPIDAYSNAVPFSHGF ...

  6. The Green-Kubo formula, autocorrelation function and fluctuation spectrum for finite Markov chains with continuous time

    Energy Technology Data Exchange (ETDEWEB)

    Chen Yong; Chen Xi; Qian Minping [School of Mathematical Sciences, Peking University, Beijing 100871 (China)

    2006-03-17

    A general form of the Green-Kubo formula, which describes the fluctuations pertaining to all the steady states whether equilibrium or non-equilibrium, for a system driven by a finite Markov chain with continuous time (briefly, MC) {l_brace}{xi}{sub t}{r_brace}, is shown. The equivalence of different forms of the Green-Kubo formula is exploited. We also look at the differences in terms of the autocorrelation function and the fluctuation spectrum between the equilibrium state and the non-equilibrium steady state. Also, if the MC is in the non-equilibrium steady state, we can always find a complex function {psi}, such that the fluctuation spectrum of {l_brace}{phi}({xi}{sub t}){r_brace} is non-monotonous in [0, + {infinity})

  7. Controlling the Shapes of Silver Nanocrystals with Different Capping Agents

    Energy Technology Data Exchange (ETDEWEB)

    Zeng, J.; Tao, J.; Zheng, Y.; Rycenga, M.; Li, Z.-Y.; Zhang, Q.A.; Zhu, Y.; Xia, Y.

    2010-06-30

    This paper provides direct evidence to support the role of a capping agent in controlling the evolution of Ag seeds into nanocrystals with different shapes. Starting with single-crystal seeds (spherical or cubic in shape), we could selectively obtain Ag octahedrons enclosed by {l_brace}111{r_brace} facets and nanocubes/nanobars enclosed by {l_brace}100{r_brace} facets by adding sodium citrate (Na{sub 3}CA) and poly(vinyl pyrrolidone) (PVP), respectively, as a capping agent while all other parameters were kept the same. This research not only offers new insights into the role played by a capping agent in shape-controlled synthesis but also provides, for the first time, Ag octahedrons as small as 40 nm in edge length for optical and spectroscopic studies.

  8. 7th SOSORT consensus paper: conservative treatment of idiopathic & Scheuermann's kyphosis

    Directory of Open Access Journals (Sweden)

    Van Loon PJM

    2010-05-01

    Full Text Available Abstract Thoracic hyperkyphosis is a frequent problem and can impact greatly on patient's quality of life during adolescence. This condition can be idiopathic or secondary to Scheuermann disease, a disease disturbing vertebral growth. To date, there is no sound scientific data available on the management of this condition. Some studies discuss the effects of bracing, however no guidelines, protocols or indication's of treatment for this condition were found. The aim of this paper was to develop and verify the consensus on managing thoracic hyperkyphosis patients treated with braces and/or physiotherapy. Methods The Delphi process was utilised in four steps gradually modified according to the results of a set of recommendations: we involved the SOSORT Board twice, then all SOSORT members twice, with a Pre-Meeting Questionnaire (PMQ, and during a Consensus Session at the SOSORT Lyon Meeting with a Meeting Questionnaire (MQ. Results There was an unanimous agreement on the general efficacy of bracing and physiotherapy for this condition. Most experts suggested the use of 4-5 point bracing systems, however there was some controversy with regards to physiotherapeutic aims and modalities. Conclusion The SOSORT panel of experts suggest the use of rigid braces and physiotherapy to correct thoracic hyperkyphosis during adolescence. The evaluation of specific braces and physiotherapy techniques has been recommended.

  9. Measuring breath acetone for monitoring fat loss: Review.

    Science.gov (United States)

    Anderson, Joseph C

    2015-12-01

    Endogenous acetone production is a by-product of the fat metabolism process. Because of its small size, acetone appears in exhaled breath. Historically, endogenous acetone has been measured in exhaled breath to monitor ketosis in healthy and diabetic subjects. Recently, breath acetone concentration (BrAce) has been shown to correlate with the rate of fat loss in healthy individuals. In this review, the measurement of breath acetone in healthy subjects is evaluated for its utility in predicting fat loss and its sensitivity to changes in physiologic parameters. BrAce can range from 1 ppm in healthy non-dieting subjects to 1,250 ppm in diabetic ketoacidosis. A strong correlation exists between increased BrAce and the rate of fat loss. Multiple metabolic and respiratory factors affect the measurement of BrAce. BrAce is most affected by changes in the following factors (in descending order): dietary macronutrient composition, caloric restriction, exercise, pulmonary factors, and other assorted factors that increase fat metabolism or inhibit acetone metabolism. Pulmonary factors affecting acetone exchange in the lung should be controlled to optimize the breath sample for measurement. When biologic factors are controlled, BrAce measurement provides a non-invasive tool for monitoring the rate of fat loss in healthy subjects. © 2015 The Authors Obesity published by Wiley Periodicals, Inc. on behalf of The Obesity Society (TOS).

  10. Observations of silicon carbide by high resolution transmission electron microscopy

    International Nuclear Information System (INIS)

    Smith, D.J.; Jepps, N.W.; Page, T.F.

    1978-01-01

    High resolution transmission electron microscopy techniques, principally involving direct lattice imaging, have been used as part of a study of the crystallography and phase transformation mechanics of silicon carbide polytypes. In particular, the 3C (cubic) and 6H (hexagonal) polytypes have been examined together with partially transformed structural mixtures. Although direct observation of two-dimensional atomic structures was not possible at an operating voltage of 100 kV, considerable microstructural information has been obtained by careful choice of the experimental conditions. In particular, tilted beam observations of the 0.25 nm lattice fringes have been made in the 3C polytype for two different brace 111 brace plane arrays in order to study the dimensions and coherency of finely-twinned regions together with brace 0006 brace and brace 1 0 bar1 2 brace lattice images in the 6H polytype which allow the detailed stacking operations to be resolved. Lower resolution lattice images formed with axial illumination have also been used to study the nature of the 3C → 6H transformation and results are presented showing that the transformation interface may originate with fine twinning of the 3C structure followed by growth of the resultant 6H regions. Observations have been made of the detailed stepped structure of this interface together with the stacking fault distribution in the resultant 6H material. (author)

  11. Isopiestic Investigation of the Osmotic and Activity Coefficients of {yMgCl2 + (1 - y)MgSO4}(aq) and the Osmotic Coefficients of Na2SO4.MgSO4(aq) at 298.15 K

    Energy Technology Data Exchange (ETDEWEB)

    Miladinovic, J; Ninkovic, R; Todorovic, M; Rard, J A

    2007-06-06

    Isopiestic vapor pressure measurements were made for {l_brace}yMgCl{sub 2} + (1-y)MgSO{sub 4}{r_brace}(aq) solutions with MgCl{sub 2} ionic strength fractions of y = 0, 0.1997, 0.3989, 0.5992, 0.8008, and (1) at the temperature 298.15 K, using KCl(aq) as the reference standard. These measurements for the mixtures cover the ionic strength range I = 0.9794 to 9.4318 mol {center_dot} kg{sup -1}. In addition, isopiestic measurements were made with NaCl(aq) as reference standard for mixtures of {l_brace}xNa{sub 2}SO{sub 4} + (1-x)MgSO{sub 4}{r_brace}(aq) with the molality fraction x = 0.50000 that correspond to solutions of the evaporite mineral bloedite (astrakanite), Na{sub 2}Mg(SO{sub 4}){sub 2} {center_dot} 4H{sub 2}O(cr). The total molalities, m{sub T} = m(Na{sub 2}SO{sub 4}) + m(MgSO{sub 4}), range from m{sub T} = 1.4479 to 4.4312 mol {center_dot} kg{sup -1} (I = 5.0677 to 15.509 mol {center_dot} kg{sup -1}), where the uppermost concentration is the highest oversaturation molality that could be achieved by isothermal evaporation of the solvent at 298.15 K. The parameters of an extended ion-interaction (Pitzer) model for MgCl2(aq) at 298.15 K, which were required for an analysis of the {l_brace}yMgCl{sub 2} + (1-y)MgSO{sub 4}{r_brace}(aq) mixture results, were evaluated up to I = 12.025 mol {center_dot} kg{sup -1} from published isopiestic data together with the six new osmotic coefficients obtained in this study. Osmotic coefficients of {l_brace}yMgCl{sub 2} + (1-y)MgSO{sub 4}{r_brace}(aq) solutions from the present study, along with critically-assessed values from previous studies, were used to evaluate the mixing parameters of the extended ion-interaction model.

  12. Scoliosis

    Science.gov (United States)

    ... bigger braces. Braces are usually named after the cities where they were invented and have names like ... During the operation, the orthopedic surgeon fuses the bones in the spine together so that they can ...

  13. Evaluation of the stress level of children with idiopathic scoliosis in relation to the method of treatment and parameters of the deformity.

    Science.gov (United States)

    Leszczewska, Justyna; Czaprowski, Dariusz; Pawłowska, Paulina; Kolwicz, Aleksandra; Kotwicki, Tomasz

    2012-01-01

    Stress level due to existing body deformity as well as to the treatment with a corrective brace is one of factors influencing the quality of life of children with idiopathic scoliosis undergoing non-surgical management. The purpose of the study was to evaluate the stress level among children suffering from idiopathic scoliosis in relation to the method of treatment and the parameters of the deformity. Seventy-three patients with idiopathic scoliosis participated in the study. Fifty-two children were treated by means of physiotherapy, while 21 patients were treated with both Cheneau corrective brace and physiotherapy. To assess the stress level related to the deformity itself and to the method of treatment with corrective brace, the two Bad Sobernheim Stress Questionnaires (BSSQs) were applied, the BSSQ Deformity and the BSSQ Brace, respectively.

  14. Evaluation of the Stress Level of Children with Idiopathic Scoliosis in relation to the Method of Treatment and Parameters of the Deformity

    Directory of Open Access Journals (Sweden)

    Justyna Leszczewska

    2012-01-01

    Full Text Available Stress level due to existing body deformity as well as to the treatment with a corrective brace is one of factors influencing the quality of life of children with idiopathic scoliosis undergoing non-surgical management. The purpose of the study was to evaluate the stress level among children suffering from idiopathic scoliosis in relation to the method of treatment and the parameters of the deformity. Seventy-three patients with idiopathic scoliosis participated in the study. Fifty-two children were treated by means of physiotherapy, while 21 patients were treated with both Cheneau corrective brace and physiotherapy. To assess the stress level related to the deformity itself and to the method of treatment with corrective brace, the two Bad Sobernheim Stress Questionnaires (BSSQs were applied, the BSSQ Deformity and the BSSQ Brace, respectively.

  15. A new look at the quantum mechanics of the harmonic oscillator

    Energy Technology Data Exchange (ETDEWEB)

    Kastrup, H.A.

    2006-12-15

    At first sight it is probably hard to believe that something new can be said about the harmonic oscillator (HO). But that is so indeed: Classically the Harmonic Oscillator (HO) is the generic example for the use of angle and action variables {phi} element of R mod 2{pi} and I>0. However, the transformation q= {radical}(2I)cos {phi}, p=-{radical}(2I)sin {phi} is only locally symplectic and singular for (q,p)=(0,0). Globally the phase space {l_brace}(q,p){r_brace} has the topological structure of the plane R{sup 2}, whereas the phase space {l_brace}({phi},I){r_brace} corresponds globally to the punctured plane R{sup 2}-(0,0) or to a simple cone S{sup 1} x R{sup +} with the tip deleted. This makes a qualitative difference as to the quantum theory of the two phase spaces: The quantizing canonical group for the plane R{sup 2} consists of the (centrally extended) translations generated by the Poisson Lie algebra basis {l_brace}q,p,1{r_brace}, whereas the corresponding canonical group of the phase space {l_brace}({phi},I){r_brace} is the group SO{up_arrow}(1,2)=Sp(2,R)/Z{sub 2}, where Sp(2,R) is the sympletic group of the plane, with the generating Poisson Lie algebra basis {l_brace}h{sub 0}=I,h{sub 1}=Icos{phi},h{sub 2}=-Isin{phi}{r_brace} which provides also the basic ''observables'' on {l_brace}({phi}, I){r_brace}. In the quantum mechanics of the ({phi},I)-model of the HO the three h{sub j} correspond to self-adjoint generators K{sub j}, j=0,1,2, of irreducible unitary representations from the positive discrete series of the group SO{up_arrow}(1,2) or one of its infinitely many covering groups, the representations parametrized by the Bargmann index k>0. This index k determines the ground state energy E{sub k,n=0}={Dirac_h}{omega}k of the ({phi},I)-Hamiltonian H(anti K)={Dirac_h}{omega}K{sub 0}. For an m-fold covering the lowest possible value for k is k=1/m, which can be made arbitrarily small by choosing m accordingly. This is not in contraction to

  16. Lateral-Torsional Buckling Instability Caused by Individuals Walking on Wood Composite I-Joists

    Science.gov (United States)

    Villasenor Aguilar, Jose Maria

    Recent research has shown that a significant number of the falls from elevation occur when laborers are working on unfinished structures. Workers walking on wood I-joists on roofs and floors are prone to fall hazards. Wood I-joists have been replacing dimension lumber for many floor systems and a substantial number of roof systems in light-frame construction. Wood I-joists are designed to resist axial stresses on the flanges and shear stresses on the web while minimizing material used. However, wood I-joists have poor resistance to applied lateral and torsional loads and are susceptible to lateral-torsional buckling instability. Workers walking on unbraced or partially braced wood I-joists can induce axial and lateral forces as well as twist. Experimental testing demonstrated that workers cause lateral-torsional buckling instability in wood I-joists. However, no research was found related to the lateral-torsional buckling instability induced by individuals walking on the wood I-joists. Furthermore, no research was found considering the effects of the supported end conditions and partial bracing in the lateral-torsional buckling instability of wood I-joists. The goal of this research was to derive mathematical models to predict the dynamic lateral-torsional buckling instability of wood composite I-joists loaded by individuals walking considering different supported end conditions and bracing system configurations. The dynamic lateral-torsional buckling instability was analyzed by linearly combining the static lateral-torsional buckling instability with the lateral bending motion of the wood Ijoists. Mathematical models were derived to calculate the static critical loads for the simply supported end condition and four wood I-joist hanger supported end conditions. Additionally, mathematical models were derived to calculate the dynamic maximum lateral displacements and positions of the individual walking on the wood Ijoists for the same five different supported end

  17. Study on passive earth pressure acting on the embedment of an earth retaining wall for braced excavation work in cohesive soil; Nenseido jiban ni okeru kussaku dodomeheki neirebu no judo doatsu ni kansuru kenkyu

    Energy Technology Data Exchange (ETDEWEB)

    Nakamura, H. [Pacific Consultants K.K., Tokyo (Japan); Hirashima, K. [Yamanashi University, Yamanashi (Japan). Faculty of Engineering

    1995-12-15

    Passive earth pressure exerts a great influence on the stress and deformation of earth retaining walls in braced excavation. To calculate this pressure, conventional ultimate earth pressure equation, or Rankine-Resals and Coulomb`s equation, are currently applied respectively to cohesive and sandy soil. However, these intentional equation to determine passive earth pressure do not adequately take into account the excavation width during work and the shearing resistance on the earth retaining wall surface. This paper deals with cohesive soil only, deriving a calculation equation for passive earth pressure, which takes into account excavation width and the shearing resistance of the earth retaining wall surface. Then, constants in this equation are determined using the calculation results obtained from the finite element method with blasts-plastic elements. The calculation results are also compared with measured values in the model test in order to check the applicability of the calculation equation for passive earth pressure thus obtained. Finally, this paper proposes a practicable calculation equation for passive earth pressure. 13 refs., 10 figs., 10 tabs.

  18. Textured strontium titanate layers on platinum by atomic layer deposition

    Energy Technology Data Exchange (ETDEWEB)

    Blomberg, T., E-mail: tom.blomberg@asm.com [ASM Microchemistry Ltd., Vaeinoe Auerin katu 12 A, 00560 Helsinki (Finland); Anttila, J.; Haukka, S.; Tuominen, M. [ASM Microchemistry Ltd., Vaeinoe Auerin katu 12 A, 00560 Helsinki (Finland); Lukosius, M.; Wenger, Ch. [IHP, Im Technologiepark 25, 15236 Frankfurt (Oder) (Germany); Saukkonen, T. [Aalto University, Puumiehenkuja 3, 02150 Espoo (Finland)

    2012-08-31

    Formation of textured strontium titanate (STO) layers with large lateral grain size (0.2-1 {mu}m) and low X-ray reflectivity roughness ({approx} 1.36 nm) on Pt electrodes by industry proven atomic layer deposition (ALD) method is demonstrated. Sr(t-Bu{sub 3}Cp){sub 2}, Ti(OMe){sub 4} and O{sub 3} precursors at 250 Degree-Sign C were used to deposit Sr rich STO on Pt/Ti/SiO{sub 2}/Si Empty-Set 200 mm substrates. After crystallization post deposition annealing at 600 Degree-Sign C in air, most of the STO grains showed a preferential orientation of the {l_brace}001{r_brace} plane parallel to the substrate surface, although other orientations were also present. Cross sectional and plan view transmission electron microscopy and electron diffraction analysis revealed more than an order of magnitude larger lateral grain sizes for the STO compared to the underlying multicrystalline {l_brace}111{r_brace} oriented platinum electrode. The combination of platinum bottom electrodes with ALD STO(O{sub 3}) shows a promising path towards the formation of single oriented STO film. - Highlights: Black-Right-Pointing-Pointer Amorphous strontium titanate (STO) on platinum formed a textured film after annealing. Black-Right-Pointing-Pointer Single crystal domains in 60 nm STO film were 0.2-1 {mu}m wide. Black-Right-Pointing-Pointer Most STO grains were {l_brace}001{r_brace} oriented.

  19. Outcome at 10 years after treatment for adolescent idiopathic scoliosis

    DEFF Research Database (Denmark)

    Andersen, Mikkel O; Christensen, Steen Bach; Thomsen, Karsten

    2006-01-01

    A total of 215 consecutive patients treated either by bracing or operation received a questionnaire after 9.7 years.......A total of 215 consecutive patients treated either by bracing or operation received a questionnaire after 9.7 years....

  20. X-ray studies of synthetic radiation-counting diamonds

    Energy Technology Data Exchange (ETDEWEB)

    Yacoot, Andrew; Moore, Moreton (Royal Holloway and Bedford New Coll., Egham (UK). Dept. of Physics); Makepeace, Anthony (Bristol Univ. (UK). Dept. of Physiology)

    1990-10-01

    Synthetic diamonds with a nitrogen content less than 100 ppm may be used as radiation dosemeters in a conduction counting mode, and are especially useful in medical applications. Crystal imperfections, revealed by x-ray diffraction topography, were found to affect counting performance. The best quality diamond gave the highest photocurrent (500 nA at 50 V mm{sup -1} and 2.75 Gy min{sup -1}). Diamonds containing dislocations had lower photocurrents but had the advantage of shorter settling times (seconds rather than minutes). Placing contacts on two opposite cube {l brace}100{r brace} faces gave a higher photocurrent than on a pair of octahedral {l brace}111{r brace} faces. Higher photocurrents were also achieved when the majority of dislocations were perpendicular rather than parallel, to the electric field. Some recommendations for selecting synthetic diamonds for dosemeters are given. (author).

  1. Exact Hausdorff centered measure of symmetry Cantor sets

    Energy Technology Data Exchange (ETDEWEB)

    Dai Meifeng [Department of Mathematics, Jiangsu University, Zhenjiang 212013 (China)] e-mail: daimf0225@163.com; Tian Lixin [Department of Mathematics, Jiangsu University, Zhenjiang 212013 (China)] e-mail: tianlx@ujs.edu.cn

    2005-10-01

    Let K({lambda}{sub 1},{lambda}{sub 2}), the symmetry Cantor sets, be the attractor of an iterated function system {l_brace}f{sub 1},f{sub 2},f{sub 3}{r_brace} on the line, where f{sub 1}(x)={lambda}{sub 1}x, f{sub 2}(x)={lambda}{sub 2}x+1-{lambda}{sub 2}2,f{sub 3}(x)=1-{lambda}{sub 1}+{lambda}{sub 1}x, x-bar [0,1]. In this paper, we proved that if 1-2{lambda}{sub 1}-{lambda}{sub 2}2>={lambda}, where {lambda}=max{l_brace}{lambda}{sub 1},{lambda}{sub 2}{r_brace}, then the exact Hausdorff centered measure C{sup s} of K({lambda}{sub 1},{lambda}{sub 2}) equals 1, where s is the Hausdorff dimension of K({lambda}{sub 1},{lambda}{sub 2})

  2. Behaviour of parallel girders stabilised with U-frames

    DEFF Research Database (Denmark)

    Virdi, Kuldeep; Azzi, Walid

    2010-01-01

    Lateral torsional buckling is a key factor in the design of steel girders. Stability can be enhanced by cross-bracing, reducing the effective length and thus increasing the ultimate capacity. U-frames are an option often used to brace the girders when designing through type of bridges and where...... overhead bracing is not practical. This paper investigates the effect of the U-frame spacing on the stability of the parallel girders. Eigenvalue buckling analysis was undertaken with four different spacings of the U-frames. Results were extracted from finite element analysis, interpreted and conclusions...

  3. Possible Solutions of Various Transport Problems; O nakhozhdenii reshenij nekotorykh zadach perenosa

    Energy Technology Data Exchange (ETDEWEB)

    Lebedev, V. I. [Institut Atomnoj Ehnergii Im. I.V. Kurchatova Moskva, SSSR (Russian Federation)

    1968-01-15

    Let x = (x{sub 1}....,x{sub q}), R{sub q}(x) be the q-dimensional space (q{>=}2), s be the unit vector, and #Greek Capital Letter Omega With Tonos# the surface of the unit sphere. The problem of solving transport equations with a degenerate scattering indicatrix is a multidimensional problem in R{sub q}x#Greek Capital Letter Omega With Tonos#; the nature of these problems calls for rapidly converging iterative methods which do not require all the information on the preceding step. The paper proposes a KP method: the idea consists in solving in R{sub q} simplified problems of error determination using successive iterative steps of decreasing difficulty. Two operations are performed in the KP: the K-operation is a simple iteration in R{sub q}x{Omega} and operation P = {l_brace}P{sub 1}(n{sub 1}),...P{sub 0}(n{sub 0}){r_brace} is for the error with P{sub k} (n{sub k}) representing the solution in R{sub q} of the ultimate problem for a differential equation of order 2n{sub k}. P-operations are found and the convergence of the following methods is studied: KP{sub 1}(n), P{sub 2}(0), K{sup 2}P{sub 1}(n), cyclic KP{sub 1}(1) and KP{sub 1}(0) etc. For 2{pi}T periodic problems the convergence is estimated, P(KP) (KP price) and cheap algorithms are found, and the non-improvability is shown. Numerical calculations indicated that the KP method is very efficient. The Case results are generalized for the q-dimensional case: in Rqx{Omega} a system of solutions is found for a homogeneous single-velocity transport equation with constant coefficients and an isotropic scattering indicatrix {Phi}{sub {omega}}(S)exp({+-}(x, {omega})/v) These are generalized functions with {sub v}#Greek Lunate Epsilon Symbol#{l_brace}(-1, 1], {+-} v{sub 0}{r_brace} and {omega} #Greek Lunate Epsilon Symbol#. Theorems are proved for the completeness of {l_brace}{Phi}{sub v{omega}}{r_brace} in L{sub 2}({Omega}), for the partial orthogonality of and the possibility of representing {psi}#Greek Lunate Epsilon

  4. Uranium diphosphonates templated by interlayer organic amines

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, Anna-Gay D., E-mail: nelsoa@umich.edu [Department of Civil Engineering and Geological Sciences, University of Notre Dame, IN 46556 (United States); Department of Earth and Environmental Sciences, University of Michigan, Ann Arbor, MI 48109-1005 (United States); Alekseev, Evgeny V. [Institute of Energy and Climate Research (IEK-6), Forschungszentrum Juelich Wilhelm-Johnen-Strasse, 52428 Juelich (Germany); Institut fuer Kristallographie, RWTH Aachen University, D-52066 Aachen (Germany); Albrecht-Schmitt, Thomas E. [Department of Civil Engineering and Geological Sciences, University of Notre Dame, IN 46556 (United States); Department of Chemistry and Biochemistry, University of Notre Dame, IN 46556 (United States); Ewing, Rodney C. [Department of Earth and Environmental Sciences, University of Michigan, Ann Arbor, MI 48109-1005 (United States)

    2013-02-15

    The hydrothermal treatment of uranium trioxide and methylenediphosphonic acid with a variety of amines (2,2-dipyridyl, triethylenediamine, ethylenediamine, and 1,10-phenanthroline) at 200 Degree-Sign C results in the crystallization of a series of layered uranium diphosphonate compounds, [C{sub 10}H{sub 9}N{sub 2}]{l_brace}UO{sub 2}(H{sub 2}O)[CH{sub 2}(PO{sub 3})(PO{sub 3}H)]{r_brace} (Ubip2), [C{sub 6}H{sub 14}N{sub 2}]{l_brace}(UO{sub 2}){sub 2}[CH{sub 2}(PO{sub 3})(PO{sub 3}H)]{sub 2}{center_dot}2H{sub 2}O{r_brace} (UDAB), [C{sub 2}H{sub 10}N{sub 2}]{sub 2}{l_brace}(UO{sub 2}){sub 2}(H{sub 2}O){sub 2}[CH{sub 2}(PO{sub 3}){sub 2}]{sub 2}{center_dot}0.5H{sub 2}O{r_brace} (Uethyl), and [C{sub 12}H{sub 9}N{sub 2}]{l_brace}UO{sub 2}(H{sub 2}O)[CH{sub 2}(PO{sub 3})(PO{sub 3}H)]{r_brace} (Uphen). The crystal structures of the compounds are based on UO{sub 7} units linked by methylenediphosphonate molecules to form two-dimensional anionic sheets in Ubip2 and UDAB, and one-dimensional anionic chains in Uethyl and Uphen, which are charge balanced by protonated amine molecules. Interaction of the amine molecules with phosphonate oxygens and water molecules results in extensive hydrogen bonding in the interlayer. These amine molecules serve both as structure-directing agents and charge-balancing cations for the anionic uranium phosphonate sheets and chains in the formation of the different coordination geometries and topologies of each structure. Reported herein are the syntheses, structural and spectroscopic characterization of the synthesized compounds. - Graphical abstract: The Raman spectra of the synthesized compounds and an illustration of the stacking of the layers with the diprotonated triethylenediamine molecules in [C{sub 6}H{sub 14}N{sub 2}]{l_brace}(UO{sub 2}){sub 2}[CH{sub 2}(PO{sub 3})(PO{sub 3}H)]{sub 2}{center_dot}2H{sub 2}O{r_brace} UDAB. Solvent water molecules are removed for clarity. The corresponding Raman spectra for the complexes synthesized is also

  5. Studies on the selectivity of the reaction of (CO){sub 5}W=C(aryl)H with enynes: transfer of the carbene ligand to the C=C Bond versus insertion of the C triple bond C into the W=C Bond

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, H.; Volkland, H.P.; Stumpf, R.

    1996-10-01

    The strongly electrophilic monophenylcarbene complex [(CO){sub 5}W=C(Ph)H] (2a) reacts with the enynes H-C triple bond C-R(R=-C(Me)=CH{sub 2})(3), -C{sub 6}H{sub 4}-CH=CH{sub 2}-p (5) and subsequently with PMe{sub 3} to form the C{sub a}lpha-PMe{sub 3} adducts of the vinylidene complexes [(CO){sub 5}W-{l_brace}C(PMe{sub 3})=CH-C{sub 3}H{sub 3}(Me)Ph{r_brace}] (4) and [(CO){sub 5}W {l_brace}C(PMe{sub 3})=CH-C{sub 6}H{sub 4}-C{sub 3}H{sub 4}Ph{r_brace}] (6). The reaction very likely proceeds by transfer of the carbene ligand to the C=C bond of the enyne to form a cyclopropyl-substituted alkyne complex which is in equilibrium with its vinylidene isomer.

  6. Synthesis and characterization of copolymers 4,5-dihydroisoxazole and (-)-menthyl acrylates; Sintese e caracterizacao de copolimeros de cadeia lateral derivados de acrilatos de 4,5-di-hidroisoxazol e do (-)-mentol

    Energy Technology Data Exchange (ETDEWEB)

    Passo, Joel A.; Merlo, Aloir A. [Universidade Federal do Rio Grande do Sul, Porto Alegre, RS (Brazil). Inst. de Quimica; Eccher, Juliana; Bechtold, Ivan H. [Universidade Federal de Santa Catarina, Florianopolis, SC (Brazil). Campus Universitario Trindade. Dept. de Fisica; Kelly, Stephen M., E-mail: aloir@iq.ufrgs.br [University of Hull, Hull (United Kingdom). Dept. of Chemistry

    2012-07-01

    Five monomers 5-[4-(5-cyano-4,5-dihydroisoxazol-3-yl)phenoxy]undecyl acrylate (7a); n-alkyl 3-{l_brace}4-[5-(acryloyloxyundecyl)oxyphenyl]{r_brace}-4,5-dihydroisoxazole-5-carboxylate (7b,c for n-butyl and n-hexyl, respectively); 3-{l_brace}4-[5-(acryloyloxyundecyl) oxyphenyl]{r_brace}-4,5-dihydroisoxazole-5-carboxylic acid (7d) and (1R,2S,5R)-2-isopropyl-5-methylcyclohexyl acrylate (9) and the corresponding copolymers 10a-d,11 and homopolymers 12 from 7a and 13 from 9 were designed and synthesized. Except for acrylate 9 which is derived from (-)-menthol, all of the monomers belong to the series containing the isoxazoline ring linked to the acrylate unit by a flexible spacer chain of eleven methylene units. They presented low glass temperature and despite birefringence behavior, these copolymers showed no mesomorphic properties. (author)

  7. Generating explanations via analogical comparison.

    Science.gov (United States)

    Hoyos, Christian; Gentner, Dedre

    2017-10-01

    Generating explanations can be highly effective in promoting learning in both adults and children. Our interest is in the mechanisms that underlie this effect and in whether and how they operate in early learning. In adult reasoning, explanation may call on many subprocesses-including comparison, counterfactual reasoning, and reasoning by exclusion; but it is unlikely that all these processes are available to young children. We propose that one process that may serve both children and adults is comparison. In this study, we asked whether children would use the results of a comparison experience when asked to explain why a model skyscraper was stable. We focused on a challenging principle-that diagonal cross-bracing lends stability to physical structures (Gentner et al., Cognitive Science, 40, 224-240, 2016). Six-year-olds either received no training or interacted with model skyscrapers in one of three different conditions, designed to vary in their potential to invite and support comparison. In the Single Model condition, children interacted with a single braced model. In the comparison conditions (Low Alignability and High Alignability), children compared braced and unbraced models. Following experience with the models, children were asked to explain why the braced model was stable. They then received two transfer tasks. We found that children who received highly alignable pairs were most likely to (a) produce brace-based explanations and (b) transfer the brace principle to a dissimilar context. This provides evidence that children can benefit from analogical comparison in generating explanations and also suggests limitations on this ability.

  8. The effect of substrate orientation on the kinetics and thermodynamics of initial oxide-film growth on metals

    Energy Technology Data Exchange (ETDEWEB)

    Reichel, Friederike

    2007-11-19

    This thesis addresses the effect of the parent metal-substrate orientation on the thermodynamics and kinetics of ultra-thin oxide-film growth on bare metals upon their exposure to oxygen gas at low temperatures (up to 650 K). A model description has been developed to predict the thermodynamically stable microstructure of a thin oxide film grown on its bare metal substrate as function of the oxidation conditions and the substrate orientation. For Mg and Ni, the critical oxide-film thickness is less than 1 oxide monolayer and therefore the initial development of an amorphous oxide phase on these metal substrates is unlikely. Finally, for Cu and densely packed Cr and Fe metal surfaces, oxide overgrowth is predicted to proceed by the direct formation and growth of a crystalline oxide phase. Further, polished Al single-crystals with {l_brace}111{r_brace}, {l_brace}100{r_brace} and {l_brace}110{r_brace} surface orientations were introduced in an ultra-high vacuum system for specimen processing and analysis. After surface cleaning and annealing, the bare Al substrates have been oxidized by exposure to pure oxygen gas. During the oxidation, the oxide-film growth kinetics has been established by real-time in-situ spectroscopic ellipsometry. After the oxidation, the oxide-film microstructures were investigated by angle-resolved X-ray photoelectron spectroscopy and low energy electron diffraction. Finally, high-resolution transmission electron microscopic analysis was applied to study the microstructure and morphology of the grown oxide films on an atomic scale. (orig.)

  9. Modification of the colony tower for the Rio Blanco detonation

    International Nuclear Information System (INIS)

    Blume, J.A.; Freeman, S.A.; Honda, K.K.; Lee, L.A.

    1975-01-01

    Supplemental structural bracing was designed and installed for the 180-ft-tall Colony Tower, an experimental oil shale processing retort structure, in anticipation of its lateral response to the Rio Blanco detonation. The tower is a steel structure with both horizontal and vertical diagonal bracing. Data obtained from the earlier Project Rulison detonation indicated that an evaluation study was necessary. Design criteria that would provide an adequate margin of safety were developed based on predicted Rio Blanco ground motion. The evaluation of the unmodified structure showed that several bracing members would be subjected to forces exceeding their yield strength, and some would reach a level at which failure could occur. Further analyses were made with assumed modified bracing members. A final scheme for modified vertical bracing was established and installed. After modification, the response of the tower during the Rio Blanco detonation was measured by instruments on the ground and at various locations on the tower, and no evidence of damage was discovered. The modification of the Colony Tower and the procedures used to determine these modifications show the usefulness of current ground motion and structural response prediction technology for forecasting dynamic behavior of important structures subjected to ground motion from underground nuclear explosions. (auth)

  10. Adolescent idiopathic scoliosis: Indications and efficacy of nonoperative treatment

    Directory of Open Access Journals (Sweden)

    Federico Canavese

    2011-01-01

    Full Text Available The strategy for the treatment of idiopathic scoliosis depends essentially upon the magnitude and pattern of the deformity, and its potential for progression. Treatment options include observation, bracing and/or surgery. During the past decade, several studies have demonstrated that the natural history of adolescent idiopathic scoliosis can be positively affected by nonoperative treatment, especially bracing. Other forms of conservative treatment, such as chiropractic or osteopathic manipulation, acupuncture, exercise or other manual treatments, or diet and nutrition, have not yet been proven to be effective in controlling spinal deformity progression, and those with a natural history that is favorable at the completion of growth. Observation is appropriate treatment for small curves, curves that are at low risk of progression, and those with a natural history that is favorable at the completion of growth. Indications for brace treatment are a growing child presenting with a curve of 25°-40° or a curve less than 25° with documented progression. Curves of 20°-25° in patients with pronounced skeletal immaturity should also be treated. The purpose of this review is to provide information about conservative treatment of adolescent idiopathic scoliosis. Indications for conservative treatment, hours daily wear and complications of brace treatment as well as brace types are discussed.

  11. Unspecific chronic low back pain - a simple functional classification tested in a case series of patients with spinal deformities.

    Science.gov (United States)

    Weiss, Hans-Rudolf; Werkmann, Mario

    2009-02-17

    Up to now, chronic low back pain without radicular symptoms is not classified and attributed in international literature as being "unspecific". For specific bracing of this patient group we use simple physical tests to predict the brace type the patient is most likely to benefit from. Based on these physical tests we have developed a simple functional classification of "unspecific" low back pain in patients with spinal deformities. Between January 2006 and July 2007 we have tested 130 patients (116 females and 14 males) with spinal deformities (average age 45 years, ranging from 14 years to 69) and chronic unspecific low back pain (pain for > 24 months) along with the indication for brace treatment for chronic unspecific low back pain. Some of the patients had symptoms of spinal claudication (n = 16). The "sagittal realignment test" (SRT) was applied, a lumbar hyperextension test, and the "sagittal delordosation test" (SDT). Additionally 3 female patients with spondylolisthesis were tested, including one female with symptoms of spinal claudication and 2 of these patients were 14 years of age and the other 43yrs old at the time of testing. 117 Patients reported significant pain release in the SRT and 13 in the SDT (> or = 2 steps in the Roland & Morris VRS). 3 Patients had no significant pain release in both of the tests (manual investigation we found hypermobility at L5/S1 or a spondylolisthesis at level L5/S1. In the other patients who responded well to the SRT loss of lumbar lordosis was the main issue, a finding which, according to scientific literature, correlates well with low back pain. The 3 patients who did not respond to either test had a fair pain reduction in a generally delordosing brace with an isolated small foam pad inserted at the level of L 2/3, leading to a lordosation at this region. With the exception of 3 patients (2.3%) a clear distribution to one of the two classes has been possible. 117 patients were supplied successfully with a sagittal

  12. Effect of the Abdominal Hollowing and Bracing Maneuvers on Activity Pattern of the Lumbopelvic Muscles During Prone Hip Extension in Subjects With or Without Chronic Low Back Pain: A Preliminary Study.

    Science.gov (United States)

    Kahlaee, Amir H; Ghamkhar, Leila; Arab, Amir M

    2017-02-01

    The purpose of this study was to compare the effect of abdominal hollowing (AH) and abdominal bracing (AB) maneuvers on the activity pattern of lumbopelvic muscles during prone hip extension (PHE) in participants with or without nonspecific chronic low back pain (CLBP). Twenty women with or without CLBP participated in this cross-sectional observational study. The electromyographic activity (amplitude and onset time) of the contralateral erector spinae (CES), ipsilateral erector spinae (IES), gluteus maximus, and biceps femoris muscles was measured during PHE with and without abdominal maneuvers. A 3-way mixed model analysis of variance and post hoc tests were used for statistical analysis. Between-group comparisons showed that the CES onset delay during PHE alone was greater (P = .03) and the activity level of IES, CES, and biceps femoris in all maneuvers (P .05). Performance of the AH maneuver decreased the erector spinae muscle AMP in both groups, and neither maneuver altered the onset delay of any of the muscles in either group. The low back pain group showed higher levels of activity in all muscles (not statistically significant in gluteus maximus during all maneuvers). The groups were similar according to the onset delay of any of the muscles during either maneuver. Copyright © 2016. Published by Elsevier Inc.

  13. Platinum nanocube catalysts for methanol and ethanol electrooxidation

    Energy Technology Data Exchange (ETDEWEB)

    Han, Sang-Beom; Song, You-Jung; Lee, Jong-Min; Kim, Jy-Yeon; Park, Kyung-Won [Department of Chemical and Environmental Engineering, Soongsil University, Seoul 156-743 (Korea)

    2008-07-15

    We prepared Pt nanocube catalyst with about 3.6 nm in size by a polyol process in the presence of PVP as a stabilizer and Fe ion as a kinetic controller. The crystal structure of Pt nanocube with {l_brace}1 0 0{r_brace} faces was confirmed by field-emission transmission electron microscopy. In a cyclic voltammogram, we found that the Pt nanocube catalyst showed relatively high ratio of the forward anodic peak current to the reverse anodic peak current resulting in less accumulation of residues on the catalyst. The Pt nanocube catalyst with the edge of stepped {l_brace}1 0 0{r_brace} faces was preferable to breakage of CH{sub 3}OH and CH{sub 3}CH{sub 2}OH compared to polycrystalline Pt nanocatalyst. In an electrochemical measurement for methanol and ethanol electrooxidation, the Pt nanocube catalyst showed an excellent catalytic activity, i.e., lower onset potential and higher current density, compared to the polycrystalline Pt nanocatalyst. (author)

  14. Radiation damage in He implanted silicon at high temperature using multi-energies

    CERN Document Server

    David, M L; Oliviero, E; Denanot, M F; Beaufort, M F; Declemy, A; Blanchard, C; Gerasimenko, N N; Barbot, J F

    2002-01-01

    He sup + ions were implanted at 800 deg. C into (1 0 0) silicon with multiple energies and selected fluences to get a number of displacement per atom constant in a large plateau. The ion-related defects have been mainly studied by transmission electron microscopy. Both the amount and the microstructure of defects have been found to be strongly dependent on the order of implants. Faceted cavities are only observed where damage overlapping occurs. The first implant provides thus nucleation sites for cavities. The generation of these sites is less efficient when using increasing energies because of damage recovery; fewer cavities are observed. Concurrently interstitial-type defects, left brace 1 1 3 right brace agglomerates, are formed. The observed state of growth of these left brace 1 1 3 right brace defects (rod-like and ribbon-like defects) is dependent on the implantation energy order but in any cases, no dislocation loops are observed even in the deepest damage region.

  15. Studies on the controlled growth of InAs nanostructures on scission surfaces; Untersuchungen zum kontrollierten Wachstum von InAs-Nanostrukturen auf Spaltflaechen

    Energy Technology Data Exchange (ETDEWEB)

    Bauer, J.

    2006-01-15

    The aim of this thesis was the controlled alignment of self-assembled InAs nano-structures on a {l_brace}110{r_brace}-oriented surface. The surface is prestructured with the atomic precision offered by molecular beam epitaxy, using the cleaved edge overgrowth-technique. On all samples grown within this work, the epitaxial template in the first growth step was deposited on a (001)GaAs substrate, while the InAs-layer forming the nanostructures during the second growth step was grown on cleaved {l_brace}110{r_brace}-GaAs surfaces. Atomic Force Microscopy (AFM) investigations demonstrate the formation of quantum dot (QD)-like nanostructures on top of the AlAs-stripes. X-ray diffraction measurements on large arrays of aligned quantum dots demonstrate that the quantum dots are formed of pure InAs. First investigations on the optical properties of these nanostructures were done using microphotoluminescence-spectroscopy with both high spatial and spectral resolution. (orig.)

  16. Stability of GNSS Monumentation: Analysis of Co-Located Monuments in the UNAVCO Plate Boundary Observatory

    Science.gov (United States)

    Blume, F.; Herring, T.; Mattioli, G. S.; Feaux, K.; Walls, C. P.; Austin, K. E.; Dittmann, S. T.

    2017-12-01

    Geodetic-quality permanent GNSS stations have used a number of different monument styles for the purpose of ensuring that the motions of the GNSS antenna reflect those of the Earth's crust while minimizing non-tectonic motions near the surface. Monuments range from simple masts mounted on buildings or drilled into bedrock, costing a few hundred dollars to machine-drilled-braced monuments in soil costing tens of thousands. The stability of an individual monument will depend on its design, the construction techniques used to install it, and the local surface geology where it is installed. Previous studies have separately investigated pairs of identical monuments at a single site, monument type performance using global statistical analysis, and multiple monument styles at a single site, yet the stability of different monument types in similar geologic conditions has not been adequately determined. To better characterize the stability of various monument styles in diverse geologic conditions UNAVCO constructed two additional monuments at five existing PBO stations in 2013. Deep drilled-braced, short drilled-braced, and single mast type monuments were installed at sites with bedrock at the surface; deep drilled-braced, short driven-braced and pillar type monuments were installed at sites with alluvium or soil at the surface. The sites include a variety of geographic, hydrologic, and geologic conditions. Data collected from the PBO Multi-Monument Experiment have been analyzed using a variety of methods. Each site is characterized using quality-control parameters such as multipath, signal-to-noise and previously determined seasonal variations. High-precision processing by PBO Analysis Centers with GAMIT and GIPSY use regional and global schemes and yield time-series with millimeter-level that determine noise content, overall site stability relative to other PBO sites and differential motions between the individual monuments. Sub-millimeter results from single

  17. Knee braces - unloading

    Science.gov (United States)

    ... most people talk about the arthritis in their knees, they are referring to a type of arthritis ... is caused by wear and tear inside your knee joints. Cartilage, the firm, rubbery tissue that cushions ...

  18. Combined effects of knee brace, laterally wedged insoles and toe-in gait on knee adduction moment and balance in moderate medial knee osteoarthritis patients.

    Science.gov (United States)

    Khan, Saad Jawaid; Khan, Soobia Saad; Usman, Juliana; Mokhtar, Abdul Halim; Abu Osman, Noor Azuan

    2018-03-01

    To test the hypothesis that toe-in gait (TI) will further reduce first peak (Knee Adduction Moment) KAM and decrease balance when combined with a knee brace (KB) and laterally wedged insoles (LWI) in medial knee osteoarthritis (kOA) patients. Twenty patients with bilateral symptomatic medial kOA. 4-point leverage-based KB, full-length LWI with 5° inclination and toe-in gait (TI). First and second peak knee adduction moment (fKAM and sKAM respectively), balance and pain. The fKAM and sKAM were determined from 3-dimensional gait analysis with six randomized conditions: (1) N (without any intervention), (2) KB, (3) KB + TI, (4) LWI, (5) LWI + TI, (6) KB + LWI + TI. Balance was assessed by Biodex Balance System using three stability settings, (i) Static (ii) Moderate dynamic setting for fall risk (FR12) and (iii) High dynamic setting for fall risk (FR8). The reduction in fKAM and sKAM was greatest (19.75% and 12%) when TI was combined with KB and LWI respectively. No change in balance was observed when TI combined with KB, and LWI and when used concurrently with both the orthosis at static and FR12 conditions. Significant balance reduction was found at FR8 for KB + TI (22.22%), and KB + LWI + TI (35.71%). Pain increased significantly for KB (258%), KB + TI (305%), LWI + TI (210%) and KB + LWI + TI (316%). LWI showed no effect on pain. There is a synergistic effect of TI when combined with KB and LWI concurrently in sKAM reduction. However, the concurrent use of TI, KB and LWI decreases balance and pain as assessed on a highly dynamic platform. Copyright © 2018 Elsevier B.V. All rights reserved.

  19. Rehabilitation of children and infants with osteogenesis imperfecta. A program for ambulation.

    Science.gov (United States)

    Gerber, L H; Binder, H; Weintrob, J; Grange, D K; Shapiro, J; Fromherz, W; Berry, R; Conway, A; Nason, S; Marini, J

    1990-02-01

    Management of children and infants with osteogenesis imperfecta (OI) poses difficult decisions for pediatricians, orthopedists, and physiatrists. These children are frequently frail with disabling bone and joint deformities and fractures. In an eight-year cumulative management of 12 children with OI, a comprehensive program included strengthening exercises to the pelvic girdle and lower extremity muscles, in addition to pool exercises and molded seating to support upright posture. Long leg braces were fitted when the children were able to sit unsupported. All 12 were fitted with braces; nine were functional ambulators, and three were home ambulators. Six children required femoral plating or rodding, two of whom subsequently had the metal removed. Lower extremity fractures averaged one and one-half per year prior to bracing for nine children who had fractures. There was 0.83 fracture per year for the ten children who had fractures after bracing. The degree of femoral bowing increased in four, decreased in four, and remained unchanged in four, while the degree of tibial bowing increased in two, decreased in nine, and remained unchanged in one during the observation period. A comprehensive rehabilitation program and long leg bracing with surgical operations on the femur result in a high level of functional activity for children with OI with an acceptable level of risk for fracture.

  20. 2016 SOSORT guidelines: orthopaedic and rehabilitation treatment of idiopathic scoliosis during growth.

    Science.gov (United States)

    Negrini, Stefano; Donzelli, Sabrina; Aulisa, Angelo Gabriele; Czaprowski, Dariusz; Schreiber, Sanja; de Mauroy, Jean Claude; Diers, Helmut; Grivas, Theodoros B; Knott, Patrick; Kotwicki, Tomasz; Lebel, Andrea; Marti, Cindy; Maruyama, Toru; O'Brien, Joe; Price, Nigel; Parent, Eric; Rigo, Manuel; Romano, Michele; Stikeleather, Luke; Wynne, James; Zaina, Fabio

    2018-01-01

    The International Scientific Society on Scoliosis Orthopaedic and Rehabilitation Treatment (SOSORT) produced its first guidelines in 2005 and renewed them in 2011. Recently published high-quality clinical trials on the effect of conservative treatment approaches (braces and exercises) for idiopathic scoliosis prompted us to update the last guidelines' version. The objective was to align the guidelines with the new scientific evidence to assure faster knowledge transfer into clinical practice of conservative treatment for idiopathic scoliosis (CTIS). Physicians, researchers and allied health practitioners working in the area of CTIS were involved in the development of the 2016 guidelines. Multiple literature reviews reviewing the evidence on CTIS (assessment, bracing, physiotherapy, physiotherapeutic scoliosis-specific exercises (PSSE) and other CTIS) were conducted. Documents, recommendations and practical approach flow charts were developed using a Delphi procedure. The process was completed with the Consensus Session held during the first combined SOSORT/IRSSD Meeting held in Banff, Canada, in May 2016. The contents of the new 2016 guidelines include the following: background on idiopathic scoliosis, description of CTIS approaches for various populations with flow-charts for clinical practice, as well as literature reviews and recommendations on assessment, bracing, PSSE and other CTIS. The present guidelines include a total of 68 recommendations divided into following topics: bracing ( n  = 25), PSSE to prevent scoliosis progression during growth ( n  = 12), PSSE during brace treatment and surgical therapy ( n  = 6), other conservative treatments ( n  = 2), respiratory function and exercises ( n  = 3), general sport activities ( n  = 6); and assessment ( n  = 14). According to the agreed strength and level of evidence rating scale, there were 2 recommendations on bracing and 1 recommendation on PSSE that reached level of

  1. Which one Enhances Muscular Performance in ACL Reconstructed Subjects

    Science.gov (United States)

    Harput, Gulcan; Ulusoy, Burak; Atay, Ahmet Ozgur; Baltacı, Gul

    2014-01-01

    Objectives: The aim of this study was to investigate the effects of functional knee brace and kinesiotaping on muscular performance in anterior cruciate ligament reconstructed subjects who reached return to sport phase of the rehabilitation. Methods: Twenty (17 males, 3 females, Age: 24.7±7.1 years, Body weight: 74.4±12.0 kg, Height: 177.9±6.5 cm, BMI: 23.9±3.6 kg/m2) subjects who underwent anterior cruciate ligament reconstruction by using hamstring tendon auto graft were included in this study. When the subjects reached the return to sports phase of rehabilitation which was 6th months after surgery, knee muscle strength, jump performance and balance tests were performed 3 times: bare, with knee brace and with kinesio taping. The order of the tests were randomized to eliminate the effects of fatigue and motor learning. Quadriceps and hamstring muscle strength was measured on an isokinetic dynamometer at 180 °/s and 60°/s angular velocities. Vertical Jump (VJ) and One Leg Hop Tests (OLHT) were used to assess jump performance. Star Excursion Balance Test (SEBT) with anterior, posteromedial and posterolateral reach distance was used to assess the dynamic balance. When all tests were performed, the subjects were asked under which test condition they felt more confident. Repeated measures of ANOVA was used to analyze the difference among three test conditions (bare, kinesiotaping, knee brace). Bonferroni post hoc test was used for pairwise comparison. Results: SEBT posteromedial (PM)and posterolateral (PL) reach distances were found significantly different among three test conditions(PM: F(2,38)=3.42,p=0.04), PL: F(2,38)=4.37,p=0.02). Kinesiotaping increased posteromedial reach distance (p=0.03). On the other hand, brace decreased posterolateral reach distance (p=0.04). VJ and OLHT performance were also found significantly different between three test conditions (VJ: F (2,38)=3.44,p=0.04, OLHT: (F(2,38)=4.04,p=0.02). Kinesio taping increased one leg hop distance

  2. The Paneitz curvature problem on lower dimensional spheres

    CERN Document Server

    Ben-Ayed, M

    2003-01-01

    In this paper we prescribe a fourth order conformal invariant (the Paneitz curvature) on the n-spheres, with n is an element of left brace 5, 6 right brace. Using dynamical and topological methods involving the study of critical points at infinity of the associated variational problem, we prove some existence results.

  3. Les charpentes à entrait retroussé moisé : exemples orléanais des XVe et XVIe siècles Braced collar-beam roofs: examples from 15th and 16th century Orleans

    Directory of Open Access Journals (Sweden)

    Clément Alix

    2010-03-01

    Full Text Available La ville d’Orléans possède un ensemble important et inédit de charpentes à pannes des XVe et XVIe s. présentant la particularité de posséder un entrait retroussé moisé. Attesté dès le premier quart du XVe siècle, ce procédé innovant, constitué de deux pièces jumelées venant enserrer les principaux éléments de la ferme, va largement se diffuser dans les édifices religieux mais surtout dans l’habitat domestique, de la maison polyvalente en pan-de-bois au riche hôtel particulier. Ce mode de construction, démontrant une parfaite maîtrise de la statique de la charpente dès sa conception en vue de renforcer la triangulation de la ferme, s’impose donc rapidement dans un contexte architectural local marqué par la rareté de l’emploi de structures à chevrons-formant-fermes. Ainsi, on le retrouve également dans les charpentes à enrayure (tourelle d’escalier, toiture en pavillon, abside. L’utilisation généralisée de la moise à Orléans, et de manière plus ponctuelle en val de Loire et dans certaines régions de France, amène aussi à s’interroger sur l’origine de ce procédé connu sous d’autres formes dans des charpentes dès les XIIe-XIIIe s.The town of Orleans possesses an important and unpublished collection of timber-framed roof structures of the 15th and 16th centuries, with a braced collar-beam. Known since the first quarter of the 15th century, this innovative process, involving two twinned pieces clasping the main elements of the frame, became widely spread in religious buildings but particularly in domestic housing, from the multipurpose timber-framed home to the elaborate town house. This method of construction, demonstrating a perfect mastery of the statics of a roof structure from its design with a view to reinforcing the triangulation of the truss, rapidly established itself in a local architectural context marked by the rare use of “chevrons-formant-fermes” (common rafters forming a

  4. Behavior of Shear Link of WF Section with Diagonal Web Stiffener of Eccentrically Braced Frame (EBF of Steel Structure

    Directory of Open Access Journals (Sweden)

    Yurisman

    2010-11-01

    Full Text Available This paper presents results of numerical and experimental study of shear link behavior, utilizing diagonal stiffener on web of steel profile to increase shear link performance in an eccentric braced frame (EBF of a steel structure system. The specimen is to examine the behavior of shear link by using diagonal stiffener on web part under static monotonic and cyclic load. The cyclic loading pattern conducted in the experiment is adjusted according to AISC loading standards 2005. Analysis was carried out using non-linear finite element method using MSC/NASTRAN software. Link was modeled as CQUAD shell element. Along the boundary of the loading area the nodal are constraint to produce only one direction loading. The length of the link in this analysis is 400mm of the steel profile of WF 200.100. Important parameters considered to effect significantly to the performance of shear link have been analyzed, namely flange and web thicknesses, , thickness and length of web stiffener, thickness of diagonal stiffener and geometric of diagonal stiffener. The behavior of shear link with diagonal web stiffener was compared with the behavior of standard link designed based on AISC 2005 criteria. Analysis results show that diagonal web stiffener is capable to increase shear link performance in terms of stiffness, strength and energy dissipation in supporting lateral load. However, differences in displacement ductility’s between shear links with diagonal stiffener and shear links based on AISC standards have not shown to be significant. Analysis results also show thickness of diagonal stiffener and geometric model of stiffener to have a significant influence on the performance of shear links. To perform validation of the numerical study, the research is followed by experimental work conducted in Structural Mechanic Laboratory Center for Industrial Engineering ITB. The Structures and Mechanics Lab rotary PAU-ITB. The experiments were carried out using three test

  5. Automated Airdrop Information Retrieval System-Human Fact ors Database (AAIRS-HFD) (Users Manual)

    Science.gov (United States)

    1994-09-01

    creeps, or chokes) Pressure Change Disorders Loss of Sensorimotor Abilities Loss of Cognitive/Perceptual Abilities Treatment drug therapy ...physical therapy cognitive therapy biofeedback therapy 73 9. Psychological Factors Situational Awareness altitude awareness Visual/Spatial...on/off valve prebreather Floatation Devices life preserver Scuba Gear Ankle Braces Knee Braces/Pads 82 7. Cargo/Resupply Parachute Assembly

  6. Influence of the carrier Gas, trimethylgallium flow, and growth time on the character of the selective epitaxy of GaN

    Energy Technology Data Exchange (ETDEWEB)

    Rozhavskaya, M. M., E-mail: MRozhavskaya@gmail.com; Lundin, V. V.; Zavarin, E. E.; Troshkov, S. I.; Brunkov, P. N.; Tsatsulnikov, A. F. [Russian Academy of Sciences, Ioffe Physical-Technical Institute (Russian Federation)

    2013-03-15

    The influence of the carrier gas, trimethylgallium flow, and growth time on the character of the selective epitaxy of GaN in stripe windows oriented along the crystallographic direction Left-Pointing-Angle-Bracket 11-bar00 Right-Pointing-Angle-Bracket GaN for various widths of the mask between the stripes is studied. It is shown that the addition of nitrogen in the reactor atmosphere leads to changes in the form of the stripes in the case of wide (40 {mu}m) mask from a rectangular form restricted by a {l_brace}1 1-bar20{r_brace} lateral face to a trapezoidal form restricted by a {l_brace}1 1-bar22{r_brace} lateral face. It is also shown that during growth in the nitrogen-hydrogen mixture, the gallium flow starts to considerably affect the form of the growing stripes. It is shown that the process is significantly unstable, which leads to a noticeable variation in the form type as the transverse section of the stripe increases.

  7. Microstructures and precipitates in laser-ablated YBCO thin films on SrTiO[sub 3] (110). [Y-Ba-Cu-O

    Energy Technology Data Exchange (ETDEWEB)

    Catana, A. (IBM Research Div., Zurich Research Lab., Rueschlikon (Switzerland)); Rossel, C. (IBM Research Div., Zurich Research Lab., Rueschlikon (Switzerland)); Perrin, A. (Lab. de Chimie du Solide et Inorganique Moleculaire, Univ. de Rennes 1, 35 (France)); Guilloux-Viry, M. (Lab. de Chimie du Solide et Inorganique Moleculaire, Univ. de Rennes 1, 35 (France)); Thivet, C. (Lab. de Chimie du Solide et Inorganique Moleculaire, Univ. de Rennes 1, 35 (France))

    1993-05-10

    Thin YBCO films ([proportional to] 100 nm) have been deposited by laser ablation on SrTiO[sub 3] (110) substrates. Microstructural investigations have been performed by scanning tunneling and high-resolution electron microscopy. The results show that the surface corrugation is related to the growth of twisted YBCO domains that nucleate at the film/substrate interface. The twist is characterized by a 90 rotation of YBCO around the 100 and/or 010 axes, which results in [l brace]013[r brace] and/or [l brace]103[r brace] planes parallel to the substrate surface. Precipitates belonging to Y[sub 2]O[sub 3] are densely distributed on the film surface. No such second phases have been identified inside the YBCO films. The orientational relationship between precipitates and film is such that the lattice mismatch is minimized in the interface planes. A large number of precipitates grow from the film surface outwards. This phenomenon can be explained on the basis of lattice matching arguments and favorable growth kinetics. (orig.)

  8. Liquid densities and excess molar volumes for (ionic liquids + methanol + water) ternary system at atmospheric pressure and at various temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Deenadayalu, Nirmala [Department of Chemistry, Durban University of Technology, Steve Biko Campus, P.O. Box 1334, Durban, KwaZulu-Natal 4001 (South Africa)], E-mail: NirmalaD@dut.ac.za; Kumar, Satish; Bhujrajh, Pravena [Department of Chemistry, Durban University of Technology, Steve Biko Campus, P.O. Box 1334, Durban, KwaZulu-Natal 4001 (South Africa)

    2007-09-15

    Excess molar volumes, V{sub m}{sup E} have been evaluated from density measurements over the entire composition range for ternary liquid system of ionic liquid (1-ethyl-3-methyl-imidazolium diethylenglycol monomethylether sulphate {l_brace}[EMIM][CH{sub 3}(OCH{sub 2}CH{sub 2}){sub 2}OSO{sub 3}]) (1) + methanol (2) + water (3){r_brace} at T = (298.15, 303.15, and 313.15) K. A vibrating tube densimeter was used for these measurements at atmospheric pressure. The V{sub m}{sup E} values were found to be negative at T = (298.15 and 303.15) K. For {l_brace}[EMIM][CH{sub 3}(OCH{sub 2}CH{sub 2}){sub 2}OSO{sub 3}] (1) + methanol (2) + water (3){r_brace} at T = 313.15 K the V{sub m}{sup E} values become positive at higher mole fraction of ionic liquid and at a corresponding decrease in mole fraction of water. All the experimental data were fitted with the Redlich-Kister equation. The results have also been analysed in term of graph theoretical approach.

  9. Relationship between squeezing and entangled state transformations

    CERN Document Server

    Fan Hong Yi

    2003-01-01

    We show that c-number dilation transform in the Einstein-Podolsky-Rosen (EPR) entangled state, i.e. vertical bar eta sub 1 , eta sub 2) -> vertical bar eta sub 1 , eta sub 2 /mu) (or vertical bar eta sub 1 , eta sub 2) -> vertical bar eta sub 1 /mu, eta sub 2)), maps onto a kind of one-sided two-mode squeezing operator exp left brace i lambda/2(P sub 1 + P sub 2)(Q sub 1 + Q sub 2) - lambda/2 right brace, (or exp left brace i lambda/2(P sub 1 - P sub 2)(Q sub 1 - Q sub 2) - lambda/2 right brace). Using the IWOP technique, we derive their normally ordered form and construct the corresponding squeezed states. In doing so, some new relationship between squeezing and entangled state transformation is revealed. The dynamic Hamiltonian for such a kind of squeezing evolution is derived. The properties and application of the one-sided squeezed state are briefly discussed. These states can also be obtained with the use of a beam splitter.

  10. Symmetries of the nuclear average field hamiltonian and a search for possible exotic equilibrium deformations in superdeformed nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Li Xunjun; Dudek, J.; Romain, P. (Centre de Recherches Nucleaires, IN2P3-CNRS, Univ. Louis Pasteur, 67 - Strasbourg (France))

    1991-11-21

    Symmetry properties of the general average-field hamiltonian-matrix resulting from the geometrical symmetries of the hamiltonian itself are derived and discussed. The corresponding numerical algorithms are constructed. Total energy calculations for superdeformed nuclei are then extended to include the usually neglected deformation modes {alpha}{sub {lambda}=3{mu}{ne}0} in the expansion of the nuclear surface expression R({theta}, {phi}; {l brace}{alpha}{r brace})=c({l brace}{alpha}{r brace})R{sub 0}(1+{Sigma}{sub {lambda}} {Sigma}{sub {mu}=-{lambda}}{sup {lambda}} {alpha}{sub {lambda}{mu}}{sup *}{Upsilon}{sub {lambda}{mu}}({theta}, {phi})). The general trends in the shell-energy dependence on {alpha}{sub {lambda}=3{mu}} and the implied instabilities in the superdeformed configurations of the rare earth nuclei are studied using the Strutinsky formula with the macroscopic part taken in the form of the folded-Yukawa plus exponential interaction. A possibility of new (double superdeformed minimum) structures coexisting in some nuclei and resulting from the proton shell effects is predicted and illustrated. No significant neutron effects are found in the rare earth superdeformed nuclei considered. (orig.).

  11. In situ neutron diffraction study of the plastic deformation mechanisms of B2 ordered intermetallic alloys: NiAl, CuZn, and CeAg

    Energy Technology Data Exchange (ETDEWEB)

    Wollmershauser, J.A. [Department of Materials Science and Engineering, University of Virginia, P.O. Box 400745, 116 Engineer' s Way, Charlottesville, VA 22904-04745 (United States); Kabra, S. [Materials Science and Technology Division, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Agnew, S.R. [Department of Materials Science and Engineering, University of Virginia, P.O. Box 400745, 116 Engineer' s Way, Charlottesville, VA 22904-04745 (United States)], E-mail: sra4p@virginia.edu

    2009-01-15

    The internal stress developments of B2 compounds NiAl, CuZn, and CeAg are examined using in situ neutron diffraction. CeAg is a representative of a newly discovered class of fully ordered and ductile B2 compounds. Using polycrystal plasticity modeling to interpret the results, it is revealed that the internal stress evolution of CeAg is nearly identical to that of NiAl, indicating that they share a common primary mechanism of plastic deformation, i.e., <1 0 0>{l_brace}0 1 1{r_brace} 'cube' slip. This result reinforces the dilemma previously observed for rare-earth alloys CuY, AgY, and CuDy, since cube slip provides insufficient independent slip systems to accommodate large-scale homogenous polycrystalline deformation. There is no evidence in the diffraction data of either mechanical twinning or stress-induced phase transformation. The activity of bcc-type <1 1 1>{l_brace}11-bar0{r_brace} slip at high stresses is confirmed and a lower bound for the critical resolved shear stress is quantified.

  12. Structural relations of harmonic sums and Mellin transformers at weight w=6

    Energy Technology Data Exchange (ETDEWEB)

    Bluemlein, Johannes

    2009-01-15

    We derive the structural relations between nested harmonic sums and the corresponding Mellin transforms of Nielsen integrals and harmonic polylogarithms at weight w=6. They emerge in the calculations of massless single-scale quantities in QED and QCD, such as anomalous dimensions and Wilson coefficients, to 3- and 4-loop order. We consider the set of the multiple harmonic sums at weight six without index {l_brace}-1{r_brace}. This restriction is sufficient for all known physical cases. The structural relations supplement the algebraic relations, due to the shuffle product between harmonic sums, studied earlier. The original amount of 486 possible harmonic sums contributing at weight w=6 reduces to 99 sums with no index {l_brace}-1{r_brace}. Algebraic and structural relations lead to a further reduction to 20 basic functions. These functions supplement the set of 15 basic functions up to weight w=5 derived formerly. We line out an algorithm to obtain the analytic representation of the basic sums in the complex plane. (orig.)

  13. Factors influencing the choice of going to a dental quack practice for orthodontic treatment among the citizen of Bandung

    Directory of Open Access Journals (Sweden)

    Akhyar Dyni Zakyah

    2016-11-01

    Full Text Available Introduction: Braces is the treatment of choice for malocclusion. However, in recent years malocclusion no longer serves as the reason behind the orthodontic treatment. Many people use it for the fashion purposes and some of them got it from a dental quack. The purpose of this study was to understand factors that influenced citizen of Bandung to go to dental quack practice for orthodontics treatment. Methods: Cross-sectional study with purposive sampling technique consisting of 30 samples. Inclusion criteria were subject wearing metal braces from dental quack, live within area of Bandung, and willing to participate in the study. Exclusion criteria was subjects that refused to participate in the study. Results: The study showed that 73% of the subjects use the treatment for aligning teeth over getting along with the trend or the perception of beauty from using colorful bracket rubber. 63% chose a dental quack because of the suggestions from friends who had done it before them. Low income combined with the need for orthodontics treatment and inadequate information about dental braces influencing subjects choice to go to a dental quack. The study showed that socioeconomic environment highly influenced the decision to wear braces from a dental quack. Conclusion: The low price factor was the main reason for dental quack braces highly demanded. Common people need to be educated to get proper treatment for malocclusion and to go for improper provider of dental treatment.

  14. Non-inductive current drive via helicity injection by Alfven waves in low-aspect-ratio tokamaks

    Energy Technology Data Exchange (ETDEWEB)

    Cuperman, S.; Bruma, C.; Komoshvili, K. [Tel Aviv Univ. (Israel). Sackler Faculty of Exact Sciences

    1996-08-01

    A theoretical investigation of radio-frequency (RF) current drive via helicity injection in low aspect ratio tokamaks is carried out. A current-carrying cylindrical plasma surrounded by a helical sheet-current antenna and situated inside a perfectly conducting shell is considered. Toroidal features of low-aspect-ratio tokamaks are simulated by incorporating the following effects: (i) arbitrarily small aspect ratio, R{sub O}/a ``identical to`` 1/{epsilon}; (ii) strongly sheared equilibrium magnetic field; and (iii) relatively large poloidal component of the equilibrium magnetic field. This study concentrates on the Alfven continuum, i.e. the case in which the wave frequency satisfies the condition {l_brace}{omega}{sub Alf}({tau}){r_brace}{sub min}{r_brace} {<=} {omega} {<=} {l_brace}{omega}{sub Alf}({tau}){r_brace}{sub max}, where {omega}{sub Alf}({tau}) ``identical to`` {omega}{sub Alf}[n({tau}), B{sub O}({tau})] is an eigenfrequency of the shear Alfven wave (SAW). Thus, using low-{beta} magnetohydrodynamics, the wave equation with correct boundary (matching) conditions is solved, the RF field components are found, and subsequently current drive, power deposition and efficiency are computed. The results of our investigation clearly demonstrate the possibility of generation of RF-driven currents via helicity injection by Alfven waves in low-aspect-ratio tokamaks, in the SAW mode. A special algorithm is developed that enables one to select the antenna parameters providing optimal current drive efficiency. (Author).

  15. 鉄骨充腹ばりの横座屈に関する研究 (その5) -モーメント勾配のあるはりの塑性変形能力及び補剛材の設計法-

    OpenAIRE

    中村, 武; 若林, 實

    1981-01-01

    In this paper, reported is a design method of H-shaped beams in platic range, in whichthe lateral buckling effects are taken into consideration. Based on the experimental results and semi-theoretical aspects, a design formula which gives the relationship between the lateral bracing spacingand rotation capacity under moment gradient and a design principle for lateral bracings are derivedand proposed.

  16. Supersymmetric M3-branes and G{sub 2} manifolds

    Energy Technology Data Exchange (ETDEWEB)

    Cvetic, M. E-mail: cvetic@cvetic.hep.upenn.edu; Gibbons, G.W.; Lue, H.; Pope, C.N

    2002-01-07

    We obtain a generalisation of the original complete Ricci-flat metric of G{sub 2} holonomy on R{sup 4}xS{sup 3} to a family with a nontrivial parameter {lambda}. For generic {lambda} the solution is singular, but it is regular when {lambda}={l_brace}-1,0,+1{r_brace}. The case {lambda}=0 corresponds to the original G{sub 2} metric, and {lambda}={l_brace}-1,1{r_brace} are related to this by an S{sub 3} automorphism of the SU(2){sup 3} isometry group that acts on the S{sup 3}xS{sup 3} principal orbits. We then construct explicit supersymmetric M3-brane solutions in D=11 supergravity, where the transverse space is a deformation of this class of G{sub 2} metrics. These are solutions of a system of first-order differential equations coming from a superpotential. We also find M3-branes in the deformed backgrounds of new G{sub 2} holonomy metrics that include one found by A. Brandhuber, J. Gomis, S. Gubser and S. Gukov, and show that they also are supersymmetric.

  17. Nanoscale characterization of martensite structures in copper based shape memory alloys

    Energy Technology Data Exchange (ETDEWEB)

    Adiguzel, O, E-mail: oadiguzel@firat.edu.t [Firat University Department of Physics, 23169 Elazig (Turkey)

    2010-11-01

    Martensitic transformations are first order displacive transitions and occur in the materials on cooling from high temperature. Shape memory effect is an unusual property exhibited by certain alloy systems, and leads to martensitic transition. Copper-based alloys exhibit this property in beta phase field which possess simple bcc- structures, austenite structure at high-temperatures. As temperature is lowered the austenite undergoes martensitic transition following two ordering reactions, and structural changes in nanoscale govern this transition. Atomic movements are also confined to interatomic lengths in sub-{mu}m or angstrom scale in martensitic transformation. The formation of the layered structures in copper based alloys consists of shears and shear mechanism. Martensitic transformations occur in a few steps with the cooperative movement of atoms less than interatomic distances by means of lattice invariant shears on a {l_brace}110{r_brace} - type plane of austenite matrix which is basal plane or stacking plane of martensite. The lattice invariant shears occurs, in two opposite directions, <110> -type directions on the {l_brace}110{r_brace}-type plane. These shears gives rise to the formation of layered structure.

  18. Monitoring recovery following syndesmosis sprain: a case report.

    Science.gov (United States)

    Spaulding, S J

    1995-10-01

    A sprain to the tibial-fibular syndesmosis often results in prolonged rehabilitation or surgical intervention before recovery occurs. This paper documents gait recovery both before and after surgery for a syndesmosis sprain. Ground reaction force (GRF) data were available before injury and before surgery. Data were also collected every 3 days from 4 days to 4 months after syndesmosis screw removal (8 weeks after surgery). Weightbearing during the stance phase of gait did not approach normal values until approximately 4 months after syndesmosis screw removal. The push-off phase of gait also was slow to recover. When it was possible for the subject to use one or two crutches, differences in GRF were evident, such that walking with one crutch demonstrated increased force production at the ground. Bracing the ankle with a semirigid brace increased GRF, whereas a boot-type lace-up brace resulted in decreased GRF. In this case report of a combined ankle and syndesmosis sprain, results suggest the weightbearing and push-off force were seriously compromised. Decreasing the number of walking assistive devices and wearing a semirigid ankle brace increased the amount of weightbearing through the affected leg and may have merit in encouraging muscle function.

  19. Molecular dynamics simulations of quasi-brittle crack development in iron

    Energy Technology Data Exchange (ETDEWEB)

    Borodin, V.A., E-mail: borodin@dni.polin.kiae.su [Karlsruhe Institute of Technology (KIT), 76131 Karlsruhe (Germany); NRC Kurchatov Institute, Kurchatov Sq. 1, 123182 Moscow (Russian Federation); Vladimirov, P.V., E-mail: Pavel.Vladimirov@kit.edu [Karlsruhe Institute of Technology (KIT), 76131 Karlsruhe (Germany)

    2011-08-31

    The paper presents the results of molecular dynamics (MD) simulations of three-dimensional kinetics of micro-crack propagation in alpha-iron and the accompanying lattice transformations at the crack tips. We show that crack initiation on {l_brace}0 0 1{r_brace} planes in iron is preceded with the emission of compact slip bands from the pre-crack tips, in agreement with the predictions of the earlier quasi-two-dimensional simulations. The application of Voronoi decomposition technique for atomic short-range order processing has allowed us to clarify the kinetics of structural transformations at the tips of nucleating and propagating cracks for three most common systems of crack propagation in iron. It is demonstrated that the compact slip bands emanating from the crack tips not only accompany crack nucleation, but remain an essential feature of the crack propagation on {l_brace}0 0 1{r_brace} planes. Due to the strong coupling between the crack tip and slip band propagation, the crack propagation can be limited by slip band interaction with microstructural obstacles, abundantly created in ferritic-martensitic steels in radiation environment of nuclear facilities.

  20. Inspection- and test arrangement

    International Nuclear Information System (INIS)

    Weber, R.; Gallwas, J.

    1980-01-01

    The ultrasonic testing equipment is located on a wagon that can be moved on a circular rail fixed below the bottom of the cylindrical pressure vessel. To compensate thermal expansions between ground and rail, this rail is provided on its outside with radial sticks that are embedded in braces. The braces themselves are connected with the bottom that has to be tested. (DG) [de

  1. Extraction of pentylbenzene from high molar mass alkanes (C{sub 14} and C{sub 17}) by N-methyl-2-pyrrolidone

    Energy Technology Data Exchange (ETDEWEB)

    Fandary, Mohamed S. [Chemical Engineering Department, College of Technological Studies, P.O. Box 3242, Salmyiah 22033 (Kuwait)]. E-mail: mfandary@yahoo.com; Al-Jimaz, Adel S. [Chemical Engineering Department, College of Technological Studies, P.O. Box 3242, Salmyiah 22033 (Kuwait); Al-Kandary, Jasem A. [Chemical Engineering Department, College of Technological Studies, P.O. Box 3242, Salmyiah 22033 (Kuwait); Fahim, Mohamed A. [Chemical Engineering Department, University of Kuwait, P.O. Box 5969, Safat 13060 (Kuwait)

    2006-04-15

    Equilibrium tie line data have been determined for the two ternary liquid systems: {l_brace}tetradecane, or heptadecane + pentylbenzene + N-methyl-2-pyrrolidone (NMP){r_brace} over a temperature range of (298 to 328) K. The two systems studied exhibit type I liquid + liquid phase diagram. The effect of temperature and n-alkane chain length upon solubility, selectivity, and distribution coefficients were investigated experimentally.

  2. Nuclear fuel elements

    International Nuclear Information System (INIS)

    Ainsworth, K.F.

    1979-01-01

    A nuclear fuel element is described having a cluster of nuclear fuel pins supported in parallel, spaced apart relationship by transverse cellular braces within coaxial, inner and outer sleeves, the inner sleeve being in at least two separate axial lengths, each of the transverse braces having a peripheral portion which is clamped peripherally between the ends of the axial lengths of the inner sleeve. (author)

  3. The Soviet Theory of Reflexive Control in Historical and Psychocultural Perspective: A Preliminary Study

    Science.gov (United States)

    1986-07-01

    broad spectrum of military and political affairs. After all, historian Hannah Arendt ,153 economist John Kenneth Galbraith,154 and sociologists Raven and...Military Systems Engineering (op. cit.), pp. 334-348. 153 Arendt , Hannah , The Origins of Totalitarianism, Harcourt Brace and Company, New York, 1951...and Crisis Behavior, George Allen and Unwin, London, 198Z. Arendt , Hannah , The Origins of Totalitarianism, Harcourt Brace and Company, New York, 1951

  4. Supramolecular architectures in layer-by-layer films of single-walled carbon nanotubes, chitosan and cobalt (II) phthalocyanine

    Energy Technology Data Exchange (ETDEWEB)

    Sousa Luz, Roberto A. de; Martins, Marccus Victor A.; Magalhaes, Janildo L. [Departamento de Quimica, Centro de Ciencias da Natureza, Universidade Federal do Piaui, Teresina - PI, CEP 64049-550 (Brazil); Siqueira, Jose R. [Instituto de Ciencias Exatas, Naturais e Educacao, Universidade Federal do Triangulo Mineiro, Uberaba - MG, CEP 38025-180, Brazil (Brazil); Zucolotto, Valtencir; Oliveira, Osvaldo N. [Instituto de Fisica de Sao Carlos, Universidade de Sao Paulo, Sao Carlos - SP, CEP 13560-970 (Brazil); Crespilho, Frank N. [Centro de Ciencias Naturais e Humanas, Universidade Federal do ABC, Santo Andre - SP, CEP 09210-170 (Brazil); Cantanhede da Silva, Welter, E-mail: welter@ufpi.edu.br [Departamento de Quimica, Centro de Ciencias da Natureza, Universidade Federal do Piaui, Teresina - PI, CEP 64049-550 (Brazil)

    2011-11-01

    Highlights: {yields} Platforms were assembled from cobalt phthalocyanine, chitosan and carbon nanotubes. {yields} Supramolecular organization of multilayer films was investigated. {yields} Increase of the supramolecular charge transfer after carbon nanotube incorporation. {yields} Functional modulation based on constitutional dynamic chemistry was achieved. - Abstract: The building of supramolecular structures in nanostructured films has been exploited for a number of applications, with the film properties being controlled at the molecular level. In this study, we report on the layer-by-layer (LbL) films combining cobalt (II) tetrasulfonated phthalocyanine (CoTsPc), chitosan (Chit) and single-walled carbon nanotubes (SWCNTs) in two architectures, {l_brace}Chit/CoTsPc{r_brace}{sub n} and {l_brace}Chit-SWCNTs/CoTsPc{r_brace}{sub n} (n = 1-10). The physicochemical properties of the films were evaluated and the multilayer formation was monitored with microgravimetry measurements using a quartz microbalance crystal and an electrochemical technique. According to atomic force microscopy (AFM) results, the incorporation of SWCNTs caused the films to be thicker, with a thickness ca. 3 fold that of a 2-bilayer LbL film with no SWCNTs. Cyclic voltammetry revealed a quasi-reversible, one electron process with E{sub 1/2} at -0.65 V (vs SCE) and an irreversible oxidation process at 0.80 V in a physiological medium for both systems, which can be attributed to [CoTsPc(I)]{sup 5-}/[CoTsPc(II)]{sup 4-} and CoTsPc(II) to CoTsPc(III), respectively. The {l_brace}Chit-SWCNTs/CoTsPc{r_brace}{sub 5} multilayer film exhibited an increased faradaic current, probably associated with the supramolecular charge transfer interaction between cobalt phthalocyanine and SWCNTs. The results demonstrate that an intimate contact at the supramolecular level between functional SWCNTs immobilized into biocompatible chitosan polymer and CoTsPc improves the electron flow from CoTsPc redox sites to the

  5. Synthesis and characterization of [{sup 76}Br]-labeled high-affinity A{sub 3} adenosine receptor ligands for positron emission tomography

    Energy Technology Data Exchange (ETDEWEB)

    Kiesewetter, Dale O. [Positron Emission Tomography Radiochemistry Group, NIBIB, Clinical Center, National Institutes of Health, Bethesda, MD 20892 (United States)], E-mail: dk7k@nih.gov; Lang Lixin; Ma Ying; Bhattacharjee, Abesh Kumar [Positron Emission Tomography Radiochemistry Group, NIBIB, Clinical Center, National Institutes of Health, Bethesda, MD 20892 (United States); Gao, Zhan-Guo; Joshi, Bhalchandra V.; Melman, Artem; Castro, Sonia de; Jacobson, Kenneth A. [Molecular Recognition Section, Laboratory of Bioorganic Chemistry, National Institute of Diabetes and Digestive and Kidney Diseases, National Institutes of Health, Bethesda, MD 20892 (United States)

    2009-01-15

    Introduction: Bromine-76-radiolabeled analogues of previously reported high-affinity A{sub 3} adenosine receptor (A{sub 3}AR) nucleoside ligands have been prepared as potential radiotracers for positron emission tomography. Methods: The radiosyntheses were accomplished by oxidative radiobromination on the N{sup 6}-benzyl moiety of trimethyltin precursors. Biodistribution studies of the kinetics of uptake were conducted in awake rats. Results: We prepared an agonist ligand {l_brace}[{sup 76}Br](1'S,2'R,3'S,4'R,5'S)-4'-{l_brace}2-chloro-6-[(3-bromophenylmethyl)amino] purin-9-yl{r_brace}-1'-(methylaminocarbonyl)bicyclo[3.1.0]hexane-2',3'-diol (MRS3581){r_brace} in 59% radiochemical yield with a specific activity of 19.5 GBq/{mu}mol and an antagonist ligand {l_brace}[{sup 76}Br](1'R,2'R,3'S,4'R,5'S)-4'-(6-(3-bromobenzylamino) -2-chloro-9H-purin-9-yl)bicyclo[3.1.0]hexane-2',3'-diol (MRS5147){r_brace} in 65% radiochemical yield with a specific activity of 22 GBq/{mu}mol. The resultant products exhibited the expected high affinity (K{sub i}{approx}0.6 nM) and specific binding at the human A{sub 3}AR in vitro. Biodistribution studies in the rat showed uptake in the organs of excretion and metabolism. The antagonist MRS5147 exhibited increasing uptake in testes, an organ that contains significant quantities of A{sub 3}AR, over a 2-h time course, which suggests the presence of a specific A{sub 3}AR retention mechanism. Conclusion: We were able to compare uptake of the [{sup 76}Br]-labeled antagonist MRS5147 to [{sup 76}Br]agonist MRS3581. The antagonist MRS5147 shows increasing uptake in the testes, an A{sub 3}AR-rich tissue, suggesting that this ligand may have promise as a molecular imaging agent.

  6. Synthesis and crystal structure of terbium(III) meta-oxoborate Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}); Synthese und Kristallstruktur von Terbium(III)-meta-Oxoborat Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6})

    Energy Technology Data Exchange (ETDEWEB)

    Nikelski, Tanja; Schleid, Thomas [Institut fuer Anorganische Chemie der Universitaet Stuttgart (Germany)

    2003-06-01

    The terbium meta-oxoborate Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}) is obtained as single crystals by the reaction of terbium, Tb{sub 4}O{sub 7} and TbCl{sub 3} with an excess of B{sub 2}O{sub 3} in gastight sealed platinum ampoules at 950 C after three weeks. The compound appears to be air- and water-resistant and crystallizes as long, thin, colourless needles which tend to growth-twinning due to their marked fibrous habit. The crystal structure of Tb(BO{sub 2}){sub 3} (orthorhombic, Pnma; a = 1598.97(9), b = 741.39(4), c = 1229.58(7) pm; Z = 16) contains strongly corrugated oxoborate layers {sub {infinity}}{sup 2}{l_brace}(BO{sub 2}){sup -}{r_brace} built of vertex-linked [BO{sub 4}]{sup 5-} tetrahedra (d(B-O) = 143 - 154 pm, and angsph;(O-B-O) = 102-115 ) which spread out parallel (100). The four crystallographically different Tb{sup 3+} cations all exhibit coordination numbers of eight towards the oxygen atoms (d(Tb-O) = 228-287 pm). The corresponding metal cation polyhedra [TbO{sub 8}]{sup 13+} too convene to layers (composition: {sub {infinity}}{sup 2}{l_brace}(Tb{sub 2}O{sub 11}){sup 16-}{r_brace}) which are likewise oriented parallel to the (100) plane. (Abstract Copyright [2003], Wiley Periodicals, Inc.) [German] Das Terbium-meta-Oxoborat Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}) entsteht einkristallin bei der Reaktion von Terbium, Tb{sub 4}O{sub 7} und TbCl{sub 3} mit einem Ueberschuss von B{sub 2}O{sub 3} in gasdicht verschlossenen Platinampullen nach drei Wochen bei 950 C. Die Verbindung ist luft- und wasserstabil und faellt in langen, duennen, farblosen Nadeln an, die aufgrund ihres ausgepraegt faserigen Habitus zur Wachstumsverzwillingung neigen. Die Kristallstruktur von Tb(BO{sub 2}){sub 3} (orthorhombisch, Pnma; a = 1598, 97(9), b = 741, 39(4), c = 1229, 58(7) pm; Z = 16) enthaelt parallel (100) verlaufende, stark gewellte Oxoborat-Schichten {sub {infinity}}{sup 2}{l_brace}(BO{sub 2}){sup -}{r_brace} aus

  7. Unspecific chronic low back pain – a simple functional classification tested in a case series of patients with spinal deformities

    Directory of Open Access Journals (Sweden)

    Werkmann Mario

    2009-02-01

    Full Text Available Abstract Background Up to now, chronic low back pain without radicular symptoms is not classified and attributed in international literature as being "unspecific". For specific bracing of this patient group we use simple physical tests to predict the brace type the patient is most likely to benefit from. Based on these physical tests we have developed a simple functional classification of "unspecific" low back pain in patients with spinal deformities. Methods Between January 2006 and July 2007 we have tested 130 patients (116 females and 14 males with spinal deformities (average age 45 years, ranging from 14 years to 69 and chronic unspecific low back pain (pain for > 24 months along with the indication for brace treatment for chronic unspecific low back pain. Some of the patients had symptoms of spinal claudication (n = 16. The "sagittal realignment test" (SRT was applied, a lumbar hyperextension test, and the "sagittal delordosation test" (SDT. Additionally 3 female patients with spondylolisthesis were tested, including one female with symptoms of spinal claudication and 2 of these patients were 14 years of age and the other 43yrs old at the time of testing. Results 117 Patients reported significant pain release in the SRT and 13 in the SDT (>/= 2 steps in the Roland & Morris VRS. 3 Patients had no significant pain release in both of the tests ( Pain intensity was high (3,29 before performing the physical tests (VRS-scale 0–5 and low (1,37 while performing the physical test for the whole sample of patients. The differences where highly significant in the Wilcoxon test (z = -3,79; p In the 16 patients who did not respond to the SRT in the manual investigation we found hypermobility at L5/S1 or a spondylolisthesis at level L5/S1. In the other patients who responded well to the SRT loss of lumbar lordosis was the main issue, a finding which, according to scientific literature, correlates well with low back pain. The 3 patients who did not

  8. Effects of counteracting external valgus moment on lateral tibial cartilage contact conditions and tibial rotation.

    Science.gov (United States)

    Shriram, Duraisamy; Parween, Rizuwana; Lee, Yee Han Dave; Subburaj, Karupppasamy

    2017-07-01

    Knee osteoarthritis that prevalently occurs at the medial compartment is a progressive chronic disorder affecting the articular cartilage of the knee joint, and lead to loss of joint functionality. Valgus braces have been used as a treatment procedure to unload the medial compartment for patients with medial osteoarthritis. Valgus braces through the application of counteracting external valgus moment shift the load from medial compartment towards the lateral compartment. Previous biomechanical studies focused only on the changes in varus moments before and after wearing the brace. The objective of this study was to investigate the influence of opposing external valgus moment applied by knee braces on the lateral tibial cartilage contact conditions using a 3D finite element model of the knee joint. Finite element simulations were performed on the knee joint model without and with the application of opposing valgus moment to mimic the unbraced and braced conditions. Lateral tibial cartilage contact pressures and contact area, and tibial rotation (varus-valgus and internal-external) were estimated for the complete walking gait cycle. The opposing valgus moment increased the maximum contact pressure and contact area on the lateral tibial cartilage compared to the normal gait moment. A peak contact pressure of 8.2 MPa and maximum cartilage loaded area of 28% (loaded cartilage nodes) on the lateral cartilage with the application of external valgus moment were induced at 50% of the gait cycle. The results show that the use of opposing valgus moment may significantly increase the maximum contact pressures and contact area on the lateral tibial cartilage and increases the risk of articular cartilage damage on the lateral compartment.

  9. Scattering theory for open quantum systems

    Energy Technology Data Exchange (ETDEWEB)

    Behrndt, Jussi [Technische Univ. Berlin (Germany). Inst. fuer Mathematik; Malamud, Mark M. [Donetsk National University (Ukraine). Dept. of Mathematics; Neidhardt, Hagen [Weierstrass-Institut fuer Angewandte Analysis und Stochastik (WIAS) im Forschungsverbund Berlin e.V. (Germany)

    2006-07-01

    Quantum systems which interact with their environment are often modeled by maximal dissipative operators or so-called Pseudo-Hamiltonians. In this paper the scattering theory for such open systems is considered. First it is assumed that a single maximal dissipative operator A{sub D} in a Hilbert space H is used to describe an open quantum system. In this case the minimal self-adjoint dilation K of A{sub D} can be regarded as the Hamiltonian of a closed system which contains the open system {l_brace}A{sub D},h{r_brace}, but since K is necessarily not semibounded from below, this model is difficult to interpret from a physical point of view. In the second part of the paper an open quantum system is modeled with a family {l_brace}A({mu}){r_brace} of maximal dissipative operators depending on energy {mu}, and it is shown that the open system can be embedded into a closed system where the Hamiltonian is semibounded. Surprisingly it turns out that the corresponding scattering matrix can be completely recovered from scattering matrices of single Pseudo-Hamiltonians as in the first part of the paper. The general results are applied to a class of Sturm-Liouville operators arising in dissipative and quantum transmitting Schroedinger-Poisson systems. (orig.)

  10. Surface-Energy-Anisotropy-Induced Orientation Effects on RayleighInstabilities in Sapphire

    Energy Technology Data Exchange (ETDEWEB)

    Santala, Melissa; Glaeser, Andreas M.

    2006-01-01

    Arrays of controlled-geometry, semi-infinite pore channels of systematically varied crystallographic orientation were introduced into undoped m-plane (10{bar 1}0) sapphire substrates using microfabrication techniques and ion-beam etching and subsequently internalized by solid-state diffusion bonding. A series of anneals at 1700 C caused the breakup of these channels into discrete pores via Rayleigh instabilities. In all cases, channels broke up with a characteristic wavelength larger than that expected for a material with isotropic surface energy, reflecting stabilization effects due to surface-energy anisotropy. The breakup wavelength and the time required for complete breakup varied significantly with channel orientation. For most orientations, the instability wavelength for channels of radius R was in the range of 13.2R-25R, and complete breakup occurred within 2-10 h. To first order, the anneal times for complete breakup scale with the square of the breakup wavelength. Channels oriented along a <11{bar 2}0> direction had a wavelength of {approx} 139R, and required 468 h for complete breakup. Cross-sectional analysis of channels oriented along a <11{bar 2}0> direction showed the channel to be completely bounded by stable c(0001), r{l_brace}{bar 1}012{r_brace}, and s{l_brace}10{bar 1}1{r_brace} facets.

  11. Effects of Protein-pheromone Complexation on Correlated Chemical Shift Modulations

    Energy Technology Data Exchange (ETDEWEB)

    Perazzolo, Chiara; Wist, Julien [Ecole Polytechnique Federale de Lausanne, Institut des Sciences et Ingenierie Chimiques (Switzerland); Loth, Karine; Poggi, Luisa [Ecole Normale Superieure, Departement de chimie, associe au CNRS (France); Homans, Steve [University of Leeds, School of Biochemistry and Microbiology (United Kingdom); Bodenhausen, Geoffrey [Ecole Polytechnique Federale de Lausanne, Institut des Sciences et Ingenierie Chimiques (Switzerland)], E-mail: Geoffrey.Bodenhausen@ens.fr

    2005-12-15

    Major urinary protein (MUP) is a pheromone-carrying protein of the lipocalin family. Previous studies by isothermal titration calorimetry (ITC) show that the affinity of MUP for the pheromone 2-methoxy-3-isobutylpyrazine (IBMP) is mainly driven by enthalpy, with a small unfavourable entropic contribution. Entropic terms can be attributed in part to changes in internal motions of the protein upon binding. Slow internal motions can lead to correlated or anti-correlated modulations of the isotropic chemical shifts of carbonyl C' and amide N nuclei. Correlated chemical shift modulations (CSM/CSM) in MUP have been determined by measuring differences of the transverse relaxation rates of zero- and double-quantum coherences ZQC{l_brace}C'N{r_brace} and DQC{l_brace}C'N{r_brace}, and by accounting for the effects of correlated fluctuations of dipole-dipole couplings (DD/DD) and chemical shift anisotropies (CSA/CSA). The latter can be predicted from tensor parameters of C' and N nuclei that have been determined in earlier work. The effects of complexation on slow time-scale protein dynamics can be determined by comparing the temperature dependence of the relaxation rates of APO-MUP (i.e., without ligand) and HOLO-MUP (i.e., with IBMP as a ligand)

  12. Adsorption properties and inhibition of mild steel corrosion in hydrochloric solution by some newly synthesized diamine derivatives: Experimental and theoretical investigations

    Energy Technology Data Exchange (ETDEWEB)

    Herrag, L.; Hammouti, B.; Elkadiri, S.; Aouniti, A. [Laboratoire de Chimie Appliquee et Environnement, LCAE-URAC18, Faculte des Sciences, Universite Mohammed Premier, B.P. 717, M-6000 Oujda (Morocco); Jama, C. [Unite Materiaux et Transformations (UMET), Ingenierie des Systemes Polymeres, CNRS UMR 8207, ENSCL, B.P. 90108, F-59652 Villeneuve d' Ascq Cedex (France); Vezin, H. [Laboratoire de Spectrochimie Infrarouge et Raman (LASIR), UMR-CNRS 8516, Universite des Sciences et Technologies de Lille, Batiment C5, F-59655 Villeneuve d' Ascq Cedex (France); Bentiss, F., E-mail: fbentiss@enscl.f [Laboratoire de Chimie de Coordination et d' Analytique (LCCA), Faculte des Sciences, Universite Chouaib Doukkali, B.P. 20, M-24000 El Jadida (Morocco)

    2010-09-15

    New diamine derivatives, namely 2-[{l_brace}2-[bis-(2-hydroxyethyl)amino]ethyl{r_brace}(2-hydroxyethyl)amino]ethanol (DAME) and 2-[{l_brace}2-[bis-(2-hydroxyethyl)amino]ethyl{r_brace}(2-hydroxyethyl)amino]propanol (DAMP) were synthesised and their inhibitive action against the corrosion of mild steel in 1 M HCl solution were investigated at 308 K. The detailed study of DAME is given using gravimetric measurements and polarization curves method. Results show that DAME is a good inhibitor and inhibition efficiency reaches 91.7% at 10{sup -3} M. Tafel polarization study revealed that DAME acts as a mixed-type inhibitor. The inhibitor adsorption process in mild steel/DAME/hydrochloric acid system was studied at different temperatures (308-353 K) by means of weight loss measurements. The adsorption of DAME on steel surface obeyed Langmuir's adsorption isotherm. The kinetic and thermodynamic parameters for mild steel corrosion and inhibitor adsorption, respectively, were determined and discussed. The comparative study of inhibitive performance of the two diamine derivatives revealed that DAME is more effective than DAMP. Quantitative Structure-Activity Relationship (QSAR) approach has been conducted in attempt to correlate the corrosion inhibition properties of these diamine derivatives with their calculated quantum chemical parameters.

  13. Energy cost of ambulation in healthy and disabled Filipino children.

    Science.gov (United States)

    Luna-Reyes, O B; Reyes, T M; So, F Y; Matti, B M; Lardizabal, A A

    1988-11-01

    The energy expenditures (Ee) for locomotion by nondisabled and disabled Filipino children aged 7 to 13 were determined and compared using indirect calorimetry. Forty-one controls (20 boys and 21 girls) ambulated at a comfortable pace; 16 children (eight boys and eight girls) with lower extremity poliomyelitis of varying severity ambulated by (1) wheelchair propulsion, (2) bilateral axillary crutches, (3) unilateral lower extremity ankle-foot orthoses or knee-ankle-foot orthoses, and (4) unassisted. Disabled children, regardless of their mode of ambulation, had to expend significantly more energy to ambulate than normal children (p less than 0.05). Wheelchair propulsion cost 16% more energy than the normal gait; crutch ambulation cost 41% more than the control. Children using unilateral braces sacrificed speed to attain near-normal Ee. When they ambulated without orthoses, their Ee increased by 109% over the control. In ascending order, the least energy was expanded by normal ambulation followed by disabled ambulation with unilateral brace, disabled propelling a wheelchair, disabled ambulation with bilateral axillary crutches, and disabled ambulation without brace. Efficiency of locomotion was reflected in the values obtained for Ee in terms of kcal x 10(-3)/kg/m, as demonstrated by the lower Ee but slower ambulation of children with braces, as compared to the nondisabled children.

  14. Knee Bracing: What Works?

    Science.gov (United States)

    ... what it’s treating. Some are worn all the time. Some are only worn during sports, exercise, or physical activity. You should check the ... and Injury Prevention, Injury Rehabilitation, Prevention and Wellness, Sports ... Management September 1, 2005 Copyright © American Academy of Family ...

  15. Complete {sup 1}H and {sup 13}C NMR structural assignments for a group of four goyazensolide-type furanoheliangolides

    Energy Technology Data Exchange (ETDEWEB)

    Soares, Ana Carolina Ferreira; Silva, Aline Nazare; Matos, Priscilla Mendonca; Silva, Eder Henrique da; Heleno, Vladimir Constantino Gomes [Universidade de Franca, Franca, SP (Brazil). Nucleo de Pesquisas em Ciencias Exatas e Tecnologicas; Lopes, Norberto Peporine; Lopes, Joao Luis Callegari [Universidade de Sao Paulo (FCFRP/USP), Ribeirao Preto, SP (Brazil). Fac. de Ciencias Farmaceuticas de Ribeirao Preto. Dept. de Quimica e Fisica; Sass, Daiane Cristina, E-mail: vheleno_05@yahoo.com.br [Universidade de Sao Paulo (FFCLRP/USP), Ribeirao Preto, SP (Brazil). Fac. de Filosofia, Ciencias e Letras de Ribeirao Preto. Dept. de Quimica

    2012-07-01

    Four goyazensolide-type sesquiterpene lactones - lychnofolide, centratherin, goyazensolide and goyazensolide acetate - were thoroughly studied by NMR experimental techniques. {sup 1}H NMR, {sup 13}C NMR {l_brace}{sup 1}H{r_brace}, COSY, HMQC, HMBC, J-res. and NOE experiments were performed to provide the needed structural information. Complete and unequivocal assignment, including the determination of all multiplicities, was obtained for each structure and the data collections are presented in tables (author)

  16. Idiopatiske skolioser

    DEFF Research Database (Denmark)

    Andersen, M O; Andersen, G R; Christensen, S B

    1993-01-01

    The article summarizes the current theories on the aetiology, natural history, diagnosis and treatment of adolescent idiopathic scoliosis. Much remains unknown concerning the genesis of scoliosis. The current treatment with bracing or spinal fusion is effective.......The article summarizes the current theories on the aetiology, natural history, diagnosis and treatment of adolescent idiopathic scoliosis. Much remains unknown concerning the genesis of scoliosis. The current treatment with bracing or spinal fusion is effective....

  17. Terrorism: A Selected Bibliography.

    Science.gov (United States)

    1984-07-30

    Terrorism, Outraged World Seeks an Answer." U. News and World Report, September 18, 1972, p. 16. Arendt , Hannah . Crisis of the Republic. N. Y., Harcourt...Brace Jovanovich, 1972. Arendt , Hannah , On Violence. N. Y. Harcourt, Brace and World, 1970. Arendt , Hannah . On Revolutions. N. Y., Viking Press, 1965... Arendt , Hannah . "Reflections on Violence." Journal of International Affairs, 23:1, 1969. "Are the Skies Really Friendly?" Proposed Theories of Relief for

  18. The French Polemic: Nationalism, Racism and Atlanticism in the Past, Present and Future

    Science.gov (United States)

    1993-12-01

    as described by Hannah Arendt , was a "curious mixture of frustrated nobleman and romantic ntellectual who invented racism almost by accident. Gobineau...34 of which they disapproved. 4" 43Hannah Arendt , The Origins of Totalitarianism (New York: Harcourt, Brace and Company, 1951): 172. ൴Ibid. 4...L’immigration en France au XXe :iecle, Armand Colin Editeur, 1990. Arendt , -1. The Origins of Totalitarianism, Harcourt, Brace Co., 1951. Aziz, P., "France-Europe

  19. Influences of combined therapies with traditional Chinese medicine on pulmonary function and surface average electromyogram ratio in adolescent idiopathic scoliosis patients

    Directory of Open Access Journals (Sweden)

    Jia-ping SHEN

    2016-09-01

    Full Text Available Objective  To evaluate the influences of traditional Chinese medicinal combined therapies on pulmonary function and surface average electromyogram (AEMG ratio in adolescent idiopathic scoliosis patients. Methods  One hundred and twenty outpatients with mild and moderate adolescent idiopathic scoliosis were randomly divided into a Traditional Chinese Medicine (TCM group and a brace group. TCM group patients underwent i Navigation of the spinal balance (twice a day, 40min/ time, until to skeletal maturity; ii Balance manipulation (twice a week, 25min/time, lasted 12 months; iii Small needle-knife therapy (once a week, 10 times. The brace group patients were treated with a Milwaukee brace. The Cobb angle was measured after 12 and 24 months of treatment, pulmonary function was determined after 12 months of treatment, and AEMG ratio of the surface electromyogram was measured 6, 12, 18 and 24 months after treatment, and intergroup comparison was performed. Results  The Cobb angle significantly decreased in both groups 12 months after treatment (P0.05 in the TCM group and brace group, respectively, 12 months after treatment and 62.5% and 34.7% (P<0.05, respectively, 24 months aftertreatment. Pulmonary function was significantly improved 12 months after treatment in TCM group (P<0.05 but significantly decreased in brace group (P<0.05. The AEMG ratio was significantly reduced (P<0.01 and tended to remain at 1 after stopping treatment in TCM group, showed that the muscle imbalance existed on both sides of the scoliosis, but was adverse in brace group (P<0.05, showed that the muscle imbalance aggravated. No side effect of the therapeutic method was found. Conclusions  The spinal balance therapy based on traditional Chinese medicine theory has excellent therapeutic efficacy and safety, and can significantly ameliorate the imbalance existed on both sides of the scoliosis, improve lung function index, and have better compliance. The AEMG ratio is a

  20. Room temperature photoluminescence in crystalline/amorphous Er-doped Cd{sub 2}V{sub 2}O{sub 7}

    Energy Technology Data Exchange (ETDEWEB)

    Cid-Garcia, A. [Benemerita Universidad Autonoma de Puebla. Postgrado en Fisica Aplicada. Facultad de Ciencias Fisico-Matematicas, Mexico (Mexico); Lozada-Morales, R., E-mail: rlozada@fcfm.buap.mx [Benemerita Universidad Autonoma de Puebla. Postgrado en Fisica Aplicada. Facultad de Ciencias Fisico-Matematicas, Mexico (Mexico); Lopez-Calzada, G. [Centro de Investigacion y de Estudios Avanzados del IPN, Unidad Queretaro, Apartado Postal 1-798, Queretaro, Qro. 76001 (Mexico); Zayas, Ma. E. [Departamento de Investigacion en Fisica de la Universidad de Sonora, Edificio 3I, Blvd. Edificio 5 E, Luis Encinas s/n, Col. Centro, 83000. Hermosillo, Sonora, Mexico (Mexico); Zelaya Angel, O. [Departamento de Fisica, Centro de Investigacion y de Estudios Avanzados, P.O. Box 14-740, Mexico 07360 D. F. (Mexico); and others

    2012-06-15

    Er{sup 3+} ions were introduced into a new type of oxide matrixes prepared with different proportions of CdO and V{sub 2}O{sub 5}. The source of Er{sup 3+} employed was Er(NO{sub 3}){sub 3}{center_dot}5H{sub 2}O, which yielded an Er{sup 3+} concentration of {approx}1 at%. Depending on the reactants proportions, the samples resulted in crystalline or amorphous structures. X-ray diffraction indicated that the crystalline samples were constituted by polycrystalline Cd{sub 2}V{sub 2}O{sub 7}, in agreement with Raman spectroscopy measurements. Depending on the proportions of the component oxides, the band gap changed in the 2.49-1.77 eV energy range, as determined through photoacoustic spectroscopy. From photoluminescence spectra, the following electronic transitions of Er{sup 3+} were observed in both types of samples: {l_brace}{sup 2}H{sub 11/2}, {sup 4}S{sub 3/2}, {sup 4}F{sub 9/2}, {sup 4}I{sub 9/2}{r_brace}{yields}{sup 4}I{sub 15/2} and {sup 4}S{sub 3/2}{yields}{sup 4}I{sub 13/2}. In the case of crystalline samples manifolds, originating from the Stark effect, were measured for the {l_brace}{sup 2}H{sub 11/2}, {sup 4}S{sub 3/2}, {sup 4}F{sub 9/2}{r_brace}{yields}{sup 4}I{sub 15/2} and {sup 4}S{sub 3/2}{yields}{sup 4}I{sub 13/2} transitions. - Highlights: Black-Right-Pointing-Pointer The Cd{sub 2}V{sub 2}O{sub 7} has been fabricated in amorphous and crystalline phases. Black-Right-Pointing-Pointer The band gap of crystalline samples varied in the 2.49-2.41 eV range. Black-Right-Pointing-Pointer The absorption edge for the glasses had lower values with a minimum of 1.77 eV. Black-Right-Pointing-Pointer The {l_brace}{sup 2}H{sub 11/2}, {sup 4}S{sub 3/2}, {sup 4}F{sub 9/2}, {sup 4}I{sub 9/2}{r_brace}{yields}{sup 4}I{sub 15/2} and {sup 4}S{sub 3/2}{yields}{sup 4}I{sub 13/2,} were observed in PL.

  1. Spatial and Temporal Changes in Air Pollution Along the Gulf Coast Observed During BRACE: A Case Study of the Land-Sea Breeze

    Science.gov (United States)

    Wellman, D.; Luke, W.; Arnold, J.; Watson, T.; Gunter, L.

    2003-12-01

    NOAA's Air Resources Laboratory conducted airborne measurements of trace gases and aerosols in the Bay Region Atmospheric Chemistry Experiment (BRACE) using the NOAA Twin Otter. The Twin Otter flew more than 90 hours in 21 flights in and around the Tampa metropolitan region in May, 2002, at altitudes of 60-3000 m MSL. Flights were conducted over rural and suburban areas, over the centers of Tampa and St. Petersburg, and over Tampa Bay and the Gulf of Mexico. One objective of the aircraft flights was to investigate the role of the sea breeze circulation in determining patterns of nutrient deposition and pollutant loads in the Tampa Bay watershed. Results will be presented from a May 8 flight designed to investigate the effect of the sea breeze recirculation upon Tampa's air quality. The Twin Otter took off at 1425 UTC and after performing a spiral ascent over the Sydney ground site, proceeded to fly north, at 200 feet above mean sea level (MSL) just off the Gulf coast, west of St. Petersburg. Back trajectory analysis suggested the dominance of a northerly rotation in the sea breeze; thus, air sampled over the Gulf passed some hours earlier to the south of the Tampa metropolitan area, in an area largely devoid of major pollution sources, before being advected eastward in the afternoon return flow. Ozone levels in this air mass ranged from 40 to 50 ppbv. Farther north the Twin Otter encountered the advected urban plume from Tampa, displaced to the north by the combination of southeasterly sea breeze flow and westerly return flow, and tracked this plume inland. Ozone levels quickly jumped to 60 ppbv, and increased to as high as 90 ppbv as photochemical processing continued in the advected plume. Nitric acid levels, which approached 4 ppbv in the aged urban air at the coast, dropped rapidly to as low as 1 ppbv inland. A final flight leg to the east of downtown Tampa encountered fresh anthropogenic pollution from the afternoon rush hour; ozone was rapidly produced in the

  2. Warrior Transition Leader: Medical Rehabilitation Handbook

    Science.gov (United States)

    2011-01-01

    meter medley relay, swimming the anchor . After observing athletes with one leg competing in track during the 1996 Paralympics, Register was fitted with...down to the toes. Shoes, inserts, ankle –foot orthotics, ankle braces, and knee braces are some of the devices commonly prescribed for various...conditions. Lower limb orthotics can be functional, accommodative, or corrective. The ankle –foot orthosis fi g u r E 8-5. Wrist–hand orthosis. aSSiStivE

  3. Dislocation of primary total hip arthroplasty and the risk of redislocation.

    LENUS (Irish Health Repository)

    Brennan, Stephen A

    2012-09-01

    6554 primary total hip arthroplasties were reviewed. Risk factors for dislocation were analysed to assess which were important in terms of predicting recurrent instability. The patients risk of having a second dislocation was independently associated with the surgical approach adopted (p = 0.03) and the time to first dislocation from the primary hip replacement (p = 0.002). Early dislocators whose surgery was performed through an anterolateral approach had less recurrence than late dislocators through a posterior or transtrochanteric approach. None of the other risk factors including head size (p = 0.59), modularity (p = 0.54), mechanism of dislocation (p = 0.23), leg length discrepancy (p = 0.69) and acetabular inclination (p = 0.31) were influential. The use of an abduction brace was not useful in preventing a further dislocation with 69.2% of those braced re-dislocating compared to 68.5% who were not braced (p = 0.96).

  4. Octacyanoniobate(IV)-based molecular magnets revealing 3D long-range order

    Energy Technology Data Exchange (ETDEWEB)

    Pelka, R; Balanda, M [Institute of Physics PAN, Radzikowskiego 152, 31-342, Krakow (Poland); Pinkowicz, D; Drath, O; Nitek, W; Sieklucka, B [Faculty of Chemistry, Jagiellonian University, Ingardena 3, 30-060 Krakow (Poland); Rams, M; Majcher, A, E-mail: robert.pelka@ifj.edu.pl [Institute of Physics, Jagiellonian University, Reymonta 4, 30-059 Krakow (Poland)

    2011-07-06

    Isostructural series of chemical formula {l_brace}[M{sup II}(pirazol){sub 4}]{sub 2}[Nb{sup IV}(CN){sub 8}]{center_dot} 4H{sub 2}O{r_brace}{sub n} (M{sup II} = Mn (1), Fe (2), Co (3), Ni (4)) has been obtained by the self-assembly technique. Its unique crystallographic structure consists in the formation of a 3D extended network of magnetic centers braced by geometrically identical cyanido bridges. Magnetic measurements reveal the transitions to the 3D order at temperatures 23.7, 8.3, 5.9, 13.4 K for 1, 2, 3, and 4, respectively. The character of order is demonstrated to be ferrimagnetic for 1 and 2 and ferromagnetic for 3 and 4. The mean-field approach is used to determine the corresponding exchange coupling constants. The observed interactions are discussed within the magnetic orbital model.

  5. The validity of compliance monitors to assess wearing time of thoracic-lumbar-sacral orthoses in children with spinal cord injury.

    Science.gov (United States)

    Hunter, Louis N; Sison-Williamson, Mitell; Mendoza, Melissa M; McDonald, Craig M; Molitor, Fred; Mulcahey, M J; Betz, Randal R; Vogel, Lawrence C; Bagley, Anita

    2008-06-15

    Prospective multicenter observation. To determine the validity of 3 commercially available at recording thoracic-lumbar-sacral orthosis (TLSO) wearing time of children with spinal cord injury (SCI) and to assess each monitor's function during daily activities. A major limitation to studies assessing the effectiveness of spinal prophylactic bracing is the patient's compliance with the prescribed wearing time. Although some studies have begun to use objective compliance monitors, there is little documentation of the validity of the monitors during activities of daily life and no comparisons of available monitors. Fifteen children with SCI who wore a TLSO for paralytic scoliosis were observed for 4 days during their rehabilitation stay. Three compliance monitors (2 temperature and 1 pressure sensitive) were mounted onto each TLSO. Time of brace wear from the monitors was compared with the wear time per day recorded in diaries. Observed versus monitored duration of brace wear found the HOBO (temperature sensitive) to be the most valid compliance monitor. The HOBO had the lowest average of difference and variance of difference scores. The correlation between the recorded daily entries and monitored brace wear time was also highest for the HOBO in analysis of dependent and independent scores. Bland-Altman plots showed that the pressure sensitive monitor underestimated wear time whereas the temperature monitors overestimated wear time. Compliance to prescribed wearing schedule has been a barrier to studying TLSO efficacy. All 3 monitors were found to measure TLSO compliance, but the 2 temperature monitors were more in agreement with the daily diaries. Based on its functional advantages compared with the HOBO, the StowAway TidbiT will be used to further investigate the long-term compliance of TLSO bracing in children with SCI.

  6. Synthesis and in-vivo evaluation of C-11 p-PVP-MEMA as a PET radioligand for imaging nicotinic receptors

    Energy Technology Data Exchange (ETDEWEB)

    Paine, T.; Kassiou, M. [Univ Sydney, Sch Chem, Sydney, NSW 2006 (Australia); Dolle, F.; Langle, S.; Roger, G.; Lagnel-de Bruin, B.; Hinnen, F.; Valette, H.; Bottlaender, M. [CEA, Serv Hosp Frederic Joliot, Inst Imagerie Biomed, F-91401 Orsay (France); Fulton, R.R.; Henderson, D.J. [Royal Prince Alfred Hosp, Dept PET and Nucl Med, Camperdown, NSW 2050 (Australia); Coster, M.J. [Griffith Univ, Eskitis Inst Cell and Mol Therapies, Nathan, Qld 4121 (Australia); Kassiou, M. [Univ Sydney, Discipline Med Radiat Sci, Sydney, NSW2006 (Australia); Brain and Mind Res Inst, Camperdown, NSW2050 (Australia)

    2008-07-01

    Within the class of (4-pyridinyl)vinyl-pyridines developed by Abbott laboratories as potent neuronal nicotinic acetylcholine receptor ligands, p-PVP-MEMA ({l_brace}oro-5-((E)-2-pyridin-4-yl-vinyl) pyridin-3-yloxy]-1-methylethyl{r_brace} is the lead compound of a novel series that do not display the traditional nicotinic-like pyrrole-ring but still possessing high sub-nanomolar affinity (K-i 0.077 nm-displacement of [H-3](-)cytisine from whole rat brain synaptic membranes). In the present study, p-PVP-MEMA and its nor-derivative ({l_brace}oro-5-((E)-2-pyridin-4- yl-vinyl) pyridin-3-yloxy]-1-methylethyl{r_brace} as precursor for labelling with the short-lived positron-emitter carbon-11 (T{sub 1/2} = 20.4 min) were synthesized in 10 chemical steps from 2-hydroxy-5-nitropyridine and Boc-D-alanine. N-Alkylation of nor-p-PVP-MEMA with [C-11] methyl iodide afforded [C-11]p-PVP-MEMA ({>=} 98% radiochemically pure, specific activity of 86.4 GBq {mu} mol{sup -1}) in 2% (non-decay corrected and non-optimized) radiochemical yield, in 34 min (including HPLC purification and formulation). Preliminary positron emission tomography PET) results obtained in a Papio hamadryas baboon showed that [C-11] p-PVP-MEMA is not a suitable PET-radioligand. (authors)

  7. Microstructure and texture development during high-strain torsion of NiAl

    Energy Technology Data Exchange (ETDEWEB)

    Kloeden, B.

    2006-07-01

    In this study polycrystalline NiAl has been subjected to torsion deformation. The deformation, microstructure and texture development subject to the shear strain are studied by different techniques (Electron Back-Scatter and High Energy Synchrotron Radiation). Beside the development of microstructure and texture with shear strain, the effect of an initial texture as well as the deformation temperature on the development of texture and microstructure constitute an important part of this study. Therefore, samples with three different initial textures were deformed in the temperature range T=700 K-1300 K. The shear stress-shear strain curves are characterized by a peak at low strains, which is followed by softening and a steady state at high strains. Grain refinement takes place for all samples and the average grain size decreases with temperature. For temperatures T>1000 K, discontinuous dynamic recrystallization occurs, by which new grains form by nucleation and subsequent growth. The texture is characterized by two components, {l_brace}100{r_brace}<100> (cube,C) and {l_brace}110{r_brace}<100> (Goss,G). Torsional creep of NiAl is characterized by a stress exponent, which depends on temperature and an activation energy, which is stress dependent. The Swift effect, due to which samples change their axial dimension during torsion without applied axial stress, is observed for NiAl. (orig.)

  8. Device for the burst protection of nuclear reactor pressure vessels

    International Nuclear Information System (INIS)

    Daublebsky, P.

    1976-01-01

    The burst protection device has a hood over top and bottom of the pressure vessel with superimposed hinged supports lying in their turn against supporting rings which are connected with each other by vertical bracing. It is proposed to place an intermediate layer between hoods and vertical bracing absorbing thermal stresses, i.e. deforming plastically with gradually increasing pressure, but behaving like a rigid body in the case of shock loads. As a material lead e.g. is proposed. (UWI) [de

  9. Control component retainer

    International Nuclear Information System (INIS)

    Walton, L.A.; King, R.A.

    1983-01-01

    An apparatus is described for retaining an undriven control component assembly disposed in a fuel assembly in a nuclear reactor of the type having a core grid plate. The first part of the mechanism involves a housing for the control component and the second part is a brace with a number of arms that reach under the grid plate. The brace and the housing are coupled together to firmly hold the control components in place even under strong flows of th coolant

  10. Portable, space-saving medical patient support system

    Science.gov (United States)

    Bzorgi,; Fariborz, [Knoxville, TN

    2011-02-01

    A support platform having a stowed configuration and a deployed configuration on a floor. The support platform is related to stretcher devices that are used for transporting, confining, or conducting medical procedures on medical patients in medical emergencies. The support platform typically includes a work surface that has a geometric extent. A base that typically includes a plurality of frame members is provided, and the frame members are disposed across the geometric extent of, and proximal to, the work surface in the stowed configuration. The frame members are typically disposed on the floor in the deployed configuration. There is a foldable bracing system engaged with the work surface and engaged with the base. At least a portion of the foldable bracing system is disposed substantially inside at least a portion of the plurality of frame members in the stowed configuration. Further, the foldable bracing system is configured for translocation of the work surface distal from the base in the deployed configuration.

  11. A quantitative method for evaluating inferior glenohumeral joint stiffness using ultrasonography.

    Science.gov (United States)

    Tsai, Wen-Wei; Lee, Ming-Yih; Yeh, Wen-Lin; Cheng, Shih-Chung; Soon, Kok-Soon; Lei, Kin Fong; Lin, Wen-Yen

    2013-02-01

    Subluxation of the affected shoulder in post-stroke patients is associated with nerve disorders and muscle fatigue. Clinicians must be able to accurately and reliably measure inferior glenohumeral subluxation in patients to provide appropriate treatment. However, quantitative methods for evaluating the laxity and stiffness of the glenohumeral joint (GHJ) are still being developed. The aim of this study was to develop a new protocol for evaluating the laxity and stiffness of the inferior GHJ using ultrasonography under optimal testing conditions and to investigate changes in the GHJ from a commercially available humerus brace and shoulder brace. Multistage inferior displacement forces were applied to create a glide between the most cephalad point on the visible anterosuperior surface of the humeral head and coracoid process in seven healthy volunteers. GHJ stiffness was defined as the slope of the linear regression line between the glides and different testing loads. The testing conditions were defined by different test loading mechanisms (n=2), shoulder constraining conditions (n=2), and loading modes (n=4). The optimal testing condition was defined as the condition with the least residual variance of measured laxity to the calculated stiffness under different testing loads. A paired t-test was used to compare the laxity and stiffness of the inferior GHJ using different braces. No significant difference was identified between the two test loading mechanisms (t=0.218, p=0.831) and two shoulder constraining conditions (t=-0.235, p=0.818). We concluded that ultrasonographic laxity measurements performed using a pulley set loading mechanism was as reliable as direct loading. Additionally, constraining the unloaded shoulder was proposed due to the lower mean residual variance value. Moreover, pulling the elbow downward with loading on the upper arm was suggested, as pulling the elbow downward with the elbow flexed and loading on the forearm may overestimate stiffness

  12. Synthesis, structures and properties of a series of manganese coordination complexes constructed from dicarboxylic fluorene derivatives

    Energy Technology Data Exchange (ETDEWEB)

    Li Xing, E-mail: lixing@nbu.edu.cn [State Key Laboratory Base of Novel Functional Materials and Preparation Science, Faculty of Materials Science and Chemical Engineering, Ningbo University, Ningbo, Zhejiang, 315211 (China); Zhao Xiuhua; Bing Yue; Zha Meiqin; Xie Hongzhen; Guo Zhiyong [State Key Laboratory Base of Novel Functional Materials and Preparation Science, Faculty of Materials Science and Chemical Engineering, Ningbo University, Ningbo, Zhejiang, 315211 (China)

    2013-01-15

    Assembly reactions of 9,9-diethylfluorene-2,7-dicarboxylic acid (H{sub 2}DFDC) and Mn(CH{sub 3}COO){sub 2}{center_dot}4H{sub 2}O or MnCl{sub 2}{center_dot}4H{sub 2}O by tuning of various secondary ligands such as 2,2 Prime -bipyridine (2,2 Prime -bpy), 4,4 Prime -bipyridine (4,4 Prime -bpy) or 1,3-bis(4-pyridyl)propane) (bpp), gave rise to four complexes {l_brace} [Mn{sub 2}(DFDC){sub 2}(DMF){sub 2}]{center_dot}H{sub 2}O{r_brace} {sub n} (1), [Mn(DFDC)(2,2 Prime -bpy)]{sub n} (2), {l_brace} [Mn{sub 2}(DFDC){sub 2}(4,4 Prime -bpy){sub 2}]{center_dot}2CH{sub 3}OH{r_brace} {sub n} (3), and {l_brace} [Mn{sub 4}(DFDC){sub 4}(bpp){sub 2}(CH{sub 3}OH){sub 3} (H{sub 2}O){sub 3}]{center_dot}3(CH{sub 3}OH){center_dot}3(H{sub 2}O){r_brace} {sub n} (4). Single crystal X-ray diffraction analysis reveal that complex 1 is three dimensional structure with rhombic channels filled by guest water molecules; 2 presents a close-packed structure with high thermal stability; 3 exhibits a three dimensional framework with micro-porous channels filled by guest methanol molecules and 4 is a two-dimensional structure. The photoluminescent properties of 1-4 have been studied, respectively, showing that the Mn(II) ions, accessorial organic ligands or crystal structures exert important influences on the photoluminescence emissions of H{sub 2}DFDC ligands. Thermogravimetric analysis show that the complexes have remarkably high thermal stability. Magnetic susceptibility measurements have been finished and discussed for the complexes. - Graphical abstract: Assembly of 9,9-diethylfluorene-2,7-dicarboxylic acid and Mn(II) salts by tuning of various accessorial ligands resulted in four manganese complexes with different topological frameworks. Highlights: Black-Right-Pointing-Pointer Four manganese complexes based on 9,9-diethylfluorene-2,7-dicarboxylic acid were obtained. Black-Right-Pointing-Pointer The complexes were structurally characterized by single-crystal X-ray diffraction. Black

  13. Compressed liquid densities for the (n-heptane + n-decane) and (n-octane + n-decane) systems from T = (313 to 363) K

    Energy Technology Data Exchange (ETDEWEB)

    Quevedo-Nolasco, Rodolfo [Laboratorio de Termodinamica, SEPI-ESIQIE, Instituto Politecnico Nacional, UPALM, Ed. Z, Secc. 6, 1ER piso, Lindavista, C.P. 07738 Mexico D.F. (Mexico); Galicia-Luna, Luis A., E-mail: lgalicial@ipn.mx [Laboratorio de Termodinamica, SEPI-ESIQIE, Instituto Politecnico Nacional, UPALM, Ed. Z, Secc. 6, 1ER piso, Lindavista, C.P. 07738 Mexico D.F. (Mexico); Elizalde-Solis, Octavio [Departamento de Ingenieria Quimica Petrolera, ESIQIE, Instituto Politecnico Nacional, UPALM, Edif. 8, 2o piso, Lindavista, C.P. 07738 Mexico D.F. (Mexico)

    2012-01-15

    Highlights: > We built an equipment which consists of a variable volume cell and a VTD Anton Paar DMA-HPM. > Compressed liquid densities are reported for n-heptane and n-decane. > Binary (n-heptane or n-octane + n-decane) systems were studied in the whole range of composition. > Derived properties were calculated from experimental data. - Abstract: Densities (p, {rho}, T, x{sub 1}) of two binary n-alkane systems are reported from T = (313 to 363) K in the compressed liquid phase up to 25 MPa over the whole range of composition. The binary mixtures {l_brace}x{sub 1}n-heptane + (1 - x{sub 1})n-decane{r_brace} and {l_brace}x{sub 1}n-octane + (1 - x{sub 1})n-decane{r_brace} were prepared at compositions of (x{sub 1} = 0.0531, 0.2594, 0.5219, 0.777, 0.952), and (x{sub 1} = 0.0616, 0.2801, 0.5314, 0.7736, 0.9623), respectively. A measuring system based on a vibrating tube densimeter, DMA HPM from Anton Paar with data acquisition system was developed in order to obtain experimental densities. Water and nitrogen were used as reference fluids to calibrate the densimeter. Experimental methodology was checked by comparing the n-heptane and n-decane densities against multi-parameter equations proposed in the literature. Differences between both sets of data show a maximum deviation of 0.07%. Excess molar volumes, isothermal compressibility and isobaric thermal expansivity were computed from experimental densities.

  14. Stacking faults of {gamma}{prime}{prime} phase precipitated in a Ni-15Cr-8Fe-6Nb alloy; Ni-15Cr-8Fe-6Nb gokin ni sekishutsusuru {gamma}{prime}{prime} sonai no sekiso kekkan

    Energy Technology Data Exchange (ETDEWEB)

    Kusabiraki, K; Ikeuchi, S [Toyama University, Toyama (Japan). Faculty of Engineering

    1995-09-01

    The stacking faults of a metastable {gamma}{prime}{prime} phase precipitated in a nickel-base superalloy, a modified NCF 3 type alloy (X-750M) were investigated by transmission electron microscopy and X-ray diffraction method. The {gamma}{prime}{prime} precipitates are circular shaped plates at the early stage of aging and they become elliptic or irregular shaped plates at the latter stage of aging up to 1033K. Contrast which suggests the existence of stacking faults on {l_brace}112{r_brace}{sub {gamma}{prime}{prime}} planes can be seen in many of large {gamma}{prime}{prime} precipitates extracted from the specimens aged at 1033K. It is clear that the values of {gamma}{prime}{prime}/{gamma} lattice mismatch increase with increasing the aging time from the measurement of lattice constants of the {gamma} and the {gamma}{prime}{prime} phase. The formation of stacking faults on {l_brace}112{r_brace}{sub {gamma}{prime}{prime}} in the large {gamma}{prime}{prime} precipitates is due to the movement of an a/6 [111] partial dislocation introduced by {gamma}{prime}{prime} /{gamma} coherency strain. Since a part of stacking sequence has a similar crystal structure to that of a stable {delta} phase precipitates in {gamma} phase, the formation of stacking faults in the {gamma}{prime}{prime} precipitates is considered to be favorable for the stabilization of them. 14 refs., 10 figs., 1 tab.

  15. Microstructure, texture and magnetic properties of strip-cast 1.3% Si non-oriented electrical steels

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Yuanxiang, E-mail: yunboxu@126.com [State Key Laboratory of Rolling Technology and Automation, Northeastern University, Shenyang (China); Xu Yunbo; Liu Haitao; Li Chenggang; Cao Guangming; Liu Zhenyu; Wang Guodong [State Key Laboratory of Rolling Technology and Automation, Northeastern University, Shenyang (China)

    2012-10-15

    In this work, the evolution of microstructure, texture and magnetic properties of non-oriented 1.3% silicon steel processed using the twin-roll strip casting was investigated, especially under different solidification structures. A number of microstructures about the as-cast strips show that the initial solidification structure of casting a strip can be controlled by the melt superheats. The microstructures with the average grain size of {approx}100-400 {mu}m can be obtained in strips when the melt superheats are from 20 to 60 Degree-Sign C. A nearly random, diffuse, homogeneous texture under a low melt superheat, but comparatively developed {l_brace}100{r_brace} oriented grains are formed under a high melt superheat through the cast strip thickness. The relatively low core loss and high magnetic induction can be obtained in the cold rolled and annealed sheets when increasing the initial grain size of cast-strip. The textures in annealed sheets with coarse initial grain size are characterized by the relatively strong Goss component and {l_brace}001{r_brace} fiber but weak {gamma}-fiber component, which lead to the high permeability. - Highlights: Black-Right-Pointing-Pointer The superheat has an evident effect on the grain size and orientation of strip. Black-Right-Pointing-Pointer Developed Cube and Goss textures were formed in the annealed sheet. Black-Right-Pointing-Pointer High magnetic properties were obtained in the twin-rolled strip casting process.

  16. Static/dynamic Analysis and Optimization of Z-axis Stand of PCB CNC Drilling Machine*

    Directory of Open Access Journals (Sweden)

    Zhou Yanjun

    2016-01-01

    Full Text Available The finite element analysis is used for the static and dynamic analysis of the Z axis brace of PCB CNC drilling machine. With its results of maximum displacement deformation and von Mises stress and modal frequency, the defect of original design was found out. On such bases, a variety of optimization scheme is put forward and the best size of the Z axis brace is obtained by the performance comparison of the schemes. This method offers bases for the design and renovation of other machine tool components.

  17. Localized electron nature of the antiferromagnetism of (CePd sub 3) sub 8 Ge Response to hydrostatic pressure and neutron diffraction

    CERN Document Server

    Tabata, Y; Ohoyama, K

    2003-01-01

    The magnetic properties of the compound (CePd sub 3) sub 8 Ge have been studied by means of neutron diffraction and specific heat measurement at ambient pressure and also of measurements of susceptibility and electrical resistivity under hydrostatic pressure. The magnetic modulation vector, q, of the antiferromagnetic phase is left brace 001 right brace and the spin polarization is parallel to q. With increasing the applied pressure up to 6 GPa, the Neel temperature keeps increasing, which indicates a strongly localized nature of the 4f-electrons of the compound.

  18. Seismic modifications to the Hot and Suspect Repair area Argone National Laboratory - West

    International Nuclear Information System (INIS)

    Malik, L.E.; Harris, B.G.

    1993-01-01

    The ANL-W WIPP Waste Facility Enhancement Project required substantial remodeling and upgrades to the Hot Fuels Examination Facility (HFEF) building, including the Hot and Suspect Repair Area (HSRA). The HSRA is an enclosed single-storied area inside the HFEF. It is separated into several compartments, some of which are used for handling radioactive materials. The HSRA roof consists of 18 GA steel Robertson Q decking with 1.5 in. concrete topping, and is utilized for storage. Braced steel frames support the HSRA roof, except at the north side, where the steel beams are connected to the HFEF columns. The HSRA has hollow block masonry perimeter and interior walls. Seismic evaluations concluded that the HSRA did not have a competent seismic force resisting system. The structure was upgraded by decoupling it from the HFEF framing for N/S motions, modifying two existing braced frames, adding a new braced frame that can be removed temporarily during maintenance and strengthening the roof diaphragm by a unique modification consisting of special epoxy grout and steel plates installed over the existing concrete roof

  19. Seismic modifications to the hot suspect repair area Argonne National Laboratory, West

    International Nuclear Information System (INIS)

    Malik, L.E.; Harris, B.G.

    1993-01-01

    The ANL-W WIPP Waste Facility Enhancement Project required substantial remodeling and upgrades to the Hot Fuels Examination Facility (HFEF) building, including the Hot and Suspect Repair Area (HSRA). The HSRA is an enclosed single-stoned area inside the HFEF. It is separated into several compartments, some of which are used for handling radioactive materials. The HSRA roof consists of 18 GA steel Robertson Q decking with 1.5 in. concrete topping, and is utilized for storage. Braced steel frames support the HSRA roof, except at the north side, where the steel beams arc connected to the HFEF columns. The HSRA has hollow block masonry perimeter and interior walls. Seismic evaluations concluded that the HSRA did not have a competent seismic force resisting system. The structure was upgraded by decoupling it from the HFEF framing for N/S motions, modifying two existing braced frames, adding a now braced frame that can be removed temporarily during maintenance and strengthening the roof diaphragm by a unique modification consisting of special epoxy grout and steel plates installed over the existing concrete roof

  20. Spatiotemporal dynamics on small-world neuronal networks: The roles of two types of time-delayed coupling

    Energy Technology Data Exchange (ETDEWEB)

    Wu Hao; Jiang Huijun [Hefei National Laboratory for Physical Sciences at the Microscale and Department of Chemical Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Hou Zhonghuai, E-mail: hzhlj@ustc.edu.cn [Hefei National Laboratory for Physical Sciences at the Microscale and Department of Chemical Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China)

    2011-10-15

    Highlights: > We compare neuronal dynamics in dependence on two types of delayed coupling. > Distinct results induced by different delayed coupling can be achieved. > Time delays in type 1 coupling can induce a most spatiotemporal ordered state. > For type 2 coupling, the systems exhibit synchronization transitions with delay. - Abstract: We investigate temporal coherence and spatial synchronization on small-world networks consisting of noisy Terman-Wang (TW) excitable neurons in dependence on two types of time-delayed coupling: {l_brace}x{sub j}(t - {tau}) - x{sub i}(t){r_brace} and {l_brace}x{sub j}(t - {tau}) - x{sub i}(t - {tau}){r_brace}. For the former case, we show that time delay in the coupling can dramatically enhance temporal coherence and spatial synchrony of the noise-induced spike trains. In addition, if the delay time {tau} is tuned to nearly match the intrinsic spike period of the neuronal network, the system dynamics reaches a most ordered state, which is both periodic in time and nearly synchronized in space, demonstrating an interesting resonance phenomenon with delay. For the latter case, however, we cannot achieve a similar spatiotemporal ordered state, but the neuronal dynamics exhibits interesting synchronization transitions with time delay from zigzag fronts of excitations to dynamic clustering anti-phase synchronization (APS), and further to clustered chimera states which have spatially distributed anti-phase coherence separated by incoherence. Furthermore, we also show how these findings are influenced by the change of the noise intensity and the rewiring probability of the small-world networks. Finally, qualitative analysis is given to illustrate the numerical results.

  1. Two studies in one: A propensity-score-matched comparison of fingolimod versus interferons and glatiramer acetate using real-world data from the independent German studies, PANGAEA and PEARL.

    Science.gov (United States)

    Alsop, Jonathan; Medin, Jennie; Cornelissen, Christian; Vormfelde, Stefan Viktor; Ziemssen, Tjalf

    2017-01-01

    This study compared outcomes following fingolimod or BRACE treatments (beta-interferons/glatiramer acetate) in patients with active MS (≥ 1 relapse in the previous year) following previous BRACE treatment. Patients with active MS who previously received BRACE were identified from German prospective, observational studies, PANGAEA and PEARL. A novel methodology was developed to compare outcomes between propensity-score-matched cohorts (3:1 ratio) from the independent single-arm studies. Patients in PANGAEA (n = 1287) experienced 48% fewer relapses per year than those in PEARL (n = 429; annualized relapse rate ratio: 0.52; p PANGAEA versus PEARL (3-month: 37% reduction; hazard ratio [HR], 0.63; p PANGAEA (n = 1234) than PEARL (n = 401) were free from relapses and 3-month (65.7% vs 38.7%; p PANGAEA (n = 1163) than PEARL (n = 372; 3-month: 175% increase; HR, 2.75; p PANGAEA (n = 149) were less likely than those in PEARL (n = 307) to have taken sick leave (proportion with 0 days off work: 62.4% vs 44.6%; p = 0.0005). For change in disease severity from baseline (assessed by clinicians using the Clinical Global Impressions scale; PANGAEA, n = 1207; PEARL, n = 427), a larger proportion of patients had subjective improvement and a smaller proportion had worsening status in PANGAEA than PEARL (improvement: 28.2% vs 15.2%; worsening: 16.4% vs 30.4%; p < 0.0001). Fingolimod appears to be more effective than BRACE in improving clinical and physician-/patient-reported outcomes in individuals with active MS.

  2. Early detection by MRI and conservative therapy of lumbar spondylolysis in the growing period

    International Nuclear Information System (INIS)

    Yoshida, Tohru; Namba, Hiromichi; Kasai, Tsutomu; Ohta, Susumu

    1996-01-01

    Since 1991 the early cases of spondylolysis in the growing stage have been diagnosed with MRI and treated conservatively by the authors. The final results were obtained in 153 cases (207 arches). The fusion rate of the separated part of these arches was 82% of the total. Treatment consisted mainly of prohibition of exercise and wearing a hard brace. The brace was more effective when worn not only during the day but also throughout the night. On MRI T 1 -weighted images low signal intensity changes of the pars interarticularis proved that bony fusion had been attained with conservative therapy. (author)

  3. Early detection by MRI and conservative therapy of lumbar spondylolysis in the growing period

    Energy Technology Data Exchange (ETDEWEB)

    Yoshida, Tohru; Namba, Hiromichi; Kasai, Tsutomu; Ohta, Susumu [Yoshida Orthopaedic Hospital, Toyota, Aichi (Japan)

    1996-07-01

    Since 1991 the early cases of spondylolysis in the growing stage have been diagnosed with MRI and treated conservatively by the authors. The final results were obtained in 153 cases (207 arches). The fusion rate of the separated part of these arches was 82% of the total. Treatment consisted mainly of prohibition of exercise and wearing a hard brace. The brace was more effective when worn not only during the day but also throughout the night. On MRI T{sub 1}-weighted images low signal intensity changes of the pars interarticularis proved that bony fusion had been attained with conservative therapy. (author)

  4. Highly Selective Synthesis of Catalytically Active Monodisperse Rhodium Nanocubes

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Y.; Grass, M.E.; Kuhn, J.N.; Tao, F.; Habas, S.E.; Huang, W.; Yang, P.; Somorjai, G.A.

    2009-02-21

    Synthesis of monodisperse and shape-controlled colloidal inorganic nanocrystals (NCs) is of increasing scientific interest and technological significance. Recently, shape control of Pt, Pd, Ag, Au, and Rh NCs has been obtained by tuning growth kinetics in various solution-phase approaches, including modified polyol methods, seeded growth by polyol reduction, thermolysis of organometallics, and micelle techniques. Control of reduction kinetics of the noble metal precursors and regulation of the relative growth rates of low-index planes (i.e. {l_brace}100{r_brace} and {l_brace}111{r_brace}) via selective adsorption of selected chemical species are two keys for achieving shape modification of noble metal NCs. One application for noble metal NCs of well-defined shape is in understanding how NC faceting (determines which crystallographic planes are exposed) affects catalytic performance. Rh NCs are used in many catalytic reactions, including hydrogenation, hydroformylation, hydrocarbonylation, and combustion reactions. Shape manipulation of Rh NCs may be important in understanding how faceting on the nanoscale affects catalytic properties, but such control is challenging and there are fewer reports on the shape control of Rh NCs compared to other noble metals. Xia and coworkers obtained Rh multipods exhibiting interesting surface plasmonic properties by a polyol approach. The Somorjai and Tilley groups synthesized crystalline Rh multipods, cubes, horns and cuboctahedra, via polyol seeded growth. Son and colleagues prepared catalytically active monodisperse oleylamine-capped tetrahedral Rh NCs for the hydrogenation of arenes via an organometallic route. More recently, the Somorjai group synthesized sizetunable monodisperse Rh NCs using a one-step polyol technique. In this Communication, we report the highly selective synthesis of catalytically active, monodisperse Rh nanocubes of < 10 nm by a seedless polyol method. In this approach, Br{sup -} ions from trimethyl

  5. Study of small partial-wave contributions in the neighbourhood of dominating resonance states of the proton by linearly polarized photons; Untersuchung kleiner Partialwellenbeitraege in der Naehe dominierender Resonanzzustaende des Protons mit linear polarisierten Photonen

    Energy Technology Data Exchange (ETDEWEB)

    Elsner, D.

    2007-04-15

    The reaction p(e, e'p){pi}{sup 0} has been studied at Q{sup 2}=0.2 (GeV/c){sup 2} in the region of W=1232 MeV. From measurements left and right of (vector)q cross section asymmetries {rho}{sub LT} have been obtained in forward {rho}{sub LT}({theta}{sub {pi}{sup 0}}{sup cm}=20 )=(-11.68{+-}2.36{sub stat}{+-}2.36{sub sys}) and backward {rho}{sub LT}({theta}{sub {pi}}{sub {sup 0}}{sup cm}=160)=(12.18{+-}0.27{sub stat}{+-}0.82{sub sys}) {pi}{sup 0} kinematics, from which R{l_brace}S{sub 1+}{sup *}M{sub 1+}{r_brace}/ vertical stroke M{sub 1+} vertical stroke {sup 2} and R{l_brace}S{sub 0+}{sup *}M{sub 1+}{r_brace}/ vertical stroke M{sub 1+} vertical stroke {sup 2} could be determined. Using linear polarised tagged photon beams of energy up to E{sub {gamma}}{approx_equal}1.5 GeV the photon beam asymmetry {sigma} has been measured in the reaction p((vector){gamma}, {eta})p. Based on coherent bremsstrahlung off a diamond crystal a maximum polarisation of P{sub {gamma}}=49% has been achieved at E{sub {gamma}}=1305 MeV. The beam asymmetry has been extracted from the azimuthal modulation of the cross section using both decay modes of the {eta} into two photons and 3{pi}{sup 0}. Large asymmetries up to 80% are observed, in agreement with previous measurements where already available. There is also agreement with standard model calculations. However, the required partial waves to describe the measurements differ significantly. (orig.)

  6. Structural vibration passive control and economic analysis of a high-rise building in Beijing

    Science.gov (United States)

    Chen, Yongqi; Cao, Tiezhu; Ma, Liangzhe; Luo, Chaoying

    2009-12-01

    Performance analysis of the Pangu Plaza under earthquake and wind loads is described in this paper. The plaza is a 39-story steel high-rise building, 191 m high, located in Beijing close to the 2008 Olympic main stadium. It has both fluid viscous dampers (FVDs) and buckling restrained braces or unbonded brace (BRB or UBB) installed. A repeated iteration procedure in its design and analysis was adopted for optimization. Results from the seismic response analysis in the horizontal and vertical directions show that the FVDs are highly effective in reducing the response of both the main structure and the secondary system. A comparative analysis of structural seismic performance and economic impact was conducted using traditional methods, i.e., increased size of steel columns and beams and/or use of an increased number of seismic braces versus using FVD. Both the structural response and economic analysis show that using FVD to absorb seismic energy not only satisfies the Chinese seismic design code for a “rare” earthquake, but is also the most economical way to improve seismic performance both for one-time direct investment and long term maintenance.

  7. Conservative management of neuromuscular scoliosis: personal experience and review of literature.

    Science.gov (United States)

    Kotwicki, Tomasz; Jozwiak, Marek

    2008-01-01

    The principles of conservative management of neuromuscular scoliosis in childhood and adolescence are presented. Analysis of personal experience and literature review. The topic is discussed separately for patients with flaccid or spastic paresis. These demonstrate that conservative management might be proposed for patients with neuromuscular scoliosis in many clinical situations. In spastic disorders, it maintains the symmetry around the hip joints. Bracing is technically difficult and often is not tolerated well by cerebral palsy children. In patients with flaccid paresis, the fitting and the use of brace is easier than in spastic patients. The flexibility of the spinal curvature is more important. Functional benefits of conservative management of neuromuscular scoliosis comprise stable sitting, easier use of upper limbs, discharge of the abdomen from the collapsing trunk, increased diaphragm excursion, and, not always, prevention of curve progression. Specific natural history and multiple medical problems associated with the disease make the treatment of children with neuromuscular scoliosis an extremely complex issue, best addressed when a team approach is applied. Continuously improving techniques of conservative management, comprising bracing and physiotherapy, together with correctly timed surgery incorporated in the process of rehabilitation, provide the optimal care for patients.

  8. Synthesis of zirconium aryloxide complexes containing pendent vinyl groups

    Energy Technology Data Exchange (ETDEWEB)

    Evans, W.J.; Ansari, M.A.; Ziller, J.W. [Univ. of California, Irvine, CA (United States). Dept. of Chemistry

    1999-03-22

    The attachment of pendent olefin groups to oxygen-ligated zirconium complexes using olefin-substituted phenols and alcohols and readily accessible zirconium reagents is described. Syntheses of three crystallographically characterizable complexes isolable in 55--90% yield are reported. Eugenol, HOC{sub 6}H{sub 3}(OMe-2)(CH{sub 2}CH{double_bond}CH{sub 2}-4)(HOAr) reacts with [Zr(O{sup i}Pr){sub 4}(HO{sup i}Pr)]{sub 2} in toluene to form [({sup i}PrO){sub 2}(ArO)Zr({mu}-O{sup i}Pr)]{sub 2}, 1. CH{sub 2}{double_bond}CHCH{sub 2}OH reacts with [Zr(NMe{sub 2}){sub 4}]{sub 2} in the presence of 2,6-dimethylphenol to form the mixed ligand salt, {l_brace}Me{sub 2}NH{sub 2}{r_brace}[(2,6-Me{sub 2}C{sub 6}H{sub 3}O){sub 3}Zr]{sub 2}({mu}-OCH{sub 2}CH{double_bond}CH{sub 2}){sub 3}{r_brace}, 2. The potassium salt derived from eugenol, KOAr, reacts with Zr(OEt){sub 4} in THF to form [K{sub 2}Zr(OAr){sub 4}(OEt)]{sub 2}(O), 3.

  9. Variable Geometry Aircraft Wing Supported by Struts And/Or Trusses

    Science.gov (United States)

    Melton, John E. (Inventor); Dudley, Michael R. (Inventor)

    2016-01-01

    The present invention provides an aircraft having variable airframe geometry for accommodating efficient flight. The aircraft includes an elongated fuselage, an oblique wing pivotally connected with said fuselage, a wing pivoting mechanism connected with said oblique wing and said fuselage, and a brace operably connected between said oblique wing and said fuselage. The present invention also provides an aircraft having an elongated fuselage, an oblique wing pivotally connected with said fuselage, a wing pivoting mechanism connected with said oblique wing and said fuselage, a propulsion system pivotally connected with said oblique wing, and a brace operably connected between said propulsion system and said fuselage.

  10. Burst protection for reactor pressure vessels using a hinged support bearing

    International Nuclear Information System (INIS)

    Michel, E.; Maritsch, F.

    1976-01-01

    The invention deals with a simplification of the design and manufacture and the way of controlling a hinged support bearing used as burst protection. The pure pressure load of the, e.g., 32 hinged supports distributed along the circumference of the pressure vessel head is achieved in the braced state with little control effort by a pure rotating motion caused pneumatically or hydraulically. The hinged supports are inclined by about 45 0 upwards/outwards in the braced state and with their cap-shaped head and foot are selflocking by pivoted between a supporting structure, firmly connected with the building, and a fishing ring. (TK) [de

  11. Muentz-Szasz type approximation in direct products of spaces

    Energy Technology Data Exchange (ETDEWEB)

    Sedletskii, A M [M.V. Lomonosov Moscow State University, Moscow (Russian Federation)

    2006-10-31

    We consider the problem of completeness of the system of exponentials exp{l_brace}-{lambda}{sub n}t{r_brace}, Re {lambda}{sub n}>0, in direct products E=E{sub 1} x E{sub 2} of the spaces E{sub 1}=E{sub 1}(0,1) and E{sub 2}=E{sub 2}(1,{infinity}) of functions defined on (0,1) and (1,{infinity}), respectively. We describe rather broad classes of spaces E{sub 1} and E{sub 2} such that the well-known condition of Szasz is necessary for the completeness of the above system in E and sufficient for this completeness.

  12. Surface crack nucleation and propagation in electrodeposited nanocrystalline Ni-P alloy during high cycle fatigue

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Shigeaki; Kamata, Akiyuki [Department of Mechanical Engineering, Faculty of Engineering, Ashikaga Institute of Technology, 268-1 Omae, Ashikaga, Tochigi 326-8558 (Japan); Watanabe, Tadao, E-mail: skoba@ashitech.ac.j [Key Laboratory for Anisotropy and Texture of Materials, Northeastern University, Shenyang, 110004 (China)

    2010-07-01

    The morphology of specimen surface after fatigue fracture was evaluated in connection with grain orientation distribution and grain boundary microstructure to reveal a mechanism of fatigue fracture in nanocrystalline materials. The electrodeposited and sharply {l_brace}001{r_brace} textured Ni -2.0 mass% P alloy with the average grain size of ca. 45 nm and high fractions of low-angle and {Sigma}3 boundaries showed 2 times higher fatigue limit than electrodeposited microcrystalline Ni polycrystal. The surface features of fatigued specimen were classified into two different types of morphologies characterized as brittle fracture at the central area and as ductile fracture at the surrounding area.

  13. Ventricular emptying performance in patients with tetralogy of Fallot; Assessment with Fourier analysis of gated blood-pool data

    Energy Technology Data Exchange (ETDEWEB)

    Takeda, Kan; Maeda, Hisato; Nakagawa, Tsuyoshi; Ito, Tsunao; Yamaguchi, Nobuo; Matsuda, Akira (Mie Univ., Tsu (Japan). School of Medicine)

    1989-12-01

    Comparison of emptying patterns between left and right ventricles (LV, RV) was performed with Fourier analysis of gated blood-pool data in patients with tetralogy of Fallot (TF). Using global time-activity curves, the phase and amplitude at the first-harmonic component of Fourier series were calculated and emptying patterns of both ventricles were evaluated by phase difference {l brace}D(phase)=RV phase minus LV phase{r brace} and RV/LV amplitude ratio {l brace}R(amp){r brace}. In 20 patients with normal cardiac function, D(phase) was minimal (mean 2.0{plus minus}6.6 degrees) and R(amp) was less than 1.0 (mean 0.60{plus minus}0.19). In 11 patients with TF, D(phase) was significantly larger than normal, with a mean value of 24.3{plus minus}10.0 degrees (p<0.01) and became greater in a reversed proportion to the ratio of the pulmonary-to-systemic blood flow (p<0.01). In all but one cases with TF, R(amp) was greater than 1.0 with a mean value of 1.4{plus minus}0.4, significantly larger than normal (p<0.001). Furthermore, using time-activity curves approximated by terms up to the 3rd-harmonic component, the temporal difference in emptying patterns between both ventricles was investigated. In TF cases, the time from end-diastole to minimum count (T2) was significantly larger in RV than in LV (p<0.001). The elongated T2 interval of RV seemed to play an important role in producing RV phase lag. Thus, this non-invasive method is valuable for pathophysiologic investigation of patients with TF and can be of help in estimating the severity of their disease. (author).

  14. Ebulliometric determination and prediction of (vapor + liquid) equilibria for binary and ternary mixtures containing alcohols (C{sub 1}-C{sub 4}) and dimethyl carbonate

    Energy Technology Data Exchange (ETDEWEB)

    Matsuda, Hiroyuki, E-mail: matsuda@chem.cst.nihon-u.ac.jp [Department of Materials and Applied Chemistry, Nihon University, 1-8 Kanda Surugadai, Chiyoda-ku, Tokyo 101-8308 (Japan); Fukano, Makoto; Kikkawa, Shinichiro [Department of Materials and Applied Chemistry, Nihon University, 1-8 Kanda Surugadai, Chiyoda-ku, Tokyo 101-8308 (Japan); Constantinescu, Dana [Carl von Ossietzky Universitaet Oldenburg, Technische Chemie, D-26111 Oldenburg (Germany); Kurihara, Kiyofumi; Tochigi, Katsumi; Ochi, Kenji [Department of Materials and Applied Chemistry, Nihon University, 1-8 Kanda Surugadai, Chiyoda-ku, Tokyo 101-8308 (Japan); Gmehling, Juergen [Carl von Ossietzky Universitaet Oldenburg, Technische Chemie, D-26111 Oldenburg (Germany)

    2012-01-15

    Highlights: > The VLE behavior of systems containing dimethyl carbonate (DMC) was investigated. > VLE data for ternary and binary mixtures containing alcohol and DMC were measured. > Several activity coefficient models were used for data reduction or prediction. > Valley line, i.e., distillation boundary, was observed for the ternary mixture. > Residue curves were calculated to investigate composition profile for distillation. - Abstract: (Vapor + liquid) equilibrium (VLE) data for a ternary mixture, namely {l_brace}methanol + propan-1-ol + dimethyl carbonate (DMC){r_brace}, and four binary mixtures, namely an {l_brace}alcohol (C{sub 3} or C{sub 4}) + DMC{r_brace}, containing the binary constituent mixtures of the ternary mixture, were measured at p = (40.00 to 93.32) kPa using a modified Swietoslawski-type ebulliometer. The experimental data for the binary systems were correlated using the Wilson model. The Wilson model was also applied to the ternary system to predict the VLE behavior using parameters from the binary mixtures. The modified UNIFAC (Dortmund) model was also tested for the predictions of the VLE behavior of the binary and ternary mixtures. In addition, the experimental VLE data for the ternary and constituent binary mixtures were correlated using the extended Redlich-Kister (ERK) model, which can completely represent the azeotropic points. For the ternary system, a comparison of the experimental and the predicted or correlated boiling points obtained using the Wilson and ERK models showed that the ERK model is more accurate. The valley line, i.e., the curve which divides the patterns of vapor-liquid tie lines, was found in the (methanol + propan-1-ol + DMC) system. This valley line could be represented by the ERK model. Finally, the composition profile for simple distillation of this ternary mixture was obtained by analysis of the residue curves from the estimated Wilson parameters of the constituent binary mixtures.

  15. Electromyography-controlled exoskeletal upper-limb-powered orthosis for exercise training after stroke.

    Science.gov (United States)

    Stein, Joel; Narendran, Kailas; McBean, John; Krebs, Kathryn; Hughes, Richard

    2007-04-01

    Robot-assisted exercise shows promise as a means of providing exercise therapy for weakness that results from stroke or other neurological conditions. Exoskeletal or "wearable" robots can, in principle, provide therapeutic exercise and/or function as powered orthoses to help compensate for chronic weakness. We describe a novel electromyography (EMG)-controlled exoskeletal robotic brace for the elbow (the active joint brace) and the results of a pilot study conducted using this brace for exercise training in individuals with chronic hemiparesis after stroke. Eight stroke survivors with severe chronic hemiparesis were enrolled in this pilot study. One subject withdrew from the study because of scheduling conflicts. A second subject was unable to participate in the training protocol because of insufficient surface EMG activity to control the active joint brace. The six remaining subjects each underwent 18 hrs of exercise training using the device for a period of 6 wks. Outcome measures included the upper-extremity component of the Fugl-Meyer scale and the modified Ashworth scale of muscle hypertonicity. Analysis revealed that the mean upper-extremity component of the Fugl-Meyer scale increased from 15.5 (SD 3.88) to 19 (SD 3.95) (P = 0.04) at the conclusion of training for the six subjects who completed training. Combined (summated) modified Ashworth scale for the elbow flexors and extensors improved from 4.67 (+/-1.2 SD) to 2.33 (+/-0.653 SD) (P = 0.009) and improved for the entire upper limb as well. All subjects tolerated the device, and no complications occurred. EMG-controlled powered elbow orthoses can be successfully controlled by severely impaired hemiparetic stroke survivors. This technique shows promise as a new modality for assisted exercise training after stroke.

  16. Solubility of perfumery and fragrance raw materials based on cyclohexane in 1-octanol under ambient and high pressures up to 900 MPa

    Energy Technology Data Exchange (ETDEWEB)

    Domanska, Urszula [Physical Chemistry Division, Faculty of Chemistry, Warsaw University of Technology, Noakowskiego 3, 00-664 Warsaw (Poland)], E-mail: ula@ch.pw.edu.pl; Morawski, Piotr; Piekarska, Maria [Physical Chemistry Division, Faculty of Chemistry, Warsaw University of Technology, Noakowskiego 3, 00-664 Warsaw (Poland)

    2008-04-15

    The (solid + liquid) phase equilibria (SLE) of binary mixtures containing 1-octanol and fragrance raw materials based on cyclohexane were investigated. The systems {l_brace}1-octanol (1) + cyclohexyl carboxylic acid (CCA), or cyclohexyl acetic acid (CAA), or cyclohexyl acetate (CA), or 2-cyclohexyl ethyl acetate (2CEA), or 2-cyclohexyl ethanol (2CE)(2){r_brace} have been measured by a dynamic method in wide range of temperatures from (220 to 320) K and ambient pressure. For all systems SLE diagrams were detected as eutectic mixtures with complete miscibility in the liquid phase. The experimental data were correlated by means of the Wilson and NRTL equations, utilizing parameters derived from the (solid + liquid) equilibrium. The root-mean-square deviations of the solubility temperatures for all calculated data are dependent upon the particular system and the particular equation used. Additionally, the SLE in binary mixture that contain {l_brace}1-octanol (1) + CCA (2){r_brace} has been measured under very high pressures up to about 900 MPa at the temperature range from T = (303.15 to 353.15) K. The thermostatted apparatus for the measurements of transition pressures from the (liquid + solid) state was used. The freezing and melting temperatures at a constant composition increase monotonously with pressure. The high pressure experimental results obtained at isothermal conditions (p-x) were interpolated to more convenient T-x diagram. Data of the (pressure + temperature) composition relation at the high pressure (solid + liquid) phase equilibria was correlated by the polynomial based on the Yang model. The basic thermodynamic properties of pure substances viz. the melting point, enthalpy of fusion, enthalpy of solid-solid phase transition, and glass transition, have been determined by the differential scanning calorimetry (DSC)

  17. Feasibility study of a wearable exoskeleton for children: is the gait altered by adding masses on lower limbs?

    Directory of Open Access Journals (Sweden)

    Stefano Rossi

    Full Text Available We are designing a pediatric exoskeletal ankle robot (pediatric Anklebot to promote gait habilitation in children with Cerebral Palsy (CP. Few studies have evaluated how much or whether the unilateral loading of a wearable exoskeleton may have the unwanted effect of altering significantly the gait. The purpose of this study was to evaluate whether adding masses up to 2.5 kg, the estimated overall added mass of the mentioned device, at the knee level alters the gait kinematics. Ten healthy children and eight children with CP, with light or mild gait impairment, walked wearing a knee brace with several masses. Gait parameters and lower-limb joint kinematics were analyzed with an optoelectronic system under six conditions: without brace (natural gait and with masses placed at the knee level (0.5, 1.0, 1.5, 2.0, 2.5 kg. T-tests and repeated measures ANOVA tests were conducted in order to find noteworthy differences among the trial conditions and between loaded and unloaded legs. No statistically significant differences in gait parameters for both healthy children and children with CP were observed in the five "with added mass" conditions. We found significant differences among "natural gait" and "with added masses" conditions in knee flexion and hip extension angles for healthy children and in knee flexion angle for children with CP. This result can be interpreted as an effect of the mechanical constraint induced by the knee brace rather than the effect associated with load increase. The study demonstrates that the mechanical constraint induced by the brace has a measurable effect on the gait of healthy children and children with CP and that the added mass up to 2.5 kg does not alter the lower limb kinematics. This suggests that wearable devices weighing 25 N or less will not noticeably modify the gait patterns of the population examined here.

  18. Abdominal Hollowing Reduces Lateral Trunk Displacement During Single-Leg Squats in Healthy Females But Does Not Affect Peak Hip Abduction Angle or Knee Abductio Angle/Moment.

    Science.gov (United States)

    Linde, Lukas D; Archibald, Jessica; Lampert, Eve C; Srbely, John Z

    2017-07-17

    Females suffer 4-6 times more non-contact anterior cruciate ligament (ACL) injuries than males due to neuromuscular control deficits of the hip musculature leading to increases in hip adduction angle, knee abduction angle, and knee abduction moment during dynamic tasks such as single-leg squats. Lateral trunk displacement has been further related to ACL injury risk in females, leading to the incorporation of core strength/stability exercises in ACL preventative training programs. However, the direct mechanism relating lateral trunk displacement and lower limb ACL risk factors is not well established. To assess the relationship between lateral trunk displacement and lower limb measures of ACL injury risk by altering trunk control through abdominal activation techniques during single-leg squats in healthy females. Interventional Study Setting: Movement and Posture Laboratory Participants: 13 healthy females (21.3±0.88y, 1.68±0.07m, 58.27±5.46kg) Intervention: Trunk position and lower limb kinematics were recorded using an optoelectric motion capture system during single-leg squats under differing conditions of abdominal muscle activation (abdominal hollowing, abdominal bracing, control), confirmed via surface electromyography. Lateral trunk displacement, peak hip adduction angle, peak knee abduction angle/moment, and average muscle activity from bilateral internal oblique, external oblique, and erector spinae muscles. No differences were observed for peak lateral trunk displacement, peak hip adduction angle or peak knee abduction angle/moment. Abdominal hollowing and bracing elicited greater muscle activation than the control condition, and bracing was greater than hollowing in four of six muscles recorded. The lack of reduction in trunk, hip, and knee measures of ACL injury risk during abdominal hollowing and bracing suggests that these techniques alone may provide minimal benefit in ACL injury prevention training.

  19. Management of Spinal Deformities and Evidence of Treatment Effectiveness

    Science.gov (United States)

    Bettany-Saltikov, Josette; Turnbull, Deborah; Ng, Shu Yan; Webb, Richard

    2017-01-01

    Introduction: The review evaluates the up-to-date evidence for the treatment of spinal deformities, including scoliosis and hyperkyphosis in adolescents and adults. Material and Methods: The PubMed database was searched for review articles, prospective controlled trials and randomized controlled trials related to the treatment of spinal deformities. Articles on syndromic scoliosis were excluded and so were the articles on hyperkyphosis of the spine with causes other than Scheuermann’s disease and osteoporosis. Articles on conservative and surgical treatments of idiopathic scoliosis, adult scoliosis and hyperkyphosis were also included. For retrospective papers, only studies with a follow up period exceeding 10 years were included. Results: The review showed that early-onset idiopathic scoliosis has a worse outcome than late-onset idiopathic scoliosis, which is rather benign. Patients with AIS function well as adults; they have no more health problems when compared to patients without scoliosis, other than a slight increase in back pain and aesthetic concern. Conservative treatment of adolescent idiopathic scoliosis (AIS) using physiotherapeutic scoliosis-specific exercises (PSSE), specifically PSSR and rigid bracing was supported by level I evidence. Yet to date, there is no high quality evidence (RCT`s) demonstrating that surgical treatment is superior to conservative treatment for the management of AIS. For adult scoliosis, there are only a few studies on the effectiveness of PSSEs and a conclusion cannot as yet be drawn. For hyperkyphosis, there is no high-quality evidence for physiotherapy, bracing or surgery for the treatment of adolescents and adults. However, bracing has been found to reduce thoracic hyperkyphosis, ranging from 55 to 80° in adolescents. In patients over the age of 60, bracing improves the balance score, and reduces spinal deformity and pain. Surgery is indicated in adolescents and adults in the presence of progression of kyphosis

  20. Mass spectrometric investigation of synthetic glycoside of muramyl dipeptide immobilized on fumed silica surface

    Energy Technology Data Exchange (ETDEWEB)

    Kulik, Tetiana V., E-mail: tanyakulyk@gala.net [O.O. Chuiko Institute of Surface Chemistry, National Academy of Sciences of Ukraine, 17 Generala Naumova Str., Kyiv 03164 (Ukraine); Azizova, Liana R., E-mail: liana_azizova@ukr.net [O.O. Chuiko Institute of Surface Chemistry, National Academy of Sciences of Ukraine, 17 Generala Naumova Str., Kyiv 03164 (Ukraine); Palyanytsya, Borys B. [O.O. Chuiko Institute of Surface Chemistry, National Academy of Sciences of Ukraine, 17 Generala Naumova Str., Kyiv 03164 (Ukraine); Zemlyakov, Alexander E.; Tsikalova, Victoria N. [Vernadsky Tauric National University, pr. Akademika Vernadskogo 4, Simferopol, 95007 (Ukraine)

    2010-05-25

    N-Acetylmuramyl-L-alanyl-D-isoglutamine or muramyl dipeptide is a cleavage product of peptidoglycan by lysozyme. This study explored the use of the temperature-programmed desorption mass spectrometry (TPDMS) in analysis of glycoside of muramyl dipeptide: O-{l_brace}(4-tert-butylcyclohexyl)-2-acetamido-2, 3-dideoxy-{beta}-D-glucopyranoside-3-yl{r_brace}-D-lactoyl-L-alanyl-D-isoglutamine (MDP) on the surface of fumed silica. Stages of pyrolysis of MDP in condensed state and on the silica surface have been determined. Three stages have been clear identified under pyrolysis of MDP on the silica surface. Kinetic parameters of thermal reactions on the fumed silica surface and in the condensed state have been calculated.

  1. New Formulation of the Governing Equations for Analyzing Outrigger Structures

    International Nuclear Information System (INIS)

    Er, G.-K.

    2010-01-01

    In this paper, an easily comprehensible solution procedure is proposed for the analysis of outrigger-braced structures. The idea is based on the compatibility of the columns' axial deformation. The unknowns are selected to be the axial forces in the columns. The resulted governing equations and the equations for the optimum analysis of the outrigger locations are different from the conventional ones, but numerical analysis shows that the results obtained with the new equations are same as those obtained with conventional equations. The relations between the new equations and the conventional ones are also figured out. The new procedure of formulating the governing equations can be easily extended to more complicated cases of outrigger-braced structures.

  2. The effect of support springs in ends welded gap hollow YT-joint

    Directory of Open Access Journals (Sweden)

    R. F. Vieira

    Full Text Available This paper presents an analysis on the effect of support springs in an ends circular hollow sections welded into a YT joint. The overall behavior and failure of the joint were characterized under axial compression of the lap brace. Two joint failure modes were identified: chord wall plastification (Mode A and cross-sectional chord buckling (Mode F in the region below the lap brace. The system was modeled with and without support springs using the numerical finite element program Ansys. Model results were compared with experimental data in terms of principal stress in the joint intersection. The finite element model without support springs proved to be more accurate than that with support springs.

  3. Phase behaviour and molecular dynamics in the binary system of sodium perchlorate and 1,2-propanediamine

    Energy Technology Data Exchange (ETDEWEB)

    Terashima, Yukio [Department of Natural Science Education, Joint Graduate School, Hyogo University of Teacher Education (Japan); Takeda, Kiyoshi, E-mail: takeda@naruto-u.ac.j [Department of Chemistry, Naruto University of Education, 748 Nakajima, Takashima Naruto-cho, Naruto, Tokushima 772-8502 (Japan); Honda, Makoto [Department of Physics, Naruto University of Education (Japan)

    2011-03-15

    The phase and glass transition behaviour in a binary mixture of sodium perchlorate and 1,2-propanediamine {l_brace}(NaClO{sub 4}){sub x}(12PDA){sub 1-x}, x < 0.40{r_brace} was investigated by differential scanning calorimetry and Raman scattering measurements. A eutectic point and a peritectic point were found at x = 0.17 and 0.19, respectively. The phase diagram indicates the existence of solvated compounds of (NaClO{sub 4}){sub 1}(12PDA){sub 4} and (NaClO{sub 4}){sub 2}(12PDA){sub 5}. The concentration dependence of the glass transition point shows a sigmoid curve implying an underlying anomaly.

  4. The theoretical shear strength of fcc crystals under superimposed triaxial stress

    Energy Technology Data Exchange (ETDEWEB)

    Cerny, M., E-mail: cerny.m@fme.vutbr.cz [Institute of Engineering Physics, Faculty of Mechanical Engineering, Brno University of Technology, Technicka 2, CZ-616 69 Brno (Czech Republic); Pokluda, J. [Institute of Engineering Physics, Faculty of Mechanical Engineering, Brno University of Technology, Technicka 2, CZ-616 69 Brno (Czech Republic)

    2010-05-15

    The influence of a triaxial stress applied normally to shear planes and shear direction during affine shear deformation of face-centered cubic crystals on the theoretical shear strength is studied for the <112-bar >{l_brace}111{r_brace} shear system using first-principles methods. The applied relaxation procedure guarantees that the modeled system is subjected to a superposition of shear, normal and in-plane stresses with individually adjustable in-plane and normal stress values. The theoretical shear strengths of individual elements prove to be qualitatively different functions of the superimposed stresses. In the special case of hydrostatic loading, however, these functions are qualitatively uniform. This behavior is discussed in terms of the electronic structure.

  5. Complete {sup 1}H and {sup 13}C NMR assignments and anti fungal activity of two 8-hydroxy flavonoids in mixture

    Energy Technology Data Exchange (ETDEWEB)

    Johann, Susana; Smania Junior, Artur [Universidade Federal de Santa Catarina (UFSC), Florianopolis, SC (Brazil). Dept. de Microbiologia e Parasitologia. Lab. de Antibioticos; Pizzolatti, Moacir G. [Universidade Federal de Santa Catarina (UFSC), Florianopolis, SC (Brazil). Dept. de Quimica; Schripsema, Jan; Braz-Filho, Raimundo [Universidade Estadual do Norte Fluminense (UENF), Campos dos Goytacazes, RJ (Brazil). Setor de Quimica de Produtos Naturais. Lab. de Quimica e Funcao de Proteinas e Peptideos (LQFPP); Branco, Alexsandro [Universidade Estadual de Feira de Santana, BA (Brazil). Dept. de Saude. Lab. de Fitoquimica]. E-mail: branco@uefs.br

    2007-06-15

    A mixture of the two new flavonols 8-hydroxy-3, 4', 5, 6, 7-pentamethoxyflavone (1) and 8-hydroxy-3, 3', 4', 5, 6, 7-hexamethoxyflavone (2) was isolated from a commercial sample of Citrus aurantifolia. An array of one- ({sup 1}H NMR, {l_brace}{sup 1}H{r_brace} {sup -13}C NMR, and APT{sup -13}C NMR) and two-dimensional NMR techniques (COSY, NOESY, HMQC and HMBC) was used to achieve the structural elucidation and the complete {sup 1}H and {sup 13}C chemical shift assignments of these natural compounds. In addition, the antifungal activity of these compounds against phytopathogenic and human pathogenic fungi was investigated. (author)

  6. [14C]-radiolabeling of {[trans-(8β)]-6-methyl-1-(1-methylethyl) ergoline-8-carboxylic acid, 4-methoxycyclohexyl ester (Z)-2-buteneidioate (1:1)}

    International Nuclear Information System (INIS)

    Marzoni, G.; Wheeler, W.J.; Garbrecht, W.L.

    1988-01-01

    The 5HT 2 -receptor antagonist, [ 14 C]-labeled brace[trans-(8β)]-6-methyl-1-(1-methylethyl)ergoline-8-carboxylic acid, 4-methoxycyclohexyl ester (Z)-2-butenedioate (1:1)brace (LY281067) was synthesized from unlabeled 6-methyl-1-(1-methylethyl)ergoline-8-carboxylic acid. The [ 14 C] label was introduced into the carboxyl group attached to the 8 position of the ergoline nucleus. This site is stable to metabolism. The synthesis involves removal of an unlabeled carboxyl group and subsequent reinsertion of a [ 14 C]-labeled carboxyl group into the same position. The radiolabel is not introduced until near the end of the synthesis which allows for ease of handling and scale-up of intermediates. (author)

  7. Osteogenesis Imperfecta

    Science.gov (United States)

    ... cure, but you can manage symptoms. Treatments include exercise, pain medicine, physical therapy, wheelchairs, braces, and surgery. NIH: National Institute of Arthritis and Musculoskeletal and Skin Diseases

  8. The unique N-terminal zinc finger of synaptotagmin-like protein 4 reveals FYVE structure.

    Science.gov (United States)

    Miyamoto, Kazuhide; Nakatani, Arisa; Saito, Kazuki

    2017-12-01

    Synaptotagmin-like protein 4 (Slp4), expressed in human platelets, is associated with dense granule release. Slp4 is comprised of the N-terminal zinc finger, Slp homology domain, and C2 domains. We synthesized a compact construct (the Slp4N peptide) corresponding to the Slp4 N-terminal zinc finger. Herein, we have determined the solution structure of the Slp4N peptide by nuclear magnetic resonance (NMR). Furthermore, experimental, chemical modification of Cys residues revealed that the Slp4N peptide binds two zinc atoms to mediate proper folding. NMR data showed that eight Cys residues coordinate zinc atoms in a cross-brace fashion. The Simple Modular Architecture Research Tool database predicted the structure of Slp4N as a RING finger. However, the actual structure of the Slp4N peptide adopts a unique C 4 C 4 -type FYVE fold and is distinct from a RING fold. To create an artificial RING finger (ARF) with specific ubiquitin-conjugating enzyme (E2)-binding capability, cross-brace structures with eight zinc-ligating residues are needed as the scaffold. The cross-brace structure of the Slp4N peptide could be utilized as the scaffold for the design of ARFs. © 2017 The Protein Society.

  9. Postoperative braces for degenerative lumbar diseases

    NARCIS (Netherlands)

    Machado, Andre N.; Ayala, Ana Patricia; Rubinstein, Sidney M.; El Dib, Regina; Rodrigues, Luciano M.; Gotfryd, Alberto Ofenhejm; Tamaoki, Marcel Jun; Belloti, João Carlos

    2017-01-01

    This is a protocol for a Cochrane Review (Intervention). The objectives are as follows: The primary objective is to evaluate the effectiveness of orthosis following lumbar spinal surgery for people with degenerative disease on pain reduction and improvement of functional status. Secondary objectives

  10. Optimization of Single-Layer Braced Domes

    Directory of Open Access Journals (Sweden)

    Grzywiński Maksym

    2017-06-01

    Full Text Available The paper deals with discussion of optimization problem in civil engineering structural space design. Minimization of mass should satisfy the limit state capacity and serviceability conditions. The cross-sectional areas of bars and structural dimensions are taken as design variables. Variables are used in the form of continuous and discrete. The analysis is done using the Structural and Design of Experiments modules of Ansys Workbench v17.2. As result of the method a mass reduction of 46,6 % is achieved.

  11. Pain control methods in use and perceived effectiveness by patients with Ehlers-Danlos syndrome: a descriptive study.

    Science.gov (United States)

    Arthur, Karen; Caldwell, Karen; Forehand, Samantha; Davis, Keith

    2016-01-01

    The purpose of this study was to assess the pain control methods in use by patients who have Ehlers-Danlos Syndrome (EDS), a group of connective tissue disorders, and their perceived effectiveness. This descriptive study involved 1179 adults diagnosed with EDS who completed an anonymous on-line survey. The survey consisted of demographics information, the Patient Reported Outcomes Measurement Information System (PROMIS) Pain-Behavior, PROMIS Pain-Interference, and Neuro QOL Satisfaction with Social Roles and Activities scales, as well as a modified version of the Pain Management Strategies Survey. Respondents reported having to seek out confirmation of their EDS diagnosis with multiple healthcare providers, which implies the difficulty many people with EDS face when trying to gain access to appropriate treatment. Patients with EDS experience higher levels of pain interference and lower satisfaction with social roles and activities compared to national norms. Among the treatment modalities in this study, those perceived as most helpful for acute pain control were opioids, surgical interventions, splints and braces, avoidance of potentially dangerous activities and heat therapy. Chronic pain treatments rated as most helpful were opioids, splints or braces and surgical interventions. For methods used for both acute and chronic pain, those perceived as most helpful were opioids, massage therapies, splints or braces, heat therapy and avoiding potentially dangerous activities. EDS is a complex, multi-systemic condition that can be difficult to diagnose and poses challenges for healthcare practitioners who engage with EDS patients in holistic care. Improved healthcare provider knowledge of EDS is needed, and additional research on the co-occurring diagnoses with EDS may assist in comprehensive pain management for EDS patients. Ehlers-Danlos Syndrome (EDS) is a group of connective tissue disorders associated with defective production of collagen, which can dramatically

  12. Analysis of foods and beverages: modern techniques

    National Research Council Canada - National Science Library

    Charalambous, George

    1984-01-01

    ... CHARALAMBOUS St. Louis, Missouri 1984 ACADEMIC PRESS, INC. (Harcourt Brace Jovanovich, Publishers) Orlando San Diego San Francisco Toronto Montreal Sydney Tokyo New York Säo Paulo London Copyri...

  13. 48 CFR 47.301-1 - Responsibilities of contracting officers.

    Science.gov (United States)

    2010-10-01

    ... termination, including the movement of property by the Government to and from contractors' plants. (b... the use of special equipment, excess blocking and bracing material, or circuitous routing. ...

  14. Adventures in Manipulation

    Science.gov (United States)

    Christensen, Bonniejean

    1971-01-01

    Objects to an alleged misrepresentation and inaccurate presentation of a J. R. R. Tolkien quotation in "Adventures in Reading" (Harcourt, Brace & World, 1969), a ninth grade literature anthology. (RD)

  15. Biosynthesis of quinolizidine alkaloids. Incorporation of [1-amino-15N, 1-13C] cadaverine into lupanine, 13-hydroxylupanine, and angustifoline

    International Nuclear Information System (INIS)

    Rana, J.; Robins, D.J.

    1985-01-01

    The labelling patterns in (+)-lupanine, (+)-13-hydroxylupanine, and (+)-angustifoline derived biosynthetically from [1-amino- 15 N,1- 13 C]-1,5-diaminopentane (cadaverine) have been established by 13 C n.m.r. spectroscopy. Three cadaverine units are incorporated to about the same extent into each of these three alkaloids. The presence of two doublets due to 13 C- 15 N coupling in the 13 C brace 1 H brace n.m.r. spectra associated with C-2 and C-15 of lupanine and 13-hydroxylupanine, and one 13 C- 15 N doublet at C-2 of angustifoline, indicate that two of the cadaverine units are converted into the outer rings of the tetracyclic quinolizidine alkaloids in a specific fashion. (author)

  16. Plastic incompatibility stresses and stored elastic energy in plastically deformed copper

    Energy Technology Data Exchange (ETDEWEB)

    Baczmanski, A. [Faculty of Physics and Applied Computer Science, AGH-University of Science and Technology, al. Mickiewicza 30, 30-059 Krakow (Poland)], E-mail: baczman@ftj.agh.edu.pl; Hfaiedh, N.; Francois, M. [LASMIS, Universite de Technologie de Troyes, 11 rue Marie Curie, B.P. 2060, 10010 Troyes (France); Wierzbanowski, K. [Faculty of Physics and Applied Computer Science, AGH-University of Science and Technology, al. Mickiewicza 30, 30-059 Krakow (Poland)

    2009-02-15

    The X-ray diffraction method and theoretical model of elastoplastic deformation were used to examine the residual stresses in polycrystalline copper. To this end, the {l_brace}2 2 0{r_brace} strain pole figures were determined for samples subjected to different magnitudes of tensile deformation. Using diffraction data and the self-consistent model, the tensor of plastic incompatibility stress was found for each orientation of a polycrystalline grain. Crystallographic textures, macroscopic and second-order residual stresses were considered in the analysis. As a result, the distributions of elastic stored energy and von Mises equivalent stress were presented in Euler space and correlated with the preferred orientations of grains. Moreover, using the model prediction, the variation of the critical resolved shear stress with grain orientation was determined.

  17. Growth, spectral and thermal studies of ibuprofen crystals

    Energy Technology Data Exchange (ETDEWEB)

    Ramukutty, S.; Ramachandran, E. [Department of Physics, Thiruvalluvar College, Papanasam (India)

    2012-01-15

    RS -Ibuprofen was crystallized for the first time in silica gel under suitable pH conditions by reduction of solubility method. The grown crystals were characterized by single crystal X-ray diffraction and density measurement. The functional groups present in the crystal were identified using Fourier transform infrared spectroscopy. Optical bandgap energy of ibuprofen was estimated as 3.19(3) eV from UV-Vis spectrum. Thermogravimetric analysis revealed that ibuprofen is thermally stable upto 102.9 C and the initial loss of mass was due to evaporation only. Morphological study showed that the growth is prominent along b-axis and the prominent face is {l_brace}100{r_brace}. (copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  18. Structural investigations of homoepitaxial Si films grown at low temperature by pulsed magnetron sputtering on Si(111) substrates

    Energy Technology Data Exchange (ETDEWEB)

    Fenske, F. [Hahn-Meitner-Institut Berlin, Abt. Silizium-Photovoltaik, Kekulestr. 5, D-12485 Berlin (Germany)], E-mail: fenske@hmi.de; Schulze, S.; Hietschold, M. [Technische Universitaet Chemnitz, Analytik an Festkoerperoberflaechen, Reichenhainer Str. 70, D-09107 Chemnitz (Germany); Schmidbauer, M. [Institut fuer Kristallzuechtung Berlin, Max-Born-Str.2, D-12489 Berlin (Germany)

    2008-06-02

    Using pulsed magnetron sputtering at low substrate temperature (T{sub s} = 580 {sup o}C) the homoepitaxial growth on Si(111) was studied. The films were comprehensively characterized by cross-section transmission electron microscopy and various diffraction methods. Up to a film thickness of 1240 nm no breakdown of the epitaxial growth was observed. The surface microstructure, characterized by electron backscatter diffraction, exhibits exclusively crystalline structure with (111) orientation. Careful analysis of selected area electron diffraction patterns and high-resolution X-ray diffraction data clearly proves the existence of twinning/stacking faults in the {l_brace}111{r_brace} planes. Besides these defects - which are typical for low-temperature epitaxy - no additional significant defects related to the energetic particle bombardment by the sputter deposition method are observed.

  19. Indentation plasticity of barium titanate single crystals: Dislocation influence on ferroelectric domain walls

    Energy Technology Data Exchange (ETDEWEB)

    Liu, D. [Department of Mechanical Engineering, University of Houston, 4800 Calhoun Road, Houston, TX 77204 (United States)]. E-mail: duo.liu@mail.uh.edu; Chelf, M. [Department of Mechanical Engineering, University of Houston, 4800 Calhoun Road, Houston, TX 77204 (United States); White, K.W. [Department of Mechanical Engineering, University of Houston, 4800 Calhoun Road, Houston, TX 77204 (United States)

    2006-10-15

    The plastic behaviors of barium titanate (001) and (110) single crystals are studied with atomic force microscopy and piezoresponse force microscopy (PFM) following nanoindendation damage. Plastic deformation mechanisms of ferroelectric barium titanate single crystals are discussed with a focus on the interaction between PFM response and dislocation activities. Nanoindentation tests indicate that the theoretical strength is approached prior to the first pop-in event, consistent with the creation of dislocation nucleation sites required for the onset of plasticity. Surface topographic and piezoelectric analyses indicate that pile-ups around indents result from dislocation activities on the primary slip system, {l_brace}110{r_brace}{sub pc}<11-bar 0>{sub pc}. The more complex indentation-induced domain patterns observed on (110) barium titanate are also discussed.

  20. Massive 3-loop ladder diagrams for quarkonic local operator matrix elements

    Energy Technology Data Exchange (ETDEWEB)

    Ablinger, Jakob; Schneider, Carsten [Johannes Kepler Univ., Linz (Austria). Research Inst. for Symbolic Computation; Bluemlein, Johannes; Hasselhuhn, Alexander; Wissbrock, Fabian [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); Klein, Sebastian [Technische Hochschule Aachen (Germany). Inst. fuer Theoretische Physik

    2012-06-15

    3-loop diagrams of the ladder-type, which emerge for local quarkonic twist-2 operator matrix elements, are computed directly for general values of the Mellin variable N using Appell-function representations and applying modern summation technologies provided by the package Sigma and the method of hyperlogarithms. In some of the diagrams generalized harmonic sums with {xi} element of {l_brace}1,1/2,2{r_brace} emerge beyond the usual nested harmonic sums. As the asymptotic representation of the corresponding integrals shows, the generalized sums conspire giving well behaved expressions for large values of N. These diagrams contribute to the 3-loop heavy flavor Wilson coefficients of the structure functions in deep-inelastic scattering in the region Q{sup 2} >> m{sup 2}.

  1. Massive 3-loop ladder diagrams for quarkonic local operator matrix elements

    Energy Technology Data Exchange (ETDEWEB)

    Ablinger, Jakob [Research Institute for Symbolic Computation (RISC), Johannes Kepler University, Altenbergerstrasse 69, A-4040 Linz (Austria); Bluemlein, Johannes, E-mail: johannes.bluemlein@desy.de [Deutsches Elektronen-Synchrotron, DESY, Platanenallee 6, D-15738 Zeuthen (Germany); Hasselhuhn, Alexander [Deutsches Elektronen-Synchrotron, DESY, Platanenallee 6, D-15738 Zeuthen (Germany); Klein, Sebastian [Research Institut fuer Theoretische Physik E, RWTH Aachen University, D-52056 Aachen (Germany); Schneider, Carsten [Research Institute for Symbolic Computation (RISC), Johannes Kepler University, Altenbergerstrasse 69, A-4040 Linz (Austria); Wissbrock, Fabian [Deutsches Elektronen-Synchrotron, DESY, Platanenallee 6, D-15738 Zeuthen (Germany)

    2012-11-01

    3-loop diagrams of the ladder-type, which emerge for local quarkonic twist-2 operator matrix elements, are computed directly for general values of the Mellin variable N using Appell-function representations and applying modern summation technologies provided by the package Sigma and the method of hyperlogarithms. In some of the diagrams generalized harmonic sums with {xi} Element-Of {l_brace}1,1/2,2{r_brace} emerge beyond the usual nested harmonic sums. As the asymptotic representation of the corresponding integrals shows, the generalized sums conspire giving well behaved expressions for large values of N. These diagrams contribute to the 3-loop heavy flavor Wilson coefficients of the structure functions in deep-inelastic scattering in the region Q{sup 2} Much-Greater-Than m{sup 2}.

  2. Variable-Fidelity Aeroservoelastic Analysis Tool for Concept Evaluation, Design and Wind-Tunnel Test Support, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Ongoing work in advanced air-vehicles, such as ultra-light-weight truss-braced and elastically tailored concepts is beginning to provide the insight necessary to...

  3. Updating sea spray aerosol emissions in the Community Multiscale Air Quality (CMAQ) model version 5.0.2

    Data.gov (United States)

    U.S. Environmental Protection Agency — The uploaded data consists of the BRACE Na aerosol observations paired with CMAQ model output, the updated model's parameterization of sea salt aerosol emission size...

  4. Muscular dystrophy

    Science.gov (United States)

    ... are no known cures for the various muscular dystrophies. The goal of treatment is to control symptoms. Physical therapy may help maintain muscle strength and function. Leg braces and a wheelchair ...

  5. Health related quality of life and perception of deformity in patients with adolescent idiopathic scoliosis.

    Science.gov (United States)

    Çolak, Tuğba Kuru; Akgül, Turgut; Çolak, Ilker; Dereli, Elif Elçin; Chodza, Mehmet; Dikici, Fatih

    2017-01-01

    Quality of life and cosmethic appearance have gained importance as outcomes in AIS treatment. Improving aesthetic appearance and quality of life are defined as the primary aims of scoliosis treatment by health professionals. Studies that assess and compare the different treatment results in the field of quality of life and cosmethics are some what limited. A cross-sectional study was designed to compare quality of life and deformity perception in patients with adolescent idiopathic scoliosis (AIS) received conservative (exercise or exercise + brace) or surgical treatment. A total of 68 (58 females) patients aged 10-18 years with AIS received conservative (exercise or exercise+brace) or surgical treatment were invited to participate in the study. Quality of life (Scoliosis Research Society-23 (SRS-23)) and perception of deformity (Walter Reed Visual Assessment (WRVAS)) were assessed. Conservatively treated patients had significantly superior scores in function domain of SRS-23 than surgically treated patients (exercise/surgery, exercise+brace/surgery; p= 0.009, 0.004). Otherwise, surgically treated patients had significantly superior scores in self-image (p= 0.000, 0.000), and satisfaction with management (p= 0.001, 0.006) domains of SRS-23, and WRVAS (p= 0.000, 0.000) than conservative groups. In addition to radiographic assessments, quality of life, aesthetic perception, functionality, satisfaction with management, psycho-social status should carefully be taken into consideration by health professionals in the teratment of AIS.

  6. Adolescent Idiopathic Scoliosis: A 71 Cases Study Ascertaining that Straightening Is Possible, and a New Etiological Hypothesis.

    Science.gov (United States)

    Polak, Jan

    2013-12-01

    Seventy-one children (23 boys and 48 girls, aged 6 to 18 year-old) with adolescent idiopathic scoliosis (AIS) between 11° and 62°, without braces, have been treated manually, only at the level of the neck. To ascertain that non-surgical straightening of AIS is possible (without brace). So far no disease modifying treatment for AIS existed. Braces can only slow down worsening (and this can only be achieved if they are worn 23 hours a day). Surgery is not without important risks. All patients have been treated exclusively with a manual therapy called Brachy-Myotherapy. This method treats spasmed (contractured) muscles by placing them in a shortening position according to a specific protocol. An average straightening of 8° of AIS was observed, with a maximum of 25°. 94% of cases improved, 67 out of 71. The worst prognosis was, the better results. The more advanced AIS was, the better the results. A simple and reliable treatment of AIS is possible. AIS seems to be a compensation mechanism of the body, with the aim of keeping the ears, and thus the labyrinths, at a horizontal level for correct equilibrium. When lasting post-traumatic neck muscle contractures causing a permanent side-bending of the skull have been treated, this compensation mechanism becomes irrelevant and scoliosis tends to subside.

  7. On the Seismic Response of Protected and Unprotected Middle-Rise Steel Frames in Far-Field and Near-Field Areas

    Directory of Open Access Journals (Sweden)

    Dora Foti

    2014-01-01

    Full Text Available Several steel moment-resisting framed buildings were seriously damaged during Northridge (1994; Kobe (1995; Kocaeli, Turkey (1999, earthquakes. Indeed, for all these cases, the earthquake source was located under the urban area and most victims were in near-field areas. In fact near-field ground motions show velocity and displacement peaks higher than far-field ones. Therefore, the importance of considering near-field ground motion effects in the seismic design of structures is clear. This study analyzes the seismic response of five-story steel moment-resisting frames subjected to Loma Prieta (1989 earthquake—Gilroy (far-field register and Santa Cruz (near-field register. The design of the frames verifies all the resistance and stability Eurocodes’ requirements and the first mode has been determined from previous shaking-table tests. In the frames two diagonal braces are installed in different positions. Therefore, ten cases with different periods are considered. Also, friction dampers are installed in substitution of the braces. The behaviour of the braced models under the far-field and the near-field records is analysed. The responses of the aforementioned frames equipped with friction dampers and subjected to the same ground motions are discussed. The maximum response of the examined model structures with and without passive dampers is analysed in terms of damage indices, acceleration amplification, base shear, and interstory drifts.

  8. Download this PDF file

    African Journals Online (AJOL)

    Players completed an injury questionnaire probing the prevalence and nature of hockey ... [4] The success of prophylactic ankle bracing as an effective rehabilitative ... ception in soccer, basketball and athletic populations, with the findings.

  9. 49 CFR 173.12 - Exceptions for shipment of waste materials.

    Science.gov (United States)

    2010-10-01

    ... blocked and braced in such a manner that they are separated from incompatible materials by a minimum... pallet with shrink-wrap or stretch-wrap except that labels representative of each Hazard Class or...

  10. Design and synthesis of a redox-active tc-99m radiopharmaceutical with ferrocenedithiocarboxylate [FcCS=Fe(C{sub 5}H{sub 4}CS{sub 2})(C{sub 5}H{sub 5}){sup -}

    Energy Technology Data Exchange (ETDEWEB)

    Uccelli, Licia; Bolzati, Cristina; Boschi, Alessandra; Duatti, Adriano E-mail: dta@ifeuniv.unife.it; Morin, Christophe; Pasqualini, Roberto; Giganti, Melchiore; Piffanelli, Adriano

    1999-01-01

    The synthesis, at tracer level, of two Tc-99m complexes having the same chemical composition and structure, but differing by one electron in the total electron counting, is reported. These compounds have been prepared by reacting [{sup 99m}TcO{sub 4}]{sup -} with the piperidinium salt of the ligand ferrocenedithiocarboxylate {l_brace}[Fe(II)(C{sub 5}H{sub 4}CS{sub 2})(C{sub 5}H{sub 5})]{sup -}=FcCS{r_brace}, in the presence of N-methyl S-methyldithiocarbazate as donor of N{sup 3-} groups, and triphenylphosphine or SnCl{sub 2} as reducing agents. The formation of the neutral complex [{sup 99m}Tc(N)(FcCS){sub 2}] (compound A) and of the monocationic, mixed-valence complex [{sup 99m}Tc(N)(FcCS) (FcCS*)]{sup +} (compound B) {l_brace}FcCS* [Fe(III)(C{sub 5}H{sub 4}CS{sub 2})(C{sub 5}H{sub 5})]{r_brace} was obtained in high yield. Both complexes comprise a terminal Tc{identical_to}N multiple bond and two FcCS ligands coordinated to the metal center through the two sulfur atoms of the -CS{sub 2} group, but they differ in the oxidation state of one of the two iron atoms of the coordinated FcCS ligands. In complex A, the two Fe atoms are both in the +2 oxidation state, while in B, one Fe atom is in the +2 and the other is in the +3 oxidation state. Thus, B is a mixed-valence Fe(II)-Fe(III) complex. B is easily converted into A by one-electron exchange with various reductants such as triphenylphosphine and excess SnCl{sub 2}. Biodistribution studies in rats showed that complexes A and B are mostly retained in lungs and liver without any significant uptake in organs such as heart and brain.

  11. Variability of United States Online Rehabilitation Protocols for Proximal Hamstring Tendon Repair.

    Science.gov (United States)

    Lightsey, Harry M; Kantrowitz, David E; Swindell, Hasani W; Trofa, David P; Ahmad, Christopher S; Lynch, T Sean

    2018-02-01

    The optimal postoperative rehabilitation protocol following repair of complete proximal hamstring tendon ruptures is the subject of ongoing investigation, with a need for more standardized regimens and evidence-based modalities. To assess the variability across proximal hamstring tendon repair rehabilitation protocols published online by United States (US) orthopaedic teaching programs. Cross-sectional study. Online proximal hamstring physical therapy protocols from US academic orthopaedic programs were reviewed. A web-based search using the search term complete proximal hamstring repair rehabilitation protocol provided an additional 14 protocols. A comprehensive scoring rubric was developed after review of all protocols and was used to assess each protocol for both the presence of various rehabilitation components and the point at which those components were introduced. Of 50 rehabilitation protocols identified, 35 satisfied inclusion criteria and were analyzed. Twenty-five protocols (71%) recommended immediate postoperative bracing: 12 (34%) prescribed knee bracing, 8 (23%) prescribed hip bracing, and 5 (14%) did not specify the type of brace recommended. Fourteen protocols (40%) advised immediate nonweightbearing with crutches, while 16 protocols (46%) permitted immediate toe-touch weightbearing. Advancement to full weightbearing was allowed at a mean of 7.1 weeks (range, 4-12 weeks). Most protocols (80%) recommended gentle knee and hip passive range of motion and active range of motion, starting at a mean 1.4 weeks (range, 0-3 weeks) and 4.0 weeks (range, 0-6 weeks), respectively. However, only 6 protocols (17%) provided specific time points to initiate full hip and knee range of motion: a mean 8.0 weeks (range, 4-12 weeks) and 7.8 weeks (range, 0-12 weeks), respectively. Considerable variability was noted in the inclusion and timing of strengthening, stretching, proprioception, and cardiovascular exercises. Fifteen protocols (43%) required completion of

  12. The multiple zeta value data mine

    Energy Technology Data Exchange (ETDEWEB)

    Buemlein, J. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); Broadhurst, D.J. [Open Univ., Milton Keynes (United Kingdom). Physics and Astronomy Dept.; Vermaseren, J.A.M. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); NIKHEF, Amsterdam (Netherlands)

    2009-07-15

    We provide a data mine of proven results for multiple zeta values (MZVs) of the form {zeta}(s{sub 1},s{sub 2},..,s{sub k}) = sum {sup {infinity}}{sub n{sub 1}}{sub >n{sub 2}}{sub >...>n{sub k}}{sub >0} {l_brace}1/(n{sub 1}{sup s{sub 1}}..n{sub k}{sup s{sub k}}){r_brace} with weight w = sum {sup K}{sub i=1}s{sub i} and depth k and for Euler sums of the form sum {sup {infinity}}{sub n{sub 1}}{sub >n{sub 2}}{sub >...>n{sub k}}{sub >0} {l_brace}({epsilon}{sub 1}{sup n{sub 1}}..{epsilon}{sub 1}{sup n{sub k}})/(n{sub 1}{sup s{sub 1}}..n{sub k}{sup s{sub k}}){r_brace} with signs {epsilon}{sub i} = {+-} 1. Notably, we achieve explicit proven reductions of all MZVs with weights w{<=}22, and all Euler sums with weights w{<=}12, to bases whose dimensions, bigraded by weight and depth, have sizes in precise agreement with the Broadhurst. Kreimer and Broadhurst conjectures. Moreover, we lend further support to these conjectures by studying even greater weights (w{<=}30), using modular arithmetic. To obtain these results we derive a new type of relation for Euler sums, the Generalized Doubling Relations. We elucidate the ''pushdown'' mechanism, whereby the ornate enumeration of primitive MZVs, by weight and depth, is reconciled with the far simpler enumeration of primitive Euler sums. There is some evidence that this pushdown mechanism finds its origin in doubling relations. We hope that our data mine, obtained by exploiting the unique power of the computer algebra language FORM, will enable the study of many more such consequences of the double-shuffle algebra of MZVs, and their Euler cousins, which are already the subject of keen interest, to practitioners of quantum field theory, and to mathematicians alike. (orig.)

  13. Field driven ferromagnetic phase nucleation and propagation from the domain boundaries in antiferromagnetically coupled perpendicular anisotropy films

    Energy Technology Data Exchange (ETDEWEB)

    Hauet, Thomas; Gunther, Christian M.; Hovorka, Ondrej; Berger, Andreas; Im, Mi-Young; Fischer, Peter; Hellwig, Olav

    2008-12-09

    We investigate the reversal process in antiferromagnetically coupled [Co/Pt]{sub X-1}/{l_brace}Co/Ru/[Co/Pt]{sub X-1}{r_brace}{sub 16} multilayer films by combining magnetometry and Magnetic soft X-ray Transmission Microscopy (MXTM). After out-of-plane demagnetization, a stable one dimensional ferromagnetic (FM) stripe domain phase (tiger-tail phase) for a thick stack sample (X=7 is obtained), while metastable sharp antiferromagnetic (AF) domain walls are observed in the remanent state for a thinner stack sample (X=6). When applying an external magnetic field the sharp domain walls of the thinner stack sample transform at a certain threshold field into the FM stripe domain wall phase. We present magnetic energy calculations that reveal the underlying energetics driving the overall reversal mechanisms.

  14. Superconducting nitride halides MNX (M = Ti, Zr, Hf; X = Cl, Br, I)

    Energy Technology Data Exchange (ETDEWEB)

    Schurz, Christian M.; Shlyk, Larysa; Schleid, Thomas; Niewa, Rainer [Stuttgart Univ. (Germany). Inst. fuer Anorganische Chemie

    2011-07-01

    Two different polymorphs of the metal nitride halides MNX (M = Ti, Zr, Hf; X = Cl, Br, I) are known to crystallize in layered structures. The two crystal structures differ in the way {sub {infinity}}{sup 2}{l_brace}X[M{sub 2}N{sub 2}]X{r_brace} slabs are stacked along the c-axes. Metal atoms and/or organic molecules can be intercalated into the van-der-Waals gap between these layers. After such an electron-doping via intercalation the prototypic band insulators change into superconductors with moderate high critical temperatures T{sub c} up to 25.5 K. This review gathers information on synthesis routes, structural characteristics and properties of the prototypic nitride halides and the derivatives after electron-doping with a focus on superconductivity. (orig.)

  15. Asymptotic Distribution of Eigenvalues for a Class of Second-Order Elliptic Operators with Irregular Coefficients in R{sup d}

    Energy Technology Data Exchange (ETDEWEB)

    Zielinski, Lech [Universite du Littoral, LMPA (France)], E-mail: lech.zielinski@lmpa.univ-littoral.fr

    2002-06-15

    Let A=A{sub 0}+v(x) where A{sub 0} is a second-order uniformly elliptic self-adjoint operator in R{sup d} and v is a real valued polynomially growing potential. Assuming that v and the coefficients of A{sub 0} are Hoelder continuous, we study the asymptotic behaviour of the counting function N(A,{lambda}) ({lambda}{sup {yields}}{infinity}) with the remainder estimates depending on the regularity hypotheses. Our strongest regularity hypotheses involve Lipschitz continuity and give the remainder estimate N(A,{lambda})O({l_brace}{lambda}{r_brace}{sup -{mu}}), where {mu} may take an arbitrary value strictly smaller than the best possible value known in the smooth case. In particular, our results are obtained without any hypothesis on critical points of the potential.

  16. Fluid Mechanics, Drag Reduction and Advanced Configuration Aeronautics

    Science.gov (United States)

    Bushnell, Dennis M.

    2000-01-01

    This paper discusses Advanced Aircraft configurational approaches across the speed range, which are either enabled, or greatly enhanced, by clever Flow Control. Configurations considered include Channel Wings with circulation control for VTOL (but non-hovering) operation with high cruise speed, strut-braced CTOL transports with wingtip engines and extensive ('natural') laminar flow control, a midwing double fuselage CTOL approach utilizing several synergistic methods for drag-due-to-lift reduction, a supersonic strut-braced configuration with order of twice the L/D of current approaches and a very advanced, highly engine flow-path-integrated hypersonic cruise machine. This paper indicates both the promise of synergistic flow control approaches as enablers for 'Revolutions' in aircraft performance and fluid mechanic 'areas of ignorance' which impede their realization and provide 'target-rich' opportunities for Fluids Research.

  17. Radiological Outcomes in Adolescent Idiopathic Scoliosis Patients More Than 22 Years After Treatment

    DEFF Research Database (Denmark)

    Simony, Ane; Christensen, Steen Bach; Carreon, Leah Y

    2015-01-01

    STUDY DESIGN: Longitudinal cohort. OBJECTIVES: To evaluate the long-term radiologic outcomes in adolescent idiopathic scoliosis (AIS) patients more than 22 years after treatment. SUMMARY OF BACKGROUND DATA: Although treatment for AIS is prophylactic and is aimed at preventing curve progression......, very few studies report long-term outcomes of treatment. METHODS: AIS patients treated with Boston brace or posterior spinal fusion (PSF) with Harrington-dorso-transverse traction (DTT) instrumentation from 1983 to 1990 were requested to return to clinic. Subsequently, 36-inch standing radiographs were...... obtained after patient consent. Cobb angles were compared with pretreatment and immediate posttreatment radiographs. Any evidence of adjacent-level disease or local kyphosis was also noted. RESULTS: One hundred fifty-nine (78%) of 219 patients were available for follow-up, 66 braced and 93 surgical...

  18. Analytical investigation of AlCl[3]/SO[2]Cl[2] catholyte materials for secondary fuze reserve batteries.

    Energy Technology Data Exchange (ETDEWEB)

    Butler, Paul Charles; Rodriguez, Mark Andrew; Segall, Judith M.; Malizia, Louis A., Jr.; Cherry, Brian Ray; Andrews, Nicholas L.; Clark, Nancy H.; Alam, Todd Michael; Ingersoll, David T.; Tallant, David Robert; Simpson, Regina Lynn; Boyle, Timothy J.; Garcia, Manuel Joseph

    2004-05-01

    Exploration of the fundamental chemical behavior of the AlCl{sub 3}/SO{sub 2}Cl{sub 2} catholyte system for the ARDEC Self-Destruct Fuze Reserve Battery Project under accelerated aging conditions was completed using a variety of analytical tools. Four different molecular species were identified in this solution, three of which are major. The relative concentrations of the molecular species formed were found to depend on aging time, initial concentrations, and storage temperature, with each variable affecting the kinetics and thermodynamics of this complex reaction system. We also evaluated the effect of water on the system, and determined that it does not play a role in dictating the observed molecular species present in solution. The first Al-containing species formed was identified as the dimer [Al({mu}-Cl)Cl{sub 2}]{sub 2}, and was found to be in equilibrium with the monomer, AlCl{sub 3}. The second species formed in the reaction scheme was identified by single crystal X-ray diffraction studies as [Cl{sub 2}Al({mu}-O{sub 2}SCl)]{sub 2} (I), a scrambled AlCl{sub 3}{center_dot}SO{sub 2} adduct. The SO{sub 2}(g) present, as well as CL{sub 2}(g), was formed through decomposition of SO{sub 2}CL{sub 2}. The SO{sub 2}(g) generated was readily consumed by AlCl{sub 3} to form the adduct 1 which was experimentally verified when 1 was also isolated from the reaction of SO{sub 2}(g) and AlCl {sub 3}. The third species found was tentatively identified as a compound having the general formula {l_brace}[Al(O)Cl{sub 2}][OSCl{sub 2}]{r_brace}{sub n}. This was based on {sup 27}Al NMR data that revealed a species with tetrahedrally coordinated Al metal centers with increased oxygen coordination and the fact that the precipitate, or gel, that forms over time was shown by Raman spectroscopic studies to possess a component that is consistent with SOCl{sub 2}. The precursor to the precipitate should have similar constituents, thus the assignment of {l_brace}[Al(O)Cl{sub 2}][OSCl{sub 2

  19. Muscle atrophy

    Science.gov (United States)

    ... People who cannot actively move one or more joints can do exercises using braces or splints . When ... A.M. Editorial team. Muscle Disorders Read more Neuromuscular Disorders Read more NIH MedlinePlus Magazine Read more ...

  20. Medical Management

    Science.gov (United States)

    ... org Close Charcot-Marie-Tooth Disease (CMT) Medical Management Although there’s no cure for CMT, there are ... individualized physical therapy program. For more on medical management of CMT, see Surgery Sometimes, Bracing Often, Caution ...

  1. Download this PDF file

    African Journals Online (AJOL)

    dell

    2014-04-01

    Apr 1, 2014 ... Traffic crashes accounted for 15 cases (46.9%). .... fractures, acromioclavicular joint dislocation, an open tibial fracture, fractures of the ..... The treatment of femoral fractures by cast-brace application and early ambulation. A.

  2. Ankle Sprains. A Round Table.

    Science.gov (United States)

    Physician and Sportsmedicine, 1986

    1986-01-01

    Types of ankle sprains, surgical versus nonsurgical treatment, tape versus brace for support, rehabilitation, exercise, and prevention of ankle sprains are discussed by a panel of experts. An acute ankle taping technique is illustrated. (MT)

  3. Relationship Between Neck Strength, Anthropometric Parameters, and Gender with Head Motion under Impact Acceleration

    National Research Council Canada - National Science Library

    Morris, Charles

    1996-01-01

    .... Since women tend to have less upper-body strength than men, it was hypothesized that they may not be able to brace their heads as effectively against the loads which occur during impact and escape...

  4. 16 (No.1)

    African Journals Online (AJOL)

    mwakagugu

    2010-05-24

    May 24, 2010 ... The relevant pre-operative information recorded for each patient included diagnosis ... orthodontic treatment (braces), teeth in the fracture line, fractured teeth ... roots; the use of sterile surgical gloves had no better advantage ...

  5. DC motor proportional control system for orthotic devices

    Science.gov (United States)

    Blaise, H. T.; Allen, J. R.

    1972-01-01

    Multi-channel proportional control system for operation of dc motors for use with externally-powered orthotic arm braces is described. Components of circuitry and principles of operation are described. Schematic diagram of control circuit is provided.

  6. Iron fortification of foods

    National Research Council Canada - National Science Library

    Wiemer, Kathryn L; Clydesdale, F. M

    1985-01-01

    ... Massachusetts General Milk, Minneapolis, Inc. Minnesota Nutrition Kathryn L. Wiemer With t h e s u p p o r t of T H E NUTRITION FOUNDATION 1985 ACADEMIC PRESS, I N C . (Harcourt Brace Jovanovich...

  7. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... Foreign bodies near and especially lodged in the eyes are particularly important. Tooth fillings and braces usually ... to the contrast material and experience hives, itchy eyes or other reactions. If your child experiences allergic ...

  8. Assessment of Bearing Capacity and Stiffness in New Steel Sets Used for Roadway Support in Coal Mines

    Directory of Open Access Journals (Sweden)

    Renshu Yang

    2017-10-01

    Full Text Available There is high demand for roadway support in coal mines for the swelling soft rocks. As high strength steel sets can be taken as an effective alternative to control large deformation in this type of rocks, based on an original set, three new sets, including a floor beam set, a roof and floor beams set, and a roof and floor beams and braces set, are proposed in this research. In order to examine the strengths of new sets, four scaled sets of one original set, and three new sets, have been manufactured and tested in loading experiments. Results indicated that three new sets all exhibited higher strength than the original set. In experiments, the roof beam in set plays a significant effect on top arch strengthening, while the floor beam plays significant effect on bottom arch strengthening. The maximum bearing capacity and stiffness of the top arch with roof beam are increased to 1.63 times and 3.06 times of those in the original set, and the maximum bearing capacity and stiffness of the bottom arch with floor beam are increased to 1.44 times and 3.55 times of those in original set. Based on the roof and floor beams, two more braces in the bottom arch also play a significant effect in bottom corners strengthening, but extra braces play little role in top arch strengthening. These new sets provide more choices for roadway support in swelling soft rocks.

  9. Evaluation of shoulder and elbow functions after treatment of humeral shaft fractures: a 20-132-month follow-up study.

    Science.gov (United States)

    Fırat, Ahmet; Deveci, Alper; Güler, Ferhat; Oçgüder, Ali; Oğuz, Temel; Bozkurt, Murat

    2012-01-01

    The aim of this study was to evaluate the long-term results of shoulder and elbow functions in humeral shaft fractures treated with functional brace, plate and screw osteosynthesis or intramedullary nailing. The study included 128 patients treated for humeral shaft fracture. The patients were divided into three groups according to treatment method: Group 1 (n=62) received functional brace, Group 2 (n=36) plate and screw osteosynthesis and Group 3 (n=30) intramedullary nailing. Coronal and sagittal humeral angulations were measured radiologically during the final follow-up. Shoulder and elbow functions were evaluated using the Constant shoulder score, the Mayo Elbow Performance Scoring and range of movement measurements. The mean follow-up time was 74 (range: 20 to 132) months. Mean Constant shoulder scores were 92.4 in Group 1, 85.6 in Group 2 and 74 in Group 3. A statistically significant difference was detected between the Constant shoulder scores of Groups 2 and 3 (p0.05). In the statistical evaluation of the Constant shoulder scores, a statistically significant difference was detected between the Constant scores of patients with a varus angulation greater than 20° and those with neutral alignment. Functional results of humeral shaft fractures treated with functional brace appear to be satisfactory. Varus and antecurvatum may affect shoulder and elbow function. In the presence of surgical indications, plate and screw fixation technique is the most effective method in terms of shoulder and elbow functions.

  10. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... an MRI scan, but this is rare. Tooth fillings and braces usually are not affected by the magnetic field, but they may distort images of the facial area or brain, so you should let the ...

  11. Arthrography

    Medline Plus

    Full Text Available ... an MRI scan, but this is rare. Tooth fillings and braces usually are not affected by the magnetic field, but they may distort images of the facial area or brain, so you should let the ...

  12. MRI of the Chest

    Medline Plus

    Full Text Available ... an MRI scan, but this is rare. Tooth fillings and braces usually are not affected by the magnetic field, but they may distort images of the facial area or brain, so you should let the ...

  13. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... lodged in the eyes are particularly important. Tooth fillings and braces usually are not affected by the magnetic field, but they may distort images of the facial area or brain, so the radiologist should be ...

  14. Cosmetic Dentistry

    Science.gov (United States)

    If you have stained, broken or uneven teeth, cosmetic dentistry can help. Cosmetic dentistry is different from orthodontic treatment, which can straighten your teeth with braces or other devices. Cosmetic dental procedures include Bleaching to make teeth whiter ...

  15. Bracing up for a global nuclear renaissance

    International Nuclear Information System (INIS)

    Autebert, Remy

    2008-01-01

    The nuclear new build market is dynamic: the nuclear renaissance is here. The challenge facing today the nuclear industry is to meet this strong demand: design and build new reactors..... and ensure an adequate fuel supply for the existing reactors and the new ones. AREVA is getting ready to meet those needs. To answer in the best possible way the call of several new customers, and to make the necessary investments AREVA has made the choice of complementing its own strength with new alliances. When it was created, AREVA has set a new model: an integrated group capable of supplying all parts of the nuclear cycle, from Uranium mining to reactor design construction and servicing, and then up to used fuel management and recycling. This merger of reactor activities and fuel cycle services has proved successful. Focused acquisitions have further strengthened our own capabilities. In addition, AREVA has set-up several alliances to further develop the nuclear market. In the United States, AREVA joined forces with the US utility Constellation to create Uni Star to promoting the EPR. Today, several US utilities are choosing the AREVA's US-EPR. They will benefit from the experience gained in licensing and building the EPR in Finland, in France and soon in China. And they will benefit of course from the unique features of the EPR: easier maintenance, shorter outage, enhanced safety. Willing to meet the growing demand of countries launching a new nuclear program, AREVA set up an alliance with MHI to design a mid-size reactor, ATEMEA 1. Such an alliance allows to speed-up time to market of this new product, which will offer the latest available technologies. In the fuel cycle, AREVA has also developed acquisitions and alliances. As an example, thanks to such an alliance, the new enrichment plant GB-2, could get access to the most efficient centrifugation process. In this fast growing global market, at AREVA we believe into the value of collaboration and partnership to best serve our customers

  16. Optimization Of Double-Layer Braced Barrel Vaults

    Directory of Open Access Journals (Sweden)

    Grzywiński Maksym

    2015-12-01

    Full Text Available The paper deals with discussion of discrete optimization problem in civil engineering structural space design. Minimization of mass should satisfy the limit state capacity and serviceability conditions. The cross-sectional areas of truss bars are taken as design variables. Optimization constraints concern stresses, displacements and stability, as well as technological and computational requirements.

  17. Deposition of gold nanoparticles on glass substrate by ultrasonic spray pyrolysis

    Energy Technology Data Exchange (ETDEWEB)

    Garza, Maria de la; Hernandez, Tomas [Laboratorio de Materiales I, Centro de Laboratorios Especializados, Facultad de Ciencias Quimicas, Universidad Autonoma de Nuevo Leon. Av. Universidad s/n Cd. Universitaria, C.P. 66451, San Nicolas de los Garza, Nuevo Leon (Mexico); Colas, Rafael [Programa Doctoral en Ingenieria de Materiales, Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon. Av. Universidad s/n Cd. Universitaria, C.P. 66451, San Nicolas de los Garza, Nuevo Leon (Mexico); Gomez, Idalia, E-mail: mgomez@fcq.uanl.mx [Laboratorio de Materiales I, Centro de Laboratorios Especializados, Facultad de Ciencias Quimicas, Universidad Autonoma de Nuevo Leon. Av. Universidad s/n Cd. Universitaria, C.P. 66451, San Nicolas de los Garza, Nuevo Leon (Mexico)

    2010-10-25

    Ultrasonic spray pyrolysis was used to deposit gold nanoparticles on a glass substrate using ZrO{sub 2} as a surrounding medium. The deposition was made using three flow rates of caring gas. The characterization was made by UV-Vis spectroscopy, X-ray diffraction, scanning electronic microscopy and atomic force microscopy. The UV-Vis spectra showed that the surface plasmon resonance peak, indicative of the presence of gold nanoparticles, was shown to shift towards the red spectrum as the flow rate increased; this shift can be associated to the change in size of the particles, which are assumed to grow on a {l_brace}1 1 1{r_brace} planes, as was detected by X-ray diffraction. Gold nanoparticles of spheroidal morphology with a relation of around 2:1 were detected by scanning electron microscopy, these observations were confirmed by atomic force microscopy.

  18. EBSD and FIB/TEM examination of shape memory effect deformation structures in U-14 at.% Nb

    Energy Technology Data Exchange (ETDEWEB)

    Clarke, A.J. [Materials Science and Technology Division, Mail Stop G770, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)], E-mail: aclarke@lanl.gov; Field, R.D.; McCabe, R.J.; Cady, C.M.; Hackenberg, R.E.; Thoma, D.J. [Materials Science and Technology Division, Mail Stop G770, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)

    2008-06-15

    Detailed examinations of shape memory effect (SME) deformation structures in martensite of U-14 at.% Nb were performed with electron backscatter diffraction (EBSD) and transmission electron microscopy (TEM). An accommodation strain analysis, which has been previously used to predict SME deformation structures and texture evolution in polycrystalline material, was also performed. Martensite variants and twin relationships observed with EBSD after compressive or tensile deformation were determined to be consistent with those expected from calculated accommodation strains. Focused ion beam (FIB) was used to select twinned regions identified with EBSD for more detailed TEM analysis to verify the presence of these specific twins. The observed SME twinning systems in the martensite agree with previous TEM observations and the predicted {l_brace}1-bar76{r_brace} twinning system was observed experimentally for the first time in U-14 at.% Nb using these complementary techniques.

  19. Bone Bruise of the Thoracic Spine Caused by Mild Physical Activity in Children

    Directory of Open Access Journals (Sweden)

    Kenji Yokoyama

    2017-01-01

    Full Text Available Vertebral bone bruise (VBB in children commonly occurs following a fall from a height, and more than one vertebral body may be affected. We encountered 6 children each with a single VBB caused by mild physical activity. All the children had tenderness on the corresponding spinous process with no neurologic findings. Magnetic resonance imaging (MRI showed typical findings of VBB in all cases. The children were treated conservatively with a soft thoracolumbar brace and instructed to rest with no physical activity for a month. At follow-up 1 month later, the back pain had diminished, and the signal changes seen on MRI had disappeared in all cases. We conclude that mild physical activity may be a cause of VBB in children and good clinical results can be achieved by using a soft thoracolumbar brace and rest.

  20. Synthesis of anisotropic gold nanoparticles using xylitol as a dual functional reductant and stabilizer

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Jinmiao; Yao, Chengli; Yuan, Xinsong; Chen, Chen; Qi, Chunxia; Xia, Yuehua; Dong, Lin [Department of Chemistry and Chemical Engineering, Hefei Normal University, Hefei (China)

    2010-08-15

    The morphology of gold nanoparticles was controlled with hydrogentetrachloroaurate (HAuCl{sub 4}) and xylitol through a hydrothermal process using xylitol as reducing agent and controlled reagent. The molar ratio of xylitol relative to HAuCl{sub 4}, reaction time and temperature played important roles in determining the geometric shape and size of the product. These nanoplates were single crystals with planar width of 80-500 nm. The formation of nanobelts and two-dimensional single-crystal nanosheets is explained by the preferential adsorption of xylitol molecules from the solution onto the {l_brace}111{r_brace} planes of Au nuclei. These nanosheets could be used, for example, in gas sensors, in the fabrication of nanodevices and substrate materials, in property studies, and also for inducing hypothermia in tumors. (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)