Tyrosine phosphorylation of 3BP2 is indispensable for the interaction with VAV3 in chicken DT40 cells

International Nuclear Information System (INIS)

Chihara, Kazuyasu; Kimura, Yukihiro; Honjoh, Chisato; Yamauchi, Shota; Takeuchi, Kenji; Sada, Kiyonao

2014-01-01

Adaptor protein c-Abl SH3 domain-binding protein-2 (3BP2) is known to play regulatory roles in immunoreceptor-mediated signal transduction. We have previously demonstrated that Tyr 174 , Tyr 183 and Tyr 446 in mouse 3BP2 are predominantly phosphorylated by Syk, and the phosphorylation of Tyr 183 and the Src homology 2 (SH2) domain of mouse 3BP2 are critical for B cell receptor (BCR)-induced activation of nuclear factor of activated T cells (NFAT) in human B cells. In this report, we have shown that Syk, but not Abl family protein-tyrosine kinases, is critical for BCR-mediated tyrosine phosphorylation of 3BP2 in chicken DT40 cells. Mutational analysis showed that Tyr 174 , Tyr 183 and Tyr 426 of chicken 3BP2 are the major phosphorylation sites by Syk and the SH2 domain of 3BP2 is critical for tyrosine phosphorylation. In addition, phosphorylation of Tyr 426 is required for the inducible interaction with the SH2 domain of Vav3. Moreover, the expression of the mutant form of 3BP2 in which Tyr 426 was substituted to Phe resulted in the reduction in BCR-mediated Rac1 activation, when compared with the case of wild-type. Altogether, these data suggest that 3BP2 is involved in the activation of Rac1 through the regulation of Vav3 by Syk-dependent phosphorylation of Tyr 426 following BCR stimulation. - Highlights: • 3BP2 is phosphorylated by Syk, but not Abl family kinases in BCR signaling. • Tyr183 and Tyr426 in chicken 3BP2 are the major phosphorylation sites by Syk. • The SH2 domain of 3BP2 is critical for tyrosine phosphorylation of 3BP2. • Phosphorylation of Tyr426 in 3BP2 is required for the inducible binding with Vav3. • 3BP2 is involved in the regulation of BCR-mediated Rac1 activation

The generation, validation and testing of a coupled 219-group neutron 36-group gamma ray AMPX-II library

International Nuclear Information System (INIS)

Panini, G.C.; Siciliano, F.; Lioi, A.

1987-01-01

The main characteristics of a P 3 coupled 219-group neutron 36-group gamma-ray library in the AMPX-II Master Interface Format obtained processing ENDF/B-IV data by means of various AMPX-II System modules are presented in this note both for the more reprocessing aspects and features of the generated component files-neutrons, photon and secondary gamma-ray production cross sections. As far as the neutron data are concerned there is the avaibility of 186 data sets regarding most significant fission products. Results of the additional validation of the neutron data pertaining to eighteen benchmark experiments are also given. Some calculational tests on both neutron and coupled data emphasize the important role of the secondary gamma-ray data in nuclear criticality safety calculations

RanBP3 influences interactions between CRM1 and its nuclear protein export substrates

OpenAIRE

Englmeier, Ludwig; Fornerod, Maarten; Bischoff, F. Ralf; Petosa, Carlo; Mattaj, Iain W.; Kutay, Ulrike

2001-01-01

We investigated the role of RanBP3, a nuclear member of the Ran-binding protein 1 family, in CRM1-mediated protein export in higher eukaryotes. RanBP3 interacts directly with CRM1 and also forms a trimeric complex with CRM1 and RanGTP. However, RanBP3 does not bind to CRM1 like an export substrate. Instead, it can stabilize CRM1–export substrate interaction. Nuclear RanBP3 stimulates CRM1-dependent protein export in permeabilized cells. These data indicate that RanBP3 functions by a novel mec...

G3BP1, G3BP2 and CAPRIN1 are required for translation of interferon stimulated mRNAs and are targeted by a dengue virus non-coding RNA.

Science.gov (United States)

Bidet, Katell; Dadlani, Dhivya; Garcia-Blanco, Mariano A

2014-07-01

Viral RNA-host protein interactions are critical for replication of flaviviruses, a genus of positive-strand RNA viruses comprising major vector-borne human pathogens including dengue viruses (DENV). We examined three conserved host RNA-binding proteins (RBPs) G3BP1, G3BP2 and CAPRIN1 in dengue virus (DENV-2) infection and found them to be novel regulators of the interferon (IFN) response against DENV-2. The three RBPs were required for the accumulation of the protein products of several interferon stimulated genes (ISGs), and for efficient translation of PKR and IFITM2 mRNAs. This identifies G3BP1, G3BP2 and CAPRIN1 as novel regulators of the antiviral state. Their antiviral activity was antagonized by the abundant DENV-2 non-coding subgenomic flaviviral RNA (sfRNA), which bound to G3BP1, G3BP2 and CAPRIN1, inhibited their activity and lead to profound inhibition of ISG mRNA translation. This work describes a new and unexpected level of regulation for interferon stimulated gene expression and presents the first mechanism of action for an sfRNA as a molecular sponge of anti-viral effectors in human cells.

Multi-group neutron transport theory

International Nuclear Information System (INIS)

Zelazny, R.; Kuszell, A.

1962-01-01

Multi-group neutron transport theory. In the paper the general theory of the application of the K. M. Case method to N-group neutron transport theory in plane geometry is given. The eigenfunctions (distributions) for the system of Boltzmann equations have been derived and the completeness theorem has been proved. By means of general solution two examples important for reactor and shielding calculations are given: the solution of a critical and albedo problem for a slab. In both cases the system of singular integral equations for expansion coefficients into a full set of eigenfunction distributions has been reduced to the system of Fredholm-type integral equations. Some results can be applied also to some spherical problems. (author) [fr

G3BP1, G3BP2 and CAPRIN1 are required for translation of interferon stimulated mRNAs and are targeted by a dengue virus non-coding RNA.

Directory of Open Access Journals (Sweden)

Katell Bidet

2014-07-01

Full Text Available Viral RNA-host protein interactions are critical for replication of flaviviruses, a genus of positive-strand RNA viruses comprising major vector-borne human pathogens including dengue viruses (DENV. We examined three conserved host RNA-binding proteins (RBPs G3BP1, G3BP2 and CAPRIN1 in dengue virus (DENV-2 infection and found them to be novel regulators of the interferon (IFN response against DENV-2. The three RBPs were required for the accumulation of the protein products of several interferon stimulated genes (ISGs, and for efficient translation of PKR and IFITM2 mRNAs. This identifies G3BP1, G3BP2 and CAPRIN1 as novel regulators of the antiviral state. Their antiviral activity was antagonized by the abundant DENV-2 non-coding subgenomic flaviviral RNA (sfRNA, which bound to G3BP1, G3BP2 and CAPRIN1, inhibited their activity and lead to profound inhibition of ISG mRNA translation. This work describes a new and unexpected level of regulation for interferon stimulated gene expression and presents the first mechanism of action for an sfRNA as a molecular sponge of anti-viral effectors in human cells.

Neutron transmission study of the rotacional freedom of methyl groups in polydimethylsiloxane

International Nuclear Information System (INIS)

Amaral, L.Q.; Vinhas, L.A.; Herdade, S.B.

1973-01-01

The total neutron cross section of polydimethylsiloxane has been measured as a function of neutron wavelenght in the range of 4A to 10A, at room temperature, using a slow-neutron chopper and time-of-flight spectrometer. Scattering cross sections per hydrogen atom were obtained and the slope (12.2 +- 0.2) barns/A has been derived. Comparison with calculated neutron cross sections using the Krieger-Nelkin formalism for different dynamical situations as well as comparison with calibration curves relating the slope to the barrier hindering internal rotation indicates the existence of pratically free rotation of CH 3 groups about their C 3 axis

The TENDL neutron data library and the TEND1038 38-group neutron constant system

International Nuclear Information System (INIS)

Abramovich, S.N.; Gorelov, V.P.; Gorshikhin, A.A.; Grebennikov, A.N.; Il'in, V.N.; Krut'ko, N.A.; Farafontov, G.G.

2002-01-01

The library contains neutron data for 103 nuclei - i.e. for 38 actinide nuclei (from 232 Th to 249 Cm), 26 fission fragment nuclei and 39 nuclei in structural and technological materials. The 38-group constants were obtained from TENDL. The high-energy group boundary is 20 MeV. The energy range below 1.2 eV contains 11 groups. Temperature and resonance effects were taken into account. The delayed neutron parameters for 6 groups and the yields of 40 fission fragments were obtained (light and heavy, stable and non-stable). The fast neutron features of spherical critical assemblies were calculated using constants from TEND1038. (author)

Sample descriptions and geophysical logs for cored well BP-3-USGS, Great Sand Dunes National Park and Preserve, Alamosa County, Colorado

Science.gov (United States)

Grauch, V.J.S.; Skipp, Gary L.; Thomas, Jonathan V.; Davis, Joshua K.; Benson, Mary Ellen

2015-01-01

The BP-3-USGS well was drilled at the southwestern corner of Great Sand Dunes National Park in the San Luis Valley, south-central Colorado, 68 feet (ft, 20.7 meters [m]) southwest of the National Park Service’s boundary-piezometer (BP) well 3. BP-3-USGS is located at latitude 37°43ʹ18.06ʺN. and longitude 105°43ʹ39.30ʺW., at an elevation of 7,549 ft (2,301 m). The well was drilled through poorly consolidated sediments to a depth of 326 ft (99.4 m) in September 2009. Water began flowing from the well after penetrating a clay-rich layer that was first intercepted at a depth of 119 ft (36.3 m). The base of this layer, at an elevation of 7,415 ft (2,260 m) above sea level, likely marks the top of a regional confined aquifer recognized throughout much of the San Luis Valley. Approximately 69 ft (21 m) of core was recovered (about 21 percent), almost exclusively from clay-rich zones. Coarser grained fractions were collected from mud extruded from the core barrel or captured from upwelling drilling fluids. Natural gamma-ray, full waveform sonic, density, neutron, resistivity, spontaneous potential, and induction logs were acquired. The well is now plugged and abandoned.

A general formula considering one group delayed neutron under nonequilibrium condition

International Nuclear Information System (INIS)

Li Haofeng; Chen Wenzhen; Zhu Qian; Luo Lei

2008-01-01

A general neutron breeder formula is developed when the reactor does not reach the steady state and the reactivity changes in phase. This formula can be used to calculate the results of six groups delayed neutron model through a way of amending λ in one group delayed neutron model. The analysis shows that the solution of amended single group delayed neutron model is approximately equal to that of six-group delayed neutron model, and the amended model meets the engineering accuracy. (authors)

Rasputin, more promiscuous than ever: a review of G3BP.

Science.gov (United States)

Irvine, Katharine; Stirling, Renee; Hume, David; Kennedy, Derek

2004-12-01

In this review, we highlight what G3BP's domain structure initially suggested; that G3BPs are "scaffolding" proteins linking signal transduction to RNA metabolism. Whilst it is most attractive to hypothesise about G3BP's role in signalling to mRNA metabolism, it is not known whether all G3BP functions impinge on their RNA-binding activities, so any theories are naturally subject to this qualification. It is hypothesised that, in coordination with an array of other proteins, G3BP, in a phosphorylation-dependent manner, is involved in the post-transcriptional regulation of a subset of mRNAs, at least some of which are in common with those regulated by Hu proteins. These transcripts, partially controlled at the post-transcriptional level by G3BPs, code for proteins important in transcription (e.g. c-Myc) and cytoskeletal arrangement (e.g. Tau), amongst other as yet undetermined pathways. The subtle differences between G3BP family members could dictate binding to a variety of signalling proteins, so each of the G3BPs may participate in different, though possibly related mRNPs, which are assembled in response to different stimuli. The combinatorial nature of the mRNP complex offers a powerful means of regulating gene expression, beyond that provided by a simple mRNA sequence. The ways in which mRNP flexibility and specificity may be harnessed to coordinate gene expression of functionally or structurally related mRNAs are not yet fully appreciated. Characterising mRNP composition and the function/s of mRNP components, such as the G3BPs, will aid in the understanding of how post-transcriptional mechanisms contribute to the global regulation of gene expression.

RADHEAT-V3, a code system for generating coupled neutron and gamma-ray group constants and analyzing radiation transport

International Nuclear Information System (INIS)

Koyama, Kinji; Taji, Yukichi; Miyasaka, Shun-ichi; Minami, Kazuyoshi.

1977-07-01

The modular code system RADHEAT is for producing coupled multigroup neutron and gamma-ray cross section sets, analyzing the neutron and gamma-ray transport, and calculating the energy deposition and atomic displacements due to these radiations in a nuclear reactor or shield. The basic neutron cross sections and secondary gamma-ray production data are taken from ENDF/B and POPOP4 libraries respectively. The system (1) generates multigroup neutron cross sections, energy deposition coefficients and atomic displacement factors due to neutron reactions, (2) generates multigroup gamma-ray cross sections and energy transfer coefficients, (3) generates secondary gamma-ray production cross sections, (4) combines these cross sections into the coupled set, (5) outputs and updates the multigroup cross section libraries in convenient formats for other transport codes, (6) analyzes the neutron and gamma-ray transport and calculates the energy deposition and the number density of atomic displacements in a medium, (7) collapses the cross sections to a broad-group structure, by option, using the weighting functions obtained by one-dimensional transport calculation, and (8) plots, by option, multigroup cross sections, and neutron and gamma-ray distributions. Definitions of the input data required in various options of the code system are also given. (auth.)

Tyrosine phosphorylation of 3BP2 is indispensable for the interaction with VAV3 in chicken DT40 cells.

Science.gov (United States)

Chihara, Kazuyasu; Kimura, Yukihiro; Honjoh, Chisato; Yamauchi, Shota; Takeuchi, Kenji; Sada, Kiyonao

2014-03-10

Adaptor protein c-Abl SH3 domain-binding protein-2 (3BP2) is known to play regulatory roles in immunoreceptor-mediated signal transduction. We have previously demonstrated that Tyr(174), Tyr(183) and Tyr(446) in mouse 3BP2 are predominantly phosphorylated by Syk, and the phosphorylation of Tyr(183) and the Src homology 2 (SH2) domain of mouse 3BP2 are critical for B cell receptor (BCR)-induced activation of nuclear factor of activated T cells (NFAT) in human B cells. In this report, we have shown that Syk, but not Abl family protein-tyrosine kinases, is critical for BCR-mediated tyrosine phosphorylation of 3BP2 in chicken DT40 cells. Mutational analysis showed that Tyr(174), Tyr(183) and Tyr(426) of chicken 3BP2 are the major phosphorylation sites by Syk and the SH2 domain of 3BP2 is critical for tyrosine phosphorylation. In addition, phosphorylation of Tyr(426) is required for the inducible interaction with the SH2 domain of Vav3. Moreover, the expression of the mutant form of 3BP2 in which Tyr(426) was substituted to Phe resulted in the reduction in BCR-mediated Rac1 activation, when compared with the case of wild-type. Altogether, these data suggest that 3BP2 is involved in the activation of Rac1 through the regulation of Vav3 by Syk-dependent phosphorylation of Tyr(426) following BCR stimulation. Copyright © 2014 Elsevier Inc. All rights reserved.

Use of one delayed-neutron precursor group in transient analysis

International Nuclear Information System (INIS)

Diamond, D.J.

1983-01-01

In most reactor dynamics calculations six groups of delayed-neutron precursors are usually accounted for. However, under certain circumstances it may be advantageous to simplify the calculation and utilize a single delayed-neutron group. The motivation for going to one precursor group is economy. For LWR transient codes that use point kinetics the equations are solved very rapidly and six precursor groups should always be used. However, codes with spatially dependent neutron kinetics are very long running and the use of one precursor group may save computer costs and not impair the accuracy of the results significantly. Furthermore, in some codes, the elimation of five presursor groups makes additional memory available which may be used to give a net increase in the accuracy of the calculations, e.g., by allowing for an increase in mesh density. In order to use one delayed neutron precursor group it is necessary to derive a single decay constant, 6 lambda-, which, along with the total (or one group) delayed neutron fraction β = Σ/sub i = 1/β/sub i/, will adequately describe the transeint precursor behavior. The present summary explains how a recommendation for lambda- was derived

8-group relative delayed neutron yields for monoenergetic neutron induced fission of 239Pu

International Nuclear Information System (INIS)

Piksaikin, V.M.; Kazakov, L.E.; Isaev, S.G.; Korolev, G.G.; Roshchenko, V.A.; Tertychnyj, R.G

2002-01-01

The energy dependence of the relative yield of delayed neutrons in an 8-group model representation was obtained for monoenergetic neutron induced fission of 239 Pu. A comparison of this data with the available experimental data by other authors was made in terms of the mean half-life of the delayed neutron precursors. (author)

Thermal neutron group constants in monoatomic-gas approximation

Energy Technology Data Exchange (ETDEWEB)

Matausek, M V; Bosevski, T [Institute of nuclear sciences Boris Kidric, Vinca, Beograd (Yugoslavia)

1965-12-15

To solve the problem of space-energy neutron distribution in an elementary reactor cell, a combination of the multigroup procedure and the P{sub 3} approximation of the spherical harmonics method was chosen. The calculation was divided into two independent parts: the first part was to provide multigroup constants which serve as input data for the second part - the determination of the slow neutron spectra. In the present report only the first part of the problem will be discussed. The velocity dependence of cross-sections and scattering function in thermal range was interpreted by the monoatomic-gas model. A digital computer program was developed for the evaluation of the group values for these quantities (author00.

Development of SiC Neutron Detector Assembly to Measure the Neutron Flux of the Reactor Core

Energy Technology Data Exchange (ETDEWEB)

Park, Se Hwan; Park, June Sic; Shin, Hee Sung; Kim, Ho Dong [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kim, Yong Kyun [Hanyang University, Seoul (Korea, Republic of)

2012-05-15

At present, the conventional detector to measure the neutron at harsh environment is a Self Powered Neutron Detector (SPND). Rhodium(Rh)-103 is in the SPND. When neutron is incident on the Rhodium, the neutron capture reaction occurs, and the Rh-103 is converted to Rh-104. The Rh-104 is decayed to Pd-104 by {beta}-decay, and electrons are generated as the decay products. Because of the half life of Rh-104, approximately 5 minutes are required for the SPND output to reach the equilibrium condition. Therefore the on-line monitoring of the nuclear reactor state is limited if the neutron flux in the reactor core is monitored with the SPND. Silicon carbide (SiC) has the possibility to be developed as neutron detector at harsh environment, because the SiC can be operative at high temperature and high neutron flux conditions. Previously, the basic operation properties of the SiC detector were studied. Also, the radiation response of the SiC detector was studied at high neutron and gamma dose rate. The measurement results for an ex-core neutron flux monitor or a neutron flux monitor of the spent fuel were published. The SiC detector was also developed as neutron detector to measure the fissile material with active interrogation method. However, the studies about the development of SiC detector are still limited. In the present work, the radiation damage effect of the SiC detector was studied. The detector structure was determined based on the study, and a neutron detector assembly was made with the SiC detectors. The neutron and gamma-ray response of the detector assembly is presented in this paper. The detector assembly was positioned in the HANARO research reactor core, the performance test was done. The preliminary results are also included in this paper

Comparison of pressure vessel neutron fluences for the Balakovo-3 reactor with measurements and investigation of the influence of neutron cross sections and number of groups on the results

Energy Technology Data Exchange (ETDEWEB)

Barz, H U; Boehmer, B; Konheiser, J; Stephan, I

1998-10-01

The general methodical questions of experimental and theoretical determination of neutron fluences have been described in connection with the measurements and 3-D Monte Carlo calculation for the Rovno-3 reactor. The same calculation and measurement methods were applied for the Balakovo-3 reactor. In the first part, the results of the comparison for Balakovo will be given and discussed. However, for this reactor the main attention was focussed on investigations of the accuracy of the calculation. In this connection an important question is the influence of neutron data on the results. With this respect not only the source of the data but also the number of energy groups is important. (orig.)

Antibody response in vaccinated pregnant mares to recent G3BP[12] and G14P[12] equine rotaviruses

Directory of Open Access Journals (Sweden)

Nemoto Manabu

2012-11-01

Full Text Available Abstract Background Both the G3P[12] and the G14P[12] type of equine group A rotavirus (RVA have recently become predominant in many countries, including Japan. G3 types are classified further into G3A and G3B. The G3A viruses have been circulating in Europe, Australia, and Argentina, and the G3B viruses have been circulating in Japan. However, only an inactivated vaccine containing a single G3BP[12] strain is commercially available in Japan. To assess the efficacy of the current vaccine against recently circulating equine RVA strains, we examined antibody responses in pregnant mares to recent G3BP[12] and G14P[12] strains by virus neutralization test. Findings After vaccination in five pregnant mares, the geometric mean serum titers of virus-neutralizing antibody to recent G3BP[12] strains increased 5.3- to 7.0-fold and were similar to that against homologous vaccine strain. Moreover, antibody titers to recent G14P[12] strains were also increased 3.0- to 3.5-fold. Conclusions These results suggest that inoculation of mares with the current vaccine should provide foals with virus-neutralizing antibodies against not only the G3BP[12] but also the G14P[12] RVA strain via the colostrum.

Real time neutron flux monitoring using Rh self powered neutron detector

Energy Technology Data Exchange (ETDEWEB)

Juna, Byung Jin; Lee, Byung Chul; Park, Sang Jun; Jung, Hoan Sung [KAERI, Daejeon (Korea, Republic of)

2012-10-15

Rhodium (Rh) self powered neutron detectors (SPNDs) are widely used for on line monitoring of local neutron flux. Its signal is slower than the actual variation of neutron flux owing to a delayed {beta} decay of the Rh activation product, but real time monitoring is possible by solving equations between the neutron reaction rate in the detector and its signal. While the measuring system is highly reliable, the accuracy depends on the method solving the equations and accuracy of the parameters in the equations. The uncertain parameters are the contribution of gamma rays to the signal, and the branching ratios of Rh 104 and Rh 104m after the neutron absorption of Rh 103. Real time neutron flux monitoring using Rh SPNDs has been quite successful for neutron transmutation doping (NTD) at HANARO. We revisited the initial data used for the verification of a real time monitoring system, to refine algorithm for a better solution and to check the parameters for correctness. As a result, we suggest an effective way to determine the prompt parameter.

Real time neutron flux monitoring using Rh self powered neutron detector

International Nuclear Information System (INIS)

Juna, Byung Jin; Lee, Byung Chul; Park, Sang Jun; Jung, Hoan Sung

2012-01-01

Rhodium (Rh) self powered neutron detectors (SPNDs) are widely used for on line monitoring of local neutron flux. Its signal is slower than the actual variation of neutron flux owing to a delayed β decay of the Rh activation product, but real time monitoring is possible by solving equations between the neutron reaction rate in the detector and its signal. While the measuring system is highly reliable, the accuracy depends on the method solving the equations and accuracy of the parameters in the equations. The uncertain parameters are the contribution of gamma rays to the signal, and the branching ratios of Rh 104 and Rh 104m after the neutron absorption of Rh 103. Real time neutron flux monitoring using Rh SPNDs has been quite successful for neutron transmutation doping (NTD) at HANARO. We revisited the initial data used for the verification of a real time monitoring system, to refine algorithm for a better solution and to check the parameters for correctness. As a result, we suggest an effective way to determine the prompt parameter

Microdeletion/microduplication of proximal 15q11.2 between BP1 and BP2: a susceptibility region for neurological dysfunction including developmental and language delay.

Science.gov (United States)

Burnside, Rachel D; Pasion, Romela; Mikhail, Fady M; Carroll, Andrew J; Robin, Nathaniel H; Youngs, Erin L; Gadi, Inder K; Keitges, Elizabeth; Jaswaney, Vikram L; Papenhausen, Peter R; Potluri, Venkateswara R; Risheg, Hiba; Rush, Brooke; Smith, Janice L; Schwartz, Stuart; Tepperberg, James H; Butler, Merlin G

2011-10-01

The proximal long arm of chromosome 15 has segmental duplications located at breakpoints BP1-BP5 that mediate the generation of NAHR-related microdeletions and microduplications. The classical Prader-Willi/Angelman syndrome deletion is flanked by either of the proximal BP1 or BP2 breakpoints and the distal BP3 breakpoint. The larger Type I deletions are flanked by BP1 and BP3 in both Prader-Willi and Angelman syndrome subjects. Those with this deletion are reported to have a more severe phenotype than individuals with either Type II deletions (BP2-BP3) or uniparental disomy 15. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes that are not imprinted. Reports of mutations or disturbed expression of these genes appear to impact behavioral and neurological function in affected individuals. Recently, reports of deletions and duplications flanked by BP1 and BP2 suggest an association with speech and motor delays, behavioral problems, seizures, and autism. We present a large cohort of subjects with copy number alteration of BP1 to BP2 with common phenotypic features. These include autism, developmental delay, motor and language delays, and behavioral problems, which were present in both cytogenetic groups. Parental studies demonstrated phenotypically normal carriers in several instances, and mildly affected carriers in others, complicating phenotypic association and/or causality. Possible explanations for these results include reduced penetrance, altered gene dosage on a particular genetic background, or a susceptibility region as reported for other areas of the genome implicated in autism and behavior disturbances.

48 CFR 3.104-1 - Definitions.

Science.gov (United States)

2010-10-01

... BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Safeguards 3.104-1 Definitions. As used in this... delivery order, task order, or an order under a Basic Ordering Agreement; (5) The amount paid or to be paid... procedures of OMB Circular A-76, participation in management studies, preparation of in-house cost estimates...

An accurate solution of point reactor neutron kinetics equations of multi-group of delayed neutrons

International Nuclear Information System (INIS)

Yamoah, S.; Akaho, E.H.K.; Nyarko, B.J.B.

2013-01-01

Highlights: ► Analytical solution is proposed to solve the point reactor kinetics equations (PRKE). ► The method is based on formulating a coefficient matrix of the PRKE. ► The method was applied to solve the PRKE for six groups of delayed neutrons. ► Results shows good agreement with other traditional methods in literature. ► The method is accurate and efficient for solving the point reactor kinetics equations. - Abstract: The understanding of the time-dependent behaviour of the neutron population in a nuclear reactor in response to either a planned or unplanned change in the reactor conditions is of great importance to the safe and reliable operation of the reactor. In this study, an accurate analytical solution of point reactor kinetics equations with multi-group of delayed neutrons for specified reactivity changes is proposed to calculate the change in neutron density. The method is based on formulating a coefficient matrix of the homogenous differential equations of the point reactor kinetics equations and calculating the eigenvalues and the corresponding eigenvectors of the coefficient matrix. A small time interval is chosen within which reactivity relatively stays constant. The analytical method was applied to solve the point reactor kinetics equations with six-groups delayed neutrons for a representative thermal reactor. The problems of step, ramp and temperature feedback reactivities are computed and the results compared with other traditional methods. The comparison shows that the method presented in this study is accurate and efficient for solving the point reactor kinetics equations of multi-group of delayed neutrons

Neutron radiography working group test programme

International Nuclear Information System (INIS)

Domanus, J.C.

1989-03-01

Scope and results of the Euratom Neutron Radiography Working Group Test Program are described. Seven NR centers from six European Community countries have performed this investigation using eleven NR facilities. Four test items were neutron radiographed using 30 different film/converter combinations. From film density measurements neutron beam components were determined. Radiographic sensitivity was assessed from visual examinations of the radiographs. About 25,000 dimensional measurements were made and were used for the assessment of accuracies of dimensional measurements from neutron radiographs. The report gives a description of the test items used for the Test Program, the film density and dimensional measurements, and concentrates on the assessment of the measuring results. The usefulness of the beam purity and sensitivity indicators was assessed with the conclusion that they are not suitable for neutron radiography of nuclear reactor fuel. Ample information is included in the report about measuring accuracies which can be reached in dimensional measurements of fuel pins. After a general comparison of measuring accuracies is discussed. Results from different NR facilities are treated separately as are the different kinds of dimensions of the fuel pins. Finally human and instrument factors are discussed. After presenting final conclusions (which take into account the above-mentioned factors) results of other investigations about dimensional measurements are shortly reviewed

JRR-3 neutron radiography facility

International Nuclear Information System (INIS)

Matsubayashi, M.; Tsuruno, A.

1992-01-01

JRR-3 neutron radiography facility consists of thermal neutron radiography facility (TNRF) and cold neutron radiography facility (CNRF). TNRF is installed in JRR-3 reactor building. CNRF is installed in the experimental beam hall adjacent to the reactor building. (author)

Activity of the Delayed Neutron Working Group of JNDC and the International Evaluation Cooperation - WPEC/SG6

International Nuclear Information System (INIS)

Yoshida, Tadashi

1999-01-01

The Delayed Neutron Working Group was established in April 1997 within the Nuclear Data Subcommittee of JNDC. It has two principal missions. One is to coordinate the Japanese activities toward the WPEC/Subgroup-6 efforts, and the other is to recommend the delayed neutron data for JENDL-3.3. The final report of Subgroup-6, which in one of the subgroups of the NEA International Evaluation Cooperation (WPEC) and is in charge of the delayed neutron data, is to be completed in 1999. Here in Japan, JENDL-3.3 is planned to be released in early 2000. Delayed Neutron Working Group is, then, going to finalize its activity by the end of the fiscal year 1999 after recommending appropriate sets of data as coherently as possible with the of Subgroup-6 efforts. (author)

ZZ CAD, 51 Neutron-Group, 25 Gamma-Group Albedo Data for 4 Materials from DOT Flux

International Nuclear Information System (INIS)

1992-01-01

A - Description of problem or function: Format: BREESE tape-writing program, MORSE; Number of groups: 51 neutron, 25 gamma-ray group albedo data. Nuclides: 1) 12 inches of water. 2) 12 inches of ordinary concrete. 3) 9 inches of carbon steel (SA508). 4) 1/2 inches of steel over 12 inches of concrete. (O, Ca, Al, C, Si, H, K, Mg, Fe, Na, Mn); Origin: DOT angular flux tape. CAD is a set of 51 neutron, 25 gamma-ray group albedo data for the following four materials: 1) 12 inches of water. 2) 12 inches of ordinary concrete. 3) 9 inches of carbon steel (SA508). 4) 1/2 inches of steel over 12 inches of concrete. The differential angular albedos are a function of the five incident polar directions and 30 reflected directions. B - Method of solution: The data has been generated from a DOT angular flux tape using the code CARP (abstract PSR-0131). C - Restrictions on the complexity of the problem: Since the amount of data is so large, it is necessary to run CARP, using the group reduction option, in order to run a problem on most computers

DWARF, 1-D Few-Group Neutron Diffusion with Thermal Feedback for Burnup and Xe Oscillation

International Nuclear Information System (INIS)

Anderson, E.C.; Putnam, G.E.

1975-01-01

1 - Description of problem or function: DWARF allows one-dimensional simulation of reactor burnup and xenon oscillation problems in slab, cylindrical, or spherical geometry using a few-group diffusion theory model. 2 - Method of solution: The few-group, neutron diffusion theory equations are reduced to a system of finite-difference equations that are solved for each group by the Gauss method at each time point. Fission neutron source iteration can be accelerated with Chebyshev extrapolation. A thermal feedback iterative loop is used to obtain consistent solutions for the distributions of reactor power, neutron flux, and fuel and coolant properties with the neutron group constants functions of the latter. Solutions for the new nuclide concentrations of a time-point are made with the flux assumed constant in the time interval. 3 - Restrictions on the complexity of the problem - Maxima of: 4 groups; 40 regions; 50 macroscopic materials (Only 10 are functions of the feedback variables); 50 nuclides per region; 250 mesh points

Association of 3BP2 with SHP-1 regulates SHP-1-mediated production of TNF-α in RBL-2H3 cells.

Science.gov (United States)

Chihara, Kazuyasu; Nakashima, Kenji; Takeuchi, Kenji; Sada, Kiyonao

2011-12-01

Adaptor protein 3BP2, a c-Abl Src homology 3 (SH3) domain-binding protein, is tyrosine phosphorylated and positively regulates mast cell signal transduction after the aggregation of the high affinity IgE receptor (FcεRI). Overexpression of the Src homology 2 (SH2) domain of 3BP2 results in the dramatic suppression of antigen-induced degranulation in rat basophilic leukemia RBL-2H3 cells. Previously, a linker for activation of T cells (LAT) was identified as one of the 3BP2 SH2 domain-binding protein. In this report, to further understand the functions of 3BP2 in FcεRI-mediated activation of mast cell, we explored the protein that associates with the SH2 domain of 3BP2 and found that SH2 domain-containing phosphatase-1 (SHP-1) inducibly interacts with the SH2 domain of 3BP2 after the aggregation of FcεRI. The phosphorylation of Tyr(564) in the carboxy (C)-terminal tail region of SHP-1 is required for the direct interaction of SHP-1 to the SH2 domain of 3BP2. The expression of the mutant form of SHP-1 which was unable to interact with 3BP2 resulted in the significant reduction in SHP-1-mediated tumor necrosis factor-α (TNF-α) production without any effects on the degranulation in antigen-stimulated RBL-2H3 cells. These findings suggest that 3BP2 directly interacts with Tyr(564) -phosphorylated form of SHP-1 and positively regulates the function of SHP-1 in FcεRI-mediated signaling in mast cells. © 2011 The Authors. Journal compilation © 2011 by the Molecular Biology Society of Japan/Blackwell Publishing Ltd.

Multi-group transport methods for high-resolution neutron activation analysis

International Nuclear Information System (INIS)

Burns, K. A.; Smith, L. E.; Gesh, C. J.; Shaver, M. W.

2009-01-01

The accurate and efficient simulation of coupled neutron-photon problems is necessary for several important radiation detection applications. Examples include the detection of nuclear threats concealed in cargo containers and prompt gamma neutron activation analysis for nondestructive determination of elemental composition of unknown samples. In these applications, high-resolution gamma-ray spectrometers are used to preserve as much information as possible about the emitted photon flux, which consists of both continuum and characteristic gamma rays with discrete energies. Monte Carlo transport is the most commonly used modeling tool for this type of problem, but computational times for many problems can be prohibitive. This work explores the use of multi-group deterministic methods for the simulation of neutron activation problems. Central to this work is the development of a method for generating multi-group neutron-photon cross-sections in a way that separates the discrete and continuum photon emissions so that the key signatures in neutron activation analysis (i.e., the characteristic line energies) are preserved. The mechanics of the cross-section preparation method are described and contrasted with standard neutron-gamma cross-section sets. These custom cross-sections are then applied to several benchmark problems. Multi-group results for neutron and photon flux are compared to MCNP results. Finally, calculated responses of high-resolution spectrometers are compared. Preliminary findings show promising results when compared to MCNP. A detailed discussion of the potential benefits and shortcomings of the multi-group-based approach, in terms of accuracy, and computational efficiency, is provided. (authors)

ALS mutant SOD1 interacts with G3BP1 and affects stress granule dynamics.

Science.gov (United States)

Gal, Jozsef; Kuang, Lisha; Barnett, Kelly R; Zhu, Brian Z; Shissler, Susannah C; Korotkov, Konstantin V; Hayward, Lawrence J; Kasarskis, Edward J; Zhu, Haining

2016-10-01

Amyotrophic lateral sclerosis (ALS) is a fatal neurodegenerative disease. Mutations in Cu/Zn superoxide dismutase (SOD1) are responsible for approximately 20 % of the familial ALS cases. ALS-causing SOD1 mutants display a gain-of-toxicity phenotype, but the nature of this toxicity is still not fully understood. The Ras GTPase-activating protein-binding protein G3BP1 plays a critical role in stress granule dynamics. Alterations in the dynamics of stress granules have been reported in several other forms of ALS unrelated to SOD1. To our surprise, the mutant G93A SOD1 transgenic mice exhibited pathological cytoplasmic inclusions that co-localized with G3BP1-positive granules in spinal cord motor neurons. The co-localization was also observed in fibroblast cells derived from familial ALS patient carrying SOD1 mutation L144F. Mutant SOD1, unlike wild-type SOD1, interacted with G3BP1 in an RNA-independent manner. Moreover, the interaction is specific for G3BP1 since mutant SOD1 showed little interaction with four other RNA-binding proteins implicated in ALS. The RNA-binding RRM domain of G3BP1 and two particular phenylalanine residues (F380 and F382) are critical for this interaction. Mutant SOD1 delayed the formation of G3BP1- and TIA1-positive stress granules in response to hyperosmolar shock and arsenite treatment in N2A cells. In summary, the aberrant mutant SOD1-G3BP1 interaction affects stress granule dynamics, suggesting a potential link between pathogenic SOD1 mutations and RNA metabolism alterations in ALS.

BARC 75 - A 75 group neutron-photon coupled cross-section library with P5- anisotropic scattering matrices

International Nuclear Information System (INIS)

Garg, S.B.

1990-01-01

A 75 group neutron-photon coupled cross-section library has been developed for 42 reactor nuclides utilizing the basic cross-section files - ENDF/B-IV for neutrons and DLC-7F for photons. 50 neutron energy groups and gamma energy groups are included in this library which should be well suited to carry out safety, shielding and core physics studies of nuclear reactors based on fission or fusion processes. This library is also adequate for oil logging and mineral exploration investigations. (author). 11 refs., 3 tabs

A re-evaluation of k0 and related nuclear data for the 555.8 keV gamma-line emitted by the 104mRh-104Rh mother-daughter pair for use in NAA

International Nuclear Information System (INIS)

Corte, Frans de; Lierde, Stijn van; Simonits, Andras; Bossus, Danieel; Sluijs, Robbert van; Pomme, Stefaan

1999-01-01

A re-evaluation is made of the k 0 -factor and related nuclear data for the 555.8 keV gamma-ray of the 104m Rh- 104 Rh mother-daughter pair that are important in neutron activation analysis (NAA). This study considers that the relevant level is also fed by the 4.34 min 104m Rh mother (with an absolute gamma-ray emission probability γ 2 =0.13%) and not only, as assumed in former work, by the 42.3 s 104 Rh daughter isotope (with γ 3 =2.0%). In view of this, generalised equations were developed for both the experimental determination and the analytical use of the k 0 -factor and of the associated parameters k 0 (m)/k 0 (g), Q 0 (m) and Q 0 (g) [(m): 104m Rh; (g): 104 Rh], requiring the introduction of the γ 2 and γ 3 data and also of the 104m Rh→ 104 Rh fractional decay factor F 2 (=0.9987). The experimental determinations were based on irradiations performed in the BR1 reactor in Mol and the WWR-M reactor in Budapest. Furthermore, considering the special formation of the 555.8 keV gamma-ray, the procedure for true-coincidence correction was revised as well. All this led to the compilation and recommendation of a new set of 'k 0 -NAA' data

The Arabidopsis homolog of human G3BP1 is a key regulator of stomatal and apoplastic immunity

KAUST Repository

Abulfaraj, Aala A.; Mariappan, Kiruthiga; Bigeard, Jean; Manickam, Prabhu; Blilou, Ikram; Guo, Xiujie; Al-Babili, Salim; Pflieger, Delphine; Hirt, Heribert; Rayapuram, Naganand

2018-01-01

Mammalian Ras-GTPase–activating protein SH3-domain–binding proteins (G3BPs) are a highly conserved family of RNA-binding proteins that link kinase receptor-mediated signaling to RNA metabolism. Mammalian G3BP1 is a multifunctional protein that functions in viral immunity. Here, we show that the Arabidopsis thaliana homolog of human G3BP1 negatively regulates plant immunity. Arabidopsis g3bp1 mutants showed enhanced resistance to the virulent bacterial pathogen Pseudomonas syringae pv. tomato. Pathogen resistance was mediated in Atg3bp1 mutants by altered stomatal and apoplastic immunity. Atg3bp1 mutants restricted pathogen entry into stomates showing insensitivity to bacterial coronatine–mediated stomatal reopening. AtG3BP1 was identified as a negative regulator of defense responses, which correlated with moderate up-regulation of salicylic acid biosynthesis and signaling without growth penalty.

The Arabidopsis homolog of human G3BP1 is a key regulator of stomatal and apoplastic immunity

KAUST Repository

Abulfaraj, Aala Abdulaziz Hussien

2018-05-31

Mammalian Ras-GTPase–activating protein SH3-domain–binding proteins (G3BPs) are a highly conserved family of RNA-binding proteins that link kinase receptor-mediated signaling to RNA metabolism. Mammalian G3BP1 is a multifunctional protein that functions in viral immunity. Here, we show that the Arabidopsis thaliana homolog of human G3BP1 negatively regulates plant immunity. Arabidopsis g3bp1 mutants showed enhanced resistance to the virulent bacterial pathogen Pseudomonas syringae pv. tomato. Pathogen resistance was mediated in Atg3bp1 mutants by altered stomatal and apoplastic immunity. Atg3bp1 mutants restricted pathogen entry into stomates showing insensitivity to bacterial coronatine–mediated stomatal reopening. AtG3BP1 was identified as a negative regulator of defense responses, which correlated with moderate up-regulation of salicylic acid biosynthesis and signaling without growth penalty.

The role of SH3BP2 in the pathophysiology of cherubism

Directory of Open Access Journals (Sweden)

Reichenberger Ernst J

2012-05-01

Full Text Available Abstract Cherubism is a rare bone dysplasia that is characterized by symmetrical bone resorption limited to the jaws. Bone lesions are filled with soft fibrous giant cell-rich tissue that can expand and cause severe facial deformity. The disorder typically begins in children at ages of 2-5 years and the bone resorption and facial swelling continues until puberty; in most cases the lesions regress spontaneously thereafter. Most patients with cherubism have germline mutations in the gene encoding SH3BP2, an adapter protein involved in adaptive and innate immune response signaling. A mouse model carrying a Pro416Arg mutation in SH3BP2 develops osteopenia and expansile lytic lesions in bone and some soft tissue organs. In this review we discuss the genetics of cherubism, the biological functions of SH3BP2 and the analysis of the mouse model. The data suggest that the underlying cause for cherubism is a systemic autoinflammatory response to physiologic challenges despite the localized appearance of bone resorption and fibrous expansion to the jaws in humans.

Influence of the number of energy groups on the accuracy of neutron fluence calculations

International Nuclear Information System (INIS)

Barz, H.U.; Konheiser, J.

1999-01-01

The question how many groups are necessary to obtain all needed integral quantities for the neutron load of pressure vessels and detector positions outside the vessel with sufficient accuracy is of general interest. Until now, there are no systematic investigations on this question. In principle 3-dimensional consideration is required for such neutron load calculations. Therefore, an estimation of the needed number of groups can be of interest to minimize calculation time. One general problem is the P L -approximation of the angular distributions for the transfers between different groups. For elastic scattering this P L -approximation becomes poorer with increasing number of groups. As deterministic methods generally use the P L -approximation they cannot be used for investigations of the errors caused by the group approximation. We have investigated this problem applying group Monte-Carlo but nearly exact representation of this elastic slowing down without P L -approximation. The calculations were directed to assess the neutron fluence of a Russian WWER-1000 reactor. For that a simplified geometrical model of this reactor type has been used. (orig.)

IGF2BP3 as a potential tissue marker for the diagnosis of esophageal high-grade intraepithelial neoplasia

Directory of Open Access Journals (Sweden)

Zhang JJ

2017-08-01

Full Text Available Jingjing Zhang,1,* Qing Ji,2,* Chunhua Jiao,3,* Lihua Ren,4 Ye Zhao,4 Yanfang Chen,4 Ruihua Shi,4 Yadong Feng4 1State Key Laboratory of Reproductive Medicine, Department of Prenatal Diagnosis, Obstetrics and Gynecology Hospital Affiliated to Nanjing Medical University, Nanjing, 2Department of Emergency, Jingjiang People’s Hospital, Jingjiang, 3Department of Gastroenterology, First Affiliated Hospital with Nanjing Medical University, 4Department of Gastroenterology, Zhongda Hospital, School of Medicine, Southeast University, Nanjing, People’s Republic of China *These authors contributed equally to this work Background: The clinical significance of insulin-like growth factor-II mRNA-binding protein-3 (IGF2BP3 in esophageal high-grade intraepithelial neoplasia (HGIN is not clear. This study was designed to characterize the expression of IGF2BP3 in HGIN. Patients and methods: IGF2BP3 expression was evaluated by Western blot analyses in 12 cases and by immunohistochemistry (IHC in 112 cases. The associations between IGF2BP3 expression in HGIN and the clinicopathological parameters were examined. Results: Moderate to strong IGF2BP3 expression was present in HGIN samples. Using IHC, it was found that IGF2BP3 was positive in 68 (60.71% cases. Intense IHC of IGF2BP3 in HGIN was associated with a deeper lesion depth, and the lesion depth was the only predictor of the positive expression of IGF2BP3. Conclusion: Our results suggested that IGF2BP3 may be a supplementary tissue marker for preoperative diagnosis of HGIN. Keywords: esophageal squamous cell carcinoma, precancerous lesion, immunohistochemistry detection, early diagnosis

Migros-3: a code for the generation of group constants for reactor calculations from neutron nuclear data in KEDAK format

International Nuclear Information System (INIS)

Broeders, I.; Krieg, B.

1977-01-01

The code MIGROS-3 was developed from MIGROS-2. The main advantage of MIGROS-3 is its compatibility with the new conventions of the latest version of the Karlsruhe nuclear data library, KEDAK-3. Moreover, to some extent refined physical models were used and numerical methods were improved. MIGROS-3 allows the calculation of microscopic group cross sections of the ABBN type from isotopic neutron data given in KEDAK-format. All group constants, necessary for diffusion-, consistent P 1 - and Ssub(N)-calculations can be generated. Anisotropy of elastic scattering can be taken into account up to P 5 . A description of the code and the underlying theory is given. The input and output description, a sample problem and the program lists are provided. (orig.) [de

8-group relative delayed neutron yields for epithermal neutron induced fission of 235U and 239Pu

International Nuclear Information System (INIS)

Piksaikin, V.M.; Kazakov, L.E.; Isaev, S.G.; Korolev, G.G.; Roshchenko, V.A.; Tertychnyj, R.G

2002-01-01

An 8-group representation of relative delayed neutron yields was obtained for epithermal neutron induced fission of 235 U and 239 Pu. These data were compared with ENDF/B-VI data in terms of the average half- life of the delayed neutron precursors and on the basis of the dependence of reactivity on the asymptotic period. (author)

[On the risk of spread of E. coli/EHEC O104:H4 stx 2 positive bacteria via sewerage treatment plants during the 2011 EHEC outbreak in north Germany].

Science.gov (United States)

Heinemeyer, E-A; Luden, K; Monazahian, M

2013-08-01

During an EHEC outbreak with E. coli O104:H4 stx2-pos in northern Germany 2 sewage treatment plants (Cuxhaven and Stade) of highly affected areas were monitored for the presence of the outbreak strain. 7 efflux water samples were collected at 1 h and 6 h intervals. The overall E. coli content of the treated sewage water was approximately 35 000 CFU/100 mL in both treatment plants. Among these about 500 were ESBL-E. coli (1.4%). ESBL-Agar was used as selective medium as the outbreak strain is highly resistant to 3rd generation cephalosporins. From the ESBL-isolates 208 strains have been typed by molecular methods for markers specific to the outbreak strain (O104rfb -351 base pairs (bp), flic H4-201 bp, stx2-584 bp, Tellur D - 434 bp). No outbreak strain was detected. The number of E. coli O104:H4 stx2-pos was calculated to be less than 3 per 100 mL in the treated sewage at the time of the study. Therefore it can be concluded that there was no threat for bathers to fall sick with this highly pathogenic strain from possibly sewage-contaminated bathing waters during the outbreak. The national limit value of 1 800 E. coli in 100 mL offers a high safety margin. © Georg Thieme Verlag KG Stuttgart · New York.

Semi-empirical neutron tool calibration (one and two-group approximation)

International Nuclear Information System (INIS)

Czubek, J.A.

1988-01-01

The physical principles of the new method of calibration of neutron tools for the rock porosity determination are given. A short description of the physics of neutron transport in the matter is presented together with some remarks on the elementary interactions of neutrons with nuclei (cross sections, group cross sections etc.). The definitions of the main integral parameters characterizing the neutron transport in the rock media are given. The three main approaches to the calibration problem: empirical, theoretical and semi-empirical are presented with some more detailed description of the latter one. The new semi-empirical approach is described. The method is based on the definition of the apparent slowing down or migration length for neutrons sensed by the neutron tool situated in the real borehole-rock conditions. To calculate this apparent slowing down or migration lengths the ratio of the proper space moments of the neutron distribution along the borehole axis is used. Theoretical results are given for one- and two-group diffusion approximations in the rock-borehole geometrical conditions when the tool is in the sidewall position. The physical and chemical parameters are given for the calibration blocks of the Logging Company in Zielona Gora. Using these data the neutron parameters of the calibration blocks have been calculated. An example, how to determine the calibration curve for the dual detector tool applying this new method and using the neutron parameters mentioned above together with the measurements performed in the calibration blocks, is given. The most important advantage of the new semi-empirical method of calibration is the possibility of setting on the unique calibration curve all experimental calibration data obtained for a given neutron tool for different porosities, lithologies and borehole diameters. 52 refs., 21 figs., 21 tabs. (author)

Experimentally Determining β-Decay Intensities for 103,104Nb to Improve R-process Calculations

Science.gov (United States)

Gombas, J.; Deyoung, P. D.; Spyrou, A.; Dombos, A. C.; Lyons, S.; SuN Collaboration

2017-09-01

The rapid neutron capture process (r-process) is responsible for the formation of nuclei heavier than iron. This process is theorized to occur in supernovas and/or neutron star mergers. R-process calculations require the accurate knowledge of a significant amount of nuclear properties, the majority of which are not known experimentally. Nuclear masses, β-decay properties and neutron-capture reactions are all input ingredients into r-process models. This present study focuses on the β decay of 103Nb and 104Nb. The β decay of 103Nb and 104Nb, two nuclei found in the r-process, were observed at the NSCL using the Summing NaI (SuN) detector. An unstable beam implanted inside SuN. The γ rays were measured in coincidence with the emitted electrons. The β-decay intensity function was then extracted. The experimentally determined functions for 103Nb and 104Nb will be compared to predictions made by the Quasi Random Phase Approximation (QRPA) model. These theoretical calculations are used in astrophysical models of the r-process. This comparison will lead to a better understanding of the nuclear structure for 103Nb and 104Nb. A more dependable prediction of the formation of heavier nuclei birthed from supernovas or neutron star mergers can then be made. This material is based upon work supported by the National Science Foundation under Grant No. PHY-1613188 and PHY-1306074, and by the Hope College Department of Physics Guess Research Fund.

Application of the variational method for calculation of neutron spectra and group constants - Master thesis

International Nuclear Information System (INIS)

Milosevic, M.

1979-01-01

One-dimensional variational method for cylindrical configuration was applied for calculating group constants, together with effects of elastic slowing down, anisotropic elastic scattering, inelastic scattering, heterogeneous resonance absorption with the aim to include the presence of a number of different isotopes and effects of neutron leakage from the reactor core. Neutron flux shape P 3 and adjoint function are proposed in order to enable calculation of smaller size reactors and inclusion of heterogeneity effects by cell calculations. Microscopic multigroup constants were prepared based on the UKNDL data library. Analytical-numerical approach was applied for solving the equations of the P 3 approximation to obtain neutron flux moments and adjoint functions

Research on GPU-accelerated algorithm in 3D finite difference neutron diffusion calculation method

International Nuclear Information System (INIS)

Xu Qi; Yu Ganglin; Wang Kan; Sun Jialong

2014-01-01

In this paper, the adaptability of the neutron diffusion numerical algorithm on GPUs was studied, and a GPU-accelerated multi-group 3D neutron diffusion code based on finite difference method was developed. The IAEA 3D PWR benchmark problem was calculated in the numerical test. The results demonstrate both high efficiency and adequate accuracy of the GPU implementation for neutron diffusion equation. (authors)

A multi-group neutron noise simulator for fast reactors

International Nuclear Information System (INIS)

Tran, Hoai Nam; Zylbersztejn, Florian; Demazière, Christophe; Jammes, Christian; Filliatre, Philippe

2013-01-01

Highlights: • The development of a neutron noise simulator for fast reactors. • The noise equation is solved fully in a frequency-domain. • A good agreement with ERANOS on the static calculations. • Noise calculations induced by a localized perturbation of absorption cross section. - Abstract: A neutron noise simulator has been developed for fast reactors based on diffusion theory with multi-energy groups and several groups of delayed neutron precursors. The tool is expected to be applicable for core monitoring of fast reactors and also for other reactor types with hexagonal fuel assemblies. The noise sources are modeled through small stationary fluctuations of macroscopic cross sections, and the induced first order noise is solved fully in the frequency domain. Numerical algorithms are implemented for solving both the static and noise equations using finite differences for spatial discretization, where a hexagonal assembly is radially divided into finer triangular meshes. A coarse mesh finite difference (CMFD) acceleration has been used for accelerating the convergence of both the static and noise calculations. Numerical calculations have been performed for the ESFR core with 33 energy groups and 8 groups of delayed neutron precursors using the cross section data generated by the ERANOS code. The results of the static state have been compared with those obtained using ERANOS. The results show an adequate agreement between the two calculations. Noise calculations for the ESFR core have also been performed and demonstrated with an assumption of the perturbation of the absorption cross section located at the central fuel ring

A perillyl alcohol-conjugated analog of 3-bromopyruvate without cellular uptake dependency on monocarboxylate transporter 1 and with activity in 3-BP-resistant tumor cells.

Science.gov (United States)

Chen, Thomas C; Yu, Jiali; Nouri Nigjeh, Eslam; Wang, Weijun; Myint, Phyo Thazin; Zandi, Ebrahim; Hofman, Florence M; Schönthal, Axel H

2017-08-01

The anticancer agent 3-bromopyruvate (3-BP) is viewed as a glycolytic inhibitor that preferentially kills glycolytic cancer cells through energy depletion. However, its cytotoxic activity is dependent on cellular drug import through transmembrane monocarboxylate transporter 1 (MCT-1), which restricts its anticancer potential to MCT-1-positive tumor cells. We created and characterized an MCT-1-independent analog of 3-BP, called NEO218. NEO218 was synthesized by covalently conjugating 3-BP to perillyl alcohol (POH), a natural monoterpene. The responses of various tumor cell lines to treatment with either compound were characterized in the presence or absence of supplemental pyruvate or antioxidants N-acetyl-cysteine (NAC) and glutathione (GSH). Drug effects on glyceraldehyde 3-phosphate dehydrogenase (GAPDH) enzyme activity were investigated by mass spectrometric analysis. The development of 3-BP resistance was investigated in MCT-1-positive HCT116 colon carcinoma cells in vitro. Our results show that NEO218: (i) pyruvylated GAPDH on all 4 of its cysteine residues and shut down enzymatic activity; (ii) severely lowered cellular ATP content below life-sustaining levels, and (iii) triggered rapid necrosis. Intriguingly, supplemental antioxidants effectively prevented cytotoxic activity of NEO218 as well as 3-BP, but supplemental pyruvate powerfully protected cells only from 3-BP, not from NEO218. Unlike 3-BP, NEO218 exerted its potent cytotoxic activity irrespective of cellular MCT-1 status. Treatment of HCT116 cells with 3-BP resulted in prompt development of resistance, based on the emergence of MCT-1-negative cells. This was not the case with NEO218, and highly 3-BP-resistant cells remained exquisitely sensitive to NEO218. Thus, our study identifies a mechanism by which tumor cells develop rapid resistance to 3-BP, and presents NEO218 as a superior agent not subject to this cellular defense. Furthermore, our results offer alternative interpretations of previously

48 CFR 48.104-3 - Sharing collateral savings.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Sharing collateral savings... CONTRACT MANAGEMENT VALUE ENGINEERING Policies and Procedures 48.104-3 Sharing collateral savings. (a) The Government shares collateral savings with the contractor, unless the head of the contracting activity has...

48 CFR 2448.104-3 - Sharing collateral savings.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Sharing collateral savings... DEVELOPMENT CONTRACT MANAGEMENT VALUE ENGINEERING 2448.104-3 Sharing collateral savings. (a) The authority of the HCA to determine that the cost of calculating and tracking collateral savings will exceed the...

AcEST: BP913939 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000038_B01 468 Adiantum capillus-veneris mRNA. clone: YMU001_000038_B01. BP913939 - Show BP913939...is mRNA. clone: YMU001_000038_B01. Accession BP913939 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP913939|Adiantum capillus-veneris mRNA, ... F member 3... 86 9e-17 sp|Q66H39|ABCF3_RAT ATP-binding cassette sub-family F member 3 O... 85 1e-16 sp|Q5R9...aracterized ABC transporter ATP-binding... 56 6e-08 sp|P63390|YHES_ECO57 Uncharacterized ABC transporter ATP

48 CFR 47.104-3 - Cost-reimbursement contracts.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Cost-reimbursement... CONTRACT MANAGEMENT TRANSPORTATION General 47.104-3 Cost-reimbursement contracts. (a) 49 U.S.C. 10721 and... accrues to the Government, i.e., the Government shall pay the charges or directly and completely reimburse...

Towards helium-3 neutron polarizers

International Nuclear Information System (INIS)

Tasset, F.

1995-01-01

With a large absorption cross-section entirely due to antiparallel spin capture, polarized helium-3 is presently the most promising broad-band polarizer for thermal and epithermal neutrons. Immediate interest was raised amongst the neutron community when a dense gaseous 3 He polarizer was used for the first time in 1988, on a pulsed neutron beam at Los Alamos. With 20 W of laser power on a 30 cm long, 8.6 atm target, 40% 3 He polarization was achieved in a recent polarized electron scattering experiment at SLAC. In this technique the 3 He nuclei are polarized directly at an appropriate high pressure through spin-exchange collisions with a thick, optically pumped rubidium vapor. A different and competitive approach is being presently developed at Mainz University in collaboration with ENS Paris and now the ILL. A discharge is established in pure 3 He at low pressure producing excited metastable atoms which can be optically pumped with infra-red light. Highly effective exchange collision with the atoms remaining in the ground state quickly produces 75% polarization at 1.5 mbar. A truly non-magnetic system then compresses the polarized gas up to several bars as required. The most recent machine comprises a two-stage glass-titanium compressor. In less than 1 h it can inflate a 100 cm 3 target cell with three bars of polarized gas. The very long relaxation times (several days) now being obtained at high pressure with a special metallic coating on the glass walls, the polarized cell can be detached and inserted in the neutron beam as polarizer. We expect 50% 3 He-polarization to be reached soon, allowing such filters to compete favorably with existing Heusler-crystal polarizers at thermal and short neutron wavelengths. It must be stressed that such a system based on a 3 He polarization factory able to feed several passive, transportable, polarizers is well matched to neutron scattering needs. (orig.)

Tritium release behavior from neutron-irradiated Li{sub 2}TiO{sub 3} single crystal

Energy Technology Data Exchange (ETDEWEB)

Tanifuji, Takaaki; Yamaki, Daiju; Noda, Kenji [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Nasu, Shoichi

1998-03-01

Li{sub 2}TiO{sub 3} single-crystals with various size (1-2mm) were used as specimens. After the irradiation up to 4 x 10{sup 18} n/cm{sup 2} with thermal neutrons in JRR-2, tritium release from the Li{sub 2}TiO{sub 3} specimens in isothermal heating tests was continuously measured with a proportional counter. The tritium release in the range from 625K to 1373K seems to be controlled by bulk diffusion. The tritium diffusion coefficient (D{sub T}) in Li{sub 2}TiO{sub 3} was evaluated to be D{sub T}(cm{sup 2}/sec) = 0.100exp(-104(kJ/mol)/RT), 625K3} is almost equal to those of Li{sub 2}O irradiated with thermal neutrons up to 2 x 10{sup 19} n/cm{sup 2}. It indicates that the tritium release performance of Li{sub 2}TiO{sub 3} is essentially good as Li{sub 2}O. (author)

A minireview of E4BP4/NFIL3 in heart failure.

Science.gov (United States)

Velmurugan, Bharath Kumar; Chang, Ruey-Lin; Marthandam Asokan, Shibu; Chang, Chih-Fen; Day, Cecilia-Hsuan; Lin, Yueh-Min; Lin, Yuan-Chuan; Kuo, Wei-Wen; Huang, Chih-Yang

2018-06-01

Heart failure (HF) remains a major cause of morbidity and mortality worldwide. The primary cause identified for HF is impaired left ventricular myocardial function, and clinical manifestations may lead to severe conditions like pulmonary congestion, splanchnic congestion, and peripheral edema. Development of new therapeutic strategies remains the need of the hour for controlling the problem of HF worldwide. Deeper insights into the molecular mechanisms involved in etiopathology of HF indicate the significant role of calcium signaling, autocrine signaling pathways, and insulin-like growth factor-1 signaling that regulates the physiologic functions of heart growth and development such as contraction, metabolism, hypertrophy, cytokine signaling, and apoptosis. In view of these facts, a transcription factor (TF) regulating the myriad of these signaling pathways may prove as a lead candidate for development of therapeutics. Adenovirus E4 promoter-binding protein (E4BP4), also known as nuclear-factor, interleukin 3 regulated (NFIL3), a type of basic leucine zipper TF, is known to regulate the signaling processes involved in the functioning of heart. The current review discusses about the expression, structure, and functional role of E4BP4 in signaling processes with emphasis on calcium signaling mechanisms, autocrine signaling, and insulin-like growth factor II receptor-mediated processes regulated by E4BP4 that may regulate the pathogenesis of HF. We propose that E4BP4, being the critical component for the regulation of the above signaling processes, may serve as a novel therapeutic target for HF, and scientific investigations are merited in this direction. © 2018 Wiley Periodicals, Inc.

AcEST: BP912123 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_D05 496 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D05. BP91212...3 CL498Contig1 Show BP912123 Clone id YMU001_000015_D05 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D05. Accession BP912123 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...3|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D05. (478 letters) Database: uniprot_sprot.fasta 412

A translational study "case report" on the small molecule "energy blocker" 3-bromopyruvate (3BP) as a potent anticancer agent: from bench side to bedside.

Science.gov (United States)

Ko, Y H; Verhoeven, H A; Lee, M J; Corbin, D J; Vogl, T J; Pedersen, P L

2012-02-01

The small alkylating molecule, 3-bromopyruvate (3BP), is a potent and specific anticancer agent. 3BP is different in its action from most currently available chemo-drugs. Thus, 3BP targets cancer cells' energy metabolism, both its high glycolysis ("Warburg Effect") and mitochondrial oxidative phosphorylation. This inhibits/ blocks total energy production leading to a depletion of energy reserves. Moreover, 3BP as an "Energy Blocker", is very rapid in killing such cells. This is in sharp contrast to most commonly used anticancer agents that usually take longer to show a noticeable effect. In addition, 3BP at its effective concentrations that kill cancer cells has little or no effect on normal cells. Therefore, 3BP can be considered a member, perhaps one of the first, of a new class of anticancer agents. Following 3BP's discovery as a novel anticancer agent in vitro in the Year 2000 (Published in Ko et al. Can Lett 173:83-91, 2001), and also as a highly effective and rapid anticancer agent in vivo shortly thereafter (Ko et al. Biochem Biophys Res Commun 324:269-275, 2004), its efficacy as a potent anticancer agent in humans was demonstrated. Here, based on translational research, we report results of a case study in a young adult cancer patient with fibrolamellar hepatocellular carcinoma. Thus, a bench side discovery in the Department of Biological Chemistry at Johns Hopkins University, School of Medicine was taken effectively to bedside treatment at Johann Wolfgang Goethe University Frankfurt/Main Hospital, Germany. The results obtained hold promise for 3BP as a future cancer therapeutic without apparent cyto-toxicity when formulated properly.

A translational study “case report” on the small molecule “energy blocker” 3-bromopyruvate (3BP) as a potent anticancer agent: from bench side to bedside

NARCIS (Netherlands)

Ko, Y.H.; Verhoeven, H.A.; Lee, M.J.; Corbin, D.J.; Vogl, T.J.; Pedersen, P.L.

2012-01-01

The small alkylating molecule, 3-bromopyruvate (3BP), is a potent and specific anticancer agent. 3BP is different in its action from most currently available chemo-drugs. Thus, 3BP targets cancer cells’ energy metabolism, both its high glycolysis (“Warburg Effect”) and mitochondrial oxidative

HSF and Msn2/4p can exclusively or cooperatively activate the yeast HSP104 gene.

Science.gov (United States)

Grably, Melanie R; Stanhill, Ariel; Tell, Osnat; Engelberg, David

2002-04-01

In an effort to understand how an accurate level of stress-specific expression is obtained, we studied the promoter of the yeast HSP104 gene. Through 5' deletions, we defined a 334 bp fragment upstream of the first coding AUG as sufficient and essential for maximal basal activity and a 260 bp fragment as sufficient and essential for heat shock responsiveness. These sequences contain heat shock elements (HSEs) and stress response elements (STREs) that cooperate to achieve maximal inducible expression. However, in the absence of one set of factors (e.g. in msn2Deltamsn4Delta cells) proper induction is obtained exclusively through HSEs. We also show that HSP104 is constitutively derepressed in ras2Delta cells. This derepression is achieved exclusively through activation of STREs, with no role for HSEs. Strikingly, in ras2Deltamsn2Deltamsn4Delta cells the HSP104 promoter is also derepressed, but in this strain derepression is mediated through HSEs, showing the flexibility and adaptation of the promoter. Thus, appropriate transcription of HSP104 is usually obtained through cooperation between the Msn2/4/STRE and the HSF/ HSE systems, but each factor could activate the promoter alone, backing up the other. Transcription control of HSP104 is adaptive and robust, ensuring proper expression under extreme conditions and in various mutants.

Crystal structure of the G3BP2 NTF2-like domain in complex with a canonical FGDF motif peptide

DEFF Research Database (Denmark)

Kristensen, Ole

2015-01-01

-terminal domains of the G3BP1 and Rasputin proteins. Recently, a subset of G3BP interacting proteins was recognized to share a common sequence motif, FGDF. The most studied binding partners, USP10 and viral nsP3, interfere with essential G3BP functions related to assembly of cellular stress granules. Reported...

New Beta-delayed Neutron Measurements in the Light-mass Fission Group

Energy Technology Data Exchange (ETDEWEB)

Agramunt, J. [Instituto de Física Corpuscular, CSIC-Univ. Valencia, Apdo. Correos 22085, E-46071 Valencia (Spain); García, A.R. [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas, E-28040 Madrid (Spain); Algora, A. [Instituto de Física Corpuscular, CSIC-Univ. Valencia, Apdo. Correos 22085, E-46071 Valencia (Spain); Äystö, J. [University of Jyväskylä, FI-40014 Jyväskyä (Finland); Caballero-Folch, R.; Calviño, F. [Secció d' Enginyeria Nuclear, Universitat Politécnica de Catalunya, E-08028 Barcelona (Spain); Cano-Ott, D. [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas, E-28040 Madrid (Spain); Cortés, G. [Secció d' Enginyeria Nuclear, Universitat Politécnica de Catalunya, E-08028 Barcelona (Spain); Domingo-Pardo, C. [Instituto de Física Corpuscular, CSIC-Univ. Valencia, Apdo. Correos 22085, E-46071 Valencia (Spain); Eronen, T. [University of Jyväskylä, FI-40014 Jyväskyä (Finland); Gelletly, W. [Department of Physics, University of Surrey, Guildford GU2 7XH (United Kingdom); Gómez-Hornillos, M.B. [Secció d' Enginyeria Nuclear, Universitat Politécnica de Catalunya, E-08028 Barcelona (Spain); and others

2014-06-15

A new accurate determination of beta-delayed neutron emission probabilities from nuclei in the low mass region of the light fission group has been performed. The measurements were carried out using the BELEN 4π neutron counter at the IGISOL-JYFL mass separator in combination with a Penning trap. The new results significantly improve the uncertainties of neutron emission probabilities for {sup 91}Br, {sup 86}As, {sup 85}As, and {sup 85}Ge nuclei.

Preparation and characteristics of a flexible neutron and γ-ray shielding and radiation-resistant material reinforced by benzophenone

Directory of Open Access Journals (Sweden)

Pin Gong

2018-04-01

Full Text Available With a highly functional methyl vinyl silicone rubber (VMQ matrix and filler materials of B4C, PbO, and benzophenone (BP and through powder surface modification, silicone rubber mixing, and vulcanized molding, a flexible radiation shielding and resistant composite was prepared in the study. The dispersion property of the powder in the matrix filler was improved by powder surface modification. BP was added into the matrix to enhance the radiation resistance performance of the composites. After irradiation, the tensile strength, elongation, and tear strength of the composites decreased, while the Shore hardness of the composites and the crosslinking density of the VMQ matrix increased. Moreover, the composites with BP showed better mechanical properties and smaller crosslinking density than those without BP after irradiation. The initial degradation temperatures of the composites containing BP before and after irradiation were 323.6°C and 335.3°C, respectively. The transmission of neutrons for a 2-mm thick sample was only 0.12 for an Am–Be neutron source. The transmission of γ-rays with energies of 0.662, 1.173, and 1.332 MeV for 2-cm thick samples were 0.7, 0.782, and 0.795, respectively. Keywords: Flexible Composite, Neutron Shielding, Radiation Resistance, γ-ray Shielding

Flow cytometric evaluation of the effects of 3-bromopyruvate (3BP) and dichloracetate (DCA) on THP-1 cells: a multiparameter analysis

NARCIS (Netherlands)

Verhoeven, H.A.; Griensven, van L.J.L.D.

2012-01-01

Two human leukemia cells K562 and THP-1, the breast cancer lines MCF-7 and ZR-75-1, and the melanoma line MDA-MB-435S were compared by flowcytometry for their behaviour at increasing levels of 3BP. K562 and THP-1 responded to 3BP by membrane depolarization and increased ROS; MCF-7 and ZR-75-1 showed

PHISICS multi-group transport neutronic capabilities for RELAP5

Energy Technology Data Exchange (ETDEWEB)

Epiney, A.; Rabiti, C.; Alfonsi, A.; Wang, Y.; Cogliati, J.; Strydom, G. [Idaho National Laboratory (INL), 2525 N. Fremont Ave., Idaho Falls, ID 83402 (United States)

2012-07-01

PHISICS is a neutronic code system currently under development at INL. Its goal is to provide state of the art simulation capability to reactor designers. This paper reports on the effort of coupling this package to the thermal hydraulic system code RELAP5. This will enable full prismatic core and system modeling and the possibility to model coupled (thermal-hydraulics and neutronics) problems with more options for 3D neutron kinetics, compared to the existing diffusion theory neutron kinetics module in RELAP5 (NESTLE). The paper describes the capabilities of the coupling and illustrates them with a set of sample problems. (authors)

Energy dependence of relative abundances and periods of delayed neutron separate groups from neutron induced fission of 239Pu in the virgin neutron energy range 0.37-4.97 MeV

International Nuclear Information System (INIS)

Piksajkin, V.M.; Kazakov, L.E.; Isaev, S.T.; Korolev, G.G.; Roshchenko, V.A.; Tertychnyj, R.G.

2002-01-01

Relative yield and group period of delayed neutrons induced by the 239 Pu fission in the 0.37-4.97 MeV range were measured. Comparative analysis of experimental data was conducted in terms of middle period of half-life of delayed neutron nuclei-precursors. Character and scale of changing values of delayed neutron group parameters as changing excitation energy of fission compound-nucleus have been demonstrated for the first time. Considerable energy dependence of group parameters under the neutron induced 239 Pu fission that was expressed by the decreasing middle period of half-life of nuclei-precursors by 10 % in the 2.85 eV - 5 MeV range of virgin neutrons was detected [ru

AcEST: BP920143 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_E07 533 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E07. BP92014...3 CL2377Contig1 Show BP920143 Clone id YMU001_000133_E07 Library YMU01 Length 533 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E07. Accession BP920143 Tissue type prothallium Developmental stag...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E0...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum

AcEST: BP920993 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_C06 517 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C06. BP92099...3 CL547Contig1 Show BP920993 Clone id YMU001_000144_C06 Library YMU01 Length 517 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_C06. Accession BP920993 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum capillus-veneris mRNA, clone: YMU001_0001...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum

AcEST: BP919801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000129_C11 513 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C11. BP919801... CL1Contig3 Show BP919801 Clone id YMU001_000129_C11 Library YMU01 Length 513 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000129_C11. Accession BP919801 Tissue type prothallium Developmental stage -...es. 25:3389-3402. Query= BP919801|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C11. (435 letters) Da...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919801|Adiantum capil

Knowledge Management in the Neutronics Group of CAREM Project

International Nuclear Information System (INIS)

Torres, L.; Lopasso, E.

2016-01-01

Full text: An analysis of the Neutronics Group of CAREM25 project was performed in order to plan for the gradual implementation of knowledge management. The group structure, performed tasks and the way these tasks are linked together were studied. Staff functions within the group, profiles of each position and the training and education of human resources were also analyzed. (author

Proportionate Dwarfism in Mice Lacking Heterochromatin Protein 1 Binding Protein 3 (HP1BP3) Is Associated With Alterations in the Endocrine IGF-1 Pathway.

Science.gov (United States)

Garfinkel, Benjamin P; Arad, Shiri; Le, Phuong T; Bustin, Michael; Rosen, Clifford J; Gabet, Yankel; Orly, Joseph

2015-12-01

Heterochromatin protein 1 binding protein 3 (HP1BP3) is a recently described histone H1-related protein with roles in chromatin structure and transcriptional regulation. To explore the potential physiological role of HP1BP3, we have previously described an Hp1bp3(-/-) mouse model with reduced postnatal viability and growth. We now find that these mice are proportionate dwarfs, with reduction in body weight, body length, and organ weight. In addition to their small size, microcomputed tomography analysis showed that Hp1bp3(-/-) mice present a dramatic impairment of their bone development and structure. By 3 weeks of age, mice of both sexes have severely impaired cortical and trabecular bone, and these defects persist into adulthood and beyond. Primary cultures of both osteoblasts and osteoclasts from Hp1bp3(-/-) bone marrow and splenocytes, respectively, showed normal differentiation and function, strongly suggesting that the impaired bone accrual is due to noncell autonomous systemic cues in vivo. One major endocrine pathway regulating both body growth and bone acquisition is the IGF regulatory system, composed of IGF-1, the IGF receptors, and the IGF-binding proteins (IGFBPs). At 3 weeks of age, Hp1bp3(-/-) mice exhibited a 60% reduction in circulating IGF-1 and a 4-fold increase in the levels of IGFBP-1 and IGFBP-2. These alterations were reflected in similar changes in the hepatic transcripts of the Igf1, Igfbp1, and Igfbp2 genes. Collectively, these results suggest that HP1BP3 plays a key role in normal growth and bone development by regulating transcription of endocrine IGF-1 components.

Neutron scattering lengths of 3He

International Nuclear Information System (INIS)

Alfimenkov, V.P.; Akopian, G.G.; Wierzbicki, J.; Govorov, A.M.; Pikelner, L.B.; Sharapov, E.I.

1976-01-01

The total neutron scattering cross-section of 3 He has been measured in the neutron energy range from 20 meV to 2 eV. Together with the known value of coherent scattering amplitude it leads to the two sts of n 3 He scattering lengths

IGF2BP3 functions as a potential oncogene and is a crucial target of miR-34a in gastric carcinogenesis.

Science.gov (United States)

Zhou, Yuhang; Huang, Tingting; Siu, Ho Lam; Wong, Chi Chun; Dong, Yujuan; Wu, Feng; Zhang, Bin; Wu, William K K; Cheng, Alfred S L; Yu, Jun; To, Ka Fai; Kang, Wei

2017-04-11

Gastric cancer (GC) is one of the frequent causes of cancer-related death in eastern Asian population. IGF2BP2 lists in the top rank up-regulated genes in GC, but its functional role is unclear. The expression of IGF2BP3 in GC cell lines and primary samples was examined by qRT-PCR and Western blot. The biological role of IGF2BP3 was revealed by a series of functional in vitro studies. Its regulation by microRNAs (miRNAs) was predicted by TargetScan and confirmed by luciferase assays and rescue experiments. IGF2BP3 ranked the No.1 of the up-regulated genes by expression microarray analysis in GC cell lines. The expression level of IGF2BP3 was observed in GC tissues comparing with non-tumorous gastric epitheliums. The up-regulated IGF2BP3 expression was associated with poor disease specific survival. IGF2BP3 knockdown significantly inhibited cell proliferation and invasion. Apart from copy number gain, IGF2BP3 has been confirmed to be negatively regulated by tumor-suppressive miRNA, namely miR-34a. The expression of miR-34a showed negative correlation with IGF2BP3 mRNA expression in primary GC samples and more importantly, re-overexpression of IGF2BP3 rescued the inhibitory effect of miR-34a. We compressively revealed the oncogenic role of IGF2BP3 in gastric tumorigenesis and confirmed its activation is partly due to the silence of miR-34a. Our findings identified useful prognostic biomarker and provided clinical translational potential.

Proportionate Dwarfism in Mice Lacking Heterochromatin Protein 1 Binding Protein 3 (HP1BP3) Is Associated With Alterations in the Endocrine IGF-1 Pathway

OpenAIRE

Garfinkel, Benjamin P.; Arad, Shiri; Le, Phuong T.; Bustin, Michael; Rosen, Clifford J.; Gabet, Yankel; Orly, Joseph

2015-01-01

Heterochromatin protein 1 binding protein 3 (HP1BP3) is a recently described histone H1-related protein with roles in chromatin structure and transcriptional regulation. To explore the potential physiological role of HP1BP3, we have previously described an Hp1bp3?/? mouse model with reduced postnatal viability and growth. We now find that these mice are proportionate dwarfs, with reduction in body weight, body length, and organ weight. In addition to their small size, microcomputed tomography...

Note: Coincidence measurements of 3He and neutrons from a compact D-D neutron generator

Science.gov (United States)

Ji, Q.; Lin, C.-J.; Tindall, C.; Garcia-Sciveres, M.; Schenkel, T.; Ludewigt, B. A.

2017-05-01

Tagging of neutrons (2.45 MeV) with their associated 3He particles from deuterium-deuterium (D-D) fusion reactions has been demonstrated in a compact neutron generator setup enabled by a high brightness, microwave-driven ion source with a high fraction of deuterons. Energy spectra with well separated peaks of the D-D fusion reaction products, 3He, tritons, and protons, were measured with a silicon PIN diode. The neutrons were detected using a liquid scintillator detector with pulse shape discrimination. By correlating the 3He detection events with the neutron detection in time, we demonstrated the tagging of emitted neutrons with 3He particles detected with a Si PIN diode detector mounted inside the neutron generator vacuum vessel.

Information about the new 8-group delayed neutron set preparation

International Nuclear Information System (INIS)

Svarny, J.

1998-01-01

Some comments to the present state concerning delayed neutron data preparation is given and preliminary analysis of the new 8-group delayed data (relative abundances) is presented. Comparisons of the 8-group to 6-group set is given for rod drop experiment (Unit 1, Cycle 14, NPP Dukovany).(Author)

Structure of orthorhombic SrZrO/sub 3/ by neutron powder diffraction

Energy Technology Data Exchange (ETDEWEB)

Ahtee, A; Ahtee, M [Helsinki Univ. (Finland). Dept. of Physics; Glazer, A M [Cambridge Univ. (UK). Cavendish Lab.; Hewat, A W [Institut Max von Laue - Paul Langevin, 38 - Grenoble (France)

1976-12-15

The room-temperature structure of SrZrO/sub 3/ has been established by neutron powder-profile refinement. The space group is Pbnm and SrZrO/sub 3/ is isostructural with other perovskites, such as CaTiO/sub 3/.

Hsp104 suppresses polyglutamine-induced degeneration post onset in a drosophila MJD/SCA3 model.

Directory of Open Access Journals (Sweden)

Mimi Cushman-Nick

Full Text Available There are no effective therapeutics that antagonize or reverse the protein-misfolding events underpinning polyglutamine (PolyQ disorders, including Spinocerebellar Ataxia Type-3 (SCA3. Here, we augment the proteostasis network of Drosophila SCA3 models with Hsp104, a powerful protein disaggregase from yeast, which is bafflingly absent from metazoa. Hsp104 suppressed eye degeneration caused by a C-terminal ataxin-3 (MJD fragment containing the pathogenic expanded PolyQ tract, but unexpectedly enhanced aggregation and toxicity of full-length pathogenic MJD. Hsp104 suppressed toxicity of MJD variants lacking a portion of the N-terminal deubiquitylase domain and full-length MJD variants unable to engage polyubiquitin, indicating that MJD-ubiquitin interactions hinder protective Hsp104 modalities. Importantly, in staging experiments, Hsp104 suppressed toxicity of a C-terminal MJD fragment when expressed after the onset of PolyQ-induced degeneration, whereas Hsp70 was ineffective. Thus, we establish the first disaggregase or chaperone treatment administered after the onset of pathogenic protein-induced degeneration that mitigates disease progression.

Energy dependence of relative abundances and periods of separate groups of delayed neutrons at neutron induced fission of 239Pu in a range of neutrons energies 0.37 - 5 MeV

International Nuclear Information System (INIS)

Roschenko, V.A.; Piksaikin, V.M.; Kazakov, L.E.; Isaev, S.G.; Korolev, G.G.; Tarasko, M.Z.; Tertychnyi, R.G.

2001-01-01

The fundamental role of delayed neutrons in behavior, control and safety of reactors is well known today. Delayed neutron data are of great interest not only for reactor physics but also for nuclear fission physics and astrophysics. The purpose of the present work was the measurement of energy dependence of delayed neutrons (DN) group parameters at fission of nuclei 239 Pu in a range of energies of primary neutrons from 0.37 up to 5 MeV. The measurements were executed on installation designed on the basis of the electrostatic accelerator of KG - 2.5 SSC RF IPPE. The data are obtained in 6-group representation. It is shown, that there is a significant energy dependence of DN group parameters in a range of primary neutrons energies from thermal meanings up to 5 MeV, which is expressed in reduction of the average half-life of nuclei of the DN precursors on 10 %. The data, received in the present work, can be used at creation of a set of group constants for reactors with an intermediate spectrum of neutrons. (authors)

Integrated system for production of neutronics and photonics calculational constants. Volume XVI. Tabular and graphical presentation of 175 neutron group constants derived from the LLL evaluated neutron data library (ENDL)

International Nuclear Information System (INIS)

Plechaty, E.F.; Cullen, D.E.; Howerton, R.J.; Kimlinger, J.R.

1975-01-01

As of February 3, 1975, 175 neutron group constants had been derived from the Evaluated Nuclear Data Library (ENDL) at LLL. In this volume, tables and graphs of the constants are presented along with the conventions used in their preparation. (U.S.)

[Clinical significance of NS1-BP expression in esophageal squamous cell carcinoma].

Science.gov (United States)

Ren, K; Qian, D; Wang, Y W; Pang, Q S; Zhang, W C; Yuan, Z Y; Wang, P

2018-01-23

Objective: To investigate the clinical significance of NS1-BP expression in patients with esophageal squamous cell carcinoma (ESCC), and to study the roles of NS1-BP in proliferation and apoptosis of ESCC cells. Methods: A total of 98 tumor tissues and 30 adjacent normal tissues from 98 ESCC patients were used as study group and control group, and these samples were collected in Sun Yat-Sen University Cancer Center between 2002 and 2008. In addition, 46 ESCC tissues which were collected in Cancer Institute and Hospital of Tianjin Medical University were used as validation group. Expression of mucosal NS1-BP was detected by immunohistochemistry. Kaplan-Meier curve and log-rank test were used to analyze the survival rate. Multivariate Cox proportional hazard model was used to analyze the prognostic factors. Furthermore, NS1-BP was over expressed or knocked down in ESCC cells by transient transfection. Protein levels of c-Myc were detected by western blot. Cell viability and apoptosis was analyzed by MTT assay and flow cytometry. Results: Among all of tested samples, NS1-BP were down-regulated in 9 out of 30 non-tumorous normal esophageal tissues (30.0%) and 85 out of 144 ESCC tissues (59.0%), respectively, showing a statistically significant difference ( P =0.012). In the study group, three-year disease-free survival rate of NS1-BP high expression group (53.2%) was significantly higher than that of NS1-BP low expression group (27.6%; P =0.009). In the validation group, the three-year disease-free survival rates were 57.8% and 25.5% in NS1-BP high and low levels groups, respectively, showing a similar results ( P =0.016). Importantly, multivariate analyses showed that low expression of NS1-BP was an independent predictor for chemoradiotherapy sensitivity and shorter disease-free survival time in ESCC patients( P <0.05 for all). Furthermore, overexpressed NS1-BP in TE-1 cells repressed c-Myc expression, inhibited cell proliferation and promoted apoptosis. In contrast

Syk-dependent tyrosine phosphorylation of 3BP2 is required for optimal FcRγ-mediated phagocytosis and chemokine expression in U937 cells.

Science.gov (United States)

Chihara, Kazuyasu; Kato, Yuji; Yoshiki, Hatsumi; Takeuchi, Kenji; Fujieda, Shigeharu; Sada, Kiyonao

2017-09-13

The adaptor protein c-Abl SH3 domain binding protein-2 (3BP2) is tyrosine phosphorylated by Syk in response to cross-linking of antigen receptors, which in turn activates various immune responses. Recently, a study using the mouse model of cherubism, a dominant inherited disorder caused by mutations in the gene encoding 3BP2, showed that 3BP2 is involved in the regulation of phagocytosis mediated by Fc receptor for IgG (FcγR) in macrophages. However, the molecular mechanisms underlying 3BP2-mediated regulation of phagocytosis and the physiological relevance of 3BP2 tyrosine phosphorylation remains elusive. In this study, we established various gene knockout U937 cell lines using the CRISPR/Cas9 system and found that 3BP2 is rapidly tyrosine phosphorylated by Syk in response to cross-linking of FcγRI. Depletion of 3BP2 caused significant reduction in the Fc receptor γ chain (FcRγ)-mediated phagocytosis in addition to the FcγRI-mediated induction of chemokine mRNA for IL-8, CCL3L3 and CCL4L2. Syk-dependent tyrosine phosphorylation of 3BP2 was required for overcoming these defects. Finally, we found that the PH and SH2 domains play important roles on FcγRI-mediated tyrosine phosphorylation of 3BP2 in HL-60 cells. Taken together, these results indicate that Syk-dependent tyrosine phosphorylation of 3BP2 is required for optimal FcRγ-mediated phagocytosis and chemokine expression.

AcEST: BP912712 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show BP912712...is mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, cl...one: YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI

Numeric algorithms for parallel processors computer architectures with applications to the few-groups neutron diffusion equations

International Nuclear Information System (INIS)

Zee, S.K.

1987-01-01

A numeric algorithm and an associated computer code were developed for the rapid solution of the finite-difference method representation of the few-group neutron-diffusion equations on parallel computers. Applications of the numeric algorithm on both SIMD (vector pipeline) and MIMD/SIMD (multi-CUP/vector pipeline) architectures were explored. The algorithm was successfully implemented in the two-group, 3-D neutron diffusion computer code named DIFPAR3D (DIFfusion PARallel 3-Dimension). Numerical-solution techniques used in the code include the Chebyshev polynomial acceleration technique in conjunction with the power method of outer iteration. For inner iterations, a parallel form of red-black (cyclic) line SOR with automated determination of group dependent relaxation factors and iteration numbers required to achieve specified inner iteration error tolerance is incorporated. The code employs a macroscopic depletion model with trace capability for selected fission products' transients and critical boron. In addition to this, moderator and fuel temperature feedback models are also incorporated into the DIFPAR3D code, for realistic simulation of power reactor cores. The physics models used were proven acceptable in separate benchmarking studies

Effect of CPAP Withdrawal on BP in OSA: Data from Three Randomized Controlled Trials.

Science.gov (United States)

Schwarz, Esther I; Schlatzer, Christian; Rossi, Valentina A; Stradling, John R; Kohler, Malcolm

2016-12-01

Based on meta-analyses, the BP-lowering effect of CPAP therapy in patients with OSA is reported to be approximately 2 to 3 mm Hg. This figure is derived from heterogeneous trials, which are often limited by poor CPAP adherence, and thus the treatment effect may possibly be underestimated. We analyzed morning BP data from three randomized controlled CPAP withdrawal trials, which included only patients with optimal CPAP compliance. Within the three trials, 149 patients with OSA who were receiving CPAP were randomized to continue therapeutic CPAP (n = 65) or to withdraw CPAP (n = 84) for 2 weeks. Morning BP was measured at home before and after sleep studies in the hospital. CPAP withdrawal was associated with a return of OSA (apnea-hypopnea index [AHI] at a baseline of 2.8/h and at follow-up of 33.2/h). Office systolic BP (SBP) increased in the CPAP withdrawal group compared with the CPAP continuation group by +5.4 mm Hg (95% CI, 1.8-8.9 mm Hg; P = .003) and in the home SBP group by +9.0 mm Hg (95% CI, 5.7-12.3 mm Hg; P CPAP withdrawal results in a clinically relevant increase in BP, which is considerably higher than in conventional CPAP trials; it is also underestimated when office BP is used. Greater OSA severity is associated with a higher BP rise in response to CPAP withdrawal. ClinicalTrials.gov; No.: NCT01332175 and NCT01797653) URL: www.clinicaltrials.gov and ISRCTN registry (ISRCTN 93153804) URL: http://www.isrctn.com/. Copyright © 2016 American College of Chest Physicians. Published by Elsevier Inc. All rights reserved.

Compilation of neutron flux density spectra and reaction rates in different neutron fields. V.3

International Nuclear Information System (INIS)

Ertek, C.

1980-04-01

Upon the recommendation of the International Working Group of Reactor Radiation Measurements (IWGRRM) a compilation of documents containing neutron flux density spectra and the reaction rates obtained by activiation and fission foils in different neutron fields is presented

3-D neutron transport benchmarks

International Nuclear Information System (INIS)

Takeda, T.; Ikeda, H.

1991-03-01

A set of 3-D neutron transport benchmark problems proposed by the Osaka University to NEACRP in 1988 has been calculated by many participants and the corresponding results are summarized in this report. The results of K eff , control rod worth and region-averaged fluxes for the four proposed core models, calculated by using various 3-D transport codes are compared and discussed. The calculational methods used were: Monte Carlo, Discrete Ordinates (Sn), Spherical Harmonics (Pn), Nodal Transport and others. The solutions of the four core models are quite useful as benchmarks for checking the validity of 3-D neutron transport codes

Enhancement of B-cell receptor signaling by a point mutation of adaptor protein 3BP2 identified in human inherited disease cherubism.

Science.gov (United States)

Ogi, Kazuhiro; Nakashima, Kenji; Chihara, Kazuyasu; Takeuchi, Kenji; Horiguchi, Tomoko; Fujieda, Shigeharu; Sada, Kiyonao

2011-09-01

Tyrosine phosphorylation of adaptor protein c-Abl-Src homology 3 (SH3) domain-binding protein-2 (3BP2, also referred to SH3BP2) positively regulates the B-cell antigen receptor (BCR)-mediated signal transduction, leading to the activation of nuclear factor of activated T cells (NFAT). Here we showed the effect of the proline to arginine substitution of 3BP2 in which is the most common mutation in patients with cherubism (P418R) on B-cell receptor signaling. Comparing to the wild type, overexpression of the mutant form of 3BP2 (3BP2-P416R, corresponding to P418R in human protein) enhanced BCR-mediated activation of NFAT. 3BP2-P416R increased the signaling complex formation with Syk, phospholipase C-γ2 (PLC-γ2), and Vav1. In contrast, 3BP2-P416R could not change the association with the negative regulator 14-3-3. Loss of the association mutant that was incapable to associate with 14-3-3 could not mimic BCR-mediated NFAT activation in Syk-deficient cells. Moreover, BCR-mediated phosphorylation of extracellular signal regulated kinase (ERK) and c-Jun N-terminal kinase (JNK) was not affected by P416R mutation. These results showed that P416R mutation of 3BP2 causes the gain of function in B cells by increasing the interaction with specific signaling molecules. © 2011 The Authors. Journal compilation © 2011 by the Molecular Biology Society of Japan/Blackwell Publishing Ltd.

Characteristics of the JRR-3M neutron guide tubes

International Nuclear Information System (INIS)

Suzuki, Masatoshi; Ichikawa, Hiroki; Kawabata, Yuji.

1993-01-01

Large scale neutron guide tubes have been installed in the upgraded JRR-3 (Japan Research Reactor No.3, JRR-3M). The total length of the guide tubes is 232m. The neutron fluxes and spectra were measured at the end of the neutron guide tubes. The neutron fluxes of thermal neutron guide tubes with characteristic wavelength of 2A are 1.2 x 10 8 n/cm 2 · s. The neutron fluxes of cold guide tubes are 1.4 x 10 8 n/cm 2 · s with characteristic wavelength of 4A and 2.0 x 10 8 n/cm 2 · s with 6A when the cold neutron source is operated. The neutron spectra measured by time-of-flight method agree well with their designed ones. (author)

Curves and tables of neutron cross sections of fission product nuclei in JENDL-3

Energy Technology Data Exchange (ETDEWEB)

Nakagawa, Tsuneo [ed.

1992-06-15

Neutron cross sections of 172 nuclei in the fission product region stored in JENDL-3 are shown in graphs and tables. The evaluation work of these nuclei was made by the Fission Product Nuclear Data Working Group of the Japanese Nuclear Data Committee, in the neutron energy region from 10{sup {minus}5} eV to 20 MeV. Almost of the cross section data reproduced in graphs in this report. The cross section averaged over 38 energy intervals are listed in a table. Shown in order tables are thermal cross sections, resonance integrals, Maxwellian neutron flux average cross sections, fission spectrum average cross sections, 14-MeV cross sections, one group average cross sections in neutron flux of typical types of fission reactors and average cross sections in the 30-keV Maxwellian spectrum.

Curves and tables of neutron cross sections of fission product nuclei in JENDL-3

International Nuclear Information System (INIS)

Nakagawa, Tsuneo

1992-06-01

Neutron cross sections of 172 nuclei in the fission product region stored in JENDL-3 are shown in graphs and tables. The evaluation work of these nuclei was made by the Fission Product Nuclear Data Working Group of the Japanese Nuclear Data Committee, in the neutron energy region from 10 -5 eV to 20 MeV. Almost all the cross section data are reproduced in graphs in this report. The cross section averaged over 38 energy intervals are listed in a table. Shown in other tables are thermal cross sections, resonance integrals, Maxwellian neutron flux average cross sections, fission spectrum average cross sections, 14-MeV cross sections, one group average cross sections in neutron flux of typical types of fission reactors and average cross sections in the 30-keV Maxwellian spectrum. (author)

Numerical analysis for multi-group neutron-diffusion equation using Radial Point Interpolation Method (RPIM)

International Nuclear Information System (INIS)

Kim, Kyung-O; Jeong, Hae Sun; Jo, Daeseong

2017-01-01

Highlights: • Employing the Radial Point Interpolation Method (RPIM) in numerical analysis of multi-group neutron-diffusion equation. • Establishing mathematical formation of modified multi-group neutron-diffusion equation by RPIM. • Performing the numerical analysis for 2D critical problem. - Abstract: A mesh-free method is introduced to overcome the drawbacks (e.g., mesh generation and connectivity definition between the meshes) of mesh-based (nodal) methods such as the finite-element method and finite-difference method. In particular, the Point Interpolation Method (PIM) using a radial basis function is employed in the numerical analysis for the multi-group neutron-diffusion equation. The benchmark calculations are performed for the 2D homogeneous and heterogeneous problems, and the Multiquadrics (MQ) and Gaussian (EXP) functions are employed to analyze the effect of the radial basis function on the numerical solution. Additionally, the effect of the dimensionless shape parameter in those functions on the calculation accuracy is evaluated. According to the results, the radial PIM (RPIM) can provide a highly accurate solution for the multiplication eigenvalue and the neutron flux distribution, and the numerical solution with the MQ radial basis function exhibits the stable accuracy with respect to the reference solutions compared with the other solution. The dimensionless shape parameter directly affects the calculation accuracy and computing time. Values between 1.87 and 3.0 for the benchmark problems considered in this study lead to the most accurate solution. The difference between the analytical and numerical results for the neutron flux is significantly increased in the edge of the problem geometry, even though the maximum difference is lower than 4%. This phenomenon seems to arise from the derivative boundary condition at (x,0) and (0,y) positions, and it may be necessary to introduce additional strategy (e.g., the method using fictitious points and

New isotopes of elements 104, 106 and 108 - highly stable superheavy nuclei

International Nuclear Information System (INIS)

Oganessian, Yuri

1994-01-01

In April 1993, as part of a joint Dubna-Livermore experiment at the Flerov Laboratory of Nuclear Reactions, new heavy isotopes of elements 104 and 106 were synthesized - 262 104, 265 106 and 266 106. Compared with the known even-even isotopes of elements 104 and 106, the new nuclei are characterized by their extraordinary high resistance to spontaneous fission. This is a direct proof of the macro-microscopic theory predictions in its version calculated by A.Sobiczewski et al. regarding a substantial increase in the half-lives of heavy nuclei near deformed shells with atomic number (Z) 108 and neutron number (N) 162.

Neutron multiplicity measurements with ³He alternative: Straw neutron detectors

Energy Technology Data Exchange (ETDEWEB)

Mukhopadhyay, Sanjoy [Arnold Avenue Andrews AFB, Joint Base Andrews, MD (United States); Wolff, Ronald [Arnold Avenue Andrews AFB, Joint Base Andrews, MD (United States); Detwiler, Ryan [Arnold Avenue Andrews AFB, Joint Base Andrews, MD (United States); Maurer, Richard [Arnold Avenue Andrews AFB, Joint Base Andrews, MD (United States); Mitchell, Stephen [National Security Technologies, LLC, Las Vegas, NV (United States); Guss, Paul [Remote Sensing Lab. - Nellis, Las Vegas, NV (United States); Lacy, Jeffrey L. [Proportional Technologies, Inc., Houston, TX (United States); Sun, Liang [Proportional Technologies, Inc., Houston, TX (United States); Athanasiades, Athanasios [Proportional Technologies, Inc., Houston, TX (United States)

2015-01-27

Counting neutrons emitted by special nuclear material (SNM) and differentiating them from the background neutrons of various origins is the most effective passive means of detecting SNM. Unfortunately, neutron detection, counting, and partitioning in a maritime environment are complex due to the presence of high-multiplicity spallation neutrons (commonly known as ‘‘ship effect ’’) and to the complicated nature of the neutron scattering in that environment. A prototype neutron detector was built using ¹⁰B as the converter in a special form factor called ‘‘straws’’ that would address the above problems by looking into the details of multiplicity distributions of neutrons originating from a fissioning source. This paper describes the straw neutron multiplicity counter (NMC) and assesses the performance with those of a commercially available fission meter. The prototype straw neutron detector provides a large-area, efficient, lightweight, more granular (than fission meter) neutron-responsive detection surface (to facilitate imaging) to enhance the ease of application of fission meters. Presented here are the results of preliminary investigations, modeling, and engineering considerations leading to the construction of this prototype. This design is capable of multiplicity and Feynman variance measurements. This prototype may lead to a near-term solution to the crisis that has arisen from the global scarcity of ³He by offering a viable alternative to fission meters. This paper describes the work performed during a 2-year site-directed research and development (SDRD) project that incorporated straw detectors for neutron multiplicity counting. The NMC is a two-panel detector system. We used ¹⁰B (in the form of enriched boron carbide: ¹⁰B₄C) for neutron detection instead of ³He. In the first year, the project worked with a panel of straw neutron detectors, investigated its characteristics, and

The methyl rotational potentials of Ga(CH sub 3) sub 3 derived by neutron spectroscopy

CERN Document Server

Prager, M; Parker, S F; Desmedt, A; Lechner, R E

2002-01-01

High resolution neutron spectra of Ga(CH sub 3) sub 3 show tunnelling transitions between 4.5 and 19 mu eV. The spectrum can be explained within the single-particle model on the basis of the monoclinic C2/c (Z = 16) low temperature crystal structure of Ga(CH sub 3) sub 3 with six inequivalent methyl groups in the unit cell. The overlapping tunnelling lines prevent the extraction of temperature dependent linewidths which would allow us to assign the librational energies measured in the phonon density of states. Classical rotational motion is studied by quasielastic neutron scattering. Three activation energies could be extracted. Methyl librations, tunnelling energies and barrier heights are combined with consistent intensities into rotational potentials. Only the concerted application of all spectroscopic techniques yields a conclusive description.

HAMMER, 1-D Multigroup Neutron Transport Infinite System Cell Calculation for Few-Group Diffusion Calculation

International Nuclear Information System (INIS)

Honeck, H.C.

1984-01-01

1 - Description of problem or function: HAMMER performs infinite lattice, one-dimensional cell multigroup calculations, followed (optionally) by one-dimensional, few-group, multi-region reactor calculations with neutron balance edits. 2 - Method of solution: Infinite lattice parameters are calculated by means of multigroup transport theory, composite reactor parameters by few-group diffusion theory. 3 - Restrictions on the complexity of the problem: - Cell calculations - maxima of: 30 thermal groups; 54 epithermal groups; 20 space points; 20 regions; 18 isotopes; 10 mixtures; 3 thermal up-scattering mixtures; 200 resonances per group; no overlap or interference; single level only. - Reactor calculations - maxima of : 40 regions; 40 mixtures; 250 space points; 4 groups

AcEST: BP921212 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000147_A09 361 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A09. BP921212 - Show BP921212...is mRNA. clone: YMU001_000147_A09. Accession BP921212 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921212|Adiantum capillus-veneris... mRNA, clone: YMU001_000147_A09. (361 letters) Database: uniprot_sprot.fasta 412,...itol-4,5-bisphosphate 3-ki... 30 2.9 sp|O14338|YB33_SCHPO Uncharacterized serine-rich protein C2F12.0... 29

Investigating the Role of the Arabidopsis Homologue of the Human G3BP in RNA Metabolism, Cellular Stress Responses and Innate Immunity

KAUST Repository

Abulfaraj, Aala A.

2018-04-01

Mitogen-activated protein kinases (MAPKs) belong to the most conserved signaling pathways and are found in all eukaryotes, including humans where they play important roles in various diseases and cancer. Stimulation of this signal transduction pathway by microbe-associated molecular patterns (MAMP) results in a multitude of events to regulate innate immune responses in Arabidopsis thaliana stimulating large-scale changes in gene expression. Starting from a phosphoproteomic screen in Arabidopsis thaliana wild type and mpk3, mpk4 and mpk6 mutants following microbe-associated molecular pattern (MAMP) treatment, several novel chromatin-associated proteins were identified that are differentially phosphorylated by stress-induced protein kinases. Arabidopsis Ras GTPase-activating protein SH3-domain-binding protein (AtG3BP-1) is a downstream putative substrate of the MAMP-stimulated MAPK pathway that is phosphorylated by MPK3, 4 and 6 in in vitro kinase assays. AtG3BP1 belongs to a highly conserved family of RNA-binding proteins in eukaryotes that link kinase receptormediated signaling to RNA metabolism. Here, we report the characterization of the Arabidopsis homolog of human G3BP1 in plant innate immunity. AtG3BP1 negatively regulates plant immunity and defense immune responses. Atg3bp1 mutant lines show constitutive stomata closure, expression of a number of key defense marker genes, and accumulate salicylic acid but not jasmonic acid. Furthermore, Atg3bp1 plants exhibit enhanced resistance to the biotrophic pathogen Pseudomonas syringae pv. tomato. Pathogen resistance was mediated by stomatal and apoplastic immunity in Atg3bp1. More generally, our data reinforce that AtG3BP1 is a key mediator of plant defense responses and transient expression of AtG3BP1 delivered striking disease resistance in the absence of yield penalty, highlighting a potential application of this gene in crop protection.

[Dectection of G3BP and CD44v6 in the tissues of laryngeal squamous cell carcinoma and their clinical significance].

Science.gov (United States)

Luo, Dahu; Lou, Weihua

2017-07-01

Objective To study the expressions of RNA-binding Ras-GAP SH3 binding protein (G3BP) and tumor stem cell marker CD44v6 in laryngeal squamous cell carcinoma and their correlations with angiogenesis. Methods We collected the cancer tissues and corresponding paracancerous tissues from 56 patients with laryngeal squamous cell carcinoma. The expressions of G3BP and CD44v6 proteins were detected by Western blotting in cancer tissues and corresponding paracancerous tissues; the expressions of G3BP, CD44v6 and vascular endothelial growth factor A (VEGF-A) were tested by immunohistochemistry. Thereafter, we compared the positive expression rates of G3BP and CD44v6 between in cancer tissues and in normal tissues, analyzed the correlations between the expressions of G3BP, CD44v6 and the laryngeal squamous cell carcinoma features as well as their correlations with microvessel density (MVD) that was determined by FVIIIAg immunohistochemistry. Results Western blotting showed that the expressions of G3BP and CD44v6 proteins in the laryngeal squamous cell carcinoma were higher than those in the paracancerous tissues. Immunohistochemistry showed that compared with the paracancerous tissues, G3BP, CD44v6 and VEGF-A expressions (the positive rates are 58.9%, 53.6%, 46.4%, respectively) were higher in cancer tissues. The positive rates of G3BP and CD44v6 in cancer tissues were related with the clinical stage, recurrence or metastasis, and lymph node metastasis of laryngeal squamous cell carcinoma, but had nothing to do with patients' age and tumor size. Pearson correlation analysis showed the expressions of both G3BP and CD44v6 were positively correlated with VEGF-A (r=0.741, r=0.756). MVD values were significantly higher in the G3BP and CD44v6 positive cases than in paracancerous tissues, but there was no difference in MVD between those without G3BP and CD44v6 positive expressions and the paracancerous tissues. Conclusion The positive expression rates of G3BP and CD44v6 in laryngeal

Neutron detection using Dy2O3 activation detectors

International Nuclear Information System (INIS)

Gomaa, M.A.; Mohamed, E.J.

1979-01-01

The aim of the present study is to examine the usefulness of Dy 2 O 3 not only as thermal neutron activation detector but also as a fast neutron detector. For thermal neutrons, the half life of 165 Dy is measured to be (141 +- 6) min, its response to thermal neutrons is (2.18 +- 0.01) cpm/ncm -2 s -1 for a 250 mg Dy 2 O 3 pellet. For fast neutrons the Dy 2 O 3 detector is placed within a 20 cm polyethylene sphere and its response is found to be (2.2 +- 0.1) cpm/ncm -2 s -1 for 4 MeV neutrons and (2.10 +- 0.04) cpm/ncm -2 s -1 for 14 MeV neutrons. For neutron dosimetry, its response is found to be (16.7 +- 0.4) cpm per mrem h -1 . (author)

Crystal structure of the G3BP2 NTF2-like domain in complex with a canonical FGDF motif peptide.

Science.gov (United States)

Kristensen, Ole

2015-11-06

The crystal structure of the NTF2-like domain of the human Ras GTPase SH3 Binding Protein (G3BP), isoform 2, was determined at a resolution of 2.75 Å in complex with a peptide containing a FGDF sequence motif. The overall structure of the protein is highly similar to the homodimeric N-terminal domains of the G3BP1 and Rasputin proteins. Recently, a subset of G3BP interacting proteins was recognized to share a common sequence motif, FGDF. The most studied binding partners, USP10 and viral nsP3, interfere with essential G3BP functions related to assembly of cellular stress granules. Reported molecular modeling suggested that FGDF-motif containing peptides bind in an extended conformation into a hydrophobic groove on the surface of the G3BP NTF2-like domain in a manner similar to the known binding of FxFG nucleoporin repeats. The results in this paper provide evidence for a different binding mode. The FGDF peptide binds and changes conformation of the protruding N-terminal residues by providing hydrophobic interactions to a symmetry related molecule that facilitated crystallization of the G3BP2 isoform. Copyright © 2015 Elsevier Inc. All rights reserved.

Studies on the chemistry of element 104 with the centrifuge system SISAK-3

Energy Technology Data Exchange (ETDEWEB)

Eberhardt, K.; Kratz, J.V.; Mendel, M.; Naehler, A.; Trautmann, N.; Wiehl, N. [Mainz Univ. (Germany); Alstadt, J.; Omtvedt, J.P. [Oslo Univ. (Norway); Malmbeck, R.; Skarnemark, G.; Wierczinski, B. [Chalmers Univ. of Technology, Goeteborg (Sweden); Eichler, B.; Gaeggeler, H.W.; Jost, D.T.; Tuerler, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

1997-09-01

The centrifuge system SISAK-3 combined with a detector for the measurement of {alpha}-particles and spontaneous fission (SF) fragments in a flowing organic liquid has been applied to study the chemical behaviour of element 104 produced in the reaction {sup 248}Cm({sup 18}O,5n){sup 261}104. (author) 2 figs., 2 refs.

Influence of relativistic effect on chemical properties of element 104; Wplyw efektu relatywistycznego na wlasnosci chemiczne pierwiastka 104

Energy Technology Data Exchange (ETDEWEB)

Bilewicz, A.

1997-12-31

The influence of relativistic effect upon chemical properties of element 104 is discussed. An original method of measurements of adsorption on the surface of thin film of cobalt ferrocyanate was developed and applied for the studies of 104{sup 4+} hydrolysis. Results of this experiments indicate that in the Group 4 tendency to hydrolysis decreases in the order 104{sup 4+}>Zr{sup 4+}>Hf{sup 4+}. The results were explained on the basis of relativistic effect. Unexpected chemical properties of element 104 in aqueous solutions indicate, that due to relativistic effect element 104 differs distinctly from its congeners - Zr and Hf. In contrary it becomes similar to the lightest element in the Group, Ti, through atomic mass of latter is 213 unit less. (author). 119 refs, 22 figs, 7 tabs.

Study on (d,t) reaction in the 100, 102 and 104 ruthenium isotopes

International Nuclear Information System (INIS)

Duarte, J.L.M.

1990-01-01

Neutron-hole components in 99, 101, 103 Ru isotopes were investigated by (d,t) reactions at incident deuteron energies of 15.5 MeV and 16 MeV on, respectively, 100 Ru and 102 , 104 Ru. Outgoing triton groups were momentum analyzed by a magnetic spectrograph and detected in nuclear emulsion plates with an energy resolution better than 8 KeV. A total of 14,36 and 46 levels up to 1.4, 2.1 2.5 MeV excitation energy were identified, respectively, in 99 , 101 , 103 Ru. The transferred orbital angular momenta, l, and the spectroscopic strengths were obtained by comparing experimental angular distributions, measured at carefully chosen scattering angles between 8 0 C and 46 0 C, with Distorted Wave Born Approximation predictions. The analysis of the spectroscopic strength distributions corresponding to each l-value reveals a similar pattern among the three isotopes, although there is a shift of the highest strengths towards low energy, for increasing neutron number, indicating increasing deformation. Special attention is drawn to transitions to low-lying states with l=3 and l=1 character, associated with the next major shell, whose description is discussed in terms of a quasiparticle-prolate non-rigid rotor model with the Coriolis effect fully treated, and the Interacting Boson-Fermion Model. (author)

Let-7b Regulates Myoblast Proliferation by Inhibiting IGF2BP3 Expression in Dwarf and Normal Chicken

Science.gov (United States)

Lin, Shumao; Luo, Wen; Ye, Yaqiong; Bekele, Endashaw J.; Nie, Qinghua; Li, Yugu; Zhang, Xiquan

2017-01-01

The sex-linked dwarf chicken is caused by the mutation of growth hormone receptor (GHR) gene and characterized by shorter shanks, lower body weight, smaller muscle fiber diameter and fewer muscle fiber number. However, the precise regulatory pathways that lead to the inhibition of skeletal muscle growth in dwarf chickens still remain unclear. Here we found a let-7b mediated pathway might play important role in the regulation of dwarf chicken skeletal muscle growth. Let-7b has higher expression in the skeletal muscle of dwarf chicken than in normal chicken, and the expression of insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3), which is a translational activator of IGF2, showed opposite expression trend to let-7b. In vitro cellular assays validated that let-7b directly inhibits IGF2BP3 expression through binding to its 3′UTR region, and the protein level but not mRNA level of IGF2 would be reduced in let-7b overexpressed chicken myoblast. Let-7b can inhibit cell proliferation and induce cell cycle arrest in chicken myoblast through let-7b-IGF2BP3-IGF2 signaling pathway. Additionally, let-7b can also regulate skeletal muscle growth through let-7b-GHR-GHR downstream genes pathway, but this pathway is non-existent in dwarf chicken because of the deletion mutation of GHR 3′UTR. Notably, as the loss binding site of GHR for let-7b, let-7b has enhanced its binding and inhibition on IGF2BP3 in dwarf myoblast, suggesting that the miRNA can balance its inhibiting effect through dynamic regulate its binding to target genes. Collectively, these results not only indicate that let-7b can inhibit skeletal muscle growth through let-7b-IGF2BP3-IGF2 signaling pathway, but also show that let-7b regulates myoblast proliferation by inhibiting IGF2BP3 expression in dwarf and normal chickens. PMID:28736533

Crystal structures of the human G3BP1 NTF2-like domain visualize FxFG Nup Repeat Specificity

DEFF Research Database (Denmark)

Vognsen, Tina Reinholdt; Möller, Ingvar Rúnar; Kristensen, Ole

2013-01-01

Ras GTPase Activating Protein SH3 Domain Binding Protein (G3BP) is a potential anti-cancer drug target implicated in several cellular functions. We have used protein crystallography to solve crystal structures of the human G3BP1 NTF2-like domain both alone and in complex with an FxFG Nup repeat...... peptide. Despite high structural similarity, the FxFG binding site is located between two alpha helices in the G3BP1 NTF2-like domain and not at the dimer interface as observed for nuclear transport factor 2. ITC studies showed specificity towards the FxFG motif but not FG and GLFG motifs. The unliganded...

Reports from the working group on neutron scattering

International Nuclear Information System (INIS)

1979-06-01

The present report contains papers dating from July 1978 until May 1979. During this period the experimental facilities have been expanded; a new four-circuit neutron spectrometer was installed and, together with the Fritz Hafer Institute, a measuring point was set up for investigations of ideal crystals, the Compton scattering equipment has been essentially improved. The report contains a contribution on the mechanics and the control of the neutron diffractometers existing at BER II. The main subjects of the scientific research work were magnetic structures and phase transitions, electron densities and chemical bonds, structure and dynamics of molecular crystals. At the BER II reactor measuring opportunities could be offered to a number of guest groups. Their research activities are reported, too. In addition to those made at the Berlin reactor BER II measurements could be made at the accelerator VICKSI of the Hahn-Meitner Institute and at the reactors of the Institute Laue-Langevin at Grenoble and of the Research Establishment at Riso by the working groups. (orig.) [de

Improved neutron-gamma discrimination for a 3He neutron detector using subspace learning methods

Science.gov (United States)

Wang, C. L.; Funk, L. L.; Riedel, R. A.; Berry, K. D.

2017-05-01

3He gas based neutron Linear-Position-Sensitive Detectors (LPSDs) have been used for many neutron scattering instruments. Traditional Pulse-height Analysis (PHA) for Neutron-Gamma Discrimination (NGD) resulted in the neutron-gamma efficiency ratio (NGD ratio) on the order of 105-106. The NGD ratios of 3He detectors need to be improved for even better scientific results from neutron scattering. Digital Signal Processing (DSP) analyses of waveforms were proposed for obtaining better NGD ratios, based on features extracted from rise-time, pulse amplitude, charge integration, a simplified Wiener filter, and the cross-correlation between individual and template waveforms of neutron and gamma events. Fisher Linear Discriminant Analysis (FLDA) and three Multivariate Analyses (MVAs) of the features were performed. The NGD ratios are improved by about 102-103 times compared with the traditional PHA method. Our results indicate the NGD capabilities of 3He tube detectors can be significantly improved with subspace-learning based methods, which may result in a reduced data-collection time and better data quality for further data reduction.

Three-group albedo method applied to the diffusion phenomenon with up-scattering of neutrons

International Nuclear Information System (INIS)

Terra, Andre M. Barge Pontes Torres; Silva, Jorge A. Valle da; Cabral, Ronaldo G.

2007-01-01

The main objective of this research is to develop a three-group neutron Albedo algorithm considering the up-scattering of neutrons in order to analyse the diffusion phenomenon in nonmultiplying media. The neutron Albedo method is an analytical method that does not try to solve describing explicit equations for the neutron fluxes. Thus the neutron Albedo methodology is very different from the conventional methodology, as the neutron diffusion theory model. Graphite is analyzed as a model case. One major application is in the determination of the nonleakage probabilities with more understandable results in physical terms than conventional radiation transport method calculations. (author)

AcEST: BP912112 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_C08 546 Adiantum capillus-veneris mRNA. clone: YMU001_000015_C08. BP912112 - Show BP912112...is mRNA. clone: YMU001_000015_C08. Accession BP912112 Tissue type prothallium Developmental stage - Contig I...Arabidopsis thaliana Align length 171 Score (bit) 121.0 E-value 3.0e-27 Report BLASTX 2.2.19 [Nov-02-2008] R... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912112|Adiantum capillus-veneri...s mRNA, clone: YMU001_000015_C08. (546 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765

MURALB - a programme for calculating neutron fluxes in many groups

International Nuclear Information System (INIS)

MacDougall, J.

1977-09-01

The program MURALB solves the multi-group transport equation (with no upscatter) in many equal lethargy groups to produce neutron fluxes in these groups. The code has been made very flexible by confining the spatial flux solution to a single subroutine which takes as input the cross section data and source for a single group and calculates the flux for that group. In this way by supplying different versions of this routine different geometries and methods of solution of the transport equation may be treated. At present plane, cylindrical and spherical diffusion theory and collision probability solutions are available, together with a two region collision probability solution for a rod in a square cell. There is no basic restriction to one dimension but the practical size of problem tends to be limited to about 30 spatial regions by core storage requirements. In addition to the flux solution, the code calculates neutron balance, reaction rates and few groups cross sections for each mesh region, together with the values averaged over the system (cell or reactor). The program is available both as a stand-alone code and integrated into the COSMOS system. (author)

X-ray and neutron diffraction study of alums. Pt. 2 and 3

International Nuclear Information System (INIS)

Abdeen, A.M.; Will, G.; Schaefer, W.; Kirfel, A.; Bargouth, M.O.; Recker, K.; Weiss, A.

1981-01-01

The crystal structure of the alums, (NH 3 CH 3 )Al(SO 4 ) 2 x 12 H 2 0 and (NH 4 )AL(SO 4 ) 2 x 12 H 2 0, has been determined and refined from X-ray and neutron diffraction data. The compounds crystallize cubic in space group Pa3 (Z = 4). The positional and thermal parameters of all atoms including hydrogens have been refined by full matrix least-sqares analysis resulting in Rsub(w) values from the X-ray and neutron data of 0.030 and 0.029 respectively for the methylammonium alum and of 0.024 and 0.014 respectively for the ammonium alum. The atoms of the cation groups (NH 3 CH 3 ) + and (NH 4 ) + are distributed on 8(c) and 24(d) positions in two orientations of equal probability on and around the [111] direction related to each other by an inversion centre. The disorder in the cation groups is explained by a quantized rotation. Disorder in the sulfate groups has been determined to 4.2% for the methylammonium alum and to about 17% for the ammonium alum. The disordered sulfate tetrahedra are distorted and in a reversed orientation along the threefold axis. The system of the hydrogen bonds is discussed. (orig.)

A heterozygous 21-bp deletion in CAPN3 causes dominantly inherited limb girdle muscular dystrophy

DEFF Research Database (Denmark)

Vissing, John; Barresi, Rita; Witting, Nanna

2016-01-01

screening. In this investigation, we report 37 individuals (age range: 21-85 years, 21 females and 16 males) from 10 families in whom only one mutation in CAPN3 could be identified; a 21-bp, in-frame deletion (c.643_663del21). This mutation co-segregated with evidence of muscle disease and autosomal...... not affect mRNA maturation. Calpain 3 expression in muscle, assessed by western blot, was below 15% of normal levels in the nine mutation carriers in whom this could be tested. Haplotype analysis in four families from three different countries suggests that the 21-bp deletion is a founder mutation...

Total neutron cross section for 181Ta

Directory of Open Access Journals (Sweden)

Schilling K.-D.

2010-10-01

Full Text Available The neutron time of flight facility nELBE, produces fast neutrons in the energy range from 0.1 MeV to 10 MeV by impinging a pulsed relativistic electron beam on a liquid lead circuit [1]. The short beam pulses (∼10 ps and a small radiator volume give an energy resolution better than 1% at 1 MeV using a short flight path of about 6 m, for neutron TOF measurements. The present neutron source provides 2 ⋅ 104  n/cm2s at the target position using an electron charge of 77 pC and 100 kHz pulse repetition rate. This neutron intensity enables to measure neutron total cross section with a 2%–5% statistical uncertainty within a few days. In February 2008, neutron radiator, plastic detector [2] and data acquisition system were tested by measurements of the neutron total cross section for 181Ta and 27Al. Measurement of 181Ta was chosen because lack of high quality data in an anergy region below 700 keV. The total neutron cross – section for 27Al was measured as a control target, since there exists data for 27Al with high resolution and low statistical error [3].

Characterization of Periplasmic Protein BP26 Epitopes of Brucella melitensis Reacting with Murine Monoclonal and Sheep Antibodies

Science.gov (United States)

Wu, Jingbo; Zhang, Hui; Wang, Yuanzhi; Qiao, Jun; Chen, Chuangfu; Gao, Goege F.; Allain, Jean-Pierre; Li, Chengyao

2012-01-01

More than 35,000 new cases of human brucellosis were reported in 2010 by the Chinese Center for Disease Control and Prevention. An attenuated B. melitensis vaccine M5-90 is currently used for vaccination of sheep and goats in China. In the study, a periplasmic protein BP26 from M5-90 was characterized for its epitope reactivity with mouse monoclonal and sheep antibodies. A total of 29 monoclonal antibodies (mAbs) against recombinant BP26 (rBP26) were produced, which were tested for reactivity with a panel of BP26 peptides, three truncated rBP26 and native BP26 containing membrane protein extracts (NMP) of B. melitensis M5-90 in ELISA and Western-Blot. The linear, semi-conformational and conformational epitopes from native BP26 were identified. Two linear epitopes recognized by mAbs were revealed by 28 of 16mer overlapping peptides, which were accurately mapped as the core motif of amino acid residues 93DRDLQTGGI101 (position 93 to 101) or residues 104QPIYVYPD111, respectively. The reactivity of linear epitope peptides, rBP26 and NMP was tested with 137 sheep sera by ELISAs, of which the two linear epitopes had 65–70% reactivity and NMP 90% consistent with the results of a combination of two standard serological tests. The results were helpful for evaluating the reactivity of BP26 antigen in M5-90. PMID:22457830

Mid-wavelength infrared unipolar nBp superlattice photodetector

Science.gov (United States)

Kazemi, Alireza; Myers, Stephen; Taghipour, Zahra; Mathews, Sen; Schuler-Sandy, Ted; Lee, Seunghyun; Cowan, Vincent M.; Garduno, Eli; Steenbergen, Elizabeth; Morath, Christian; Ariyawansa, Gamini; Scheihing, John; Krishna, Sanjay

2018-01-01

We report a Mid-Wavelength Infrared (MWIR) barrier photodetector based on the InAs/GaSb/AlSb type-II superlattice (T2SL) material system. The nBp design consists of a single unipolar barrier (InAs/AlSb SL) placed between a 4 μm thick p-doped absorber (InAs/GaSb SL) and an n-type contact layer (InAs/GaSb SL). At 80 K, the device exhibited a 50% cut-off wavelength of 5 μm, was fully turned-ON at zero bias and the measured QE was 50% (front side illumination with no AR coating) at 4.5 μm with a dark current density of 4.7 × 10-6 A/cm2 at Vb = 50 mV. At 150 K and Vb = 50 mV, the 50% cut-off wavelength increased to 5.3 μm, and the QE was 54% at 4.5 μm with a dark current of 5.0 × 10-4 A/cm2.

A novel mutation in the SH3BP2 gene causes cherubism: case report

Directory of Open Access Journals (Sweden)

Yu Shi-Feng

2006-12-01

Full Text Available Abstract Background Cherubism is a rare hereditary multi-cystic disease of the jaws, characterized by its typical appearance in early childhood, and stabilization and remission after puberty. It is genetically transmitted in an autosomal dominant fashion and the gene coding for SH3-binding protein 2 (SH3BP2 may be involved. Case presentation We investigated a family consisting of 21 members with 3 female affected individuals with cherubism from Northern China. Of these 21 family members, 17 were recruited for the genetic analysis. We conducted the direct sequence analysis of the SH3BP2 gene among these 17 family members. A disease-causing mutation was identified in exon 9 of the gene. It was an A1517G base change, which leads to a D419G amino acid substitution. Conclusion To our knowledge, the A1517G mutation has not been reported previously in cherubism. This finding is novel.

Fundamentals of 3-D Neutron Kinetics and Current Status

International Nuclear Information System (INIS)

Aragones, J.M.

2008-01-01

This lecture includes the following topics: 1) A summary of the cell and lattice calculations used to generate the neutron reaction data for neutron kinetics, including the spectral and burnup calculations of LWR cells and fuel assembly lattices, and the main nodal kinetics parameters: mean neutron generation time and delayed neutron fraction; 2) the features of the advanced nodal methods for 3-D LWR core physics, including the treatment of partially inserted control rods, fuel assembly grids, fuel burnup and xenon and samarium transients, and excore detector responses, that are essential for core surveillance, axial offset control and operating transient analysis; 3) the advanced nodal methods for 3-D LWR core neutron kinetics (best estimate safety analysis, real-time simulation); and 4) example applications to 3-D neutron kinetics problems in transient analysis of PWR cores, including model, benchmark and operational transients without, or with simple, thermal-hydraulics feedback.

Neutron to proton mass difference, parton distribution functions and baryon resonances from dynamics on the Lie group u(3)

DEFF Research Database (Denmark)

Trinhammer, Ole

PiMinus invariant mass in B decays. We give a controversial prediction of the relative neutron to proton mass difference 0.138 % as originating in period doublings of certain parametric states. The group space dynamics communicates with real space via the exterior derivative which projects out quark and gluon...

Summary report for MEGAPIE R+D Task Group X9: Neutronic and nuclear assessment

International Nuclear Information System (INIS)

Zanini, L.

2005-12-01

The comprehensive work performed by the R+D task group X9 since the beginning of the MEGAPIE initiative is described in this summary report. The list of topics covered by this group is large and covers many of the essential aspects of an innovative system such as the MEGAPIE target. The X9 group worked on the neutronic and nuclear related aspects of the target design, as summarized in the following. The main tool in the neutronic design of a spallation neutron target is a reliable particle transport code, and nowadays the Monte Carlo technique is widely adopted in this field. There are several codes which are more or less extensively used in the nuclear physics community; at the beginning of the project a benchmark exercise was performed among several institutes using different Monte Carlo codes. The aim of the benchmark was to perform a code intercomparison by looking at the different predictions of several important quantities, as described later in the report. The benchmark results were first compiled in two separate reports. The results are critically discussed here. Based on the obtained results, and considering also other factors such as the code maintenance, the codes FLUKA and MCNPX were indicated as the most recommended ones to be used in the continuation of the X9 work. Proton and neutron fluxes in the MEGAPIE target were calculated. Detailed models of he MEGAPIE target and of the surrounding SINQ facility were developed, as well as of the present solid SINQ target. A comparison between the neutron flux with MEGAPIE and the SINQ solid target showed that the MEGAPIE target sill deliver 40% to 50% more thermal neutrons to the instruments served by SINQ as compared to the SINQ Mark 3 target. Calculations of the beam power deposition distributions are essential as input for the thermohydraulics CFD analysis of the lower target. Power deposition was calculated with FLUKA and MCNPX. The results from the two codes agree within 5%. Approximately 85% of the beam

Summary report for MEGAPIE R+D Task Group X9: Neutronic and nuclear assessment

Energy Technology Data Exchange (ETDEWEB)

Zanini, L

2005-12-15

The comprehensive work performed by the R+D task group X9 since the beginning of the MEGAPIE initiative is described in this summary report. The list of topics covered by this group is large and covers many of the essential aspects of an innovative system such as the MEGAPIE target. The X9 group worked on the neutronic and nuclear related aspects of the target design, as summarized in the following. The main tool in the neutronic design of a spallation neutron target is a reliable particle transport code, and nowadays the Monte Carlo technique is widely adopted in this field. There are several codes which are more or less extensively used in the nuclear physics community; at the beginning of the project a benchmark exercise was performed among several institutes using different Monte Carlo codes. The aim of the benchmark was to perform a code intercomparison by looking at the different predictions of several important quantities, as described later in the report. The benchmark results were first compiled in two separate reports. The results are critically discussed here. Based on the obtained results, and considering also other factors such as the code maintenance, the codes FLUKA and MCNPX were indicated as the most recommended ones to be used in the continuation of the X9 work. Proton and neutron fluxes in the MEGAPIE target were calculated. Detailed models of he MEGAPIE target and of the surrounding SINQ facility were developed, as well as of the present solid SINQ target. A comparison between the neutron flux with MEGAPIE and the SINQ solid target showed that the MEGAPIE target sill deliver 40% to 50% more thermal neutrons to the instruments served by SINQ as compared to the SINQ Mark 3 target. Calculations of the beam power deposition distributions are essential as input for the thermohydraulics CFD analysis of the lower target. Power deposition was calculated with FLUKA and MCNPX. The results from the two codes agree within 5%. Approximately 85% of the beam

Functional interaction between type III-secreted protein IncA of Chlamydophila psittaci and human G3BP1.

Science.gov (United States)

Borth, Nicole; Litsche, Katrin; Franke, Claudia; Sachse, Konrad; Saluz, Hans Peter; Hänel, Frank

2011-01-31

Chlamydophila (Cp.) psittaci, the causative agent of psittacosis in birds and humans, is the most important zoonotic pathogen of the family Chlamydiaceae. These obligate intracellular bacteria are distinguished by a unique biphasic developmental cycle, which includes proliferation in a membrane-bound compartment termed inclusion. All Chlamydiaceae spp. possess a coding capacity for core components of a Type III secretion apparatus, which mediates specific delivery of anti-host effector proteins either into the chlamydial inclusion membrane or into the cytoplasm of target eukaryotic cells. Here we describe the interaction between Type III-secreted protein IncA of Cp. psittaci and host protein G3BP1 in a yeast two-hybrid system. In GST-pull down and co-immunoprecipitation experiments both in vitro and in vivo interaction between full-length IncA and G3BP1 were shown. Using fluorescence microscopy, the localization of G3BP1 near the inclusion membrane of Cp. psittaci-infected Hep-2 cells was demonstrated. Notably, infection of Hep-2 cells with Cp. psittaci and overexpression of IncA in HEK293 cells led to a decrease in c-Myc protein concentration. This effect could be ascribed to the interaction between IncA and G3BP1 since overexpression of an IncA mutant construct disabled to interact with G3BP1 failed to reduce c-Myc concentration. We hypothesize that lowering the host cell c-Myc protein concentration may be part of a strategy employed by Cp. psittaci to avoid apoptosis and scale down host cell proliferation.

Performance Test of BF3 Neutron Detection System

Energy Technology Data Exchange (ETDEWEB)

Choi, Yu Sun; Shin, Ho Cheol [KHNP-CRI, Daejeon (Korea, Republic of); Cho, Jin Bok; Oh, Sae Hyun; Ryou, Seok Jean [USERS, Daejeon (Korea, Republic of)

2015-10-15

The neutron detecting system of First-of-a-kind plant such an APR1400 at Shin Kori should have been verified in the condition of low operating temperature and pressure of the primary coolant system before receiving the operation license. Auxiliary Ex-core Neutron Flux Monitoring System (AENFMS) is supposed to be installed using BF3 neutron detector in Shin Kori plant. The performance test of AENFMS was conducted to measure neutron sensitivity, moderation ratio and count rate in the same condition with Ex-core Neutron Flux Monitoring System (ENFMS) of APR1400 to verify its detection characteristics in compliance with the functional requirement. Performance test has been conducted for AENFMS of APR1400 to verify BF3 neutron sensitivity, moderation ration of PE, expecting neutron signal count rate from AENFMS, possible extending cable length from detector to pre-amplifier. As a result of measurement, the neutron sensitivity of 34.246±0.168(95%CI)cps/nv, moderation ratio of 11.343±0.039(95%CI) and AENFMS expecting count rate related to ENFMS of 17.8 times are acceptable in compliance with functional requirement, respectively.

Little Boy neutron spectrum below 3 MeV

International Nuclear Information System (INIS)

Evans, A.E.; Bennett, E.F.; Yule, T.J.

1984-01-01

The leakage neutron spectrum from the Little Boy replica has been measured from 12 keV to 3 MeV using a high-resolution 3 He ionization chamber, and from 1 keV to 3 MeV using proton-recoil proportional counters. The 3 He-spectrometer measurements were made at distances of 0.75 and 2.0 m from the active center and at angles of 0 0 , 45 0 , and 90 0 with respect to the axis of the assembly. Proton-recoil measurments were made at 90 0 to the assembly axis at distances of 0.75 and 2.0 m, with a shielded measurement made at 2.0 m to estimate background due to scattering. The 3 He spectrometer was calibrated at Los Alamos using monoenergetic 7 Li(p,n) 7 Be neutrons to generate a family of response functions. The proton-recoil counters were calibrated at Argonne by studying the capture of thermal neutrons by nitrogen in the counters, by observation of the 24-keV neutron resonance in iron, and by relating to the known hydrogen content of the counters. The neutron spectrum from Little Boy was found to be highly structured, with peaks corresponding to minima in the iron total neutron cross section. In particular, influence of the 24-keV iron window was evident in both sets of spectra. The measurements provide information for dosimetry calculations and also a valuable intercomparison of neutron spectrometry using the two different detector types. Spectra measured with both detectors are in essential agreement. 8 references, 7 figures, 2 tables

Expanding the BP1-BP2 15q11.2 Microdeletion Phenotype: Tracheoesophageal Fistula and Congenital Cataracts

Directory of Open Access Journals (Sweden)

D. Wong

2013-01-01

Full Text Available The proximal q arm of chromosome 15 contains breakpoint regions BP1–BP5 with the classic deletion of BP1–BP3 best known to be associated with Prader-Willi and Angelman syndromes. The region is approximately 500 kb and microdeletions within the BP1-BP2 region have been reported in patients with developmental delay, behavioral abnormalities, and motor apraxia as well as dysmorphic features including hypertelorism, cleft or narrow palate, ear abnormalities, and recurrent upper airway infections. We report two patients with unique, never-before-reported 15q11.2 BP1-2 microdeletion syndrome findings, one with proximal esophageal atresia and distal tracheoesophageal fistula (type C and one with congenital cataracts. Cataracts have been described in Prader-Willi syndrome but we could not find any description of cataracts in Angelman syndrome. Esophageal atresia and tracheoesophageal fistula have not been reported to our knowledge in either syndrome. A chance exists that both cases are sporadic birth defects; however, the findings of the concomitant microdeletion cannot be overlooked as a possible cause. Based on our review of the literature and the presentation of our patients, we recommend that esophageal atresia and distal tracheoesophageal fistula as well as congenital cataracts be included in the phenotypic spectrum of 15q11.2 BP1-2 microdeletion syndrome.

A re-sequencing based assessment of genomic heterogeneity and fast neutron-induced deletions in a common bean cultivar

Directory of Open Access Journals (Sweden)

Jamie A. O'Rourke

2013-06-01

Full Text Available A small fast neutron mutant population has been established from Phaseolus vulgaris cv. Red Hawk. We leveraged the available P. vulgaris genome sequence and high throughput next generation DNA sequencing to examine the genomic structure of five Phaseolus vulgaris cv. Red Hawk fast neutron mutants with striking visual phenotypes. Analysis of these genomes identified three classes of structural variation; between cultivar variation, natural variation within the fast neutron mutant population, and fast neutron induced mutagenesis. Our analyses focused on the latter two classes. We identified 23 large deletions (>40 bp common to multiple individuals, illustrating residual heterogeneity and regions of structural variation within the common bean cv. Red Hawk. An additional 18 large deletions were identified in individual mutant plants. These deletions, ranging in size from 40 bp to 43,000 bp, are potentially the result of fast neutron mutagenesis. Six of the 18 deletions lie near or within gene coding regions, identifying potential candidate genes causing the mutant phenotype.

The cold neutron facility of the JRR-3M

International Nuclear Information System (INIS)

Kumai, T.; Suzuki, M.; Kakefuda, K.

1992-01-01

A description is given of a cold neutron source and neutron guide tubes of the JRR-3M. The installation of the cold neutron source (CNS) together with the neutron guide system is one of the principal objectives of the remodeling project of the JRR-3 and this CNS is the first one that was installed in the high neutron flux reactors of 14 orders of magnitude in Japan. The CNS is a liquid hydrogen moderator and vertical thermosyphon type. It mainly consists of a hydrogen plant for liquid hydrogen and helium refrigerator plant for cold helium gas. Five neutron guide tubes are installed to get thermal and cold neutron beams in the beam hall. The CNS and the guide tubes have been operated very well since August 1990. (author)

A New Open-framework Iron Borophosphate from Ionic Liquids: KFe[BP2O8(OH

Directory of Open Access Journals (Sweden)

Guangmei Wang

2011-04-01

Full Text Available A new open-framework iron borophosphate, KFe[BP2O8(OH], has been obtained by ionothermal synthesis from KH2PO4, FeCl3∙4H2O, H3BO3 and [C4mpyr]Br (1-butyl-1-methylpyrrolidinium bromide. Single-crystal X-ray diffraction analysis shows that KFe[BP2O8(OH] (monoclinic, P21/c, a = 9.372(2 Å , b = 8.146(2Å , c = 9.587(2 Å, β = 101.18(3°, V = 718.0(2Å3 and Z = 4 has a three-dimensional (3-D framework structure composed by {Fe(IIIO5(OH} octahedra as well as {BO3(OH} and {PO4} tetrahedra. As anionic structural sub-unit, KFe[BP2O8(OH], contains an infinite open-branched {[BP2O8(OH]4-} chain which is formed by alternating {BO3(OH} and {PO4} tetrahedra. {Fe(IIIO5(OH} octahedra share common O corners with five phosphate tetrahedra and the OH corner links to the hydrogen borate group to give a 3D framework. The negative charges of the inorganic framework are balanced by K+ ions.

A measurement of the absolute neutron beam polarization produced by an optically pumped 3He neutron spin filter

International Nuclear Information System (INIS)

Rich, D.R.; Bowman, J.D.; Crawford, B.E.; Delheij, P.P.J.; Espy, M.A.; Haseyama, T.; Jones, G.; Keith, C.D.; Knudson, J.; Leuschner, M.B.; Masaike, A.; Masuda, Y.; Matsuda, Y.; Penttilae, S.I.; Pomeroy, V.R.; Smith, D.A.; Snow, W.M.; Szymanski, J.J.; Stephenson, S.L.; Thompson, A.K.; Yuan, V.

2002-01-01

The capability of performing accurate absolute measurements of neutron beam polarization opens a number of exciting opportunities in fundamental neutron physics and in neutron scattering. At the LANSCE pulsed neutron source we have measured the neutron beam polarization with an absolute accuracy of 0.3% in the neutron energy range from 40 meV to 10 eV using an optically pumped polarized 3 He spin filter and a relative transmission measurement technique. 3 He was polarized using the Rb spin-exchange method. We describe the measurement technique, present our results, and discuss some of the systematic effects associated with the method

Sensitivity Analysis of Nuclide Importance to One-Group Neutron Cross Sections

International Nuclear Information System (INIS)

Sekimoto, Hiroshi; Nemoto, Atsushi; Yoshimura, Yoshikane

2001-01-01

The importance of nuclides is useful when investigating nuclide characteristics in a given neutron spectrum. However, it is derived using one-group microscopic cross sections, which may contain large errors or uncertainties. The sensitivity coefficient shows the effect of these errors or uncertainties on the importance.The equations for calculating sensitivity coefficients of importance to one-group nuclear constants are derived using the perturbation method. Numerical values are also evaluated for some important cases for fast and thermal reactor systems.Many characteristics of the sensitivity coefficients are derived from the derived equations and numerical results. The matrix of sensitivity coefficients seems diagonally dominant. However, it is not always satisfied in a detailed structure. The detailed structure of the matrix and the characteristics of coefficients are given.By using the obtained sensitivity coefficients, some demonstration calculations have been performed. The effects of error and uncertainty of nuclear data and of the change of one-group cross-section input caused by fuel design changes through the neutron spectrum are investigated. These calculations show that the sensitivity coefficient is useful when evaluating error or uncertainty of nuclide importance caused by the cross-section data error or uncertainty and when checking effectiveness of fuel cell or core design change for improving neutron economy

5 CFR 2638.104 - Definitions.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Definitions. 2638.104 Section 2638.104 Administrative Personnel OFFICE OF GOVERNMENT ETHICS GOVERNMENT ETHICS OFFICE OF GOVERNMENT ETHICS AND EXECUTIVE AGENCY ETHICS PROGRAM RESPONSIBILITIES General Provisions § 2638.104 Definitions. For the purposes of...

Induction of metallothionein(s) in organ-cultured duodenum: relationship to 1α,25-(OH)2-D3-induced CaBP synthesis

International Nuclear Information System (INIS)

Corradino, R.A.; Fullmer, C.S.; Frelier, E.; Maxwell, S.

1979-01-01

The embryonic chick duodenum contains no vitamin D-induced, calcium-binding protein (CaBP). However, when maintained in organ culture, the duodenum responds to 1α,25-(OH) 2 -D 3 in the culture medium by de novo synthesis of CaBP. Studies with this system have provided evidence that CaBP is directly involved in calcium transport at least at the mucosal surface. The present paper extends previous observations on the effects of the extremely toxic environmental pollutant, cadmium. Cadmium was found to inhibit 1α,25-(OH) 2 -D 3 -mediated responses in the organ-cultured duodenum, i.e., CaBP biosynthesis and 45 Ca uptake at the mucosal surface. Cadmium also stimulated concomitent production of a specific metallothionein (MT). Zinc had similar actions in inhibiting CaBP and stimulating Mt biosynthesis

Measurement of Leading Neutron Production in Deep-Inelastic Scattering at HERA

CERN Document Server

Aaron, F.D.; Alimujiang, K.; Andreev, V.; Antunovic, B.; Backovic, S.; Baghdasaryan, A.; Barrelet, E.; Bartel, W.; Begzsuren, K.; Belousov, A.; Bizot, J.C.; Boudry, V.; Bozovic-Jelisavcic, I.; Bracinik, J.; Brandt, G.; Brinkmann, M.; Brisson, V.; Bruncko, D.; Bunyatyan, A.; Buschhorn, G.; Bystritskaya, L.; Campbell, A.J.; Cantun Avila, K.B.; Cerny, K.; Cerny, V.; Chekelian, V.; Cholewa, A.; Contreras, J.G.; Coughlan, J.A.; Cozzika, G.; Cvach, J.; Dainton, J.B.; Daum, K.; Deak, M.; Delcourt, B.; Delvax, J.; De Wolf, E.A.; Diaconu, C.; Dodonov, V.; Dossanov, A.; Dubak, A.; Eckerlin, G.; Efremenko, V.; Egli, S.; Eliseev, A.; Elsen, E.; Falkiewicz, A.; Favart, L.; Fedotov, A.; Felst, R.; Feltesse, J.; Ferencei, J.; Fischer, D.-J.; Fleischer, M.; Fomenko, A.; Gabathuler, E.; Gayler, J.; Ghazaryan, Samvel; Glazov, A.; Glushkov, I.; Goerlich, L.; Gogitidze, N.; Gouzevitch, M.; Grab, C.; Greenshaw, T.; Grell, B.R.; Grindhammer, G.; Habib, S.; Haidt, D.; Helebrant, C.; Henderson, R.C.W.; Hennekemper, E.; Henschel, H.; Herbst, M.; Herrera, G.; Hildebrandt, M.; Hiller, K.H.; Hoffmann, D.; Horisberger, R.; Hreus, T.; Jacquet, M.; Janssen, X.; Jonsson, L.; Jung, Andreas Werner; Jung, H.; Kapichine, M.; Katzy, J.; Kenyon, I.R.; Kiesling, C.; Klein, M.; Kleinwort, C.; Kluge, T.; Knutsson, A.; Kogler, R.; Kostka, P.; Kraemer, M.; Krastev, K.; Kretzschmar, J.; Kropivnitskaya, A.; Kruger, K.; Kutak, K.; Landon, M.P.J.; Lange, W.; Lastovicka-Medin, G.; Laycock, P.; Lebedev, A.; Lendermann, V.; Levonian, S.; Li, G.; Lipka, K.; Liptaj, A.; List, B.; List, J.; Loktionova, N.; Lopez-Fernandez, R.; Lubimov, V.; Lytkin, L.; Makankine, A.; Malinovski, E.; Marage, P.; Marti, Ll.; Martyn, H.-U.; Maxfield, S.J.; Mehta, A.; Meyer, A.B.; Meyer, H.; Meyer, H.; Meyer, J.; Mikocki, S.; Milcewicz-Mika, I.; Moreau, F.; Morozov, A.; Morris, J.V.; Mozer, Matthias Ulrich; Mudrinic, M.; Muller, K.; Murin, P.; Naumann, Th.; Newman, P.R.; Niebuhr, C.; Nikiforov, A.; Nikitin, D.; Nowak, G.; Nowak, K.; Olsson, J.E.; Osman, S.; Ozerov, D.; Pahl, P; Palichik, V.; Panagoulias, I.; Pandurovic, M.; Papadopoulou, Th.; Pascaud, C.; Patel, G.D.; Pejchal, O.; Perez, E.; Petrukhin, A.; Picuric, I.; Piec, S.; Pitzl, D.; Placakyte, R.; Pokorny, B.; Polifka, R.; Povh, B.; Radescu, V.; Rahmat, A.J.; Raicevic, N.; Raspiareza, A.; Ravdandorj, T.; Reimer, P.; Rizvi, E.; Robmann, P.; Roland, B.; Roosen, R.; Rostovtsev, A.; Rotaru, M.; Ruiz Tabasco, J.E.; Rusakov, S.; Salek, D.; Sankey, D.P.C.; Sauter, M.; Sauvan, E.; Schmitt, S.; Schoeffel, L.; Schoning, A.; Schultz-Coulon, H.-C.; Sefkow, F.; Shaw-West, R.N.; Shtarkov, L.N.; Shushkevich, S.; Sloan, T.; Smiljanic, Ivan; Soloviev, Y.; Sopicki, P.; South, D.; Spaskov, V.; Specka, Arnd E.; Staykova, Z.; Steder, M.; Stella, B.; Stoicea, G.; Straumann, U.; Sunar, D.; Sykora, T.; Tchoulakov, V.; Thompson, G.; Thompson, P.D.; Toll, T.; Tomasz, F.; Tran, T.H.; Traynor, D.; Trinh, T.N.; Truol, P.; Tsakov, I.; Tseepeldorj, B.; Turnau, J.; Urban, K.; Valkarova, A.; Vallee, C.; Van Mechelen, P.; Vargas Trevino, A.; Vazdik, Y.; Vinokurova, S.; Volchinski, V.; von den Driesch, M.; Wegener, D.; Wissing, Ch.; Wunsch, E.; Zacek, J.; Zalesak, J.; Zhang, Z.; Zhokin, A.; Zimmermann, T.; Zohrabyan, H.; Zomer, F.

2010-01-01

The production of leading neutrons, where the neutron carries a large fraction x_L of the incoming proton's longitudinal momentum, is studied in deep-inelastic positron-proton scattering at HERA. The data were taken with the H1 detector in the years 2006 and 2007 and correspond to an integrated luminosity of 122 pb^{-1}. The semi-inclusive cross section is measured in the phase space defined by the photon virtuality 6 < Q^2 < 100 GeV^2, Bjorken scaling variable 1.5x10^{-4} < x < 3x10^{-2}, longitudinal momentum fraction 0.32 < x_L < 0.95 and neutron transverse momentum p_T < 0.2 GeV. The leading neutron structure function, F_2^{LN(3)}(Q^2,x,x_L), and the fraction of deep-inelastic scattering events containing a leading neutron are studied as a function of Q^2, x and x_L. Assuming that the pion exchange mechanism dominates leading neutron production, the data provide constraints on the shape of the pion structure function.

Three-Dimensional (X,Y,Z) Deterministic Analysis of the PCA-Replica Neutron Shielding Benchmark Experiment using the TORT-3.2 Code and Group Cross Section Libraries for LWR Shielding and Pressure Vessel Dosimetry

OpenAIRE

Pescarini Massimo; Orsi Roberto; Frisoni Manuela

2016-01-01

The PCA-Replica 12/13 (H2O/Fe) neutron shielding benchmark experiment was analysed using the ORNL TORT-3.2 3D SN code. PCA-Replica, specifically conceived to test the accuracy of nuclear data and transport codes employed in LWR shielding and radiation damage calculations, reproduces a PWR ex-core radial geometry with alternate layers of water and steel including a PWR pressure vessel simulator. Three broad-group coupled neutron/photon working cross section libraries in FIDO-ANISN format with ...

Phospholipid-binding protein EhC2A mediates calcium-dependent translocation of transcription factor URE3-BP to the plasma membrane of Entamoeba histolytica.

Science.gov (United States)

Moreno, Heriberto; Linford, Alicia S; Gilchrist, Carol A; Petri, William A

2010-05-01

The Entamoeba histolytica upstream regulatory element 3-binding protein (URE3-BP) is a transcription factor that binds DNA in a Ca(2+)-inhibitable manner. The protein is located in both the nucleus and the cytoplasm but has also been found to be enriched in the plasma membrane of amebic trophozoites. We investigated the reason for the unusual localization of URE3-BP at the amebic plasma membrane. Here we identify and characterize a 22-kDa Ca(2+)-dependent binding partner of URE3-BP, EhC2A, a novel member of the C2-domain superfamily. Immunoprecipitations of URE3-BP and EhC2A showed that the proteins interact and that such interaction was enhanced in the presence of Ca(2+). Recombinant and native EhC2A bound phospholipid liposomes in a Ca(2+)-dependent manner, with half-maximal binding occurring at 3.4 muM free Ca(2+). A direct interaction between EhC2A and URE3-BP was demonstrated by the ability of recombinant EhC2A to recruit recombinant URE3-BP to phospholipid liposomes in a Ca(2+)-dependent manner. URE3-BP and EhC2A were observed to translocate to the amebic plasma membrane upon an increase in the intracellular Ca(2+) concentration of trophozoites, as revealed by subcellular fractionation and immunofluorescent staining. Short hairpin RNA-mediated knockdown of EhC2A protein expression significantly modulated the mRNA levels of URE3-BP-regulated transcripts. Based on these results, we propose a model for EhC2A-mediated regulation of the transcriptional activities of URE3-BP via Ca(2+)-dependent anchoring of the transcription factor to the amebic plasma membrane.

Radiation shielding material characterization by non-destructive neutron radiography technique

International Nuclear Information System (INIS)

Hafizal Yazid; Azali Muhammad; Abdul Aziz Mohamed; Rafhayudi Jamro; Hishamuddin Husain

2007-01-01

Shielding property of boronated rubber was characterized easily by the use of neutron radiography technique. For 10 phr of boron carbide in the natural rubber composite, the ability to completely shield against neutron was found to have 8mm thickness and above for the neutron flux of 1.04 x 10 5 n/cm 2 s (author)

BP volume reduction equipment

International Nuclear Information System (INIS)

Kitamura, Yoshinori; Muroo, Yoji; Hamanaka, Isao

2003-01-01

A new type of burnable poison (BP) volume reduction system is currently being developed. Many BP rods, a subcomponent of spent fuel assemblies are discharged from nuclear power reactors. This new system reduces the overall volume of BP rods. The main system consists of BP rod cutting equipment, equipment for the recovery of BP cut pieces, and special transport equipment for the cut rods. The equipment is all operated by hydraulic press cylinders in water to reduce operator exposure to radioactivity. (author)

28 CFR 104.3 - Other definitions.

Science.gov (United States)

2010-07-01

... decedent on whose behalf a claim is brought by an eligible Personal Representative. [66 FR 66282, Dec. 21... Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) SEPTEMBER 11TH VICTIM COMPENSATION FUND OF 2001... to whom the Personal Representative shall distribute all or part of the award under § 104.52 of this...

The use of multi-energy-group neutron diffusion theory to numerically evaluate the relative utility of three dial-detector neutron porosity well logging tools

International Nuclear Information System (INIS)

Zalan, T.A.

1988-01-01

Multi-energy-group neutron diffusion theory is used to numerically evaluate the utility of two different dual-detector neutron porosity logging devices, a 14 MeV (accelerator) neutron source - epithermal neutron detector device and a 4 MeV neutron source - capture gamma-ray detector device, relative to the traditional 4 MeV neutron source - thermal neutron detector device. Fast and epithermal neutron diffusion parameters are calculated using Monte Carlo - derived neutron flux distributions. Thermal parameters are calculated from tabulated cross sections. An existing analytical method to describe the transport of gamma-rays through common earth materials is modified in order to accommodate the modeling of the 4 MeV neutron - capture gamma-ray device. The 14 MeV neutron - epithermal neutron device is found to be less sensitive to porosity than the 4 MeV neutron - capture gamma-ray device, which in turn is found to be less sensitive to porosity than the traditional 4 MeV neutron - thermal neutron device. Salinity effects are found to be comparable for the 4 MeV neutron - capture gamma-ray and 4 MeV neutron - thermal neutron devices. The 4 MeV neutron capture gamma-ray measurement is found to be deepest investigating

Apoptosis of nasopharyngeal carcinoma cell line (CNE-2) induced by neutron irradiation

International Nuclear Information System (INIS)

Liang Ke; He Shaoqin; Feng Yan; Tang Jinhua; Feng Qinfu; Shen Yu; Yin Weibo; Xu Guozhen; Liu Xinfan; Wang Luhua; Gao Li

1999-01-01

Objective: To study the apoptotic response of the nasopharyngeal carcinoma cell line (CNE-2) induced by neutron irradiation. Methods: CNE-2 cells were cultured as usual. Using the techniques of DNA agarose gel electrophoresis and DNA special fluorescent staining, the status of apoptosis in CNE-2 cells after neutron irradiation was detected. Results: It was shown that the apoptosis can be induced in CNE-2 cell after neutron radiation. Six hrs, after different doses of neutron (0/0.667/1.333/2.000/2.667/3.333 Gy) and X-ray 0/2/4/6/8/10 Gy) irradiation the apoptotic rates were 2.4%, 6.3%, 7.1%, 9.5%, 13.5%, 14.6% and 2.4%, 3.8%, 5.7%, 7.8%, 10.4%, 11.7%, respectively; at 48 hrs they were 18.3%, 21.5%, 22.8%, 29.3%, 34.2% and 13.7%, 17.6%, 21.3%, 25.6%, 28.9%, respectively. At 10 hrs after neutron irradiation the DNA ladder of apoptosis could be detected between 0.667-3.333 Gy doses in CNE-2 cells by DNA agarose gel electrophoresis. Conclusion: Neutron radiation can induce apoptosis in tumor cells. Compared with the X-ray, neutron induces apoptosis in larger extent than X-ray in the same condition; meanwhile, apoptosis after irradiation is dose and time dependent

Test of sup 3 He-based neutron polarizers at NIST

CERN Document Server

Jones, G L; Thompson, A K; Chowdhuri, Z; Dewey, M S; Snow, W M; Wietfeldt, F E

2000-01-01

Neutron spin filters based on polarized sup 3 He are useful over a wide neutron energy range and have a large angular acceptance among other advantages. Two optical pumping methods, spin-exchange and metastability-exchange, can produce the volume of highly polarized sup 3 He gas required for such neutron spin filters. We report a test of polarizers based on each of these two methods on a new cold, monochromatic neutron beam line at the NIST Center for Neutron Research.

Amino acids analysis using grouping and parceling of neutrons cross sections techniques

International Nuclear Information System (INIS)

Voi, Dante Luiz Voi; Rocha, Helio Fenandes da

2002-01-01

Amino acids used in parenteral administration in hospital patients with special importance in nutritional applications were analyzed to compare with the manufactory data. Individual amino acid samples of phenylalanine, cysteine, methionine, tyrosine and threonine were measured with the neutron crystal spectrometer installed at the J-9 irradiation channel of the 1 kW Argonaut Reactor of the Instituto de Engenharia Nuclear (IEN). Gold and D 2 O high purity samples were used for the experimental system calibration. Neutron cross section values were calculated from chemical composition, conformation and molecular structure analysis of the materials. Literature data were manipulated by parceling and grouping neutron cross sections. (author)

Superheated emulsions in neutron spectrometry by varying ambient pressure

International Nuclear Information System (INIS)

Das, Mala; Sawamura, Teruko

2005-01-01

The principle of present work lies on the dependence of the threshold neutron energy on the dimensionless quantity ''degree of metastability (ss)'' of superheated liquids. The response of the superheated emulsions consists of the drops of superheated liquid (C 2 Cl 2 F 4 , b.p. 3.77 deg. C) has been measured at different 'ss' by varying ambient pressure at different temperatures, in the presence of neutrons generated in Pb by a (γ,n) reaction from 45 MeV electron LINAC of Hokkaido University. To unfold the neutron energy spectrum, a relationship has been developed between the 'ss' of superheated liquids and the threshold neutron energy. The spectrum at the detector position has been calculated by the MCNP code and a comparison has been made with the experimental spectrum. The utilisation of 'ss' is more flexible as this relation can be applied to both positive and negative ambient pressures as well as at different ambient temperatures

Polarized (3) He Spin Filters for Slow Neutron Physics.

Science.gov (United States)

Gentile, T R; Chen, W C; Jones, G L; Babcock, E; Walker, T G

2005-01-01

Polarized (3)He spin filters are needed for a variety of experiments with slow neutrons. Their demonstrated utility for highly accurate determination of neutron polarization are critical to the next generation of betadecay correlation coefficient measurements. In addition, they are broadband devices that can polarize large area and high divergence neutron beams with little gamma-ray background, and allow for an additional spin-flip for systematic tests. These attributes are relevant to all neutron sources, but are particularly well-matched to time of flight analysis at spallation sources. There are several issues in the practical use of (3)He spin filters for slow neutron physics. Besides the essential goal of maximizing the (3)He polarization, we also seek to decrease the constraints on cell lifetimes and magnetic field homogeneity. In addition, cells with highly uniform gas thickness are required to produce the spatially uniform neutron polarization needed for beta-decay correlation coefficient experiments. We are currently employing spin-exchange (SE) and metastability-exchange (ME) optical pumping to polarize (3)He, but will focus on SE. We will discuss the recent demonstration of 75 % (3)He polarization, temperature-dependent relaxation mechanism of unknown origin, cell development, spectrally narrowed lasers, and hybrid spin-exchange optical pumping.

InterProScan Result: BP116799 [KAIKOcDNA[Archive

Lifescience Database Archive (English)

Full Text Available BP116799 BP116799_1_ORF2 D3F3F8C61868AD4C PANTHER PTHR11792 ARRESTIN 3.5e-15 T IPR000698 Arrestin Biological... Process: signal transduction (GO:0007165)|Biological Process: sensory perception (GO:0007600) ...

29 CFR 2520.104-43 - Exemption from annual reporting requirement for certain group insurance arrangements.

Science.gov (United States)

2010-07-01

... 104(a)(3) of the Act, the administrator of an employee welfare benefit plan which meets the... (Continued) EMPLOYEE BENEFITS SECURITY ADMINISTRATION, DEPARTMENT OF LABOR REPORTING AND DISCLOSURE UNDER THE EMPLOYEE RETIREMENT INCOME SECURITY ACT OF 1974 RULES AND REGULATIONS FOR REPORTING AND DISCLOSURE...

Study of variation of materials patients room's door related of neutron flux iradiation

Science.gov (United States)

Nirmalasari, Yuliana Dian; Suparmi, A.; Sardjono, Y.

2017-08-01

The treatment chamber of patients has been simulating with MCNPX Code. Optimation of simulation design of Irradiation chamber is corresponding to ISO standards for 30 MeV cyclotron generator. The simulation has used the variation of door's materials that was applied at treatment room's door. The variation of materials was Stainless Steel 202 and Pb, the thickness Pb and stainless steel 202 with the thickness were 2 cm, respectively. Neutron flux that was radiated to stainless steel 202 in the sequence was 3.34195 × 105 n . Cm-2 s-1 and 8.41568 × 104 n . Cm-2 s-1, while for Pb was 4.01349 × 105 n . Cm-2 s-1 and 2.58058 × 104 n . Cm-2 s-1. The further, neutron flux that was radiated to Pb and stainless steel 202 with the thickness were 4 cm in sequence was 4.00601 × 105 n . Cm-2 s-1 and 1.71713 × 104 n . Cm-2 s-1 for Pb, while for SS 202 was 3.09925 × 105 n . Cm-2 s-1. From this ratio we concluded that material Pb absorbed higher neutron flux than material Stainless Steel 202. On the other hand, the cost of Pb was more expensive than Stainless Steel 202. In addition, the material Stainless Steel 202 was obtaine more easily than the material Pb. There fore to overcome the economics problem, can try to build the door with stainless still 202 sheet and Pb sheet together. The further, the neutron dose with 2 cm of thickness was 7.69603 × 10-2 Gy and 2.10623 × 10-2 Gy for SS 202, while for Pb was 4.19444 × 10-2 Gy and 1.50581 × 10-2 Gy. While the neutron dose with 4 cm of thickness for SS 202 was 9.39602 × 10-2 Gy and for Pb was 4.46541 × 10-2 Gy and 1.50502 × 10-2 Gy. We recommend that this simulation should be further optimized.

KAFAX-F22 : development and benchmark of multi-group library for fast reactor using JEF-2.2. Neutron 80 group and Photon 24 group

International Nuclear Information System (INIS)

Kim, Jung Do; Gil, Choong Sup.

1997-03-01

The KAFAX-F22 was developed from JEF-2.2, which is a MATXS format, multigroup library of fast reactor. The KAFAX-F22 has 80 and 24 energy group structures for neutron and photon, respectively. It includes 89 nuclide data processed by NJOY94.38. The TRANSX/TWODANT system was used for benchmark calculations of fast reactor and one- and two-dimensional calculations of ONEDANT and TWODANT were carried out with 80 group, P 3 S 16 and with 25 group, P 3 S 8 , respectively. The average values of multiplication factors are 0.99652 for MOX cores, 1.00538 for uranium cores and 1.00032 for total cores. Various central reaction rate ratios also give good agreements with the experimental values considering experimental uncertainties except for VERA-11A, VERA-1B, ZPR-6-7 and ZPR-6-6A cores of which experimental values seem to involve some problems. (author). 13 refs., 18 tabs., 2 figs

Progress report on neutron scattering at JAERI

Energy Technology Data Exchange (ETDEWEB)

Morii, Yukio [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

1998-10-01

In the first half of fiscal year 1997, JRR-3M was operated for 97 days followed by a long term shut down for its annual maintenance. Three days were lost out of 100 scheduled operation days, due to a trouble in irradiation facility. Neutron scattering research activities at the JRR-3M have been extended from that of fiscal year 1996. In the Research Group for Quantum Condensed Matter System, experimental study under high pressures, low temperatures and high fields as well as coupling of these conditions were planned to find new quantum condensed matter systems. And, obtained experimental results were immediately provided to theorists for their investigations. In cooperation with new group, Research Group for Neutron Scattering of Strongly Correlated Electron Systems and Research Group for Neutron Scattering at Ultralow Temperatures were carrying neutron scattering experiments at JRR-3M. Research Group for Neutron Crystallography in Biology had opened a way for investigating biomatter neutron diffraction research with high experimental accuracy by growing a millimeter-class large single crystal. In fiscal year 1997, 39 research projects were conducted by these four groups and other staffs in JAERI, 27 projects collaborated with university researchers and 3 projects collaborated with private enterprises were also conducted as complementary researches. 2117 days of machine times were requested to use 8 neutron scattering instruments this year, which corresponded to 1.51 times larger than those planned at its beginning. (G.K.)

Comparison of reactor RA-4 kinetics with simulations with Matlab-Simulink for one group and six groups of delayed neutrons

International Nuclear Information System (INIS)

Orso, J A

2012-01-01

The critical state of a nuclear reactor is an unstable equilibrium. The nuclear reactor can go from critical to subcritical state or can go from critical to hypercritical state. Although the evolution of the system in these cases is slow, it requires the intervention of an operator to correct deviations. For this reason an automatic control technique was designed, based on the kinetic point to a group of delayed neutrons, which corrects deviations automatically. In this paper we study the point kinetics models in a group and six groups of delayed neutrons for different values of reactivity using the simulations software MATLAB, Simulink. A comparison of two models with the reactor kinetic behavior is made (author)

Validation of the Welch Allyn SureBP (inflation) and StepBP (deflation) algorithms by AAMI standard testing and BHS data analysis.

Science.gov (United States)

Alpert, Bruce S

2011-04-01

We evaluated two new Welch Allyn automated blood pressure (BP) algorithms. The first, SureBP, estimates BP during cuff inflation; the second, StepBP, does so during deflation. We followed the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard for testing and data analysis. The data were also analyzed using the British Hypertension Society analysis strategy. We tested children, adolescents, and adults. The requirements of the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard were fulfilled with respect to BP levels, arm sizes, and ages. Association for the Advancement of Medical Instrumentation SP10 Method 1 data analysis was used. The mean±standard deviation for the device readings compared with auscultation by paired, trained, blinded observers in the SureBP mode were -2.14±7.44 mmHg for systolic BP (SBP) and -0.55±5.98 mmHg for diastolic BP (DBP). In the StepBP mode, the differences were -3.61±6.30 mmHg for SBP and -2.03±5.30 mmHg for DBP. Both algorithms achieved an A grade for both SBP and DBP by British Hypertension Society analysis. The SureBP inflation-based algorithm will be available in many new-generation Welch Allyn monitors. Its use will reduce the time it takes to estimate BP in critical patient care circumstances. The device will not need to inflate to excessive suprasystolic BPs to obtain the SBP values. Deflation is rapid once SBP has been determined, thus reducing the total time of cuff inflation and reducing patient discomfort. If the SureBP fails to obtain a BP value, the StepBP algorithm is activated to estimate BP by traditional deflation methodology.

Profile of NF-κBp(65/NFκBp50) among prostate specific antigen sera levels in prostatic pathologies.

Science.gov (United States)

Bouraoui, Y; Ben Jemaa, A; Rodriguez, G; Ben Rais, N; Fraile, B; Paniagua, R; Sellemi, S; Royuela, M; Oueslati, R

2012-10-01

The aim of this work was to characterise the immunoexpression of NF-κB (p50/p65) in human prostatic pathologies and to study its profiles of activation among sera prostate specific antigen antigen (PSA) according the three groups: 0-4ng/mL, 4-20ng/mL and >20ng/mL. Twenty-four men with benign prostate hyperplasia (BPH); 19 men with prostate cancer (PC) and five men with normal prostates (NP). Immunohistochemical and western blot analysis was performed. Serum levels of PSA were assayed by immulite autoanalyser. In BPH and PC samples, immunoexpressions were observed for NF-κBp65 and NF-κBp50; while in NP samples, only were detected NF-κBp50. PC samples showed immunoreactions to NF-κBp65 and NF-κBp50 more intense (respectively 24.18±0.67 and 28.23±2.01) than that observed in BPH samples (respectively18.46±2.04 and 18.66±1.59) with special localisation in the nucleus. Different profiles of NF-κBp65 immunoexpressions were observed and BPH patients with sera PSA levels between 0-4ng/mL presented a significant weak percentage compared to BPH patients with sera PSA levels between 4-20ng/mL and >20ng/mL. No immunoreactions to NF-κBp65 were observed in PC patients with sera PSA levels between 4-20ng/mL. The sensibility of both NF-κB and PSA to inflammation allowed confirming the relationship between these two molecules and its involvement in prostatic diseases progression (inflammatory and neoplasic). Copyright © 2011 Elsevier Masson SAS. All rights reserved.

An optimized ultra-fine energy group structure for neutron transport calculations

International Nuclear Information System (INIS)

Huria, Harish; Ouisloumen, Mohamed

2008-01-01

This paper describes an optimized energy group structure that was developed for neutron transport calculations in lattices using the Westinghouse lattice physics code PARAGON. The currently used 70-energy group structure results in significant discrepancies when the predictions are compared with those from the continuous energy Monte Carlo methods. The main source of the differences is the approximations employed in the resonance self-shielding methodology. This, in turn, leads to ambiguous adjustments in the resonance range cross-sections. The main goal of developing this group structure was to bypass the self-shielding methodology altogether thereby reducing the neutronic calculation errors. The proposed optimized energy mesh has 6064 points with 5877 points spanning the resonance range. The group boundaries in the resonance range were selected so that the micro group cross-sections matched reasonably well with those derived from reaction tallies of MCNP for a number of resonance absorbers of interest in reactor lattices. At the same time, however, the fast and thermal energy range boundaries were also adjusted to match the MCNP reaction rates in the relevant ranges. The resulting multi-group library was used to obtain eigenvalues for a wide variety of reactor lattice numerical benchmarks and also the Doppler reactivity defect benchmarks to establish its adequacy. (authors)

Investigating the Role of the Arabidopsis Homologue of the Human G3BP in RNA Metabolism, Cellular Stress Responses and Innate Immunity

KAUST Repository

Abulfaraj, Aala A.

2018-01-01

immunity and defense immune responses. Atg3bp1 mutant lines show constitutive stomata closure, expression of a number of key defense marker genes, and accumulate salicylic acid but not jasmonic acid. Furthermore, Atg3bp1 plants exhibit enhanced resistance

Development of a bandwidth limiting neutron chopper for CSNS

Science.gov (United States)

Wang, P.; Yang, B.; Cai, W. L.

2015-08-01

Bandwidth limiting neutron choppers are indispensable key equipments for the time-of-flight neutron scattering spectrometers of China Spallation Neutron Source (CSNS). The main principle is to chop the neutron beam to limit the neutron wavelength bandwidth at the neutron detector. We have successfully developed a bandwidth limiting neutron chopper for CSNS in the CSNS advance research project II. The transmission rate of the neutron absorbing coating is less than 1×10-4 (for 1 angstrom neutron). The phase control accuracy is ±0.084° (±9.4 μs at 25 Hz). The dynamic balance grade is G1.0. Various experimental technical features have met the design requirements, and it also runs stably and reliably during the long-term tests.

ISINN-3. Neutron spectroscopy, nuclear structure, related topics

International Nuclear Information System (INIS)

1995-01-01

The proceedings contain the materials presented at the Third International Seminar on Neutron-Nucleus Interactions (ISINN-3) dealing with the problems of neutron spectroscopy, nuclear structure and related topics. The Seminar took place in Dubna on April 26-28, 1995. Over 100 scientists from Belgium, Bulgaria, Czech Republic, Germany, Japan, Latvia, Mexico, Poland, Slovakia, Ukraine, USA and from more than 10 Russian research institutes took part in the Seminar. The Seminar is dedicated to the memory of the founder of the Neutron Physics Laboratory of JINR, the famous soviet scientist Professor Fedor L. Shapiro, whose 80th anniversary is being observed. The main problems discussed are the following: fundamental interactions and symmetries in neutron-induced reactions, fundamental properties of the neutron, properties of excited nuclei after neutron capture and some other ones. Special emphasis is laid upon γ decay and neutron induced nuclear fission as well as upon the methodical aspects of new experiments

Parallel solutions of the two-group neutron diffusion equations

International Nuclear Information System (INIS)

Zee, K.S.; Turinsky, P.J.

1987-01-01

Recent efforts to adapt various numerical solution algorithms to parallel computer architectures have addressed the possibility of substantially reducing the running time of few-group neutron diffusion calculations. The authors have developed an efficient iterative parallel algorithm and an associated computer code for the rapid solution of the finite difference method representation of the two-group neutron diffusion equations on the CRAY X/MP-48 supercomputer having multi-CPUs and vector pipelines. For realistic simulation of light water reactor cores, the code employees a macroscopic depletion model with trace capability for selected fission product transients and critical boron. In addition to this, moderator and fuel temperature feedback models are also incorporated into the code. The validity of the physics models used in the code were benchmarked against qualified codes and proved accurate. This work is an extension of previous work in that various feedback effects are accounted for in the system; the entire code is structured to accommodate extensive vectorization; and an additional parallelism by multitasking is achieved not only for the solution of the matrix equations associated with the inner iterations but also for the other segments of the code, e.g., outer iterations

FDG goes BP

International Nuclear Information System (INIS)

Chan, J.G.

2000-01-01

Full text: A monograph for Fluorodeoxyglucose F-18 Injection (FDG) was first released in Supplement 1 of the United States Pharmacopoeia 1990 (USP 90) on 1 November 1989 to become effective on 1 January 1990. As this was the only monograph available until recently it served as the applicable standard to be followed. The Therapeutic Goods Act states that the British Pharmacopoeia (BP) is the precedent to be followed in Australia and implies that if a monograph exists for a finished product then this needs to be applied to achieve a certain standard of quality. If the monograph does not exist in the BP then other pharmacopoeia monographs can be sourced starting with the European Pharmacopoeia (Ph Eur) then the USP. A monograph for FDG first appeared in the Ph Eur in a 1999 Supplement (effective 1 January 1999 and now included in the Ph Eur 2000) and then in the BP 1999 (effective 1 December 1999). The Commonwealth Government Gazette (Notice 48, 1/12/99) published that the BP 99 was adopted on the 1st December 1999. Since then manufacturers have been required to comply with the monograph for FDG in the BP 99. This presentation looks at the content of the BP 99 monograph and compares it with that in the USP. Copyright (2000) The Australian and New Zealand Society of Nuclear Medicine Inc

Neutron beam effects on spin-exchange-polarized 3He.

Science.gov (United States)

Sharma, M; Babcock, E; Andersen, K H; Barrón-Palos, L; Becker, M; Boag, S; Chen, W C; Chupp, T E; Danagoulian, A; Gentile, T R; Klein, A; Penttila, S; Petoukhov, A; Soldner, T; Tardiff, E R; Walker, T G; Wilburn, W S

2008-08-22

We have observed depolarization effects when high intensity cold neutron beams are incident on alkali-metal spin-exchange-polarized 3He cells used as neutron spin filters. This was first observed as a reduction of the maximum attainable 3He polarization and was attributed to a decrease of alkali-metal polarization, which led us to directly measure alkali-metal polarization and spin relaxation over a range of neutron fluxes at Los Alamos Neutron Science Center and Institute Laue-Langevin. The data reveal a new alkali-metal spin-relaxation mechanism that approximately scales as sqrt[phi_{n}], where phi_{n} is the neutron capture-flux density incident on the cell. This is consistent with an effect proportional to the concentration of electron-ion pairs but is much larger than expected from earlier work.

Comparison of neutron fluxes obtained by 2-D and 3-D geometry with different shielding libraries in biological shield of the TRIGA MARK II reactor

International Nuclear Information System (INIS)

Bozic, M.; Zagar, T.; Ravnik, M.

2003-01-01

Neutron fluxes in different spatial locations in biological shield are obtained with TORT code (TORT-Three Dimensional Oak Ridge Discrete Ordinates Neutron/Photon Transport Code). Libraries used with TORT code were BUGLE-96 library (coupled library with 47 neutron groups and 20 gamma groups) and VITAMIN-B6 library (coupled library with 199 neutron groups and 42 gamma groups). BUGLE-96 library is derived from VITAMIN-B6 library. 2-D and 3-D models for homogeneous type of problem (without inserted beam port 4) and problem with asymmetry (non-homogeneous problem; inserted beam port 4, filled with different materials) were of interest for neutron flux calculation. The main purpose is to verify the possibility for using 2-D approximation model instead of large 3-D model in some calculations. Another purpose of this paper was to compare neutron spectral constants obtained from neutron fluxes (3-D model) determined with smaller BUGLE-96 library with new constants obtained from fluxes calculated with bigger VITAMIN-B6 library. These neutron spectral constants are used in isotopic calculation with SCALE code package (ORIGEN-S). In past only neutron spectral constants determined by neutron fluxes from BUGLE-96 library were used. Experimental results used for isotopic composition comparison are available from irradiation experiment with selected type of concrete and other materials in beam port 4 (irradiation channel 4) in TRIGA Mark II reactor. These experimental results were used as a benchmark in this paper. (author)

Report of the Working Group on low-temperature neutron irradiation

International Nuclear Information System (INIS)

1982-07-01

This report summarizes deliberations at a Working Group meeting sponsored by the Department of Energy, Division of Materials Sciences for the purpose of: (1) assessing the need for maintaining a low temperature neutron irradiation program in the United States; and (2) recommending a course of action based on this assessment

Solution of two energy-group neutron diffusion equation by triangular elements

International Nuclear Information System (INIS)

Correia Filho, A.

1981-01-01

The application of the triangular finite elements of first order in the solution of two energy-group neutron diffusion equation in steady-state conditions is aimed at. The EFTDN (triangular finite elements in neutrons diffusion) computer code in FORTRAN IV language is developed. The discrete formulation of the diffusion equation is obtained applying the Galerkin method. The power method is used to solve the eigenvalues' problem and the convergence is accelerated through the use of Chebshev polynomials. For the equation systems solution the Gauss method is applied. The results of the analysis of two test-problems are presented. (Author) [pt

Target spot localization at neutron producing accelerators

International Nuclear Information System (INIS)

Medveczki, L.; Bornemisza-Pauspertl, P.

1980-01-01

In the application of neutron producing accelerators it is required to know the actual position and the homogeneity of distribution of the emitted neutrons. Solid state nuclear track detectors offer a good possibility to get precise information on these without any disturbing influence on them. LR 115 2 type cellulose nitrate Kodak-Pathe Foils were irradiated with fast neutrons. When track density is higher than about 104 tracks cm -2 the damaged area can be observed with the naked eye, too. To get quantitative information the track densities were counted with manual technique. (author)

A 40-bp VNTR polymorphism in the 3'-untranslated region of DAT1/SLC6A3 is associated with ADHD but not with alcoholism.

Science.gov (United States)

Šerý, Omar; Paclt, Ivo; Drtílková, Ivana; Theiner, Pavel; Kopečková, Marta; Zvolský, Petr; Balcar, Vladimir J

2015-06-11

ADHD and alcoholism are psychiatric diseases with pathophysiology related to dopamine system. DAT1 belongs to the SLC6 family of transporters and is involved in the regulation of extracellular dopamine levels. A 40 bp variable number tandem repeat (VNTR) polymorphism in the 3'-untranslated region of DAT1/SLC6A3 gene was previously reported to be associated with various phenotypes involving disturbed regulation of dopaminergic neurotransmission. A total of 1312 subjects were included and genotyped for 40 bp VNTR polymorphism of DAT1/SLC6A3 gene in this study (441 alcoholics, 400 non-alcoholic controls, 218 ADHD children and 253 non ADHD children). Using miRBase software, we have performed a computer analysis of VNTR part of DAT1 gene for presence of miRNA binding sites. We have found significant relationships between ADHD and the 40 bp VNTR polymorphisms of DAT1/SLC6A3 gene (P VNTR polymorphism of DAT1/SLC6A3 gene has been detected. We have found an association between 40 bp VNTR polymorphism of DAT1/SLC6A3 gene and ADHD in the Czech population; in a broad agreement with studies in other population samples. Furthermore, we detected rare genotypes 8/10, 7/10 and 10/11 present in ADHD boys only and identified miRNAs that should be looked at as potential novel targets in the research on ADHD.

InterProScan Result: BP116799 [KAIKOcDNA[Archive

Lifescience Database Archive (English)

Full Text Available BP116799 BP116799_1_ORF2 D3F3F8C61868AD4C PRINTS PR00309 ARRESTIN 6e-17 T IPR000698 Arrestin Biological... Process: signal transduction (GO:0007165)|Biological Process: sensory perception (GO:0007600) ...

Use of the helium-3 proportional counter for neutron spectrometry; Utilisation du compteur proportionnel a helium 3 pour la spectrometrie des neutrons

Energy Technology Data Exchange (ETDEWEB)

Vialettes, H; Le Thanh, P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1967-07-01

Up to now, two methods have been mainly used for neutron spectrometry near nuclear installations: - photographic emulsion spectrometry - the so-called, 'multisphere' technique spectrometry. The first method, which is fairly difficult to apply, has a threshold energy of about 500 keV; this is a big disadvantage for an apparatus which has to be used for spectrometry around nuclear installations where the neutron radiation is very much degraded energetically. The second method does not suffer from this disadvantage but the results which it yields are only approximate. In order to extend the energy range of the neutron spectra studied with sufficient accuracy the use of a helium-3 proportional counter has been considered. This report presents the principles of operation of the helium-3 spectrometer, and the calculation methods which make it possible to take into account the two main effects tending to deform the spectra obtained: - energy absorption by the walls of the counter, - energy loss of the incident neutrons due to elastic collisions with helium-3 nuclei. As an example of the application, the shape of the neutron spectrum emitted by a polonium-lithium source is given; the results obtained are in excellent agreement with theoretical predictions. (authors) [French] Jusqu'ici deux methodes ont ete utilisees principalement pour la spectrometrie des neutrons autour des installations nucleaires: - la spectrometrie par emulsions photographiques - la spectrometrie par la technique dite des multispheres. La premiere methode, d'un emploi assez delicat presente un seuil en energie d'environ 500 keV qui est un obstacle serieux a la spectrometrie autour des installations nucleaires ou le rayonnement neutronique est tres degrade en energie. La deuxieme methode ne presente pas cet inconvenient mais les resultats qu'elle permet d'obtenir ne sont qu'approches. Pour etendre la gamme d'energie des spectres de neutrons etudies avec une precision suffisante, l'utilisation du

Polarized ³He Neutron Spin Filters

Energy Technology Data Exchange (ETDEWEB)

Sno, William Michael [Indiana Univ., Bloomington, IN (United States)

2016-01-12

The goal of this grant to Indiana University and subcontractors at Hamilton College and Wisconsin and the associated Interagency Agreement with NIST was to extend the technique of polarized neutron scattering by the development and application of polarized ³He-based neutron spin filters. This effort was blessed with long-term support from the DOE Office of Science, which started in 2003 and continued until the end of a final no-cost extension of the last 3-year period of support in 2013. The steady support from the DOE Office of Science for this long-term development project was essential to its eventual success. Further ³He neutron spin filter development is now sited at NIST and ORNL.

Neutron polarization in polarized 3He targets

International Nuclear Information System (INIS)

Friar, J.L.; Gibson, B.F.; Payne, G.L.; Bernstein, A.M.; Chupp, T.E.

1990-01-01

Simple formulas for the neutron and proton polarizations in polarized 3 He targets are derived assuming (1) quasielastic final states; (2) no final-state interactions; (3) no meson-exchange currents; (4) large momentum transfers; (5) factorizability of 3 He SU(4) response-function components. Numerical results from a wide variety of bound-state solutions of the Faddeev equations are presented. It is found that this simple model predicts the polarization of neutrons in a fully polarized 3 He target to be 87%, while protons should have a slight residual polarization of -2.7%. Numerical studies show that this model works very well for quasielastic electron scattering

Drug-DNA adducts as biomarkers for metabolic activation of the nitro-aromatic nitrogen mustard prodrug PR-104A.

Science.gov (United States)

Stornetta, Alessia; Deng, Kai-Cheng Kieren; Danielli, Sara; Liyanage, H D Sarath; Sturla, Shana J; Wilson, William R; Gu, Yongchuan

2018-04-07

PR-104A is a clinical-stage nitrogen mustard prodrug that is activated for DNA alkylation by reduction of a nitro group to the corresponding hydroxylamine (PR-104H) or amine (PR-104M). Metabolic reduction is catalysed by flavoreductases such as cytochrome P450 oxidoreductase (POR) under hypoxia, or by aldo-ketoreductase 1C3 (AKR1C3) independently of hypoxia. The unstable reduced metabolites are challenging to measure in biological samples, and biomarkers of the metabolic activation of PR-104A have not been used in the clinical evaluation of PR-104 to date. Here, we employ a selected reaction monitoring mass spectrometry assay for DNA crosslinks to assess the capacity of human cancer cells to bioactivate PR-104A. We also test whether the more abundant DNA monoadducts could be used for the same purpose. DNA monoadducts and crosslinks from PR-104A itself, and from its reduced metabolites, accumulated over 4 h in AKR1C3-expressing TF1 erythroleukaemia cells under hypoxia, whereas intracellular concentrations of unstable PR-104H and PR-104M reached steady state within 1 h. We then varied rates of PR-104A reduction by manipulating hypoxia or reductase expression in a panel of cell lines, in which AKR1C3 and POR were quantified by targeted proteomics. Hypoxia or reductase overexpression induced large increases in PR-104A sensitivity (inhibition of proliferation), DNA damage response (γH2AX formation), steady-state concentrations of PR-104H/M and formation of reduced drug-DNA adducts but not DNA adducts retaining the dinitro groups of PR-104A. The fold-change in the sum of PR-104H and PR-104M correlated with the fold-change in reduced crosslinks or monoadducts (R 2  = 0.87 for both), demonstrating their potential for assessing the capacity of cancer cells to bioactivate PR-104A. Copyright © 2018 Elsevier Inc. All rights reserved.

Comparison of 2D and 3D Neutron Transport Analyses on Yonggwang Unit 3 Reactor

International Nuclear Information System (INIS)

Maeng, Aoung Jae; Kim, Byoung Chul; Lim, Mi Joung; Kim, Kyung Sik; Jeon, Young Kyou; Yoo, Choon Sung

2012-01-01

10 CFR Part 50 Appendix H requires periodical surveillance program in the reactor vessel (RV) belt line region of light water nuclear power plant to check vessel integrity resulting from the exposure to neutron irradiation and thermal environment. Exact exposure analysis of the neutron fluence based on right modeling and simulations is the most important in the evaluation. Traditional 2 dimensional (D) and 1D synthesis methodologies have been widely applied to evaluate the fast neutron (E > 1.0 MeV) fluence exposure to RV. However, 2D and 1D methodologies have not provided accurate fast neutron fluence evaluation at elevations far above or below the active core region. RAPTOR-M3G (RApid Parallel Transport Of Radiation - Multiple 3D Geometries) program for 3D geometries calculation was therefore developed both by Westinghouse Electronic Company, USA and Korea Reactor Integrity Surveillance Technology (KRIST) for the analysis of In-Vessel Surveillance Test and Ex-Vessel Neutron Dosimetry (EVND). Especially EVND which is installed at active core height between biological shielding material and concrete also evaluates axial neutron fluence by placing three dosimetries each at Top, Middle and Bottom part of the angle representing maximum neutron fluence. The EVND programs have been applied to the Korea Nuclear Plants. The objective of this study is therefore to compare the 3D and the 2D Neutron Transport Calculations and Analyses on the Yonggwang unit 3 Reactor as an example

An analytical solution for the two-group kinetic neutron diffusion equation in cylindrical geometry

International Nuclear Information System (INIS)

Fernandes, Julio Cesar L.; Vilhena, Marco Tullio; Bodmann, Bardo Ernst

2011-01-01

Recently the two-group Kinetic Neutron Diffusion Equation with six groups of delay neutron precursor in a rectangle was solved by the Laplace Transform Technique. In this work, we report on an analytical solution for this sort of problem but in cylindrical geometry, assuming a homogeneous and infinite height cylinder. The solution is obtained applying the Hankel Transform to the Kinetic Diffusion equation and solving the transformed problem by the same procedure used in the rectangle. We also present numerical simulations and comparisons against results available in literature. (author)

Aerial Neutron Detection: Neutron Signatures for Nonproliferation and Emergency Response Applications

Energy Technology Data Exchange (ETDEWEB)

Maurer, Richard J.; Stampahar, Thomas G.; Smith, Ethan X.; Mukhopadhyay, Sanjoy; Wolff, Ronald S.; Rourke, Timothy J.; LeDonne, Jeffrey P.; Avaro, Emanuele; Butler, D. Andre; Borders, Kevin L.; Stampahar, Jezabel; Schuck, William H.; Selfridge, Thomas L.; McKissack, Thomas M.; Duncan, William W.; Hendricks, Thane J.

2012-10-17

From 2007 to the present, the Remote Sensing Laboratory has been conducting a series of studies designed to expand our fundamental understanding of aerial neutron detection with the goal of designing an enhanced sensitivity detection system for long range neutron detection. Over 35 hours of aerial measurements in a helicopter were conducted for a variety of neutron emitters such as neutron point sources, a commercial nuclear power reactor, nuclear reactor spent fuel in dry cask storage, depleted uranium hexafluoride and depleted uranium metal. The goals of the project were to increase the detection sensitivity of our instruments such that a 5.4 × 104 neutron/second source could be detected at 100 feet above ground level at a speed of 70 knots and to enhance the long-range detection sensitivity for larger neutron sources, i.e., detection ranges above 1000 feet. In order to increase the sensitivity of aerial neutron detection instruments, it is important to understand the dynamics of the neutron background as a function of altitude. For aerial neutron detection, studies have shown that the neutron background primarily originates from above the aircraft, being produced in the upper atmosphere by galactic cosmic-ray interactions with air molecules. These interactions produce energetic neutrons and charged particles that cascade to the earth’s surface, producing additional neutrons in secondary collisions. Hence, the neutron background increases as a function of altitude which is an impediment to long-range neutron detection. In order to increase the sensitivity for long range detection, it is necessary to maintain a low neutron background as a function of altitude. Initial investigations show the variation in the neutron background can be decreased with the application of a cosmic-ray shield. The results of the studies along with a representative data set are presented.

Advancement of neutron radiography technique in JRR-3M

International Nuclear Information System (INIS)

Matsubayashi, Masahito

1999-01-01

The JRR-3M thermal neutron radiography facility (JRR-3M TNRF) was completed in the JRR-3M of the Japan Atomic Energy Research Institute in 1991 and has been utilized as research tools for various kinds of research fields such as thermal hydraulic researches, agricultural researches, medical researches, archaeological researches and so on. High performance of the JRR-3M TNRF such as high neutron flux, high collimator ratio and wide radiographing field has enabled advanced researches and stimulated developments of advanced neutron radiography (NR) systems for higher spatial resolution and for higher temporal resolution. Static NR systems using neutron imaging plates or cooled CCD camera with high spatial resolution, a real-time NR system using a silicon intensifier target tube camera and a high-frame-rate NR system using a combination of an image intensifier and a high speed digital video camera with high temporal resolution have been developed to fill the requirements from researchers. (author)

Calculation of neutron flux distribution of thermal neutrons from microtron converter in a graphite moderator with water reflector

International Nuclear Information System (INIS)

Andrejsek, K.

1977-01-01

The calculation is made of the thermal neutron flux in the moderator and reflector by solving the neutron diffusion equation using the four-group theory. The correction for neutron absorption in the moderator was carried out using the perturbation theory. The calculation was carried out for four groups with the following energy ranges: the first group 2 MeV to 3 keV, the second group 3 keV to 5 eV, the third group 5 eV to 0.025 eV and the fourth group 0.025 eV. The values of the macroscopic cross section of capture and scattering, of the diffusion coefficient, the macroscopic cross section of the moderator, of the neutron age and the extrapolation length for the water-graphite moderator used in the calculations are given. The spatial distribution of the thermal neutron flux is graphically represented for graphite of a 30, 40, and 50 cm radius and for graphite of a 30 and 40 cm radius with a 10 cm water reflector; a graphic comparison is made of the distribution of the thermal neutron flux in water and in graphite, both 40 cm in radius. The system of graphite with reflector proved to be the best and most efficient system for raising the flux density of thermal neutrons. (J.P.)

Intensive Versus Standard Blood Pressure Control in SPRINT-Eligible Participants of ACCORD-BP.

Science.gov (United States)

Buckley, Leo F; Dixon, Dave L; Wohlford, George F; Wijesinghe, Dayanjan S; Baker, William L; Van Tassell, Benjamin W

2017-12-01

We sought to determine the effect of intensive blood pressure (BP) control on cardiovascular outcomes in participants with type 2 diabetes mellitus (T2DM) and additional risk factors for cardiovascular disease (CVD). This study was a post hoc, multivariate, subgroup analysis of ACCORD-BP (Action to Control Cardiovascular Risk in Diabetes Blood Pressure) participants. Participants were eligible for the analysis if they were in the standard glucose control arm of ACCORD-BP and also had the additional CVD risk factors required for SPRINT (Systolic Blood Pressure Intervention Trial) eligibility. We used a Cox proportional hazards regression model to compare the effect of intensive versus standard BP control on CVD outcomes. The "SPRINT-eligible" ACCORD-BP participants were pooled with SPRINT participants to determine whether the effects of intensive BP control interacted with T2DM. The mean baseline Framingham 10-year CVD risk scores were 14.5% and 14.8%, respectively, in the intensive and standard BP control groups. The mean achieved systolic BP values were 120 and 134 mmHg in the intensive and standard BP control groups ( P control reduced the composite of CVD death, nonfatal myocardial infarction (MI), nonfatal stroke, any revascularization, and heart failure (hazard ratio 0.79; 95% CI 0.65-0.96; P = 0.02). Intensive BP control also reduced CVD death, nonfatal MI, and nonfatal stroke (hazard ratio 0.69; 95% CI 0.51-0.93; P = 0.01). Treatment-related adverse events occurred more frequently in participants receiving intensive BP control (4.1% vs. 2.1%; P = 0.003). The effect of intensive BP control on CVD outcomes did not differ between patients with and without T2DM ( P > 0.62). Intensive BP control reduced CVD outcomes in a cohort of participants with T2DM and additional CVD risk factors. © 2017 by the American Diabetes Association.

The mitochondrial DNA 4,977-bp deletion and its implication in copy number alteration in colorectal cancer

Science.gov (United States)

2011-01-01

Background Qualitative and quantitative changes in human mitochondrial DNA (mtDNA) have been implicated in various cancer types. A 4,977 bp deletion in the major arch of the mitochondrial genome is one of the most common mutations associated with a variety of human diseases and aging. Methods We conducted a comprehensive study on clinical features and mtDNA of 104 colorectal cancer patients in the Wenzhou area of China. In particular, using a quantitative real time PCR method, we analyzed the 4,977 bp deletion and mtDNA content in tumor tissues and paired non-tumor areas from these patients. Results We found that the 4,977 bp deletion was more likely to be present in patients of younger age (≤65 years, p = 0.027). In patients with the 4,977 bp deletion, the deletion level decreased as the cancer stage advanced (p = 0.031). Moreover, mtDNA copy number in tumor tissues of patients with this deletion increased, both compared with that in adjacent non-tumor tissues and with in tumors of patients without the deletion. Such mtDNA content increase correlated with the levels of the 4,977 bp deletion and with cancer stage (p deletion may play a role in the early stage of colorectal cancer, and it is also implicated in alteration of mtDNA content in cancer cells. PMID:21232124

Congenital Arthrogryposis: An Extension of the 15q11.2 BP1-BP2 Microdeletion Syndrome?

Directory of Open Access Journals (Sweden)

K. M. Usrey

2014-01-01

Full Text Available The proximal 15q11–q13 region contains 5 breakpoints (BP1–BP5. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes. The genes in this region are known to play a role in central nervous system development and/or function. Microdeletions within the 15q11.2 BP1-BP2 region have been reported in patients with neurological dysfunction, developmental delays, behavioral problems, and dysmorphic features. We report two unrelated subjects with the 15q11.2 BP1-BP2 microdeletion and presenting with congenital arthrogryposis, a feature which has not been previously reported as part of this newly recognized microdeletion syndrome. While arthrogryposis seen in these two subjects may be coincidental, we propose that congenital arthrogryposis may result from neurological dysfunction and involvement of the microdeletion of the 15q11.2 BP1-BP2 region, further expanding the phenotype of this microdeletion syndrome. We encourage others to report patients with this chromosome microdeletion and neurological findings to further characterize the clinical phenotype.

Generation of ENDF/B-IV based 35 group neutron cross-section library and its application in criticality studies

International Nuclear Information System (INIS)

Garg, S.B.; Sinha, A.

1985-01-01

A 35 group cross-section library with P/sub 3/-anisotropic scattering matrices and resonance self-shielding factors has been generated from the basic ENDF/B-IV cross-section files for 57 elements. This library covers the neutron energy range from 0.005 ev to 15 MeV and is well suited for the neutronics and safety analysis of fission, fusion and hybrid systems. The library is contained in two well known files, namely, ISOTXS and BRKOXS. In order to test the efficacy of this library and to bring out the importance of resonance self-shielding, a few selected fast critical assemblies representing large dilute oxide and carbide fueled uranium and plutonium based systems have been analysed. These assemblies include ZPPR/sub 2/, ZPR-3-48, ZPR-3-53, ZPR-6-6A, ZPR-6-7, ZPR-9-31 and ZEBRA-2 and are amongst those recommended by the US Nuclear Data Evaluation Working Group for testing the accuracy of cross-sections. The evaluated multiplication constants of these assemblies compare favourably with those calculated by others

Cloud-based BP system integrated with CPOE improves self-management of the hypertensive patients: A randomized controlled trial.

Science.gov (United States)

Lee, Peisan; Liu, Ju-Chi; Hsieh, Ming-Hsiung; Hao, Wen-Rui; Tseng, Yuan-Teng; Liu, Shuen-Hsin; Lin, Yung-Kuo; Sung, Li-Chin; Huang, Jen-Hung; Yang, Hung-Yu; Ye, Jong-Shiuan; Zheng, He-Shun; Hsu, Min-Huei; Syed-Abdul, Shabbir; Lu, Richard; Nguyen, Phung-Anh; Iqbal, Usman; Huang, Chih-Wei; Jian, Wen-Shan; Li, Yu-Chuan Jack

2016-08-01

Less than 50% of patients with hypertensive disease manage to maintain their blood pressure (BP) within normal levels. The aim of this study is to evaluate whether cloud BP system integrated with computerized physician order entry (CPOE) can improve BP management as compared with traditional care. A randomized controlled trial done on a random sample of 382 adults recruited from 786 patients who had been diagnosed with hypertension and receiving treatment for hypertension in two district hospitals in the north of Taiwan. Physicians had access to cloud BP data from CPOE. Neither patients nor physicians were blinded to group assignment. The study was conducted over a period of seven months. At baseline, the enrollees were 50% male with a mean (SD) age of 58.18 (10.83) years. The mean sitting BP of both arms was no different. The proportion of patients with BP control at two, four and six months was significantly greater in the intervention group than in the control group. The average capture rates of blood pressure in the intervention group were also significantly higher than the control group in all three check-points. Cloud-based BP system integrated with CPOE at the point of care achieved better BP control compared to traditional care. This system does not require any technical skills and is therefore suitable for every age group. The praise and assurance to the patients from the physicians after reviewing the Cloud BP records positively reinforced both BP measuring and medication adherence behaviors. Copyright © 2016. Published by Elsevier Ireland Ltd.

Experiment on neutron transmission through depleted uranium layers and analysis with DOT 3.5 and MCNP

International Nuclear Information System (INIS)

Oka, Y.; Kodama, T.; Akiyama, M.; Hashikura, H.; Kondo, S.

1987-01-01

The reaction rates in the multi-layers containing depleted uranium were measured by activation foils and micro-fission chambers. The analysis of the experiment was carried out by using the multi-group transport calculation code, DOT 3.5 and the continuous energy Monte Carlo code, MCNP. The multi-group calculation overpredicted the low energy reaction rates in the DU layers, while the continuous energy calculation agreed well. The multi-group and continuous energy calculation was compared for the one-dimensional transmission of iron spheres. The results revealed overprediction of the multi-group calculation near the fast neutron source. The averaging of the resonance shapes in generating the multi-group cross sections made minima of the resonance valleys higher than that of the pointwise cross section. This increased the scattering of the neutrons inside and caused the overprediction of the multi-group calculation

The Higgs mass derived from the U(3) Lie group

DEFF Research Database (Denmark)

Trinhammer, Ole; Bohr, Henrik; Jensen, Mogens O Stibius

2015-01-01

The Higgs mass value is derived from a Hamiltonian on the Lie group U(3) where we relate strong and electroweak energy scales. The baryon states of nucleon and delta resonances originate in specific Bloch wave degrees of freedom coupled to a Higgs mechanism which also gives rise to the usual gauge...... boson masses. The derived Higgs mass is around 125 GeV. From the same Hamiltonian, we derive the relative neutron to proton mass ratio and the N and Delta mass spectra. All compare rather well with the experimental values. We predict scarce neutral flavor baryon singlets that should be visible...... in scattering cross-sections for negative pions on protons, in photoproduction on neutrons, in neutron diffraction dissociation experiments and in invariant mass spectra of protons and negative pions in B-decays. The fundamental predictions are based on just one length scale and the fine structure constant...

One-velocity neutron diffusion calculations based on a two-group reactor model

Energy Technology Data Exchange (ETDEWEB)

Bingulac, S; Radanovic, L; Lazarevic, B; Matausek, M; Pop-Jordanov, J [Boris Kidric Institute of Nuclear Sciences, Vinca, Belgrade (Yugoslavia)

1965-07-01

Many processes in reactor physics are described by the energy dependent neutron diffusion equations which for many practical purposes can often be reduced to one-dimensional two-group equations. Though such two-group models are satisfactory from the standpoint of accuracy, they require rather extensive computations which are usually iterative and involve the use of digital computers. In many applications, however, and particularly in dynamic analyses, where the studies are performed on analogue computers, it is preferable to avoid iterative calculations. The usual practice in such situations is to resort to one group models, which allow the solution to be expressed analytically. However, the loss in accuracy is rather great particularly when several media of different properties are involved. This paper describes a procedure by which the solution of the two-group neutron diffusion. equations can be expressed analytically in the form which, from the computational standpoint, is as simple as the one-group model, but retains the accuracy of the two-group treatment. In describing the procedure, the case of a multi-region nuclear reactor of cylindrical geometry is treated, but the method applied and the results obtained are of more general application. Another approach in approximate solution of diffusion equations, suggested by Galanin is applicable only in special ideal cases.

Low energy neutrons from a sup 2 sup 3 sup 9 PuBe isotopic neutron source inserting in moderating media

CERN Document Server

Vega, H R

2002-01-01

Several neutron applications share a common problem: the neutron source design. In this work MCNP computer code has been used to design a moderated sup 2 sup 3 sup 9 PuBe neutron source to produce low energy neutrons. The design involves the source located at the center of a spherical moderator. Moderator media studied were light water, heavy water and a heterogeneous combination of light water and heavy water. Similar moderating features were found between the 24.5 cm-radius container filled with heavy water (23.0-cm-thick) and that made with light water (3.5-cm-thick) plus heavy water (19.5-cm-thick). A sup 2 sup 3 sup 9 PuBe neutron source inserted in this moderator produces, at 27 cm, a neutron fluence of 1.8 x 10 sup - sup 4 n-cm sup - sup 2 per source neutron, with an average neutron energy of 0.34 MeV, where 47.8 % have an energy <= 0.4 eV. A further study of this moderator was carried out using a reflector medium made of graphite. Thus, 15-cm-thickness reflector improves the neutron field producing...

36 CFR 406.104-406.109 - [Reserved

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false [Reserved] 406.104-406.109 Section 406.104-406.109 Parks, Forests, and Public Property AMERICAN BATTLE MONUMENTS COMMISSION... BATTLE MONUMENTS COMMISSION §§ 406.104-406.109 [Reserved] ...

BP's emissions trading system

International Nuclear Information System (INIS)

Victor, David G.; House, Joshua C.

2006-01-01

Between 1998 and 2001, BP reduced its emissions of greenhouse gases by more than 10%. BP's success in cutting emissions is often equated with its use of an apparently market-based emissions trading program. However no independent study has ever examined the rules and operation of BP's system and the incentives acting on managers to reduce emissions. We use interviews with key managers and with traders in several critical business units to explore the bound of BP's success with emissions trading. No money actually changed hands when permits were traded, and the main effect of the program was to create awareness of money-saving emission controls rather than strong price incentives. We show that the trading system did not operate like a 'textbook' cap and trade scheme. Rather, the BP system operated much like a 'safety valve' trading system, where managers let the market function until the cost of doing so surpassed what the company was willing to tolerate

200-BP-5 operable unit Technical Baseline report

International Nuclear Information System (INIS)

Jacques, I.D.; Kent, S.K.

1991-10-01

This report supports development of a remedial investigation/feasibility study work plan for the 200-BP-5 operable unit. The report summarizes baseline information for waste sites and unplanned release sites located in the 200-BP-5 operable unit. The sites were investigated by the Technical Baseline Section of the Environmental Engineering Group, Westinghouse Hanford Company (Westinghouse Hanford). The investigation consisted of review and evaluation of current and historical Hanford Site reports, drawings, and photographs, and was supplemented with recent inspections of the Hanford Site and employee interviews. No field investigations or sampling were conducted

High-pressure 3He gas scintillation neutron spectrometer

International Nuclear Information System (INIS)

Derzon, M.S.; Slaughter, D.R.; Prussin, S.G.

1985-10-01

A high-pressure, 3 He-Xe gas scintillation spectrometer has been developed for neutron spectroscopy on D-D fusion plasmas. The spectrometer exhibits an energy resolution of (121 +- 20 keV) keV (FWHM) at 2.5 MeV and an efficiency of (1.9 +- 0.4) x 10 -3 (n/cm 2 ) -1 . The contribution to the resolution (FWHM) from counting statistics is only (22 +- 3 keV) and the remainder is due predominantly to the variation of light collection efficiency with location of neutron events within the active volume of the detector

Browns Ferry Unit 3 cavity neutron spectral analysis

International Nuclear Information System (INIS)

Martin, G.C.; Till, H.A.

1982-01-01

The General Electric Company at the Vallecitos Nuclear Center (GE-VNC) has performed neutron dosimetry measurements in the Browns Ferry Unit 3 reactor (BF3) cavity using multiple dosimeter and spectrum unfolding techniques. These measurements are the first in a BWR cavity and comprise an important part in a general program related to verification of pressure vessel integrity and to validation of calculations. Determinations of BF3 cavity neutron flux densities at five key locations at full power (1098 MWe) during core cycle 2 (November 1978 to August 1979) are presented

HEXAB-3D, 3-D Few-Group Diffusion for Hexagonal Core Geometry

International Nuclear Information System (INIS)

Apostolov, T.G.; Ivanov, K.N.; Manolova, M.A.

2002-01-01

1 - Description of program or function: A three-dimensional few-group calculational model based on diffusion theory has been developed for calculating the basic neutron physical characteristics of power reactors which have a hexagonal core configuration with a heterogeneous region structure in axial direction. There are two versions of the model: - HEXAB-III-30 - the solution range in horizontal plane is 30 - sector of reactor core - HEXAB-III-360 - the solution range in horizontal plane is full core. 2 - Method of solution: In the HEXAB-3D code the nine-point mesh-centered finite-difference approximation of neutron diffusion equation is applied. The standard inner-outer iterative strategy is used. Inner iterations are solved using two different incomplete factorization techniques: AGA two-sweep iterative method and modified AGA two-sweep iterative method both accelerated by the double successive over-relaxation procedure. The power method, combined with two- or three-term Chebishev polynomial acceleration for outer iterations is applied in the code. To improve the accuracy of the calculated integral and local reactor parameters without significantly increasing computer time and storage an effective approach has been developed. It decreases errors due to the use of coarse mesh by means of correcting the coefficients of finite- difference scheme. 3 - Restrictions on the complexity of the problem: Maximum of 10 energy groups, 30 horizontal layers and 100 material compositions

BP1 Homeoprotein Enhances Metastatic Potential in ER-negative Breast Cancer

Science.gov (United States)

Fu, Yebo; Lian, Yi; Kim, Kyung Soon; Zhang, Lei; Hindle, A. Katharine; Brody, Fred; Siegel, Robert S.; McCaffrey, Timothy A.; Fu, Sidney W.

2010-01-01

Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER-) tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. We sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target for ER- breast cancer. PMID:20842225

ZZ MATXSLIBJ33, JENDL-3.3 based, 175 N-42 photon groups (VITAMIN-J) MATXS library for discrete ordinates multi-group

International Nuclear Information System (INIS)

Kosako, K.; Yamano, N.; Fukahori, T.; Shibata, K.; Hasegawa, A.

2006-01-01

1 - Description of program or function: JENDL-3.3 based, 175 neutron-42 photon groups (VITAMIN-J) MATXS library for discrete ordinates multi-group transport codes. Format: MATXS. Number of groups: 175 neutron, 42 gamma-ray. Nuclides: 337 nuclides contained in JENDL-3.3: H-1, H-2, He-3, He-4, Li-6, Li-7, Be-9, B-10, B-11, C-Nat, N-14, N-15, O-16, F-19, Na-23, Mg-24, Mg-25, Mg-26, Al-27, Si-28, Si-29, Si-30, P-31, S-32, S-33, S-34, S-36, Cl-35, Cl-37, Ar-40, K-39, K-40, K-41, Ca-40, Ca-42, Ca-43, Ca-44, Ca-46, Ca-48, Sc-45, Ti-46, Ti-47, Ti-48, Ti-49, Ti-50, V-Nat, Cr-50, Cr-52, Cr-53, Cr-54, Mn-55, Fe-54, Fe-56, Fe-57, Fe-58, Co-59, Ni-58, Ni-60, Ni-61, Ni-62, Ni-64, Cu-63, Cu-65, Ga-69, Ga-71, Ge-70, Ge-72, Ge-73, Ge-74, Ge-76, As-75, Se-74, Se-76, Se-77, Se-78, Se-79, Se-80, Se-82, Br-79, Br-81, Kr-78, Kr-80, Kr-82, Kr-83, Kr-84, Kr-85, Kr-86, Rb-85, Rb-87, Sr-86, Sr-87, Sr-88, Sr-89, Sr-90, Y-89, Y-91, Zr-90, Zr-91, Zr-92, Zr-93, Zr-94, Zr-95, Zr-96, Nb-93, Nb-94, Nb-95, Mo-92, Mo-94, Mo-95, Mo-96, Mo-97, Mo-98, Mo-99, Mo-100, Tc-99, Ru-96, Ru-98, Ru-99, Ru-100, Ru-101, Ru-102, Ru-103, Ru-104, Ru-106, Rh-103, Rh-105, Pd-102, Pd-104, Pd-105, Pd-106, Pd-107, Pd-108, Pd-110, Ag-107, Ag-109, Ag-110m, Cd-106, Cd-108, Cd-110, Cd-111, Cd-112, Cd-113, Cd-114, Cd-116, In-113, In-115, Sn-112, Sn-114, Sn-115, Sn-116, Sn-117, Sn-118, Sn-119, Sn-120, Sn-122, Sn-123, Sn-124, Sn-126, Sb-121, Sb-123, Sb-124, Sb-125, Te-120, Te-122, Te-123, Te-124, Te-125, Te-126, Te-127m, Te-128, Te-129m, Te-130, I-127, I-129, I-131, Xe-124, Xe-126, Xe-128, Xe-129, Xe-130, Xe-131, Xe-132, Xe-133, Xe-134, Xe-135, Xe-136, Cs-133, Cs-134, Cs-135, Cs-136, Cs-137, Ba-130, Ba-132, Ba-134, Ba-135, Ba-136, Ba-137, Ba-138, Ba-140, La-138, La-139, Ce-140, Ce-141, Ce-142, Ce-144, Pr-141, Pr-143, Nd-142, Nd-143, Nd-144, Nd-145, Nd-146, Nd-147, Nd-148, Nd-150, Pm-147, Pm-148, Pm-148m, Pm-149, Sm-144, Sm-147, Sm-148, Sm-149, Sm-150, Sm-151, Sm-152, Sm-153, Sm-154, Eu-151, Eu-152, Eu-153, Eu-154, Eu-155, Eu

PERIGEE computer codes for reactor simulation in 3 dimensions, using 1 or 2 neutron velocity groups

International Nuclear Information System (INIS)

Olson, A.P.

1964-02-01

PERIGEE is a code written in SNAP for the G-20 computer. It solves the one- or two-group neutron diffusion equations by finite-difference methods on a three-dimensional, uniform mesh having a common spacing in the two directions normal to the fuel channels. The positions of mesh points along a fuel channel, relative to points in adjacent channels, may correspond to either NPD or CANDU fuel bundle positions. The extrapolated flux boundary may be specified in sufficient detail to represent a tapered or stepped circumferential reflector, a variable axial length and, for a reactor with axis horizontal, a variable moderator level and a variable plane bottom surface equivalent to the CANDU dump structure. The neutron flux may be normalized to give a specified power output from the hottest fuel bundle or hottest channel, or to give a total thermal power limited by the turbine and generator. Reactor operation may be simulated in finite time steps, taking into account any fuel shifts, any changes in moderator level and the change in nuclear properties of the fuel with increasing irradiation. The appropriate properties are obtained by interpolation from tables supplied for as many as 8 types of fuel bundle. The mean fuel exit burnup can be calculated at equilibrium for a reactor in which the exit burnups for two zones may be adjusted to give radial power flattening and the fuelling schedules may be designed to give axial power flattening in one or both zones. (author)

Optimum transmission for a 3He neutron polarizer

International Nuclear Information System (INIS)

Tasset, F.; Ressouche, E.

1995-01-01

Following recent achievements in polarizing gaseous 3 He targets by optical pumping at room temperature, polarized helium-3 is now the most promising polarizer for thermal and epithermal neutrons and should soon compete favorably with existing Heusler polarizing crystals. Because it is gaseous, a degree of freedom exists in such a filter: the pressure of the gas in the cell. This parameter allows a choice to be made in the filter design: for a given polarization of 3 He, one is able to increase the pressure, to favor neutron beam polarization, or to stay at relatively low pressure to favor the filter's transmission. In this paper, we discuss this point in the framework of a classical polarized neutron experiment, and we compare our more general results with the quality factor Q=P√(T), which is generally taken as standard for such a filter. (orig.)

Structure of Streptococcus agalactiae tip pilin GBS104: a model for GBS pili assembly and host interactions

Energy Technology Data Exchange (ETDEWEB)

Krishnan, Vengadesan [UNESCO Regional Centre for Biotechnology (RCB), Gurgaon 122 016, Haryana (India); Dwivedi, Prabhat [University of Texas Health Science Center, Houston, TX 77030 (United States); Kim, Brandon J. [San Diego State University, 5500 Campanile Drive, San Diego, CA 92182 (United States); Samal, Alexandra; Macon, Kevin [University of Alabama at Birmingham, Birmingham, AL 35294 (United States); Ma, Xin; Mishra, Arunima [University of Texas Health Science Center, Houston, TX 77030 (United States); Doran, Kelly S. [San Diego State University, 5500 Campanile Drive, San Diego, CA 92182 (United States); Ton-That, Hung [University of Texas Health Science Center, Houston, TX 77030 (United States); Narayana, Sthanam V. L., E-mail: narayana@uab.edu [University of Alabama at Birmingham, Birmingham, AL 35294 (United States); UNESCO Regional Centre for Biotechnology (RCB), Gurgaon 122 016, Haryana (India)

2013-06-01

The crystal structure of a 75 kDa central fragment of GBS104, a tip pilin from the 2063V/R strain of Streptococcus agalactiae (group B streptococcus; GBS), is reported. The crystal structure of a 75 kDa central fragment of GBS104, a tip pilin from the 2063V/R strain of Streptococcus agalactiae (group B streptococcus; GBS), is reported. In addition, a homology model of the remaining two domains of GBS104 was built and a model of full-length GBS104 was generated by combining the homology model (the N1 and N4 domains) and the crystal structure of the 75 kDa fragment (the N2 and N3 domains). This rod-shaped GBS104 model is constructed of three IgG-like domains (the N1, N2 and N4 domains) and one vWFA-like domain (the N3 domain). The N1 and N2 domains of GBS104 are assembled with distinct and remote segments contributed by the N- and C-termini. The metal-binding site in the N3 domain of GBS104 is in the closed/low-affinity conformation. Interestingly, this domain hosts two long arms that project away from the metal-binding site. Using site-directed mutagenesis, two cysteine residues that lock the N3 domain of GBS104 into the open/high-affinity conformation were introduced. Both wild-type and disulfide-locked recombinant proteins were tested for binding to extracellular matrix proteins such as collagen, fibronectin, fibrinogen and laminin, and an increase in fibronectin binding affinity was identified for the disulfide-locked N3 domain, suggesting that induced conformational changes may play a possible role in receptor binding.

Structure of Streptococcus agalactiae tip pilin GBS104: a model for GBS pili assembly and host interactions

International Nuclear Information System (INIS)

Krishnan, Vengadesan; Dwivedi, Prabhat; Kim, Brandon J.; Samal, Alexandra; Macon, Kevin; Ma, Xin; Mishra, Arunima; Doran, Kelly S.; Ton-That, Hung; Narayana, Sthanam V. L.

2013-01-01

The crystal structure of a 75 kDa central fragment of GBS104, a tip pilin from the 2063V/R strain of Streptococcus agalactiae (group B streptococcus; GBS), is reported. The crystal structure of a 75 kDa central fragment of GBS104, a tip pilin from the 2063V/R strain of Streptococcus agalactiae (group B streptococcus; GBS), is reported. In addition, a homology model of the remaining two domains of GBS104 was built and a model of full-length GBS104 was generated by combining the homology model (the N1 and N4 domains) and the crystal structure of the 75 kDa fragment (the N2 and N3 domains). This rod-shaped GBS104 model is constructed of three IgG-like domains (the N1, N2 and N4 domains) and one vWFA-like domain (the N3 domain). The N1 and N2 domains of GBS104 are assembled with distinct and remote segments contributed by the N- and C-termini. The metal-binding site in the N3 domain of GBS104 is in the closed/low-affinity conformation. Interestingly, this domain hosts two long arms that project away from the metal-binding site. Using site-directed mutagenesis, two cysteine residues that lock the N3 domain of GBS104 into the open/high-affinity conformation were introduced. Both wild-type and disulfide-locked recombinant proteins were tested for binding to extracellular matrix proteins such as collagen, fibronectin, fibrinogen and laminin, and an increase in fibronectin binding affinity was identified for the disulfide-locked N3 domain, suggesting that induced conformational changes may play a possible role in receptor binding

Use of MCAM in creating 3D neutronics model for ITER building

International Nuclear Information System (INIS)

Zeng Qin; Wang Guozhong; Dang Tongqiang; Long Pengcheng; Loughlin, Michael

2012-01-01

Highlights: ► We created a 3D neutronics model of the ITER building. ► The model was produced from the engineering CAD model by MCAM software. ► The neutron flux map in the ITER building was calculated. - Abstract: The three dimensional (3D) neutronics reference model of International Thermonuclear Experimental Reactor (ITER) only defines the tokamak machine and extends to the bio-shield. In order to meet further 3D neutronics analysis needs, it is necessary to create a 3D reference model of the ITER building. Monte Carlo Automatic Modeling Program for Radiation Transport Simulation (MCAM) was developed as a computer aided design (CAD) based bi-directional interface program between general CAD systems and Monte Carlo radiation transport simulation codes. With the help of MCAM version 4.8, the 3D neutronics model of ITER building was created based on the engineering CAD model. The calculation of the neutron flux map in ITER building during operation showed the correctness and usability of the model. This model is the first detailed ITER building 3D neutronics model and it will be made available to all international organization collaborators as a reference model.

One group neutron flux at a point in a cylindrical reactor cell calculated by Monte Carlo

Energy Technology Data Exchange (ETDEWEB)

Kocic, A [Institute of Nuclear Sciences Vinca, Beograd (Serbia and Montenegro)

1974-01-15

Mean values of the neutron flux over material regions and the neutron flux at space points in a cylindrical annular cell (one group model) have been calculated by Monte Carlo. The results are compared with those obtained by an improved collision probability method (author)

SPECTROPOLARIMETRY OF THE CLASSICAL T TAURI STAR BP TAU

International Nuclear Information System (INIS)

Chen, Wei; Johns-Krull, Christopher M.

2013-01-01

We implement a least-squares deconvolution (LSD) code to study magnetic fields on cool stars. We first apply our code to high-resolution optical echelle spectra of 53 Cam (a magnetic Ap star) and three well-studied cool stars (Arcturus, 61 Cyg A, and ξ Boo A) as well as the Sun (by observing the asteroid Vesta) as tests of the code and the instrumentation. Our analysis is based on several hundred photospheric lines spanning the wavelength range 5000 Å to 9000 Å. We then apply our LSD code to six nights of data on the Classical T Tauri Star BP Tau. A maximum longitudinal field of 370 ± 80 G is detected from the photospheric lines on BP Tau. A 1.8 kG dipole tilted at 129° with respect to the rotation axis and a 1.4 kG octupole tilted at 104° with respect to the rotation axis, both with a filling factor of 0.25, best fit our LSD Stokes V profiles. Measurements of several emission lines (He I 5876 Å, Ca II 8498 Å, and 8542 Å) show the presence of strong magnetic fields in the line formation regions of these lines, which are believed to be the base of the accretion footpoints. The field strength measured from these lines shows night-to-night variability consistent with rotation of the star

SPECTROPOLARIMETRY OF THE CLASSICAL T TAURI STAR BP TAU

Energy Technology Data Exchange (ETDEWEB)

Chen, Wei; Johns-Krull, Christopher M., E-mail: wc2@rice.edu, E-mail: cmj@rice.edu [Department of Physics and Astronomy, Rice University, Houston, TX 77005 (United States)

2013-10-20

We implement a least-squares deconvolution (LSD) code to study magnetic fields on cool stars. We first apply our code to high-resolution optical echelle spectra of 53 Cam (a magnetic Ap star) and three well-studied cool stars (Arcturus, 61 Cyg A, and ξ Boo A) as well as the Sun (by observing the asteroid Vesta) as tests of the code and the instrumentation. Our analysis is based on several hundred photospheric lines spanning the wavelength range 5000 Å to 9000 Å. We then apply our LSD code to six nights of data on the Classical T Tauri Star BP Tau. A maximum longitudinal field of 370 ± 80 G is detected from the photospheric lines on BP Tau. A 1.8 kG dipole tilted at 129° with respect to the rotation axis and a 1.4 kG octupole tilted at 104° with respect to the rotation axis, both with a filling factor of 0.25, best fit our LSD Stokes V profiles. Measurements of several emission lines (He I 5876 Å, Ca II 8498 Å, and 8542 Å) show the presence of strong magnetic fields in the line formation regions of these lines, which are believed to be the base of the accretion footpoints. The field strength measured from these lines shows night-to-night variability consistent with rotation of the star.

A program for calculating group constants on the basis of libraries of evaluated neutron data

International Nuclear Information System (INIS)

Sinitsa, V.V.

1987-01-01

The GRUKON program is designed for processing libraries of evaluated neutron data into group and fine-group (having some 300 groups) microscopic constants. In structure it is a package of applications programs with three basic components: a monitor, a command language and a library of functional modules. The first operative version of the package was restricted to obtaining mid-group non-block cross-sections from evaluated neutron data libraries in the ENDF/B format. This was then used to process other libraries. In the next two versions, cross-section table conversion modules and self-shielding factor calculation modules, respectively, were added to the functions already in the package. Currently, a fourth version of the GRUKON applications program package, for calculation of sub-group parameters, is under preparation. (author)

HEXAGA-III-120, -30. Three dimensional multi-group neutron diffusion programmes for a uniform triangular mesh with arbitrary group scattering

International Nuclear Information System (INIS)

Woznicki, Z.I.

1983-07-01

This report presents the HEXAGA-III-programme solving multi-group time-independent real and/or adjoint neutron diffusion equations for three-dimensional-triangular-z-geometry. The method of solution is based on the AGA two-sweep iterative method belonging to the family of factorization techniques. An arbitrary neutron scattering model is permitted. The report written for users provides the description of the programme input and output and the use of HEXAGA-III is illustrated by a sample reactor problem. (orig.) [de

GPU-accelerated 3D neutron diffusion code based on finite difference method

Energy Technology Data Exchange (ETDEWEB)

Xu, Q.; Yu, G.; Wang, K. [Dept. of Engineering Physics, Tsinghua Univ. (China)

2012-07-01

Finite difference method, as a traditional numerical solution to neutron diffusion equation, although considered simpler and more precise than the coarse mesh nodal methods, has a bottle neck to be widely applied caused by the huge memory and unendurable computation time it requires. In recent years, the concept of General-Purpose computation on GPUs has provided us with a powerful computational engine for scientific research. In this study, a GPU-Accelerated multi-group 3D neutron diffusion code based on finite difference method was developed. First, a clean-sheet neutron diffusion code (3DFD-CPU) was written in C++ on the CPU architecture, and later ported to GPUs under NVIDIA's CUDA platform (3DFD-GPU). The IAEA 3D PWR benchmark problem was calculated in the numerical test, where three different codes, including the original CPU-based sequential code, the HYPRE (High Performance Pre-conditioners)-based diffusion code and CITATION, were used as counterpoints to test the efficiency and accuracy of the GPU-based program. The results demonstrate both high efficiency and adequate accuracy of the GPU implementation for neutron diffusion equation. A speedup factor of about 46 times was obtained, using NVIDIA's Geforce GTX470 GPU card against a 2.50 GHz Intel Quad Q9300 CPU processor. Compared with the HYPRE-based code performing in parallel on an 8-core tower server, the speedup of about 2 still could be observed. More encouragingly, without any mathematical acceleration technology, the GPU implementation ran about 5 times faster than CITATION which was speeded up by using the SOR method and Chebyshev extrapolation technique. (authors)

GPU-accelerated 3D neutron diffusion code based on finite difference method

International Nuclear Information System (INIS)

Xu, Q.; Yu, G.; Wang, K.

2012-01-01

Finite difference method, as a traditional numerical solution to neutron diffusion equation, although considered simpler and more precise than the coarse mesh nodal methods, has a bottle neck to be widely applied caused by the huge memory and unendurable computation time it requires. In recent years, the concept of General-Purpose computation on GPUs has provided us with a powerful computational engine for scientific research. In this study, a GPU-Accelerated multi-group 3D neutron diffusion code based on finite difference method was developed. First, a clean-sheet neutron diffusion code (3DFD-CPU) was written in C++ on the CPU architecture, and later ported to GPUs under NVIDIA's CUDA platform (3DFD-GPU). The IAEA 3D PWR benchmark problem was calculated in the numerical test, where three different codes, including the original CPU-based sequential code, the HYPRE (High Performance Pre-conditioners)-based diffusion code and CITATION, were used as counterpoints to test the efficiency and accuracy of the GPU-based program. The results demonstrate both high efficiency and adequate accuracy of the GPU implementation for neutron diffusion equation. A speedup factor of about 46 times was obtained, using NVIDIA's Geforce GTX470 GPU card against a 2.50 GHz Intel Quad Q9300 CPU processor. Compared with the HYPRE-based code performing in parallel on an 8-core tower server, the speedup of about 2 still could be observed. More encouragingly, without any mathematical acceleration technology, the GPU implementation ran about 5 times faster than CITATION which was speeded up by using the SOR method and Chebyshev extrapolation technique. (authors)

NEULAND at R{sup 3}B: Multi-neutron response and resolution of the novel neutron detector

Energy Technology Data Exchange (ETDEWEB)

Kresan, Dmytro; Aumann, Thomas [Technische Universitaet Darmstadt, Darmstadt (Germany); Boretzky, Konstanze; Bertini, Denis; Heil, Michael; Rossi, Dominic; Simon, Haik [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany)

2012-07-01

NEULAND (New Large Area Neutron Detector) will serve for the detection of fast neutrons (200 - 1000 MeV) in the R3B experiment at the future FAIR. A high detection efficiency (> 90%), a high resolution (down to 20 keV) and a large multi-neutron-hit resolving power ({>=}5 neutrons) are demanded. The detector concept foresees a fully active and highly granular design of plastic scintillators. We present the detector capabilities, based on simulations performed within the FairRoot framework. The relevance of calorimetric properties for the multi-hit recognition is discussed, and exemplarily the performance for specific physics cases is presented.

Application of BP neural network for LRAD-based alpha contamination monitoring inside pipes

International Nuclear Information System (INIS)

Wu Xuemei; Li Zhe; Zhang Jinzhao; Li Pingchuan; Su Jilong; Tuo Xianguo; Liu Mingzhe

2012-01-01

Factors of airspeed, flux, activity, source position, pipe length and pipe diameter affect nonlinearly source activity readout of the Long Range Alpha Detection (LRAD). In this paper, multiparameter influence experiment is carried out using variable-control method, aiming at studying relationships between the readout and each of the factors. The back propagation (BP) neural network model is established to overcome the nonlinear effects of the factors on the readout, with the readout and the multiparameters being the input, and the source activity being the output. Experiment data of 948 groups are used for BP neural network forecasting, with an average relative error of 3.4218×10 -4 . And in a 100-group test, an average relative error of 2.217×10 -2 is obtained. It shows that with this method source radioactivity in pipes can be simulated. (authors)

Validation of the Microlife BP A3 PC upper arm blood pressure monitor in patients with diabetes mellitus according to the ANSI/AAMI/ISO 81060-2: 2013 protocol.

Science.gov (United States)

Beime, Beate; Krüger, Ralf; Hammel, Gertrud; Bramlage, Peter; Deutsch, Cornelia

2018-02-01

The aim of the present study was to validate the blood pressure (BP) measurement device, Microlife BP A3 PC, in patients with diabetes mellitus, according to the ANSI/AAMI/ISO 81060-2:2013 protocol. In 85 individuals aged 56-88 years, with predefined criteria for diabetes mellitus, BP measurements on the upper arm were performed alternately using the Microlife BP A3 PC and a standard mercury reference sphygmomanometer. A total of 333 comparisons were included for analysis. The mean difference between the Microlife BP A3 PC and the reference was -1.5±6.3 mmHg for systolic BP (SBP) and -1.3±5.2 mmHg for diastolic BP (DBP) according to criterion 1 of the protocol. For SBP, a total of 209 of the 333 measurements were within the range of 5 mmHg (62.8%), whereas the corresponding numbers for DBP were 232 of 333 (69.7%). For criterion 2, the intraindividual differences for the test device and the reference were -1.50±4.73 mmHg for SBP and -1.30±4.55 mmHg for DBP, thus being within the defined ranges provided by the protocol. The Microlife BP A3 PC fulfilled the requirements of criteria 1 and 2 of the ANSI/AAMI/ISO 81060-2:2013 protocol and can also be recommended for BP measurement in diabetic patients.

POW3D-Neutron diffusion module of the AUS system. A user's manual

International Nuclear Information System (INIS)

Harrington, B.V.; Pollard, J.P.; Barry, J.M.

1996-11-01

POW3D is a three-dimensional neutron diffusion module of the AUS modular neutronics code system. It performs eigenvalue, source of feedback-free kinetics calculations. The module includes general criticality search options and extensive editing facilities including perturbation calculations. Output options include flux or reaction rate plot files. The code permits selection from one of a variety of different solution methods (MINI, ICCG or SLOR) for inner iterations with region re balance to enhance convergence. A MINI accelerated Gauss-Siedel method is used for upscatter iterations with group rebalance to enhance a convergence. Chebyshev source extrapolation is applied for outer iterations. A detailed index is included

Fast neutron detection at near-core location of a research reactor with a SiC detector

Science.gov (United States)

Wang, Lei; Jarrell, Josh; Xue, Sha; Tan, Chuting; Blue, Thomas; Cao, Lei R.

2018-04-01

The measurable charged-particle produced from the fast neutron interactions with the Si and C nucleuses can make a wide bandgap silicon carbide (SiC) sensor intrinsically sensitive to neutrons. The 4H-SiC Schottky detectors have been fabricated and tested at up to 500 °C, presenting only a slightly degraded energy resolution. The response spectrum of the SiC detectors were also obtained by exposing the detectors to external neutron beam irradiation and at a near-core location where gamma-ray field is intense. The fast neutron flux of these two locations are ∼ 4 . 8 × 104cm-2 ṡs-1 and ∼ 2 . 2 × 107cm-2 ṡs-1, respectively. At the external beam location, a Si detector was irradiated side-by-side with SiC detector to disjoin the neutron response from Si atoms. The contribution of gamma ray, neutron scattering, and charged-particles producing reactions in the SiC was discussed. The fast neutron detection efficiencies were determined to be 6 . 43 × 10-4 for the external fast neutron beam irradiation and 6 . 13 × 10-6 for the near-core fast neutron irradiation.

Purification, crystallization and preliminary X-ray diffraction of the G3BP1 NTF2-like domain

DEFF Research Database (Denmark)

Vognsen, Tina; Möller, Ingvar Rúnar; Kristensen, Ole

2011-01-01

The nuclear transport factor 2-like (NTF2-like) domain of human G3BP1 was subcloned, overexpressed in Escherichia coli and purified. Crystals were obtained using the hanging-drop vapour-diffusion method. Diffraction data were collected to 3.6 Å resolution using synchrotron radiation. The crystals...

19 CFR 358.104 - Report.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 3 2010-04-01 2010-04-01 false Report. 358.104 Section 358.104 Customs Duties... Report. The Secretary will review and issue a report on the first five years of the operation of Part 358. The report will consider the impact of determinations to permit importation of particular merchandise...

A broad-group cross-section library based on ENDF/B-VII.0 for fast neutron dosimetry Applications

Energy Technology Data Exchange (ETDEWEB)

Alpan, F.A. [Westinghouse Electric Company, 1000 Westinghouse Drive, Cranberry Township, PA 16066 (United States)

2011-07-01

A new ENDF/B-VII.0-based coupled 44-neutron, 20-gamma-ray-group cross-section library was developed to investigate the latest evaluated nuclear data file (ENDF) ,in comparison to ENDF/B-VI.3 used in BUGLE-96, as well as to generate an objective-specific library. The objectives selected for this work consisted of dosimetry calculations for in-vessel and ex-vessel reactor locations, iron atom displacement calculations for reactor internals and pressure vessel, and {sup 58}Ni(n,{gamma}) calculation that is important for gas generation in the baffle plate. The new library was generated based on the contribution and point-wise cross-section-driven (CPXSD) methodology and was applied to one of the most widely used benchmarks, the Oak Ridge National Laboratory Pool Critical Assembly benchmark problem. In addition to the new library, BUGLE-96 and an ENDF/B-VII.0-based coupled 47-neutron, 20-gamma-ray-group cross-section library was generated and used with both SNLRML and IRDF dosimetry cross sections to compute reaction rates. All reaction rates computed by the multigroup libraries are within {+-} 20 % of measurement data and meet the U. S. Nuclear Regulatory Commission acceptance criterion for reactor vessel neutron exposure evaluations specified in Regulatory Guide 1.190. (authors)

AcEST: BP918406 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000113_B06 468 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B06. BP918406 - Show BP918406...is mRNA. clone: YMU001_000113_B06. Accession BP918406 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-vene...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-veneris m

AcEST: BP918011 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000108_E11 519 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E11. BP918011 - Show BP91801...is mRNA. clone: YMU001_000108_E11. Accession BP918011 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiant...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiantum cap

Developments of high-performance moderator vessel for JRR-3 cold neutron source

International Nuclear Information System (INIS)

Arai, Masaji; Tamura, Itaru; Hazawa, Tomoya

2015-05-01

The cold neutron source (CNS) facility converts thermal neutrons into cold neutrons to moderate neutrons with liquid hydrogen. The cold neutron beam at Japan Research Reactor No. 3 (JRR-3) is led to the beam experimental devices in the beam hall through neutron guide tubes. High intensities of the cold neutron beam are always demanded for increasing the experimental effectiveness and accuracy. In the Department of Research Reactor and Tandem Accelerator, developments of high-performance CNS moderator vessel that can produce cold neutron intensity about two times higher compared to the existing vessel have been performed in the second medium term plans. We compiled this report about the technological development to solve several problems with the design and manufacture of new vessel. In the present study, design strength evaluation, mockup test, simulation for thermo-fluid dynamics of the liquid hydrogen and strength evaluation of the different-material-bonding were studied. By these evaluation results, we verified that the developed new vessel can be applied to CNS moderator vessel of JRR-3. (author)

Expression of the Transcription Factor E4BP4 in Human Basophils

DEFF Research Database (Denmark)

Jensen, Bettina Margrethe; Gohr, Maria; Poulsen, Lars Kærgaard

2014-01-01

Rationale The cytokine IL-3 plays an important role for human basophil development, function and survival. IL-3 is also reported to induce the expression of the transcription factor E4BP4, but it is not known whether E4BP4 is expressed in basophils and influences basophil responsiveness. The aim...... by Alcian blue. RNA was extracted (0.005-0.02 µg RNA from 0.5 - 1 x 106 cells), and the corresponding cDNA analyzed by real-time PCR where E4BP4 expression was calculated as 2-(CT(E4BP4) - CT(β-actin)). E4BP4 protein expression was visualized in basophil lysates (107 cells/ml) by Western blot followed...... the transcription factor E4BP4 which might have an impact on basophil histamine release....

Use of MCAM in creating 3D neutronics model for ITER building

Energy Technology Data Exchange (ETDEWEB)

Zeng Qin [Institute of Nuclear Energy Safety Technology, Chinese Academy of Sciences, Hefei, Anhui 230031 (China); School of Nuclear Science and Technology, University of Science and Technology of China, Hefei, Anhui 230027 (China); Wang Guozhong, E-mail: mango33@mail.ustc.edu.cn [School of Nuclear Science and Technology, University of Science and Technology of China, Hefei, Anhui 230027 (China); Dang Tongqiang [School of Nuclear Science and Technology, University of Science and Technology of China, Hefei, Anhui 230027 (China); Long Pengcheng [Institute of Nuclear Energy Safety Technology, Chinese Academy of Sciences, Hefei, Anhui 230031 (China); School of Nuclear Science and Technology, University of Science and Technology of China, Hefei, Anhui 230027 (China); Loughlin, Michael [ITER Organization, Route de Vinon sur Verdon, 13115 St. Paul-Lz-Durance (France)

2012-08-15

Highlights: Black-Right-Pointing-Pointer We created a 3D neutronics model of the ITER building. Black-Right-Pointing-Pointer The model was produced from the engineering CAD model by MCAM software. Black-Right-Pointing-Pointer The neutron flux map in the ITER building was calculated. - Abstract: The three dimensional (3D) neutronics reference model of International Thermonuclear Experimental Reactor (ITER) only defines the tokamak machine and extends to the bio-shield. In order to meet further 3D neutronics analysis needs, it is necessary to create a 3D reference model of the ITER building. Monte Carlo Automatic Modeling Program for Radiation Transport Simulation (MCAM) was developed as a computer aided design (CAD) based bi-directional interface program between general CAD systems and Monte Carlo radiation transport simulation codes. With the help of MCAM version 4.8, the 3D neutronics model of ITER building was created based on the engineering CAD model. The calculation of the neutron flux map in ITER building during operation showed the correctness and usability of the model. This model is the first detailed ITER building 3D neutronics model and it will be made available to all international organization collaborators as a reference model.

Neutron spectrum adjustment using reaction rate data acquired with a liquid dosimetry system

International Nuclear Information System (INIS)

Smith, D.L.; Ikeda, Y.; Uno, Y.; Maekawa, F.

1997-01-01

A dosimetry technique based on neutron activation of circulating water with dissolved salts is discussed. The neutron source was the FNS accelerator at JAERI, Tokai, Japan. Yttrium chloride hexahydrate (YCl 3· 6H 2 O) was the salt (264.9 grams dissolved in 16.094 liters of water). Gamma-ray yields were measured with an intrinsic Ge detector. The following reactions were examined: (1) 16 O(n,p) 16 N (E thresh = 10.245 MeV, t 1/2 = 7.13 sec, E γ = 6.129 MeV); (2) 37 Cl(n,p) 37 S (E thresh = 4.194 MeV, t 1/2 = 5.05 min, E γ = 3.104 MeV); (3) 89 Y(n,n') 89m Y (E thresh = 0.919 MeV, t 1/2 = 16.06 sec, E γ = 0.909 MeV). This paper describes use of the generalized least-squares (GLS) method to adjust the neutron spectrum

Polymer-Based Black Phosphorus (bP) Hybrid Materials by in Situ Radical Polymerization: An Effective Tool To Exfoliate bP and Stabilize bP Nanoflakes

Science.gov (United States)

2018-01-01

Black phosphorus (bP) has been recently investigated for next generation nanoelectronic multifunctional devices. However, the intrinsic instability of exfoliated bP (the bP nanoflakes) toward both moisture and air has so far overshadowed its practical implementation. In order to contribute to fill this gap, we report here the preparation of new hybrid polymer-based materials where bP nanoflakes (bPn) exhibit a significantly improved stability. The new materials have been prepared by different synthetic paths including: (i) the mixing of conventionally liquid-phase exfoliated bP (in dimethyl sulfoxide, DMSO) with poly(methyl methacrylate) (PMMA) solution; (ii) the direct exfoliation of bP in a polymeric solution; (iii) the in situ radical polymerization after exfoliating bP in the liquid monomer (methyl methacrylate, MMA). This last methodology concerns the preparation of stable suspensions of bPn–MMA by sonication-assisted liquid-phase exfoliation (LPE) of bP in the presence of MMA followed by radical polymerization. The hybrids characteristics have been compared in order to evaluate the bP dispersion and the effectiveness of the bPn interfacial interactions with polymer chains aimed at their long-term environmental stabilization. The passivation of the bPn is particularly effective when the hybrid material is prepared by in situ polymerization. By using this synthetic methodology, the nanoflakes, even if with a gradient of dispersion (size of aggregates), preserve their chemical structure from oxidation (as proved by both Raman and 31P-solid state NMR studies) and are particularly stable to air and UV light exposure. The feasibility of this approach, capable of efficiently exfoliating bP while protecting the bPn, has been then verified by using different vinyl monomers (styrene and N-vinylpyrrolidone), thus obtaining hybrids where the nanoflakes are embedded in polymer matrices with a variety of intriguing thermal, mechanical, and solubility characteristics.

Spectra of γ-rays from capture of 2 eV to 9 x 104 eV neutrons by 181Ta

International Nuclear Information System (INIS)

Stelts, M.L.

Using new experimental techniques, the spectra of γ-rays from the capture of neutrons by 181 Ta were measured at the Livermore 100-MeV linac for neutrons from 2 eV to 9 x 10 4 eV with a (Ge(Li)-NaI) three-crystal spectrometer. Individual primary γ-ray lines were resolved to 1778-keV excitation in 182 Ta. Neutron resonances were resolved to 200-eV neutron energy. Data analysis techniques and codes were developed to extract positions and intensities of resolved transitions from the large data matrices accumulated in this experiment. Techniques were developed to unfold the unresolved γ-ray spectra using the simple response of the three-crystal spectrometer. The resolved transition data were used to place 110 states with spin and parity assignments in the 182 Ta level diagram below 1780-keV excitation. A set of 1240 E1 transition strengths were analyzed to extract 1.38 +- 0.11 degrees of freedom for the most likely chisquared fit to the distribution of widths. The E1 strength function was extracted for E/sub gamma/ = 4 to 6 MeV and compared with previous results. The γ-ray spectra for E/sub gamma/ = 1.5 to 6.1 MeV were unfolded for neutron energy groups between 20 and 9 x 10 4 eV. Below 5-MeV γ-ray energy no dependence of the spectral shape on neu []ron energy was observed. (30 figures, 4 tables) (auth)

AcEST: BP911801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000009_C12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000009_C12. BP911801 - Show BP911801...is mRNA. clone: YMU001_000009_C12. Accession BP911801 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911801.... 25:3389-3402. Query= BP911801|Adiantum capillus-veneris mRNA, clone: YMU001_000

Lentiviral Vpx accessory factor targets VprBP/DCAF1 substrate adaptor for cullin 4 E3 ubiquitin ligase to enable macrophage infection.

Directory of Open Access Journals (Sweden)

Smita Srivastava

2008-05-01

Full Text Available Vpx is a small virion-associated adaptor protein encoded by viruses of the HIV-2/SIVsm lineage of primate lentiviruses that enables these viruses to transduce monocyte-derived cells. This probably reflects the ability of Vpx to overcome an as yet uncharacterized block to an early event in the virus life cycle in these cells, but the underlying mechanism has remained elusive. Using biochemical and proteomic approaches, we have found that Vpx protein of the pathogenic SIVmac 239 strain associates with a ternary protein complex comprising DDB1 and VprBP subunits of Cullin 4-based E3 ubiquitin ligase, and DDA1, which has been implicated in the regulation of E3 catalytic activity, and that Vpx participates in the Cullin 4 E3 complex comprising VprBP. We further demonstrate that the ability of SIVmac as well as HIV-2 Vpx to interact with VprBP and its associated Cullin 4 complex is required for efficient reverse transcription of SIVmac RNA genome in primary macrophages. Strikingly, macrophages in which VprBP levels are depleted by RNA interference resist SIVmac infection. Thus, our observations reveal that Vpx interacts with both catalytic and regulatory components of the ubiquitin proteasome system and demonstrate that these interactions are critical for Vpx ability to enable efficient SIVmac replication in primary macrophages. Furthermore, they identify VprBP/DCAF1 substrate receptor for Cullin 4 E3 ubiquitin ligase and its associated protein complex as immediate downstream effector of Vpx for this function. Together, our findings suggest a model in which Vpx usurps VprBP-associated Cullin 4 ubiquitin ligase to enable efficient reverse transcription and thereby overcome a block to lentivirus replication in monocyte-derived cells, and thus provide novel insights into the underlying molecular mechanism.

Neutron radiography with the cyclotron, 3

International Nuclear Information System (INIS)

Hiraoka, Eiichi; Fujishiro, Masatoshi; Tsujii, Yukio

1985-01-01

Neutron radiography is well recognized as a powerful tool in nondestructive testing, but not widely used yet owing to lack of high intense thermal neutron source convenient for practical use. A new neutron radiograph facility, utilizing a sub-compact cyclotron as neutron source and equipped with vertical and horizontal irradiation ports, is presented in this article. A series of experiment, prior to its construction, was conducted using beams of a variable energy cyclotron at Tohoku University to investigate the characteristics of thermal neutron obtained, from 9 Be (p, n) reaction and thermalized by elastic scattering process. This article describes a computer simulation of neutron moderator to analyze conditions getting maximal thermal neutron flux. Some of practical neutron radiograph examination of aero-space components and museum art objects of classic bronze mirror are also presented together with an attempt realizing real time imaging technique. (author)

Validation of the BUGJEFF311.BOLIB, BUGENDF70.BOLIB and BUGLE-B7 broad-group libraries on the PCA-Replica (H2O/Fe) neutron shielding benchmark experiment

OpenAIRE

Pescarini Massimo; Orsi Roberto; Frisoni Manuela

2016-01-01

The PCA-Replica 12/13 (H2O/Fe) neutron shielding benchmark experiment was analysed using the TORT-3.2 3D SN code. PCA-Replica reproduces a PWR ex-core radial geometry with alternate layers of water and steel including a pressure vessel simulator. Three broad-group coupled neutron/photon working cross section libraries in FIDO-ANISN format with the same energy group structure (47 n + 20 γ) and based on different nuclear data were alternatively used: the ENEA BUGJEFF311.BOLIB (JEFF-3.1.1) and U...

Neutron spin echo spectrometer at JRR-3M

International Nuclear Information System (INIS)

Takeda, Takayoshi; Komura, Shigehiro; Seto, Hideki; Nagai, Michihiro; Kobayashi, Hideki; Yokoi, Eiji; Ebisawa, Tooru; Tasaki, Seiji.

1993-01-01

We have designed and have been constructing at C 2-2 cold neutron guide port of JRR-3M, JAERI, a neutron spin echo spectrometer (NSE) which is equipped with two optimized magnets for neutron spin precession, a position sensitive detector (PSD), a converging polarizer and a wide area analyzer. The dynamic range of scattering vector Q covers from 0.01 A -1 to 0.3 A -1 and that of energy E from 30neV to 0.1meV. This spectrometer makes it possible to study a mesoscopic spatial structure of the order of 1-100nm combined with a nanosecond temporal structure of the order of 0.1-100ns corresponding to dynamical behavior of large molecules such as polymer. A test experiment shows that the homogeneity condition of the precession magnet is loosened by means of PSD. (author)

Assessment of fast and thermal neutron ambient dose equivalents around the KFUPM neutron source storage area using nuclear track detectors

Energy Technology Data Exchange (ETDEWEB)

Fazal-ur-Rehman [Physics Department, King Fahd University of Petroleum and Minerals, Dhahran 31261 (Saudi Arabia)]. E-mail: fazalr@kfupm.edu.sa; Al-Jarallah, M.I. [Physics Department, King Fahd University of Petroleum and Minerals, Dhahran 31261 (Saudi Arabia); Abu-Jarad, F. [Radiation Protection Unit, Environmental Protection Department, Saudi Aramco, P. O. Box 13027, Dhahran 31311 (Saudi Arabia); Qureshi, M.A. [Center for Applied Physical Sciences, King Fahd University of Petroleum and Minerals, Dhahran 31261 (Saudi Arabia)

2005-11-15

A set of five {sup 241}Am-Be neutron sources are utilized in research and teaching at King Fahd University of Petroleum and Minerals (KFUPM). Three of these sources have an activity of 16Ci each and the other two are of 5Ci each. A well-shielded storage area was designed for these sources. The aim of the study is to check the effectiveness of shielding of the KFUPM neutron source storage area. Poly allyl diglycol carbonate (PADC) Nuclear track detectors (NTDs) based fast and thermal neutron area passive dosimeters have been utilized side by side for 33 days to assess accumulated low ambient dose equivalents of fast and thermal neutrons at 30 different locations around the source storage area and adjacent rooms. Fast neutron measurements have been carried out using bare NTDs, which register fast neutrons through recoils of protons, in the detector material. NTDs were mounted with lithium tetra borate (Li{sub 2}B{sub 4}O{sub 7}) converters on their surfaces for thermal neutron detection via B10(n,{alpha})Li6 and Li6(n,{alpha})H3 nuclear reactions. The calibration factors of NTD both for fast and thermal neutron area passive dosimeters were determined using thermoluminescent dosimeters (TLD) with and without a polyethylene moderator. The calibration factors for fast and thermal neutron area passive dosimeters were found to be 1.33 proton tracks cm{sup -2}{mu}Sv{sup -1} and 31.5 alpha tracks cm{sup -2}{mu}Sv{sup -1}, respectively. The results show variations of accumulated dose with the locations around the storage area. The fast neutron dose equivalents rates varied from as low as 182nSvh{sup -1} up to 10.4{mu}Svh{sup -1} whereas those for thermal neutron ranged from as low as 7nSvh{sup -1} up to 9.3{mu}Svh{sup -1}. The study indicates that the area passive neutron dosimeter was able to detect dose rates as low as 7 and 182nSvh{sup -1} from accumulated dose for thermal and fast neutrons, respectively, which were not possible to detect with the available active neutron

On the Stability of L4,5 in the Relativistic R3BP with Radiating ...

Indian Academy of Sciences (India)

Abstract. This paper discusses the motion of a test particle in the neigh- bourhood of the triangular points L4,5 by considering the less massive primary (secondary) as a source of radiation in the framework of the relativistic restricted three-body problem (R3BP). It is found that the positions and stability of the triangular point ...

AcEST: BP920145 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_E11 274 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E11. BP920145 - Show BP92014...is mRNA. clone: YMU001_000133_E11. Accession BP920145 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E11.... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adian

AcEST: BP920142 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_E05 486 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E05. BP920142 - Show BP92014...is mRNA. clone: YMU001_000133_E05. Accession BP920142 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris ...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris mRNA, clone: YMU001_0001

AcEST: BP919406 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000124_G04 562 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G04. BP919406 - Show BP919406...is mRNA. clone: YMU001_000124_G04. Accession BP919406 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-...ucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-veneris mRNA, c

AcEST: BP921000 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_D05 407 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D05. BP921000 - Show BP921000...is mRNA. clone: YMU001_000144_D05. Accession BP921000 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum cap...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum capillus-veneris mRN

AcEST: BP920995 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_C12 350 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C12. BP920995 - Show BP92099...is mRNA. clone: YMU001_000144_C12. Accession BP920995 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

AcEST: BP918015 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000108_F03 437 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F03. BP918015 - Show BP91801...is mRNA. clone: YMU001_000108_F03. Accession BP918015 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP918015|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F03. (437 letters) Data...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

AcEST: BP918018 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000108_F06 436 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F06. BP918018 - Show BP91801...is mRNA. clone: YMU001_000108_F06. Accession BP918018 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918018|Adiantum capillus-veneris mRNA, clone: YM...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

AcEST: BP912801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000023_A07 527 Adiantum capillus-veneris mRNA. clone: YMU001_000023_A07. BP912801 - Show BP912801...is mRNA. clone: YMU001_000023_A07. Accession BP912801 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912801...es. 25:3389-3402. Query= BP912801|Adiantum capillus-veneris mRNA, clone: YMU001_0

Serum levels of IGF-1 and IGF-BP3 are associated with event-free survival in adult Ewing sarcoma patients treated with chemotherapy

Directory of Open Access Journals (Sweden)

de Groot S

2017-06-01

Full Text Available Stefanie de Groot,1 Hans Gelderblom,1 Marta Fiocco,2,3 Judith VMG Bovée,4 Jacobus JM van der Hoeven,1 Hanno Pijl,5 Judith R Kroep1 1Department of Medical Oncology, 2Department of Medical Statistics and Bioinformatics, Leiden University Medical Center, 3Mathematical Department, Leiden University, 4Department of Pathology, 5Department of Endocrinology, Leiden University Medical Center, Leiden, the Netherlands Background: Activation of the insulin-like growth factor 1 (IGF-1 pathway is involved in cell growth and proliferation and is associated with tumorigenesis, tumor progression, and therapy resistance in solid tumors. We examined whether variability in serum levels of IGF-1, IGF-2, and IGF-binding protein 3 (IGF-BP3 can predict event-free survival (EFS and overall survival (OS in Ewing sarcoma patients treated with chemotherapy.Patients and methods: Serum levels of IGF-1, IGF-2, and IGF-BP3 of 22 patients with localized or metastasized Ewing sarcoma treated with six cycles of vincristine/ifosfamide/doxorubicin/etoposide (VIDE chemotherapy were recorded. Baseline levels were compared with presixth cycle levels using paired t-tests and were tested for associations with EFS and OS. Continuous variables were dichotomized according to the Contal and O’Quigley procedure. Survival analyses were performed using Cox regression analysis.Results: High baseline IGF-1 and IGF-BP3 serum levels were associated with EFS (hazard ratio [HR] 0.075, 95% confidence interval [CI] 0.009–0.602 and HR 0.090, 95% CI 0.011–0.712, respectively in univariate and multivariate analyses (HR 0.063, 95% CI 0.007–0.590 and HR 0.057, 95% CI 0.005–0.585, respectively. OS was improved, but this was not statistically significant. IGF-BP3 and IGF-2 serum levels increased during treatment with VIDE chemotherapy (P=0.055 and P=0.023, respectively.Conclusion: High circulating serum levels of IGF-1 and IGF-BP3 and the molar ratio of IGF-1:IGF-BP3 serum levels were associated

Trithallium tetraselenophosphate Tl3PSe4, and trithallium tetrathioarsenate, Tl3AsS4, by neutron time-of-flight diffraction

International Nuclear Information System (INIS)

Alkire, R.W.; Vergamini, P.J.; Larson, A.C.; Morosin, B.

1984-01-01

Room-temperature (293 K) single-crystal structure determinations of the isostructural materials Tl 3 PSe 4 and Tl 3 AsS 4 were performed at the Los Alamos National Laboratory Pulsed Neutron Facility. For Tl 3 PSe 4 : Msub(r) = 959.92, Pcmn, a = 9.276 (1), b = 11.036 (2), c = 9.058 (1) A, V = 927.27 A 3 , Z = 4, Dsub(m) = 6.87 (2), Dsub(x) = 6.876 Mg m -3 , lambdasub(neutron) = 0.5 → 5.2 A, F(000) = 252.5 fm. For Tl 3 AsS 4 : Msub(r) = 816.29, Pcmn, a = 9.084 (3), b = 10.877 (3), c = 8.877 (3) A, V = 877.11 A 3 , Z = 4, Dsub(m) = 6.18 (2), Dsub(x) = 6.181 Mg m -3 , lambdasub(neutron) = 0.5 → 5.2 A, F(000) = 177.2 fm. For Tl 3 PSe 4 (Tl 3 AsS 4 ), 1929 (1013) reflections were measured with I > 3sigma(I) and refined by full-matrix least squares to R(F) = 0.061 (0.063). Results on atomic refinement from this study represent an order of magnitude increase in precision over previous single-crystal X-ray structural work using Mo Kα radiation. The PSe 4 3- (AsS 4 3- ) groups have essentially tetrahedral configurations and one Tl + ion shows large anisotropic thermal motion which is structure related. (Auth.)

BP1 Homeoprotein Enhances Metastatic Potential in Er-Negative Breast Cancer

Directory of Open Access Journals (Sweden)

Yebo Fu, Yi Lian, Kyung Soon Kim, Lei Zhang, A. Katharine Hindle, Fred Brody, Robert S. Siegel, Timothy A. McCaffrey, Sidney W. Fu

2010-01-01

Full Text Available Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER- tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. I sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p<0.005, and enhanced the in vitro invasive activity by 25-65 fold (p<0.001. Microarray experiments were performed to identify differentially expressed genes when BP1 is overexpressed. The gene expression profile of the transfected cell lines were compared, resulting in 71 differentially expressed genes with a fold-change of >=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target.

On the exact solution for the multi-group kinetic neutron diffusion equation in a rectangle

International Nuclear Information System (INIS)

Petersen, C.Z.; Vilhena, M.T.M.B. de; Bodmann, B.E.J.

2011-01-01

In this work we consider the two-group bi-dimensional kinetic neutron diffusion equation. The solution procedure formalism is general with respect to the number of energy groups, neutron precursor families and regions with different chemical compositions. The fast and thermal flux and the delayed neutron precursor yields are expanded in a truncated double series in terms of eigenfunctions that, upon insertion into the kinetic equation and upon taking moments, results in a first order linear differential matrix equation with source terms. We split the matrix appearing in the transformed problem into a sum of a diagonal matrix plus the matrix containing the remaining terms and recast the transformed problem into a form that can be solved in the spirit of Adomian's recursive decomposition formalism. Convergence of the solution is guaranteed by the Cardinal Interpolation Theorem. We give numerical simulations and comparisons with available results in the literature. (author)

CALTRANS: A parallel, deterministic, 3D neutronics code

Energy Technology Data Exchange (ETDEWEB)

Carson, L.; Ferguson, J.; Rogers, J.

1994-04-01

Our efforts to parallelize the deterministic solution of the neutron transport equation has culminated in a new neutronics code CALTRANS, which has full 3D capability. In this article, we describe the layout and algorithms of CALTRANS and present performance measurements of the code on a variety of platforms. Explicit implementation of the parallel algorithms of CALTRANS using both the function calls of the Parallel Virtual Machine software package (PVM 3.2) and the Meiko CS-2 tagged message passing library (based on the Intel NX/2 interface) are provided in appendices.

AcEST: BP914068 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000039_E04 420 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E04. BP914068 - Show BP91406...is mRNA. clone: YMU001_000039_E04. Accession BP914068 Tissue type prothallium Developmental stage - Contig I...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914068|Adiantum capillus-veneris mRNA, clone:

AcEST: BP915406 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000071_B11 433 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B11. BP915406 - Show BP915406...is mRNA. clone: YMU001_000071_B11. Accession BP915406 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: Y...leic Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B11. (433

AcEST: BP912099 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_B05 315 Adiantum capillus-veneris mRNA. clone: YMU001_000015_B05. BP912099 - Show BP912099...is mRNA. clone: YMU001_000015_B05. Accession BP912099 Tissue type prothallium Developmental stage - Contig I...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099|Adiantum capillus-vene

AcEST: BP918801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000117_F03 542 Adiantum capillus-veneris mRNA. clone: YMU001_000117_F03. BP918801 - Show BP918801...is mRNA. clone: YMU001_000117_F03. Accession BP918801 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum capillus-veneris mRNA, clone: YMU0...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum ca

AcEST: BP917801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000105_F04 280 Adiantum capillus-veneris mRNA. clone: YMU001_000105_F04. BP917801 - Show BP917801...is mRNA. clone: YMU001_000105_F04. Accession BP917801 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-ve... Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-veneris mRNA, clone: YMU001_000105_F04.

AcEST: BP918017 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000108_F05 267 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F05. BP918017 - Show BP91801...is mRNA. clone: YMU001_000108_F05. Accession BP918017 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris m...cleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F05. (26

AcEST: BP915801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000077_B02 555 Adiantum capillus-veneris mRNA. clone: YMU001_000077_B02. BP915801 - Show BP915801...is mRNA. clone: YMU001_000077_B02. Accession BP915801 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP915801|Adiantum capillus-veneris mRNA, clone: YMU001_000077_B02. ...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915801|A

COSTANZA, 1-D 2 Group Space-Dependent Reactor Dynamics of Spatial Reactor with 1 Group Delayed Neutrons

International Nuclear Information System (INIS)

Agazzi, A.; Gavazzi, C.; Vincenti, E.; Monterosso, R.

1964-01-01

1 - Nature of physical problem solved: The programme studies the spatial dynamics of reactor TESI, in the two group and one space dimension approximation. Only one group of delayed neutrons is considered. The programme simulates the vertical movement of the control rods according to any given movement law. The programme calculates the evolution of the fluxes and temperature and precursor concentration in space and time during the power excursion. 2 - Restrictions on the complexity of the problem: The maximum number of lattice points is 100

Investigation on the neutron beam characteristics for boron neutron capture therapy with 3D and 2D transport calculations

International Nuclear Information System (INIS)

Kodeli, I.; Diop, C.M.; Nimal, J.C.

1994-01-01

In the framework of future Boron Neutron Capture Therapy (BNCT) experiments, where cells and animals irradiations are planned at the research reactor of Strasbourg University, the feasibility to obtain a suitable epithermal neutron beam is investigated. The neutron fluence and spectra calculations in the reactor are performed using the 3D Monte Carlo code TRIPOLI-3 and the 2D SN code TWODANT. The preliminary analysis of Al 2 O 3 and Al-Al 2 O 3 filters configurations are carried out in an attempt to optimize the flux characteristics in the beam tube facility. 7 figs., 7 refs

Matrix-type multiple reciprocity boundary element method for solving three-dimensional two-group neutron diffusion equations

International Nuclear Information System (INIS)

Itagaki, Masafumi; Sahashi, Naoki.

1997-01-01

The multiple reciprocity boundary element method has been applied to three-dimensional two-group neutron diffusion problems. A matrix-type boundary integral equation has been derived to solve the first and the second group neutron diffusion equations simultaneously. The matrix-type fundamental solutions used here satisfy the equation which has a point source term and is adjoint to the neutron diffusion equations. A multiple reciprocity method has been employed to transform the matrix-type domain integral related to the fission source into an equivalent boundary one. The higher order fundamental solutions required for this formulation are composed of a series of two types of analytic functions. The eigenvalue itself is also calculated using only boundary integrals. Three-dimensional test calculations indicate that the present method provides stable and accurate solutions for criticality problems. (author)

NodHex3D: An application for solving the neutron diffusion equations in hexagonal-Z geometry and steady state; NodHex3D: Una aplicacion para solucionar las ecuaciones de difusion de neutrones en geometria hexagonal-Z y estado estacionario

Energy Technology Data Exchange (ETDEWEB)

Esquivel E, J. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico); Del Valle G, E., E-mail: jaime.esquivel@inin.gob.mx [IPN, Escuela Superior de Fisica y Matematicas, Av. IPN s/n, Edificio 9, Col. San Pedro Zacatenco, 07738 Mexico D. F. (Mexico)

2014-10-15

The system called NodHex3D is a graphical application that allows the solution of the neutron diffusion equation. The system considers fuel assemblies of hexagonal cross section. This application arose from the idea of expanding the development of neutron own codes, used primarily for academic purposes. The advantage associated with the use of NodHex3D, is that the kernel configuration and fuel batches is dynamically without affecting directly the base source code of the solution of the neutron diffusion equation. In addition to the kernel configuration to use, specify the values for the cross sections for each batch of fuel used, these values are: diffusion coefficient, removal cross section, absorption cross section, fission cross section and dispersion cross section. Important also, considering that the system is able to perform calculations for various energy groups. As evidence of the operation of NodHex3D, was proposed to model three-dimensional core of a nuclear reactor VVER-1000, based on the reference problem AER-FCM-101. The configuration of the reactor core consists of fuel assemblies (25 batches), composed of seven distinct materials, one of which reflector material, vacuum boundary conditions on the surface delimiting the reactor core. The diffusion equation for two energy groups solves, obtaining the value of the effective neutron multiplication factor. The obtained results are compared to those documented in the reference problem and by 3-DNT codes. (Author)

AcEST: BP920147 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_F01 365 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F01. BP920147 - Show BP92014...is mRNA. clone: YMU001_000133_F01. Accession BP920147 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920147|Adiantum capillus-veneris mRNA, clone: YMU001_...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201

AcEST: BP920144 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_E09 265 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E09. BP920144 - Show BP92014...is mRNA. clone: YMU001_000133_E09. Accession BP920144 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920144|Adiantum capillus-veneris mRNA, clone: YMU001...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

AcEST: BP920141 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_E04 528 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E04. BP920141 - Show BP92014...is mRNA. clone: YMU001_000133_E04. Accession BP920141 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (528 lette...cleic Acids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (52

AcEST: BP913406 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000029_H06 570 Adiantum capillus-veneris mRNA. clone: YMU001_000029_H06. BP913406 - Show BP913406...is mRNA. clone: YMU001_000029_H06. Accession BP913406 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capillus-veneris mRNA, clone: YMU00...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capil...LDVTRGLVNGARGVVVAFES--GKHG---------------LPH 406 Query: 387 VRFACNRAEIVIGPDRQTVESGGMQVARRIQVPLILAWALSVHKCQGM

AcEST: BP918012 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000108_E12 547 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E12. BP918012 - Show BP91801...is mRNA. clone: YMU001_000108_E12. Accession BP918012 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108_E1

MCNP6 model of the University of Washington clinical neutron therapy system (CNTS).

Science.gov (United States)

Moffitt, Gregory B; Stewart, Robert D; Sandison, George A; Goorley, John T; Argento, David C; Jevremovic, Tatjana

2016-01-21

A MCNP6 dosimetry model is presented for the Clinical Neutron Therapy System (CNTS) at the University of Washington. In the CNTS, fast neutrons are generated by a 50.5 MeV proton beam incident on a 10.5 mm thick Be target. The production, scattering and absorption of neutrons, photons, and other particles are explicitly tracked throughout the key components of the CNTS, including the target, primary collimator, flattening filter, monitor unit ionization chamber, and multi-leaf collimator. Simulations of the open field tissue maximum ratio (TMR), percentage depth dose profiles, and lateral dose profiles in a 40 cm × 40 cm × 40 cm water phantom are in good agreement with ionization chamber measurements. For a nominal 10 × 10 field, the measured and calculated TMR values for depths of 1.5 cm, 5 cm, 10 cm, and 20 cm (compared to the dose at 1.7 cm) are within 0.22%, 2.23%, 4.30%, and 6.27%, respectively. For the three field sizes studied, 2.8 cm × 2.8 cm, 10.4 cm × 10.3 cm, and 28.8 cm × 28.8 cm, a gamma test comparing the measured and simulated percent depth dose curves have pass rates of 96.4%, 100.0%, and 78.6% (depth from 1.5 to 15 cm), respectively, using a 3% or 3 mm agreement criterion. At a representative depth of 10 cm, simulated lateral dose profiles have in-field (⩾ 10% of central axis dose) pass rates of 89.7% (2.8 cm × 2.8 cm), 89.6% (10.4 cm × 10.3 cm), and 100.0% (28.8 cm × 28.8 cm) using a 3% and 3 mm criterion. The MCNP6 model of the CNTS meets the minimum requirements for use as a quality assurance tool for treatment planning and provides useful insights and information to aid in the advancement of fast neutron therapy.

New Multi-group Transport Neutronics (PHISICS) Capabilities for RELAP5-3D and its Application to Phase I of the OECD/NEA MHTGR-350 MW Benchmark

Energy Technology Data Exchange (ETDEWEB)

Gerhard Strydom; Cristian Rabiti; Andrea Alfonsi

2012-10-01

PHISICS is a neutronics code system currently under development at the Idaho National Laboratory (INL). Its goal is to provide state of the art simulation capability to reactor designers. The different modules for PHISICS currently under development are a nodal and semi-structured transport core solver (INSTANT), a depletion module (MRTAU) and a cross section interpolation (MIXER) module. The INSTANT module is the most developed of the mentioned above. Basic functionalities are ready to use, but the code is still in continuous development to extend its capabilities. This paper reports on the effort of coupling the nodal kinetics code package PHISICS (INSTANT/MRTAU/MIXER) to the thermal hydraulics system code RELAP5-3D, to enable full core and system modeling. This will enable the possibility to model coupled (thermal-hydraulics and neutronics) problems with more options for 3D neutron kinetics, compared to the existing diffusion theory neutron kinetics module in RELAP5-3D (NESTLE). In the second part of the paper, an overview of the OECD/NEA MHTGR-350 MW benchmark is given. This benchmark has been approved by the OECD, and is based on the General Atomics 350 MW Modular High Temperature Gas Reactor (MHTGR) design. The benchmark includes coupled neutronics thermal hydraulics exercises that require more capabilities than RELAP5-3D with NESTLE offers. Therefore, the MHTGR benchmark makes extensive use of the new PHISICS/RELAP5-3D coupling capabilities. The paper presents the preliminary results of the three steady state exercises specified in Phase I of the benchmark using PHISICS/RELAP5-3D.

AcEST: BP912406 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000018_F09 348 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F09. BP912406... CL1894Contig1 Show BP912406 Clone id YMU001_000018_F09 Library YMU01 Length 348 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_F09. Accession BP912406 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406|Adiantum capillus-veneris mRNA...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406

AcEST: BP917406 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000100_D10 492 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D10. BP917406... CL2033Contig1 Show BP917406 Clone id YMU001_000100_D10 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_D10. Accession BP917406 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917406...Nucleic Acids Res. 25:3389-3402. Query= BP917406|Adiantum capillus-veneris mRNA,

AcEST: BP916801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000091_G06 127 Adiantum capillus-veneris mRNA. clone: YMU001_000091_G06. BP916801... CL2168Contig1 Show BP916801 Clone id YMU001_000091_G06 Library YMU01 Length 127 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000091_G06. Accession BP916801 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP916801|Adiantum capillus-veneris mRNA, clone: YMU0...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916801

AcEST: BP913801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000035_D11 562 Adiantum capillus-veneris mRNA. clone: YMU001_000035_D11. BP913801... CL482Contig1 Show BP913801 Clone id YMU001_000035_D11 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000035_D11. Accession BP913801 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum capillus-veneris mRNA, clone: YMU0

AcEST: BP920801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000141_G10 454 Adiantum capillus-veneris mRNA. clone: YMU001_000141_G10. BP920801... CL819Contig1 Show BP920801 Clone id YMU001_000141_G10 Library YMU01 Length 454 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000141_G10. Accession BP920801 Tissue type prothallium Developmental stage... Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-veneris mRNA, clone: ...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-

48 CFR 225.104 - Nonavailable articles.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Nonavailable articles. 225.104 Section 225.104 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Nonavailable articles. (a) DoD has determined that the following articles also are nonavailable in accordance...

The cold neutron source in DR 3

International Nuclear Information System (INIS)

Jensen, K.; Leth, j.A.

1980-09-01

A description of the cold neutron source in DR 3 is given. The moderator of the cold neutron source is supercritical hydrogen at about 30degK and 15 bar abs. The necessary cooling capacity is supplied by two Philips Stirling B20 cryogenerators. The hydrogen is circulated between the cryogenerators and the in-pile moderator chamber by small fans. The safety of the facility is based on the use of triple containment preventing contact between hydrogen and air. The triple containment is achieved by enclosing the high vacuum system, surrounging the hydrogen system, in a helium blanket. The achieved spectrum of the thermal neutron flux and the gain factor are given as well as the experience from more than 5 years of operation. Finally some work on extension of the facility to operate two cold sources is reported. (author)

The {sup 3}He neutron-spin filter at ILL

Energy Technology Data Exchange (ETDEWEB)

Tasset, F; Heil, W; Humblot, H; Lelievre-Berna, E; Roberts, T [Institut Max von Laue - Paul Langevin (ILL), 38 - Grenoble (France)

1997-04-01

Neutron-Spin Filters (NSF) using gaseous polarised {sup 3}He have long been recognised as of enormous potential value in many polarised neutron-scattering applications and, accordingly, ILL started a development programme some years ago. This report gives an account of the present status of the project. (author). 13 refs.

Interface requirements to couple thermal-hydraulic codes to 3D neutronic codes

Energy Technology Data Exchange (ETDEWEB)

Langenbuch, S.; Austregesilo, H.; Velkov, K. [GRS, Garching (Germany)] [and others

1997-07-01

The present situation of thermalhydraulics codes and 3D neutronics codes is briefly described and general considerations for coupling of these codes are discussed. Two different basic approaches of coupling are identified and their relative advantages and disadvantages are discussed. The implementation of the coupling for 3D neutronics codes in the system ATHLET is presented. Meanwhile, this interface is used for coupling three different 3D neutronics codes.

Interface requirements to couple thermal-hydraulic codes to 3D neutronic codes

International Nuclear Information System (INIS)

Langenbuch, S.; Austregesilo, H.; Velkov, K.

1997-01-01

The present situation of thermalhydraulics codes and 3D neutronics codes is briefly described and general considerations for coupling of these codes are discussed. Two different basic approaches of coupling are identified and their relative advantages and disadvantages are discussed. The implementation of the coupling for 3D neutronics codes in the system ATHLET is presented. Meanwhile, this interface is used for coupling three different 3D neutronics codes

A group of neutronics calculations in the MNSR using the MCNP-4C code

International Nuclear Information System (INIS)

Khattab, K.; Sulieman, I.

2009-11-01

The MCNP-4C code was used to model the 3-D core configuration for the Syrian Miniature Neutron Source Reactor (MNSR). The continuous energy neutron cross sections were evaluated from ENDF/B-VI library to calculate the thermal and fast neutron fluxes in the MNSR inner and outer irradiation sites. The thermal fluxes in the MNSR inner irradiation sites were measured for the first time using the multiple foil activation method. Good agreements were noticed between the calculated and measured results. This model is used as well to calculate neutron flux spectrum in the reactor inner and outer irradiation sites and the reactor thermal power. Three 3-D neutronic models for the Syrian MNSR reactor using the MCNP-4C code were developed also to assess the possibility of fuel conversion from 89.87 % HEU fuel (UAl 4 -Al) to 19.75 % LEU fuel (UO 2 ). This model is used in this paper to calculate the following reactor core physics parameters: clean cold core excess reactivity, calibration of the control rod worth and calculation its shut down margin, calibration of the top beryllium shim plate reflector, axial neutron flux distributions in the inner and outer irradiation sites and the kinetics parameters ( ι p l and β e ff). (authors)

The universal library of fission products and delayed neutron group yields

International Nuclear Information System (INIS)

Koldobskiy, A.B.; Zhivun, V.M.

1997-01-01

A new fission product yield library based on the Semiempirical method for the estimation of their mass and charge distribution is described. Contrary to other compilations, this library can be used with all possible excitation energies of fissionable actinides. The library of delayed neutron group yields, based on the fission product yield compilation, is described as well. (author). 15 refs, 4 tabs

Field neutron spectrometer using 3He, TEPC, and multisphere detectors

International Nuclear Information System (INIS)

Brackenbush, L.W.

1991-01-01

Since the last DOE Neutron Dosimetry Workshop, there have been a number of changes in radiation protection standards proposed by national and international advisory bodies. These changes include: increasing quality factors for neutrons by a factor of two, defining quality factors as a function of lineal energy rather than linear energy transfer (see ACCRUE-40; Joint Task Group 1986), and adoption of effective dose equivalent methodologies. In order to determine the effects of these proposed changes, it is necessary to know the neutron energy spectrum in the work place. In response to the possible adoption of these proposals, the Department of Energy (DOE) initiated a program to develop practical neutron spectrometry systems for use by health physicists. One part of this program was the development of a truly portable, battery operated liquid scintillator spectrometer using proprietary electronics developed at Lawrence Livermore National Laboratory (LLNL); this instrument will be described in the following paper. The second part was the development at PNL of a simple transportable spectrometer based on commercially available electronics. This open-quotes field neutron spectrometerclose quotes described in this paper is intended to be used over a range of neutron energies extending from thermal to 20 MeV

AcEST: BP920140 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_E03 489 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E03. BP92014...0 CL2574Contig1 Show BP920140 Clone id YMU001_000133_E03 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E03. Accession BP920140 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920140|Adian... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

AcEST: BP920146 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_E12 401 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E12. BP92014...6 CL388Contig1 Show BP920146 Clone id YMU001_000133_E12 Library YMU01 Length 401 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_E12. Accession BP920146 Tissue type prothallium Developmental stage...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum ca...rams, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum capillus-veneris mRNA, clone: YMU001_000133_

AcEST: BP920148 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_F02 429 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F02. BP92014...8 CL3819Contig1 Show BP920148 Clone id YMU001_000133_F02 Library YMU01 Length 429 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F02. Accession BP920148 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920148|Adiantum capillus-vener...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

AcEST: BP920149 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_F03 624 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F03. BP92014...9 CL2860Contig1 Show BP920149 Clone id YMU001_000133_F03 Library YMU01 Length 624 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F03. Accession BP920149 Tissue type prothallium Developmental stag...ic Acids Res. 25:3389-3402. Query= BP920149|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F03. (624 l...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

AcEST: BP914065 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000039_E01 548 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E01. BP91406...5 CL604Contig1 Show BP914065 Clone id YMU001_000039_E01 Library YMU01 Length 548 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_E01. Accession BP914065 Tissue type prothallium Developmental stage...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU0...cids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU001_000039_E01. (548 lette

AcEST: BP914061 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000039_D09 599 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D09. BP91406...1 CL1730Contig1 Show BP914061 Clone id YMU001_000039_D09 Library YMU01 Length 599 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D09. Accession BP914061 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adia...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adiantum capillus-veneris mRNA, c

AcEST: BP914069 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000039_E05 368 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E05. BP91406...9 CL2761Contig1 Show BP914069 Clone id YMU001_000039_E05 Library YMU01 Length 368 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_E05. Accession BP914069 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001_0000...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001

AcEST: BP914064 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000039_D12 560 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D12. BP91406...4 CL532Contig1 Show BP914064 Clone id YMU001_000039_D12 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_D12. Accession BP914064 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adiantum capillus-vener...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adi

AcEST: BP916406 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000087_D01 556 Adiantum capillus-veneris mRNA. clone: YMU001_000087_D01. BP916406... CL1913Contig1 Show BP916406 Clone id YMU001_000087_D01 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_D01. Accession BP916406 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capill...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capillus-veneris mRNA, c

AcEST: BP914406 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000058_E09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E09. BP914406... CL513Contig1 Show BP914406 Clone id YMU001_000058_E09 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000058_E09. Accession BP914406 Tissue type prothallium Developmental stage...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406|Adiantum capillus...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406

AcEST: BP914060 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000039_D08 539 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D08. BP91406...0 CL1835Contig1 Show BP914060 Clone id YMU001_000039_D08 Library YMU01 Length 539 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D08. Accession BP914060 Tissue type prothallium Developmental stag...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris ...Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris mRNA, clone: YMU001_000039_D08. (539 lett

AcEST: BP920998 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_D03 529 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D03. BP92099...8 CL1935Contig1 Show BP920998 Clone id YMU001_000144_D03 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_D03. Accession BP920998 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-veneris mRNA, clon... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-ven

AcEST: BP920999 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_D04 588 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D04. BP92099...9 CL317Contig1 Show BP920999 Clone id YMU001_000144_D04 Library YMU01 Length 588 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D04. Accession BP920999 Tissue type prothallium Developmental stage...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

AcEST: BP920996 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_D01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D01. BP92099...6 CL262Contig1 Show BP920996 Clone id YMU001_000144_D01 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D01. Accession BP920996 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920996|Adiantum capillus-ve

AcEST: BP920992 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_C05 525 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C05. BP92099...2 CL2523Contig1 Show BP920992 Clone id YMU001_000144_C05 Library YMU01 Length 525 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C05. Accession BP920992 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C05. (525 lett...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_00014

AcEST: BP918013 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000108_F01 490 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F01. BP918013 - Show BP91801...is mRNA. clone: YMU001_000108_F01. Accession BP918013 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...idylinositol-4-phosphate 5-kinase 1 OS=Oryza sativa subsp. japonica GN=PIPK1 PE=2 SV=2 Length = 801 Score = ..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

AcEST: BP914801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000063_A07 396 Adiantum capillus-veneris mRNA. clone: YMU001_000063_A07. BP914801... CL1121Contig1 Show BP914801 Clone id YMU001_000063_A07 Library YMU01 Length 396 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000063_A07. Accession BP914801 Tissue type prothallium Developmental stag...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801|Adiantum capillus-veneris mRNA, clone:

Production of neutronic discrete equations for a cylindrical geometry in one group energy and benchmark the results with MCNP-4B code with one group energy library

International Nuclear Information System (INIS)

Salehi, A. A.; Vosoughi, N.; Shahriari, M.

2002-01-01

In reactor core neutronic calculations, we usually choose a control volume and investigate about the input, output, production and absorption inside it. Finally, we derive neutron transport equation. This equation is not easy to solve for simple and symmetrical geometry. The objective of this paper is to introduce a new direct method for neutronic calculations. This method is based on physics of problem and with meshing of the desired geometry, writing the balance equation for each mesh intervals and with notice to the conjunction between these mesh intervals, produce the final discrete equation series without production of neutron transport differential equation and mandatory passing form differential equation bridge. This method, which is named Direct Discrete Method, was applied in static state, for a cylindrical geometry in one group energy. The validity of the results from this new method are tested with MCNP-4B code with a one group energy library. One energy group direct discrete equation produces excellent results, which can be compared with the results of MCNP-4B

Neutron cross section measurements for the Fast Breeder Program

International Nuclear Information System (INIS)

Block, R.C.

1979-06-01

This research was concerned with the measurement of neutron cross sections of importance to the Fast Breeder Reactor. The capture and total cross sections of fission products ( 101 102 104 Ru, 143 145 Nd, 149 Sm, 95 97 Mo, Cs, Pr, Pd, 107 Pd, 99 Tc) and tag gases (Kr, 78 80 Kr) were measured up to 100 keV. Filtered neutron beams were used to measure the capture cross section of 238 U (with an Fe filter) and the total cross section of Na (with a Na filter). A radioactive neutron capture detector was developed. A list of publications is included

INTCAL09 AND MARINE09 RADIOCARBON AGE CALIBRATION CURVES, 0-50,000 YEARS CAL BP

NARCIS (Netherlands)

Reimer, P. J.; Baillie, M. G. L.; Bard, E.; Bayliss, A.; Beck, J. W.; Blackwell, P. G.; Ramsey, C. Bronk; Buck, C. E.; Burr, G. S.; Edwards, R. L.; Friedrich, M.; Grootes, P. M.; Guilderson, T. P.; Hajdas, I.; Heaton, T. J.; Hogg, A. G.; Hughen, K. A.; Kaiser, K. F.; Kromer, B.; McCormac, F. G.; Manning, S. W.; Reimer, R. W.; Richards, D. A.; Southon, J. R.; Talamo, S.; Turney, C. S. M.; van der Plicht, J.; Weyhenmeye, C. E.; Weyhenmeyer, C.E.

2009-01-01

The IntCal04 and Marine04 radiocarbon calibration curves have been updated from 12 cal kBP (cal kBP is here defined as thousands of calibrated years before AD 1950), and extended to 50 cal kBP, utilizing newly available data sets that meet the IntCal Working Group criteria for pristine corals and

A phase I trial of PR-104, a pre-prodrug of the bioreductive prodrug PR-104A, given weekly to solid tumour patients

International Nuclear Information System (INIS)

McKeage, Mark J; Gu, Yongchuan; Wilson, William R; Hill, Andrew; Amies, Karen; Melink, Teresa J; Jameson, Michael B

2011-01-01

The phosphate ester PR-104 is rapidly converted in vivo to the alcohol PR-104A, a nitrogen mustard prodrug that is metabolised to hydroxylamine (PR-104H) and amine (PR-104M) DNA crosslinking agents by one-electron reductases in hypoxic cells and by aldo-keto reductase 1C3 independently of oxygen. In a previous phase I study using a q 3 week schedule of PR-104, the maximum tolerated dose (MTD) was 1100 mg/m 2 and fatigue, neutropenic fever and infection were dose-limiting. The primary objective of the current study was to determine the dose-limiting toxicity (DLT) and MTD of weekly PR-104. Patients with advanced solid tumours received PR-104 as a 1-hour intravenous infusion on days 1, 8 and 15 every 28 days with assessment of pharmacokinetics on cycle 1 day 1. Twenty-six patients (pts) were enrolled (16 male/10 female; median age 58 yrs, range 30 to 70 yrs) who had received a median of two prior chemotherapy regimens (range, 0 to 3) for melanoma (8 pts), colorectal or anal cancer (3 pts), NSCLC (3 pts), sarcoma (3 pts), glioblastoma (2 pts), salivary gland tumours (2 pts) or other solid tumours (5 pts). PR-104 was administered at 135 mg/m 2 (3 pts), 270 mg/m 2 (6 pts), 540 mg/m 2 (6 pts), 675 mg/m 2 (7 pts) and 900 mg/m 2 (4 pts) for a median of two treatment cycles (range, 1 to 7 cycles) and five infusions (range, 1 to 18) per patient. Dose-limiting toxicities (DLTs) during cycle one included grade four thrombocytopenia at 540 mg/m 2 (1 of 6 pts) and grade four thrombocytopenia and neutropenia at 900 mg/m 2 (2 of 4 pts). At an intermediate dose of 675 mg/m 2 , there were no DLTs among a total of seven patients given 12 treatment cycles but all experienced moderate to severe (grade 2 to 4) haematological toxicity. Thrombocytopenia was delayed in its onset and nadir, and its recovery was protracted and incomplete in many patients. There were no complete or partial tumour responses. PR-104-induced thrombocytopenia and neutropenia correlated with plasma AUC of PR-104

Study of the Li2CO3 as thermal neutrons detector

International Nuclear Information System (INIS)

Herrera A, E.; Urena N, F.; Delfin L, A.

2003-01-01

The use every day but it frequents of the thermal neutrons in the treatment of tumours, using the neutron capture therapy technique in boron, there is generated the necessity to develop a dosimetric system that allows to evaluate in a reliable way the fluence and consequently the dose of neutrons that it is given in the tumours of the patients. One of the techniques but employees to determine the neutron fluence sub cadmic and epi cadmic in an indirect way, it is the activation of thin sheets of gold undress and covered with cadmium respectively that when being exposed to a neutron beam to the nuclear reaction 197 Au (n, γ ) 198 Au, emitting gamma radiation with an energy of 0.4118 MeV, being this, a disadvantage to be used as dosemeter. On the other hand, when exposing the lithium carbonate to a thermal neutron beam, free radicals of CO 3 that are quantified by the electron paramagnetic resonance technique are generated. This work analyzes those basic parameters that determine if those made up of Li 2 CO 3 complete with the requirements to be used as detectors and/or dosemeters of thermal neutrons. (Author)

Evaluation of CdZnTe as neutron detector around medical accelerators

International Nuclear Information System (INIS)

Martin-Martin, A.; Iniguez, M. P.; Luke, P. N.; Barquero, R.; Lorente, A.; Morchon, J.; Gallego, E.; Quincoces, G.; Marti-Climent, J. M.

2009-01-01

The operation of electron linear accelerators (LINACs) and cyclotrons can produce a mixed gamma-neutron field composed of energetic neutrons coming directly from the source and scattered lower energy neutrons. The thermal neutron detection properties of a non-moderated coplanar-grid CdZnTe (CZT) gamma-ray detector close to an 18 MV electron LINAC and an 18 MeV proton cyclotron producing the radioisotope 18 F for positron emission tomography are investigated. The two accelerators are operated at conditions producing similar thermal neutron fluence rates of the order of 104 cm -2 s -1 at the measurement locations. The counting efficiency of the CZT detector using the prompt 558 keV photopeak following 113 Cd thermal neutron capture is evaluated and a good neutron detection performance is found at the two installations. (authors)

Use of the helium-3 proportional counter for neutron spectrometry

International Nuclear Information System (INIS)

Vialettes, H.; Le Thanh, P.

1967-01-01

Up to now, two methods have been mainly used for neutron spectrometry near nuclear installations: - photographic emulsion spectrometry - the so-called, 'multisphere' technique spectrometry. The first method, which is fairly difficult to apply, has a threshold energy of about 500 keV; this is a big disadvantage for an apparatus which has to be used for spectrometry around nuclear installations where the neutron radiation is very much degraded energetically. The second method does not suffer from this disadvantage but the results which it yields are only approximate. In order to extend the energy range of the neutron spectra studied with sufficient accuracy the use of a helium-3 proportional counter has been considered. This report presents the principles of operation of the helium-3 spectrometer, and the calculation methods which make it possible to take into account the two main effects tending to deform the spectra obtained: - energy absorption by the walls of the counter, - energy loss of the incident neutrons due to elastic collisions with helium-3 nuclei. As an example of the application, the shape of the neutron spectrum emitted by a polonium-lithium source is given; the results obtained are in excellent agreement with theoretical predictions. (authors) [fr

Study of the Li{sub 2}CO{sub 3} as thermal neutrons detector; Estudio del Li{sub 2}CO{sub 3} como detector de neutrones termicos

Energy Technology Data Exchange (ETDEWEB)

Herrera A, E.; Urena N, F.; Delfin L, A. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)] e-mail: eha@nuclear.inin.mx

2003-07-01

The use every day but it frequents of the thermal neutrons in the treatment of tumours, using the neutron capture therapy technique in boron, there is generated the necessity to develop a dosimetric system that allows to evaluate in a reliable way the fluence and consequently the dose of neutrons that it is given in the tumours of the patients. One of the techniques but employees to determine the neutron fluence sub cadmic and epi cadmic in an indirect way, it is the activation of thin sheets of gold undress and covered with cadmium respectively that when being exposed to a neutron beam to the nuclear reaction {sup 197}Au (n, {gamma} ) {sup 198} Au, emitting gamma radiation with an energy of 0.4118 MeV, being this, a disadvantage to be used as dosemeter. On the other hand, when exposing the lithium carbonate to a thermal neutron beam, free radicals of CO{sub 3} that are quantified by the electron paramagnetic resonance technique are generated. This work analyzes those basic parameters that determine if those made up of Li{sub 2}CO{sub 3} complete with the requirements to be used as detectors and/or dosemeters of thermal neutrons. (Author)

Polarization of fast neutrons in VVR-M reactor

International Nuclear Information System (INIS)

Garusov, E.A.; Lifshits, E.P.; Petrov, Yu.V.

1987-01-01

Neutron polarization in the reactor leads to circular polarization of γ quanta emitted both in radiational capture of neutrons and in the transition of nuclei excited as a result of inelastic scattering to the ground state. This may be used to determine the polarization of reactor neutrons. The circular polarization of γ quanta at light-water and graphite targets at the center of the active zone of the VVR-M reactor at the B.P. Konstantinov Leningrad Institute of Nuclear Physics was recently measured. A simplified experimental scheme is shown. Fast neutrons leaving the active zone of the reactor were excited in the inelastic scattering at the target nuclei. The polarization of the γ quanta emitted by nuclei in transitions to the ground state was measured by a polarimeter positioned above the active zone. The reason for the circular polarization of γ quanta may also be nonconservation of P parity on account of weak interaction in the capture of a neutron by hydrogen

41 CFR 105-1.104 - Publication of GSPMR.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Publication of GSPMR. 105-1.104 Section 105-1.104 Public Contracts and Property Management Federal Property Management....104 Publication of GSPMR. (a) Most GSPMR are published in the Federal Register. This practice helps to...

Neutron diffraction analysis of HRh[P(C6H5)3]4

International Nuclear Information System (INIS)

Bau, R.; Stevens, R.C.; McLean, M.; Koetzle, T.F.

1987-01-01

We have collected neutron diffraction data on a large single crystal of the title compound. The most surprising result is an extremely short Rh-H distance of 1.31(8) A, presumably caused by steric interactions involving the bulky triphenyl phosphine ligands. Crystallographic details: HRh[P(C 6 H 5 ) 3 ] 4 . 1 / 2 C 6 H 6 crystallizes in the space group Pa3, with a = b = c = 22.776(3) A, Z = 8. Data were collected at the Brookhaven High Flux Beam reactor at a temperature of -23 0 C, λ = 1.15882(7) A -1 . Least-squares refinement (in which the phenyl rings were treated as rigid groups) resulted in an R factor [based on data with f > 4σ(F)] of 0.12 for 914 reflections and 95 parameters. 10 refs

Design and producing of fine-group cross section library HENDL3.0/FG for subcritical system

International Nuclear Information System (INIS)

Zou, J.; Zeng, Q.; Xu, D.; Hu, L.; Long, P.

2012-01-01

To improve the accuracy of the neutron analyses for subcritical system with thermal fission blanket, a coupled neutron and photon (315 n + 42γ) fine-group cross section library HENDL3.0/FG based on ENDF/B-VII, JEFF3.1 and JENDL3.3 was produced by FDS team. In order to test the availability and reliability of the HENDL3.0/FG data library, shielding and critical safety benchmarks were performed with VisualBUS code. The testing results indicated that the discrepancy between calculation and experimental values of nuclear parameters fell in a reasonable range. It showed that the nuclear data library had accuracy and availability. (authors)

InterProScan Result: BP123442 [KAIKOcDNA[Archive

Lifescience Database Archive (English)

Full Text Available BP123442 BP123442_1_ORF1 331440C6CA592A17 PRINTS PR00385 P450 6.3e-05 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...

AcEST: BP920994 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_C10 322 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C10. BP92099...4 CL2871Contig1 Show BP920994 Clone id YMU001_000144_C10 Library YMU01 Length 322 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C10. Accession BP920994 Tissue type prothallium Developmental stag...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

AcEST: BP920990 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_C03 445 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C03. BP92099...0 CL4123Contig1 Show BP920990 Clone id YMU001_000144_C03 Library YMU01 Length 445 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C03. Accession BP920990 Tissue type prothallium Developmental stag...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9209...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

AcEST: BP920991 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_C04 521 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C04. BP92099...1 CL3173Contig1 Show BP920991 Clone id YMU001_000144_C04 Library YMU01 Length 521 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C04. Accession BP920991 Tissue type prothallium Developmental stag...s. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (521 letters) Dat...ucleic Acids Res. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (5

AcEST: BP918016 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000108_F04 434 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F04. BP91801...6 CL3779Contig1 Show BP918016 Clone id YMU001_000108_F04 Library YMU01 Length 434 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000108_F04. Accession BP918016 Tissue type prothallium Developmental stag..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...ic Acids Res. 25:3389-3402. Query= BP918016|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F04. (434 l

Experiment and analysis of neutron spectra in a concrete assembly bombarded by 14 MeV neutrons

International Nuclear Information System (INIS)

Oishi, Koji; Tomioka, Kazuyuki; Ikeda, Yujiro; Nakamura, Tomoo.

1988-01-01

Neutron spectrum in concrete bombarded by 14 MeV neutrons was measured using a miniature NE213 spectrometer and multi-foil activation method. A good agreement between those two experimental methods was obtained within experimental errors. The measured spectrum was compared with calculated ones using two-dimensional transport code DOT3.5 with 125 group structure cross section libraries based on ENDF/B-IV, JENDL-2, and JENDL-3T (the testing version of JENDL-3.) In the D-T neutron peak region, measured and calculated neutron spectra agreed well with each other for those libraries. However, disagreements of about -10 % to +50 % and -30 % to +40 % were obtained in the MeV region and still lower neutron energy range, respectively. As a result, it was concluded that those discrepancies were caused by the overestimation of secondary neutrons emitted by inelastic scattering from O, Si, and/or Ca which were the main components of concrete. (author)

Pediatric peripheral blood progenitor cell collection: haemonetics MCS 3P versus COBE Spectra versus Fresenius AS104.

Science.gov (United States)

Bambi, F; Faulkner, L B; Azzari, C; Gelli, A M; Tamburini, A; Tintori, V; Lippi, A A; Tucci, F; Bernini, G; Genovese, F

1998-01-01

An increasing number of apheresis machines are becoming available for peripheral blood progenitor cell (PBPC) collection in children. At the Children's Hospital of Florence (Italy), three apheresis machines were evaluated: MCS 3P (Haemonetics) (10 procedures in 4 patients, aged 10-12 years, weight 23.5-64 kg), Spectra, (COBE) (8 procedures in 3 patients, aged 4-17 years, weight 19-59 kg), and AS104 (Fresenius) (24 procedures in 9 patients, aged 2-16 years, weight 13.6-60 kg). For PBPC quantitative analysis, CD34 cytofluorimetry was employed. Relevant variables analyzed included efficiency of CD34+ cell extraction and enrichment, mononuclear cell purity and red cell contamination of the apheresis components, and platelet count decreases after leukapheresis. No significant differences in CD34+ cell-extraction abilities were found. However, the AS104 provided consistently purer leukapheresis components in terms of mononuclear cell and CD34+ cell enrichment (441 +/- 59%, vs. 240 +/- 35% and 290 +/- 42% for MCS 3P and Spectra, respectively). Postapheresis platelet counts dropped the least with the AS104. The smallest patient who underwent apheresis with MCS 3P (the only machine working on discontinuous flow and hence with greater volume shifts) weighed 23.5 kg and tolerated the procedure well, with no signs of hemodynamic instability. No significant complications were observed. All machines seem to have comparable PBPC extraction efficiency, but the AS104 seems to give the component with the greatest PBPC enrichment. This feature might be relevant for further ex vivo cell processing (CD34+ cell selection, expansion, and so on).

Study on the novel neutron-to-proton convertor for improving the detection efficiency of a triple GEM based fast neutron detector

International Nuclear Information System (INIS)

Wang Xiaodong; Yang Lei; Zhang Chunhui; Hu Bitao; Yang Herun; Zhang Junwei; Ren Zhongguo; Ha Ri-Ba-La; An Luxing

2015-01-01

A high-efficiency fast neutron detector prototype based on a triple Gas Electron Multiplier (GEM) detector, which, coupled with a novel multi-layered high-density polyethylene (HDPE) as a neutron-to-proton converter for improving the neutron detection efficiency, is introduced and tested with the Am-Be neutron source in the Institute of Modern Physics (IMP) at Lanzhou in the present work. First, the developed triple GEM detector is tested by measuring its effective gain and energy resolution with "5"5Fe X-ray source to ensure that it has a good performance. The effective gain and obtained energy resolution is 5.0 × 10"4 and around 19.2%, respectively. Secondly, the novel multi-layered HDPE converter is coupled with the cathode of the triple GEM detector making it a high-efficiency fast neutron detector. Its effective neutron response is four times higher than that of the traditional single-layered conversion technique when the converter layer number is 38. (authors)

Randomized trial of guiding hypertension management using central aortic blood pressure compared with best-practice care: principal findings of the BP GUIDE study.

Science.gov (United States)

Sharman, James E; Marwick, Thomas H; Gilroy, Deborah; Otahal, Petr; Abhayaratna, Walter P; Stowasser, Michael

2013-12-01

Arm cuff blood pressure (BP) may overestimate cardiovascular risk. Central aortic BP predicts mortality and could be a better method for patient management. We sought to determine the usefulness of central BP to guide hypertension management. This was a prospective, open-label, blinded-end point study in 286 patients with hypertension randomized to treatment decisions guided by best-practice usual care (n=142; using office, home, and 24-hour ambulatory BP) or, in addition, by central BP intervention (n=144; using SphygmoCor). Therapy was reviewed every 3 months for 12 months, and recommendations were provided to each patient and his/her doctor on antihypertensive medication titration. Outcome measures were as follows: medication quantity (daily defined dose), quality of life, and left ventricular mass (3-dimensional echocardiography). There was 92% compliance with recommendations on medication titration, and quality of life improved in both groups (post hoc P0.10), but with intervention there was a significant stepwise decrease in daily defined dose from baseline to 3 months (P=0.008) and each subsequent visit (all P0.05). We conclude that guidance of hypertension management with central BP results in a significantly different therapeutic pathway than conventional cuff BP, with less use of medication to achieve BP control and no adverse effects on left ventricular mass, aortic stiffness, or quality of life.

Metastability-exchange optical pumping of 3He for neutron polarizers

International Nuclear Information System (INIS)

Gentile, T.R.; Thompson, A.K.; Snow, W.M.

1995-01-01

Research is underway at NIST and IU to develop neutron polarizers that are based on polarized 3 He. Such polarizers rely on the strong spin dependence of the cross section for neutron capture by polarized 3 He. Two methods can produce the high density of polarized 3 He gas (10 19 -10 20 cm -3 ) required for an effective neutron polarizer: spin-exchange optical pumping, which is performed directly at high pressure (1-10 bar), and metastability-exchange optical pumping, in which the gas is polarized at low pressure (1 mbar) and then compressed. While we are pursuing both methods, progress in the metastable method will be discussed. The features of the metastable method are the high rate at which the gas can be polarized and the inherent separation of the optical pumping and target cells. In a landmark achievement, researchers at the Univ. of Mainz have developed a piston compressor that can fill a 130 cm 3 cell to a pressure of 7 bar of 45% polarized 3 He gas in 2 hours. We plan to develop a compressor and test it at the NIST Cold Neutron Research Facility. We have constructed a metastable-pumping apparatus at NIST and have obtained 76% polarization with a pumping rate of 1.2 x 10 18 atoms/sec in a 0.4 mbar, 270 cm 3 cell

Optimizing moderation of He-3 neutron detectors for shielded fission sources

Energy Technology Data Exchange (ETDEWEB)

Rees, Lawrence B., E-mail: Lawrence_Rees@byu.edu [Department of Physics and Astronomy, Brigham Young University, Provo, UT 84602 (United States); Czirr, J. Bart, E-mail: czirr@juno.com [Department of Physics and Astronomy, Brigham Young University, Provo, UT 84602 (United States)

2012-11-01

The response of a {sup 3}He neutron detector is highly dependent on the amount of moderator incorporated into the detector system. If there is too little moderation, neutrons will not react with the {sup 3}He. If there is too much moderation, neutrons will not reach the {sup 3}He. In applications for portal or border monitors where {sup 3}He detectors are used to interdict illicit importation of plutonium, the fission source is always shielded to some extent. Since the energy distribution of neutrons emitted from the source depends on the amount and type of shielding present, the optimum placement of moderating material around {sup 3}He tubes is a function of shielding. In this paper, we use Monte Carlo techniques to model the response of {sup 3}He tubes placed in polyethylene boxes for moderation. To model the shielded fission neutron source, we use a point {sup 252}Cf source placed in the center of polyethylene spheres of varying radius. Detector efficiency as a function of box geometry and shielding is explored. We find that increasing the amount of moderator behind and to the sides of the detector generally improves the detector response, but that incremental benefits are minimal if the thickness of the polyethylene moderator is greater than about 5-7 cm. The thickness of the moderator in front of the {sup 3}He tubes, however, is very important. For bare sources, about 4-5 cm of moderator is optimum, but as the shielding increases, the optimum thickness of this moderator decreases to 0.5-1 cm. Similar conclusions can be applied to polyethylene boxes employing two {sup 3}He tubes. Two-tube boxes with front moderators of non-uniform thickness may be useful for detecting neutrons over a wide energy range.

AcEST: BP918019 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000108_F08 47 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F08. BP918019 - Show BP91801... mRNA. clone: YMU001_000108_F08. Accession BP918019 Tissue type prothallium Developmental stage - Contig ID

SNAP-3D: a three-dimensional neutron diffusion code

International Nuclear Information System (INIS)

McCallien, C.W.J.

1975-10-01

A preliminary report is presented describing the data requirements of a one- two- or three-dimensional multi-group diffusion code, SNAP-3D. This code is primarily intended for neutron diffusion calculations but it can also carry out gamma calculations if the diffuse approximation is accurate enough. It is suitable for fast and thermal reactor core calculations and for shield calculations. It is assumed the reader is familiar with the older, two-dimensional code SNAP and can refer to the report [TRG-Report-1990], describing it. The present report concentrates on the enhancements to SNAP that have been made to produce the three-dimensional version, SNAP-3D, and is intended to act a a guide on data preparation until a single, comprehensive report can be published. (author)

Group Representation of the Prompt Fission Neutron Spectrum of {sup 252}Cf

Energy Technology Data Exchange (ETDEWEB)

Croft, S.; Miller, K. A. [Safeguards Science and Technology Group (N-1), Nuclear Nonproliferation Division, Los Alamos National Laboratory, Los Alamos(United States)

2011-12-15

We review the spectral representation used for the prompt fission neutron spectrum of 252Cf in the International Organization for Standardization document ISO 8529-1. We find corrections to Table A.2, the discrete group structure form, of this report are needed. We describe the approach to generating replacement values and provide a new tabulation.

Two-group neutron transport theory in adjacent space with lineary anisotropic scattering

International Nuclear Information System (INIS)

Maiorino, J.R.

1978-01-01

A solution method for two-group neutron transport theory with anisotropic scattering is introduced by the combination of case method (expansion method of self singular function) and the invariant imbedding (invariance principle). The numerical results for the Milne problem in light water and borated water is presented to demonstrate the avalibility of the method [pt

Towards 100Sn: Studies on neutron-deficient even isotopes of tin

International Nuclear Information System (INIS)

Rathke, G.E.

1987-02-01

Neutron-deficient 108,106,104 Sn isotopes were produced by heavy ion induced fusion reactions using high-intensity 59 Ni beams from the UNILAC of the GSI. Their decay properties were studied by techniques of gamma and conversion electron spectroscopy employing the mass separator on-line to the UNILAC. Earlier information on the 108 Sn → 108 In and 106 Sn → 106 In decays was complemented and improved in the course of this work. The new nucleus 104 Sn and its decay to excited states in 104 In was identified and studied for the first time. These investigations yield the following results: the mass of 104 Sn and of nuclei linked to it by alpha decay or proton radioactivity, 108 Te, 112 Xe and 109 I, 113 Cs, respectively were determined from the measured Q EC value of 104 Sn and the known mass value of 104 In. These are nuclei very close or beyond the proton drip line. In addition, information on the quenching of the fast Gamow-Teller beta decay of the even neutron-deficient tin isotopes was obtained. This complements investigations on the N = 50 isotones 94 Ru and 96 Pd, and allows a systematic comparison of these transition strengths for nuclei near the doubly magic 100 Sn. The spreading of the vertical strokeπg 9/2 -1 vg 7/2 , 1 + > configuration over several states, due to residual interactions, and the centroid energies of these magnetic dipole states were determined for the corresponding odd-odd indium isotopes. (orig./HSI)

BP-C1 in the treatment of patients with stage IV breast cancer: a randomized, double-blind, placebo-controlled multicenter study and an additional open-label treatment phase

Directory of Open Access Journals (Sweden)

Larsen S

2014-11-01

screening and after every 16 days of treatment. Computed tomography was performed at screening and every 32 days.Results: The sum of target lesions increased 2.4% in the BP-C1 group and 14.3% in the placebo group. Only the increase in the placebo group was significant (P=0.013. The difference between the groups was significant in favor of BP-C1 (P=0.04. There was a significant difference (P=0.026 in favor of BP-C1 regarding Response Evaluation Criteria In Solid Tumors (RECIST classification. The sum of lesions increased slightly in the patients receiving 64 days of continuous BP-C1 treatment, of whom 68.4% were classified as responders. The sum CTC-NCI toxicity score increased nonsignificantly in the BP-C1 group but significantly in the placebo group (P=0.05. The difference in increase between groups did not meet the level of significance (P=0.12. The sum toxicity score was reduced in the patients receiving 64 days of BP-C1 from 9.2 at screening to 8.9 at Day 48, but it increased again to 10.1 by Day 64 and 10.6 during the 28-day follow-up. "Breast cancer-related pain and discomfort" and "Breast cancer treatment problem last week" were significantly reduced (P=0.02 in the BP-C1 group but increased slightly in the placebo group; between-group differences were significant in favor of BP-C1 (P=0.05. "Breast cancer related pain and discomfort", "Breast cancer treatment problem last week," and "Physical activity problem" were significantly reduced during the 64 days of BP-C1 treatment (P≤0.05.Conclusion: For patients suffering from stage IV metastatic breast cancer, treatment with BP-C1 reduces cancer growth, is well tolerated, improves quality of life, and produces few adverse events, which were mainly mild and manageable.Keywords: tumor growth reduction, improved Quality of Life, safe, few transient adverse effects

X-ray and neutron scattering investigations of YCo3-H

International Nuclear Information System (INIS)

Benham, M.J.; Bennington, S.M.; Ross, D.K.; Noreus, D.; Yamaguchi, M.

1989-01-01

Various structural studies of YCo 3 H(D) x in the β-phase (0 2 . Neutron diffraction and inelastic neutron scattering were also used in tandem, and hydrogen occupation of a single (36i) tetrahedral site was inferred for the entire concentration range. (orig.)

Role of G3BP1 in glucocorticoid receptor-mediated microRNA-15b and microRNA-23a biogenesis in endothelial cells

KAUST Repository

Kwok, Hoi-Hin

2017-05-18

MicroRNAs (miRNAs) are a family of non-coding RNAs that play crucial roles in regulating various normal cellular responses. Recent studies revealed that the canonical miRNA biogenesis pathway is subject to sophisticated regulation. Hormonal control of miRNA biogenesis by androgen and estrogen has been demonstrated, but the direct effects of the glucocorticoid receptor (GR) on miRNA biogenesis are unknown. This study revealed the role of GR in miRNA maturation. We showed that two GR agonists, dexamethasone and ginsenoside-Rg1 rapidly suppressed the expression of mature miR-15b, miR-23a, and miR-214 in human endothelial cells. RNA pulldown coupled with proteomic analysis identified GTPase-activating protein (SH3 domain) binding protein 1 (G3BP1) as one of the RNA-binding proteins mediating GR-regulated miRNA maturation. Activated GR induced phosphorylation of v-AKT Murine Thymoma Viral Oncogene Homologue (AKT) kinase, which in turn phosphorylated and promoted nuclear translocation of G3BP1. The nuclear G3BP1 bound to the G3BP1 consensus sequence located on primary miR-15b~16-2 and miR-23a~27a~24-2 to inhibit their maturation. The findings from this study have advanced our understanding of the non-genomic effects of GR in the vascular system.

NodHex3D: An application for solving the neutron diffusion equations in hexagonal-Z geometry and steady state

International Nuclear Information System (INIS)

Esquivel E, J.; Del Valle G, E.

2014-10-01

The system called NodHex3D is a graphical application that allows the solution of the neutron diffusion equation. The system considers fuel assemblies of hexagonal cross section. This application arose from the idea of expanding the development of neutron own codes, used primarily for academic purposes. The advantage associated with the use of NodHex3D, is that the kernel configuration and fuel batches is dynamically without affecting directly the base source code of the solution of the neutron diffusion equation. In addition to the kernel configuration to use, specify the values for the cross sections for each batch of fuel used, these values are: diffusion coefficient, removal cross section, absorption cross section, fission cross section and dispersion cross section. Important also, considering that the system is able to perform calculations for various energy groups. As evidence of the operation of NodHex3D, was proposed to model three-dimensional core of a nuclear reactor VVER-1000, based on the reference problem AER-FCM-101. The configuration of the reactor core consists of fuel assemblies (25 batches), composed of seven distinct materials, one of which reflector material, vacuum boundary conditions on the surface delimiting the reactor core. The diffusion equation for two energy groups solves, obtaining the value of the effective neutron multiplication factor. The obtained results are compared to those documented in the reference problem and by 3-DNT codes. (Author)

Notes on seasonality and subsistence of west Cantabrian human groups about 1300 BP

Directory of Open Access Journals (Sweden)

Mateos Cachorro, Ana

2002-12-01

Full Text Available Final Pleistocene palaeocommunities developed some adaptative answers to alleviate their environmental constrictions. One of them using in hunting strategies was the differential selection of some individuals by age or sex. In this study the possible ages of death are estimated from mandibles and analysed along with their processing by the human groups that lived in Caldas Cave about 13000 BP. It will try to characterize mortality patterns from the ungulates in their diet, to define the stationary character of the site and to check if it is possible to consider a tactics of intentional and differential temporal planning as an answer to a subsistence strategy. These are part of a palaeoeconomic system that organized the life of these Final Upper Paleolithic societies in face of the ecological pressures and cultural limitations that were imposed them. This analysis may allow us to estimate modes of occupation and mobility in a territory as a strategic space of resource management.

Las paleocomunidades del Pleistoceno final desarrollaron unas respuestas de adaptación al entorno para paliar alguna de sus constricciones ambientales. Una de ellas, en lo que a técnicas de caza se refiere, era la selección diferencial de algunos individuos bien por edad o sexo. En este estudio se analizan las posibles edades de muerte estimadas a partir de las mandíbulas y el procesado antrópico de las mismas por parte de los grupos humanos que habitaron la Cueva de Las Caldas en el 13000 BP. Con ello se trata de caracterizar los patrones de mortalidad de los ungulados que formaron parte de su dieta, definir el carácter estacionario del yacimiento y comprobar si se puede hablar de una táctica de planificación temporal intencionada y diferencial como respuesta a una estrategia de subsistencia. Estos planteamientos forman parte del sistema paleoeconómico responsable del funcionamiento de estas sociedades del Paleolítico Superior Final ante las presiones

Group constant preparation for the estimate of neutron induced damage in structural materials

International Nuclear Information System (INIS)

Panini, G.C.

1996-01-01

Neutron heating (kerma), displacement per atom cross sections (DPA), gas and γ-ray production are important parameters for the estimate of the damage produced by neutron induced nuclear reactions in the structural materials. The NJOY System for Nuclear Data Processing has been extensively used in order to compute the above quantities; here the theory, the algorithms and the connected problems are described. (author). 6 refs, 3 tabs

Redefining the PF06864 Pfam family based on Burkholderia pseudomallei PilO2(Bp S-SAD crystal structure.

Directory of Open Access Journals (Sweden)

Patricia Lassaux

Full Text Available Type IV pili are surface-exposed filaments and bacterial virulence factors, represented by the Tfpa and Tfpb types, which assemble via specific machineries. The Tfpb group is further divided into seven variants, linked to heterogeneity in the assembly machineries. Here we focus on PilO2(Bp, a protein component of the Tfpb R64 thin pilus variant assembly machinery from the pathogen Burkholderia pseudomallei. PilO2(Bp belongs to the PF06864 Pfam family, for which an improved definition is presented based on newly derived Hidden Markov Model (HMM profiles. The 3D structure of the N-terminal domain of PilO2(Bp (N-PilO2(Bp, here reported, is the first structural representative of the PF06864 family. N-PilO2(Bp presents an actin-like ATPase fold that is shown to be present in BfpC, a different variant assembly protein; the new HMM profiles classify BfpC as a PF06864 member. Our results provide structural insight into the PF06864 family and on the Type IV pili assembly machinery.

First demonstration of laser engagement of 1-Hz-injected flying pellets and neutron generation

Science.gov (United States)

Komeda, Osamu; Nishimura, Yasuhiko; Mori, Yoshitaka; Hanayama, Ryohei; Ishii, Katsuhiro; Nakayama, Suisei; Kitagawa, Yoneyoshi; Sekine, Takashi; Sato, Nakahiro; Kurita, Takashi; Kawashima, Toshiyuki; Kan, Hirofumi; Nakamura, Naoki; Kondo, Takuya; Fujine, Manabu; Azuma, Hirozumi; Motohiro, Tomoyoshi; Hioki, Tatsumi; Kakeno, Mitsutaka; Sunahara, Atsushi; Sentoku, Yasuhiko; Miura, Eisuke

2013-01-01

Pellet injection and repetitive laser illumination are key technologies for realizing inertial fusion energy. Numerous studies have been conducted on target suppliers, injectors, and tracking systems for flying pellet engagement. Here we for the first time demonstrate the pellet injection, counter laser beams' engagement and neutron generation. Deuterated polystyrene (CD) bead pellets, after free-falling for a distance of 18 cm at 1 Hz, are successfully engaged by two counter laser beams from a diode-pumped, ultra-intense laser HAMA. The laser energy, pulse duration, wavelength, and the intensity are 0.63 J per beam, 104 fs, and 811 nm, 4.7 × 1018 W/cm2, respectively. The irradiated pellets produce D(d,n)3He-reacted neutrons with a maximum yield of 9.5 × 104/4π sr/shot. Moreover, the laser is found out to bore a straight channel with 10 μm-diameter through the 1-mm-diameter beads. The results indicate potentially useful technologies and findings for the next step in realizing inertial fusion energy. PMID:24008696

Electric quadrupole moments of the 2$_{1}^{+}$ states in $^{100,102,104}$Cd

CERN Document Server

Ekström, A; DiJulio, D D; Fahlander, C; Hjorth-Jensen, M; Blazhev, A; Bruyneel, B; Butler, P A; Davinson, T; Eberth, J; Fransen, C; Geibel, K; Hess, H; Ivanov, O; Iwanicki, J; Kester, O; Kownacki, J; Köster, U; Marsh, B A; Reiter, P; Scheck, M; Siebeck, B; Siem, S; Stefanescu, I; Toft, H K; Tveten, G M; van de Walle, J; Voulot, D; Warr, N; Weisshaar, D; Wenander, F; Wrzosek, K; Zielińska, M

2009-01-01

Using the REX-ISOLDE facility at CERN the Coulomb excitation cross sections for the 0gs+→21+ transition in the β-unstable isotopes 100,102,104Cd have been measured for the first time. Two different targets were used, which allows for the first extraction of the static electric quadrupole moments Q(21+) in 102,104Cd. In addition to the B(E2) values in 102,104Cd, a first experimental limit for the B(E2) value in 100Cd is presented. The data was analyzed using the maximum likelihood method. The provided probability distributions impose a test for theoretical predictions of the static and dynamic moments. The data are interpreted within the shell-model using realistic matrix elements obtained from a G-matrix renormalized CD-Bonn interaction. In view of recent results for the light Sn isotopes the data are discussed in the context of a renormalization of the neutron effective charge. This study is the first to use the reorientation effect for post-accelerated short-lived radioactive isotopes to simultaneously d...

Extension of the AUS reactor neutronics system for application to fusion blanket neutronics

International Nuclear Information System (INIS)

Robinson, G.S.

1984-03-01

The AUS modular code scheme for reactor neutronics computations has been extended to apply to fusion blanket neutronics. A new group cross-section library with 200 neutron groups, 37 photon groups and kerma factor data has been generated from ENDF/B-IV. The library includes neutron resonance subgroup parameters and temperature-dependent data for thermal neutron scattering matrices. The validity of the overall calculation system for fusion applications has been checked by comparison with a number of published conceptual design studies

Designing an Epithermal Neutron Beam for Boron Neutron Capture Therapy for the Fusion Reactions 2H(d,n)3He and 3H(d,n)4He1

International Nuclear Information System (INIS)

Verbeke, J.M.; Costes, S.V.; Bleuel, D.; Vujic, J.; Leung, K.N.

1998-01-01

A beam shaping assembly has been designed to moderate high energy neutrons from the fusion reactions 2 H(d,N) 3 He and 3 H(d,n) 4 He for use fin boron neutron capture therapy. The low neutron yield of the 2 H(d,n) 3 He reaction led to unacceptably long treatment times. However, a 160 mA deuteron beam of energy 400 keV led to a treatment time of 120 minutes with the reaction 3 H(d,n) 4 He. Equivalent doses of 9.6 Gy-Eq and 21.9 Gy-Eq to the skin and to a 8 cm deep tumor respectively have been computed

Free NH3 quantum rotations in Hofmann clathrates: structure factors and line widths studied by inelastic neutron scattering

International Nuclear Information System (INIS)

Sobolev, O.; Vorderwisch, P.; Desmedt, A.

2005-01-01

Quantum rotations of NH 3 groups in Hofmann clathrates Ni-Ni-C 6 H 6 and Ni-Ni-C 12 H 10 have been studied using inelastic neutron scattering. Calculations of the dynamical structure factor for a free uniaxial quantum rotor reproduce the neutron scattering data with respect to their Q- and T-dependence as well as the relative intensities for the 0 → 1, 0 → 2 and 1 → 2 transitions. Though the effective NH 3 rotation constant is different from the gas phase value, the effective radius of rotation (i.e., the average distance of protons from the rotation axis) is equal or very close to the geometrical value r = 0.94 A for a NH 3 group. Comparing the experimental data with the calculated dynamical structure factor for the 0 → 3 transition it could be shown, that the corresponding transition line, in contrast to transitions between j = 0,1,2 levels measured so far, has a finite width at T = 0 K

Neutron diffraction studies on structural and magnetic properties of RE2NiGe3 (RE=La, Ce)

International Nuclear Information System (INIS)

Kalsi, Deepti; Rayaprol, S.; Siruguri, V.; Peter, Sebastian C.

2014-01-01

We report the crystallographic properties of RE 2 NiGe 3 (RE=La, Ce) synthesized by arc melting. Rietveld refinement on the powder neutron diffraction (ND) data suggest both compounds are isostructural and crystallize in the non-centrosymmetric Er 2 RhSi 3 type structure having hexagonal space group P6 ¯ 2c. In the crystal structure of RE 2 NiGe 3 , two dimensional arrangements of nickel and germanium atoms lead to the formation of hexagonal layers with rare earth atoms sandwiched between them. Magnetic susceptibility measurements performed in low fields exhibit antiferromagnetic ordering in cerium compound around (T o =) 3.2 K. Neutron diffraction measurements at 2.8 K (i.e., at T3 and Ce 2 NiGe 3 crystallize in the Er 2 RhSi 3 type. Magnetic susceptibility show antiferromagnetic ordering for Ce 2 NiGe 3 at 3.2 K and neutron diffraction confirms the absence of long range ordering. - Highlights: RE 2 NiGe 3 (RE=La, Ce) crystallize in the ordered superstructure of the AlB 2 type. Magnetic susceptibility measurements exhibit antiferromagnetic ordering in Ce 2 NiGe 3 . Structure and magnetism of RE 2 NiGe 3 (RE=La, Ce) are studied by neutron diffraction

3-Bromopyruvate (3BP) a fast acting, promising, powerful, specific, and effective "small molecule" anti-cancer agent taken from labside to bedside: introduction to a special issue.

Science.gov (United States)

Pedersen, Peter L

2012-02-01

Although the "Warburg effect", i.e., elevated glucose metabolism to lactic acid (glycolysis) even in the presence of oxygen, has been recognized as the most common biochemical phenotype of cancer for over 80 years, its biochemical and genetic basis remained unknown for over 50 years. Work focused on elucidating the underlying mechanism(s) of the "Warburg effect" commenced in the author's laboratory in 1969. By 1985 among the novel findings made two related most directly to the basis of the "Warburg effect", the first that the mitochondrial content of tumors exhibiting this phenotype is markedly decreased relative to the tissue of origin, and the second that such mitochondria have markedly elevated amounts of the enzyme hexokinase-2 (HK2) bound to their outer membrane. HK2 is the first of a number of enzymes in cancer cells involved in metabolizing the sugar glucose to lactic acid. At its mitochondrial location HK2 binds at/near the protein VDAC (voltage dependent anion channel), escapes inhibition by its product glucose-6-phosphate, and gains access to mitochondrial produced ATP. As shown by others, it also helps immortalize cancer cells, i.e., prevents cell death. Based on these studies, the author's laboratory commenced experiments to elucidate the gene basis for the overexpression of HK2 in cancer. These studies led to both the discovery of a unique HK2 promoter region markedly activated by both hypoxic conditions and moderately activated by several metabolites (e.g., glucose), Also discovered was the promoter's regulation by epigenetic events (i.e., methylation, demethylation). Finally, the author's laboratory turned to the most important objective. Could they selectively and completely destroy cancerous tumors in animals? This led to the discovery in an experiment conceived, designed, and conducted by Young Ko that the small molecule 3-bromopyruvate (3BP), the subject of this mini-review series, is an incredibly powerful and swift acting anticancer agent

Recent status of studies on the neutron irradiation effect focusing on Nb3Sn and Nb3Al strands

International Nuclear Information System (INIS)

Nishimura, Arata

2011-01-01

A fusion reactor generates a lot of 14 MeV neutrons, some of which penetrate shielding blankets, stream out of ports and reach superconducting magnets. Some important studies were performed in the 1970s and a basic understanding of the mechanisms of neutron irradiation effect was established. Advances in the design concept of nuclear fusion reactors led to the need for consistent studies on the neutron irradiation effect of A-15 strands such as Nb 3 Sn and Nb 3 Al, which are strong candidates for fusion reactors. In the early 2000s, a progressive attempt to organize the collaborative research of universities and national institutes was started using a 14 MeV neutron source at Japan Atomic Energy Agency. This paper outlines the neutron irradiation issues related to superconducting magnets for fusion, and a brief history of research on the neutron irradiation effect is provided. In addition, experimental results regarding changes in the superconducting properties of Nb 3 Sn and Nb 3 Al strands by neutron irradiation obtained in the newly established collaborative framework are presented, and general mechanisms for the property changes are introduced. (author)

SU(3) symmetries in exotic neutron-rich nuclei

International Nuclear Information System (INIS)

Hayes, A.C.

1991-01-01

We examine the structure of the exotic neutron-rich nucleus 11 Li with an emphasis on understanding the origin of the soft E1 resonance and the neuron halo. The similarities and differences between shell model and di-neutron cluster model descriptions of the system are displayed using the Hecht expansion techniques. We find that the ground state 11 Li as described in large shell model calculations is well approximated by the di-neutron cluster state. In contrast to the ground state, the soft E1 model of 11 Li appears to have a more complicated structure and the E1 strength of this resonance is very sensitive to cancellations between p→s and p→d contributions to the dipole matrix elements. 12 refs., 6 figs., 3 tabs

SuperADAM: upgraded polarized neutron reflectometer at the Institut Laue-Langevin.

Science.gov (United States)

Devishvili, A; Zhernenkov, K; Dennison, A J C; Toperverg, B P; Wolff, M; Hjörvarsson, B; Zabel, H

2013-02-01

A new neutron reflectometer SuperADAM has recently been built and commissioned at the Institut Laue-Langevin, Grenoble, France. It replaces the previous neutron reflectometer ADAM. The new instrument uses a solid state polarizer/wavelength filter providing a highly polarized (up to 98.6%) monochromatic neutron flux of 8 × 10(4) n cm(-2) s(-1) with monochromatization Δλ∕λ = 0.7% and angular divergence Δα = 0.2 mrad. The instrument includes both single and position sensitive detectors. The position sensitive detector allows simultaneous measurement of specular reflection and off-specular scattering. Polarization analysis for both specular reflection and off-specular scattering is achieved using either mirror analyzers or a (3)He spin filter cell. High efficiency detectors, low background, and high flux provides a dynamic range of up to seven decades in reflectivity. Detailed specifications and the instrument capabilities are illustrated with examples of recently collected data in the fields of thin film magnetism and thin polymer films.

AcEST: BP912612 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000020_H07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H07. BP912612 - Show BP912612... Clone id YMU001_000020_H07 Library YMU01 Length 512 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000020_H07. Accession BP912612 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912612|Adiantum cap...illus-veneris mRNA, clone: YMU001_000020_H07. (512 letters) Database: uniprot_sprot.fasta 412,525 sequences;

AcEST: BP912212 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000016_D11 457 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D11. BP912212... CL1085Contig1 Show BP912212 Clone id YMU001_000016_D11 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D11. Accession BP912212 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912212...|Adiantum capillus-veneris mRNA, clone: YMU001_000016_D11. (457 letters) Database: uniprot_sprot.fasta 412

AcEST: BP912312 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000017_F01 489 Adiantum capillus-veneris mRNA. clone: YMU001_000017_F01. BP912312... CL1779Contig1 Show BP912312 Clone id YMU001_000017_F01 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000017_F01. Accession BP912312 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912312...|Adiantum capillus-veneris mRNA, clone: YMU001_000017_F01. (489 letters) Database: uniprot_sprot.fasta 412

AcEST: BP912128 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_D10 477 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D10. BP91212...8 CL2328Contig1 Show BP912128 Clone id YMU001_000015_D10 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D10. Accession BP912128 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...8|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D10. (461 letters) Database: uniprot_sprot.fasta 412

AcEST: BP912912 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000024_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000024_C05. BP912912... CL1433Contig1 Show BP912912 Clone id YMU001_000024_C05 Library YMU01 Length 413 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000024_C05. Accession BP912912 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912912|Adiantum capillus-ven...eris mRNA, clone: YMU001_000024_C05. (413 letters) Database: uniprot_sprot.fasta 412

AcEST: BP919999 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000131_G09 554 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G09. BP919999... CL2968Contig1 Show BP919999 Clone id YMU001_000131_G09 Library YMU01 Length 554 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_G09. Accession BP919999 Tissue type prothallium Developmental stag...b Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generatio...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919999|Adiantum capillus-ve

AcEST: BP920997 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_D02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D02. BP92099...7 CL10Contig1 Show BP920997 Clone id YMU001_000144_D02 Library YMU01 Length 534 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_D02. Accession BP920997 Tissue type prothallium Developmental stage ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920997|Adian...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2

Fast Neutron Radiotherapy for Locally Advanced Prostate Cancer: Final Report of a Radiation Therapy Oncology Group Randomized Clinical Trial

Energy Technology Data Exchange (ETDEWEB)

Laramore, G. E.; Krall, J. M.; Thomas, F. J.; Russell, K. J.; Maor, M. H.; Hendrickson, F. R.; Martz, K. L.; Griffin, T. W.; Davis, L. W.

1993-01-01

Between June 1977 and April 1983 the Radiation Therapy Oncology Group (RTOG) sponsored a Phase III randomized trial investigating the use of fast neutron radiotherapy for patients with locally advanced (Stages C and D1) adenocarcinoma of the prostate gland. Patients were randomized to receive either conventional photon radiation or fast neutron radiation used in a mixed-beam (neutron/photon) treatment schedule. A total of 91 analyzable patients were entered into the study, and the two patient groups were balanced with respect to the major prognostic variables. Actuarial curves are presented for local/regional control and "overall" survival. Ten-year results for clinically assessed local control are 70% for the mixed-beam group versus 58% for the photon group (p = 0.03) and for survival are 46% for the mixed-beam group versus 29% for the photon group (p = 0.04). This study suggests that a regional method of treatment can influence both local tumor control and survival in patients with locally advanced adenocarcinoma of the prostate gland.

Lifetime measurements of the first 2+ states in 104,106Zr: Evolution of ground-state deformations

Directory of Open Access Journals (Sweden)

F. Browne

2015-11-01

Full Text Available The first fast-timing measurements from nuclides produced via the in-flight fission mechanism are reported. The lifetimes of the first 2+ states in 104,106Zr nuclei have been measured via β-delayed γ-ray timing of stopped radioactive isotope beams. An improved precision for the lifetime of the 21+ state in 104Zr was obtained, τ(21+=2.90−20+25 ns, as well as a first measurement of the 21+ state in 106Zr, τ(21+=2.60−15+20 ns, with corresponding reduced transition probabilities of B(E2;21+→0g.s.+=0.39(2 e2b2 and 0.31(1 e2b2, respectively. Comparisons of the extracted ground-state deformations, β2=0.39(1 (104Zr and β2=0.36(1 (106Zr with model calculations indicate a persistence of prolate deformation. The data show that 104Zr is the most deformed of the neutron-rich Zr isotopes measured so far.

The Verification of Coupled Neutronics Thermal-Hydraulics Code NODAL3 in the PWR Rod Ejection Benchmark

Directory of Open Access Journals (Sweden)

Surian Pinem

2014-01-01

Full Text Available A coupled neutronics thermal-hydraulics code NODAL3 has been developed based on the few-group neutron diffusion equation in 3-dimensional geometry for typical PWR static and transient analyses. The spatial variables are treated by using a polynomial nodal method while for the neutron dynamic solver the adiabatic and improved quasistatic methods are adopted. In this paper we report the benchmark calculation results of the code against the OECD/NEA CRP PWR rod ejection cases. The objective of this work is to determine the accuracy of NODAL3 code in analysing the reactivity initiated accident due to the control rod ejection. The NEACRP PWR rod ejection cases are chosen since many organizations participated in the NEA project using various methods as well as approximations, so that, in addition to the reference solutions, the calculation results of NODAL3 code can also be compared to other codes’ results. The transient parameters to be verified are time of power peak, power peak, final power, final average Doppler temperature, maximum fuel temperature, and final coolant temperature. The results of NODAL3 code agree well with the PHANTHER reference solutions in 1993 and 1997 (revised. Comparison with other validated codes, DYN3D/R and ANCK, shows also a satisfactory agreement.

18 CFR 385.104 - Rule of construction (Rule 104).

Science.gov (United States)

2010-04-01

... Definitions § 385.104 Rule of construction (Rule 104). To the extent that the text of a rule is inconsistent with its caption, the text of the rule controls. [Order 376, 49 FR 21705, May 23, 1984] ...

Survival of parenchymal hepatocytes exposed to 14.3-MeV neutrons

International Nuclear Information System (INIS)

Jirtle, R.L.; Gould, M.N.; DeLuca, P.M. Jr.; Pearson, D.W.

1982-01-01

This report presents the results of the measurement of a dose survival curve and RBE values for rat hepatic cells irradiated in vivo with 14.3 MeV neutrons. The purpose was to determine the RBE for neutrons as a function of dose, and whether hepatocytes exposed to neutrons are as efficient at repairing potentially lethal damage as they are after exposure to low LET radiation

TDTORT: Time-Dependent, 3-D, Discrete Ordinates, Neutron Transport Code System with Delayed Neutrons

International Nuclear Information System (INIS)

2002-01-01

1 - Description of program or function: TDTORT solves the time-dependent, three-dimensional neutron transport equation with explicit representation of delayed neutrons to estimate the fission yield from fissionable material transients. This release includes a modified version of TORT from the C00650MFMWS01 DOORS3.1 code package plus the time-dependent TDTORT code. GIP is also included for cross-section preparation. TORT calculates the flux or fluence of particles due to particles incident upon the system from extraneous sources or generated internally as a result of interaction with the system in two- or three-dimensional geometric systems. The principle application is to the deep-penetration transport of neutrons and photons. Reactor eigenvalue problems can also be solved. Numerous printed edits of the results are available, and results can be transferred to output files for subsequent analysis. TDTORT reads ANISN-format cross-section libraries, which are not included in the package. Users may choose from several available in RSICC's data library collection which can be identified by the keyword 'ANISN FORMAT'. 2 - Methods:The time-dependent spatial flux is expressed as a product of a space-, energy-, and angle-dependent shape function, which is usually slowly varying in time and a purely time-dependent amplitude function. The shape equation is solved for the shape using TORT; and the result is used to calculate the point kinetics parameters (e.g., reactivity) by using their inner product definitions, which are then used to solve the time-dependent amplitude and precursor equations. The amplitude function is calculated by solving the kinetics equations using the LSODE solver. When a new shape calculation is needed, the flux is calculated using the newly computed amplitude function. The Boltzmann transport equation is solved using the method of discrete ordinates to treat the directional variable and weighted finite-difference methods, in addition to Linear Nodal

Realization of a broad band neutron spin filter with compressed, polarized 3He gas

International Nuclear Information System (INIS)

Surkau, R.; Otten, E.W.; Steiner, M.; Tasset, F.; Trautmann, N.

1997-01-01

The strongly spin dependent absorption of neutrons in nuclear spin polarized 3 -2pt vector He opens the possibility to polarize beams of thermal and epithermal neutrons. An effective 3 He neutron spin filter (NSF) requires high 3 He nuclear polarization as well as a filter thickness corresponding to a gas amount of the order of 1 bar l. We realized such a filter using direct optical pumping of metastable 3 He * atoms in a 3 He plasma at 1 mbar. Metastable exchange scattering transfers the angular momentum to the whole ensemble of 3 He atoms. At present 3 x 10 18 3 He-atoms/s are polarized up to 64%. Subsequent polarization preserving compression by a two stage compressor system enables to prepare NSF cells of about 300 cm 3 volume with 3 bar of polarized 3 He within 2 h. 3 He polarizations up to 53% were measured in a cell with a filter length of about 15 cm. By this cell a thermal neutron beam from the Mainz TRIGA reactor was polarized. A wavelength selective polarization analysis by means of Bragg scattering revealed a neutron polarization of 84% at a total transmission of 12% for a neutron wavelength of 1 A. (orig.)

Validation of the BUGJEFF311.BOLIB, BUGENDF70.BOLIB and BUGLE-B7 broad-group libraries on the PCA-Replica (H2O/Fe neutron shielding benchmark experiment

Directory of Open Access Journals (Sweden)

Pescarini Massimo

2016-01-01

Full Text Available The PCA-Replica 12/13 (H2O/Fe neutron shielding benchmark experiment was analysed using the TORT-3.2 3D SN code. PCA-Replica reproduces a PWR ex-core radial geometry with alternate layers of water and steel including a pressure vessel simulator. Three broad-group coupled neutron/photon working cross section libraries in FIDO-ANISN format with the same energy group structure (47 n + 20 γ and based on different nuclear data were alternatively used: the ENEA BUGJEFF311.BOLIB (JEFF-3.1.1 and UGENDF70.BOLIB (ENDF/B-VII.0 libraries and the ORNL BUGLE-B7 (ENDF/B-VII.0 library. Dosimeter cross sections derived from the IAEA IRDF-2002 dosimetry file were employed. The calculated reaction rates for the Rh-103(n,n′Rh-103m, In-115(n,n′In-115m and S-32(n,pP-32 threshold activation dosimeters and the calculated neutron spectra are compared with the corresponding experimental results.

Validation of the BUGJEFF311.BOLIB, BUGENDF70.BOLIB and BUGLE-B7 broad-group libraries on the PCA-Replica (H2O/Fe) neutron shielding benchmark experiment

Science.gov (United States)

Pescarini, Massimo; Orsi, Roberto; Frisoni, Manuela

2016-03-01

The PCA-Replica 12/13 (H2O/Fe) neutron shielding benchmark experiment was analysed using the TORT-3.2 3D SN code. PCA-Replica reproduces a PWR ex-core radial geometry with alternate layers of water and steel including a pressure vessel simulator. Three broad-group coupled neutron/photon working cross section libraries in FIDO-ANISN format with the same energy group structure (47 n + 20 γ) and based on different nuclear data were alternatively used: the ENEA BUGJEFF311.BOLIB (JEFF-3.1.1) and UGENDF70.BOLIB (ENDF/B-VII.0) libraries and the ORNL BUGLE-B7 (ENDF/B-VII.0) library. Dosimeter cross sections derived from the IAEA IRDF-2002 dosimetry file were employed. The calculated reaction rates for the Rh-103(n,n')Rh-103m, In-115(n,n')In-115m and S-32(n,p)P-32 threshold activation dosimeters and the calculated neutron spectra are compared with the corresponding experimental results.

Three-dimensional multiple reciprocity boundary element method for one-group neutron diffusion eigenvalue computations

International Nuclear Information System (INIS)

Itagaki, Masafumi; Sahashi, Naoki.

1996-01-01

The multiple reciprocity method (MRM) in conjunction with the boundary element method has been employed to solve one-group eigenvalue problems described by the three-dimensional (3-D) neutron diffusion equation. The domain integral related to the fission source is transformed into a series of boundary-only integrals, with the aid of the higher order fundamental solutions based on the spherical and the modified spherical Bessel functions. Since each degree of the higher order fundamental solutions in the 3-D cases has a singularity of order (1/r), the above series of boundary integrals requires additional terms which do not appear in the 2-D MRM formulation. The critical eigenvalue itself can be also described using only boundary integrals. Test calculations show that Wielandt's spectral shift technique guarantees rapid and stable convergence of 3-D MRM computations. (author)

Progress report on neutron science. April 1, 2006 - March 31, 2007

International Nuclear Information System (INIS)

Takeda, Masayasu; Ohhara, Takashi; Moriai, Atsushi

2008-03-01

There are 13 research groups in neutron science and technology in the Quantum Beam Science Directorate (QuBS) and Advanced Science Research Center (ASRC) of Japan Atomic Research Agency (JAEA). A wide variety of research is performed by these group: neutron scattering (condensed matter physics, polymer science, biology, and residual stress analysis), prompt gamma-ray analysis, neutron radiography, neutron optics, and development of a neutron spectrometer, neutron beam handling device and neutron detector. This issue summarizes research progress in neutron science and technology including activities of the Nuclear Science and Engineering Directorate of JAEA, and of the COMMON USE PROGRAM of JAEA utilizing the research reactor JRR-3 during the period between April 1, 2006 and March 31, 2007. This report contains highlights of research by these 13 neutron research groups of QuBS and ASRC, introducing 68 experimental reports. (author)

Use of research reactors for neutron activation analysis. Report of an advisory group meeting

International Nuclear Information System (INIS)

2001-04-01

Neutron activation analysis (NAA) is an analytical technique based on the measurement of characteristic radiation from radionuclides formed directly or indirectly by neutron irradiation of the material of interest. In the last three decades, neutron activation analysis has been found to be extremely useful in the determination of trace and minor elements in many disciplines. These include environmental analysis applications, nutritional and health related studies, geological as well as material sciences. The most suitable source of neutrons for NAA is a research reactor. There are several application fields in which NAA has a superior position compared to other analytical methods, and there are good prospects in developing countries for long term growth. Therefore, the IAEA is making concerted efforts to promote neutron activation analysis and at the same time to assist developing Member States in better utilization of their research reactors. The purpose of the meeting was to discuss the benefits and the role of NAA in applications and research areas that may contribute towards improving utilization of research reactors. The participants focused on five specific topics: (1) Current trends in NAA; (2) The role of NAA compared to other methods of chemical analysis; (3) How to increase the number of NAA users through interaction with industries, research institutes, universities and medical institutions; (4) How to reduce costs and to maintain quality and reliability; (5) NAA using low power research reactors. Neutron activation analysis in its various forms is still active and there are good prospects in developing countries for long-term growth. This can be achieved by a more effective use of existing irradiation and counting facilities, a better end-user focus, and perhaps marginal improvements in equipment and techniques. Therefore, it is recommended that the Member States provide financial and other assistance to enhance the effectiveness of their laboratories

New nuclear data group constant sets for fusion reactor nuclear analyses based on JENDL-4.0 and FENDL-3.0

International Nuclear Information System (INIS)

Konno, Chikara; Ohta, Masayuki; Kwon, Saerom; Ochiai, Kentaro; Sato, Satoshi

2015-01-01

We have produced new nuclear data group constant sets from JENDL-4.0 and FENDL-3.0 for fusion reactor nuclear analyses; FUSION-J40-175, FUSION-F30-175 (40 materials, neutron 175 groups, gamma 42 groups), FUSION-J40-42 and FUSION-F30-42 (40 materials, neutron 42 groups, gamma 21 groups). MATXS files of JENDL-4.0 and FENDL-3.0 were newly produced with the NJOY2012 code. FUSION-J40-175, FUSION-J40-42, FUSION-F30-175 and FUSION-F30-42 were produced with the TRANSX code. KERMA factors, DPA and gas production cross-section data were also prepared from the MATXS files with TRANSX. Test calculations were carried out in order to validate these nuclear group constant sets. They suggested that these group constant sets had no problem. (author)

SYNTH-C, Steady-State and Time-Dependent 3-D Neutron Diffusion with Thermohydraulic Feedback

Energy Technology Data Exchange (ETDEWEB)

Brega, E [ENEL-CRTN, Bastioni di Porta Volta 10, Milan (Italy); Salina, E [A.R.S. Spa, Viale Maino 35, Milan (Italy)

1980-04-01

1 - Description of problem or function: SYNTH-C-STEADY and SYNTH-C- TRANS solve respectively the steady-state and time-dependent few- group neutron diffusion equations in three dimensions x,y,z in the presence of fuel temperature and thermal-hydraulic feedback. The neutron diffusion and delayed precursor equations are approximated by a space-time (z,t) synthesis method with axially discontinuous trial functions. Three thermal-hydraulic and fuel heat transfer models are available viz. COBRA-3C/MIT model, lumped parameter (WIGL) model and adiabatic fuel heat-up model. 2 - Method of solution: The steady-state and time-dependent synthesis equations are solved respectively by the Wielandt's power method and by the theta-difference method (in time), both coupled with a block factorization technique and double precision arithmetic. The thermal-hydraulic model equations are solved by fully implicit finite differences (WIGL) or explicit-implicit difference techniques with iterations (COBRA-EC/MIT). 3 - Restrictions on the complexity of the problem: Except for the few- group limitation, the programs have no other fixed limitation so the ability to run a problem depends only on the available computer storage.

The program FEM3D users manual

International Nuclear Information System (INIS)

Misfeldt, I.

1977-11-01

A short description of the program FEM3D that solves the three-dimensional, multigroup, neutron diffusion equation by the finite element method. The elements are box-formed Lagrange type elements of order 1, 2, or 3. The program gives very reliable results within reasonable calculation times, but it is not a fast program and should therefore mostly be used where high precision is needed. (author/BP)

AcEST: BP913636 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000032_E04 520 Adiantum capillus-veneris mRNA. clone: YMU001_000032_E04. BP913636... CL2643Contig1 Show BP913636 Clone id YMU001_000032_E04 Library YMU01 Length 520 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000032_E04. Accession BP913636 Tissue type prothallium Developmental stag...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP913636|Adiantum capillus-veneris mRNA, clone: YMU001_00003...tative phospholipid-transporting ATPase ... 149 8e-36 sp|Q9LNQ4|ALA4_ARATH Putati

AcEST: BP912124 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_D06 531 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D06. BP91212...4 CL2988Contig1 Show BP912124 Clone id YMU001_000015_D06 Library YMU01 Length 531 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D06. Accession BP912124 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912124|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D06. (531 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total

AcEST: BP912125 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_D07 558 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D07. BP912125 - Show BP91212...is mRNA. clone: YMU001_000015_D07. Accession BP912125 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912125|Adiantum capillus-veneris mRN...A, clone: YMU001_000015_D07. (558 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...copeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12

AcEST: BP912120 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_D01 500 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D01. BP912120 - Show BP91212...is mRNA. clone: YMU001_000015_D01. Accession BP912120 Tissue type prothallium Developmental stage - Contig I...elated Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum Align length 130 Score (bit) 124.0 E-va...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...0|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D01. (500 letters) Database: uniprot_sprot.fasta 412

AcEST: BP912126 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa

AcEST: BP912812 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000023_B07 575 Adiantum capillus-veneris mRNA. clone: YMU001_000023_B07. BP912812... CL2610Contig1 Show BP912812 Clone id YMU001_000023_B07 Library YMU01 Length 575 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000023_B07. Accession BP912812 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912812|Adiant...um capillus-veneris mRNA, clone: YMU001_000023_B07. (575 letters) Database: uniprot_sprot.fasta 412,525 sequ

AcEST: BP912122 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_D04 544 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D04. BP91212...2 CL3363Contig1 Show BP912122 Clone id YMU001_000015_D04 Library YMU01 Length 544 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D04. Accession BP912122 Tissue type prothallium Developmental stag...obium aromaticivorans (strain DSM 12444) Align length 58 Score (bit) 33.1 E-value 0.89 Report BLASTX 2.2.19 ...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912122|Adiantum

AcEST: BP912412 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000018_G03 551 Adiantum capillus-veneris mRNA. clone: YMU001_000018_G03. BP912412... CL4248Contig1 Show BP912412 Clone id YMU001_000018_G03 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_G03. Accession BP912412 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912412|Adiantum capillus-veneris mR...NA, clone: YMU001_000018_G03. (551 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tot

AcEST: BP912012 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP912012... CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...mRNA, clone: YMU001_000012_A06. (542 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 t

AcEST: BP912512 [AcEST

Lifescience Database Archive (English)