
Sample records for bp star hr

  1. On the co-existence of chemically peculiar Bp stars, slowly pulsating B stars and constant B stars in the same part of the HR diagram

    Briquet, M.; Hubrig, S.; Cat, P. de; Aerts, C.C.; North, P.; Schöller, M.


    Aims. In order to better model massive B-type stars, we need to understand the physical processes taking place in slowly pulsating B (SPB) stars, chemically peculiar Bp stars, and non-pulsating normal B stars co-existing in the same part of the H-R diagram. Methods: We carry out a comparative study

  2. Flares on a Bp Star

    Mullan, D. J.


    Two large X-ray flares have been reported from the direction of a magnetic B2p star (σ Ori E). Sanz-Forcada et al. have suggested that the flares did not occur on the B2p star but on a companion of late spectral type. A star which is a candidate for a late-type flare star near σ Ori E has recently been identified by Bouy et al. However, based on the properties of the flares, and based on a recent model of rotating magnetospheres, we argue that, rather than attributing the two flares to a late-type dwarf, it is a viable hypothesis that the flares were magnetic phenomena associated with the rotating magnetosphere of the B2p star itself.


    Mullan, D. J.


    Two large X-ray flares have been reported from the direction of a magnetic B2p star (σ Ori E). Sanz-Forcada et al. have suggested that the flares did not occur on the B2p star but on a companion of late spectral type. A star which is a candidate for a late-type flare star near σ Ori E has recently been identified by Bouy et al. However, based on the properties of the flares, and based on a recent model of rotating magnetospheres, we argue that, rather than attributing the two flares to a late-type dwarf, it is a viable hypothesis that the flares were magnetic phenomena associated with the rotating magnetosphere of the B2p star itself.

  4. Classification of Ap-stars HR 830 and ZI CVn

    Zverko, J.


    Two ambiguously classified Ap-stars, HR 830 and 21 CVn, are studied. The observational data are compared with the data for normal stars αDel and αLyr. Star HR 830 is classified as Ap of type Si based on the enhanced absorption in the Si lines and photometric variability in UBV. 21 CVn is classified as Ap Si based on weaker absorption of helium, the variability of helium lines, photometric periodic variability and the properties of the UV spectrum. It is concluded that the photometric periodic variability is a good indicator of Ap-properties of rapidly rotating A and late B stars. (author)

  5. Photoelectric photometry of the Am star HR = V423 Per

    Jerzykiewicz, M.


    This spectroscopic binary is the largest amplitude variable among Am stars. UBV observations of the star are presented. They show that in 1964 and 1965 it was constant in B and was only marginally variable in U. The hypothesis of the ellipsoidal variability of HR 976 is then discussed and found untenable. It is pointed out that this result may reopen the issue of light variability of Am stars. 10 refs., 2 figs., 2 tabs. (author)

  6. Multiple Stars Across the H-R Diagram

    Hubrig, Swetlana; Tokovinin, Andrei; Proceedings of the ESO Workshop held in Garching, Germany, 12-15 July 2005


    Stars show a marked tendency to be in systems of different multiplicity, ranging from simple binaries and triples to globular clusters with several 10,000's of stars. The formation and evolution of multiple systems remains a challenging part of astrophysics, and the contributions in this book report on the significant progress that had been made in this research field in the last years. The reader will find a variety of research topics addressed, such as the dynamical evolution in multiple stars, the effects of the environment on multiple system parameters, stellar evolution within multiple stars, multiplicity of massive stars, pre-main sequence and intermediate mass stars, multiplicity of low-mass stars from embedded protostars to open clusters, and brown dwarfs and extrasolar planets in multiples. This book presents the proceedings of the ESO Workshop on Multiple Stars across the H-R Diagram held in the summer of 2005.

  7. The HR diagram for luminous stars in nearby galaxies

    Humphreys, R.M.


    Due to the extreme faintness of stars in other galaxies it is only possible to sample the brightest stars in the nearest galaxies. The observations must then be compared with comparable data for the brightest stars, the supergiants and O-type stars, in the Milky Way. The data for the luminous stars are most complete for the Milky Way and the Large Magellanic Cloud. The luminosities for the stars in our Galaxy are based on their membership in associations and clusters, and consequently are representative of Population I within approximately 3kpc of the Sun. The data for the stars in the LMC with spectral types O to G8 come from published observations, and the M supergiants are from the author's recent observations of red stars in the LMC. This is the first time that the M supergiants have been included in an HR diagram of the Large Cloud. The presence of the red stars is important for any discussion of the evolution of the massive stars. (Auth.)


    Chen, Wei; Johns-Krull, Christopher M.


    We implement a least-squares deconvolution (LSD) code to study magnetic fields on cool stars. We first apply our code to high-resolution optical echelle spectra of 53 Cam (a magnetic Ap star) and three well-studied cool stars (Arcturus, 61 Cyg A, and ξ Boo A) as well as the Sun (by observing the asteroid Vesta) as tests of the code and the instrumentation. Our analysis is based on several hundred photospheric lines spanning the wavelength range 5000 Å to 9000 Å. We then apply our LSD code to six nights of data on the Classical T Tauri Star BP Tau. A maximum longitudinal field of 370 ± 80 G is detected from the photospheric lines on BP Tau. A 1.8 kG dipole tilted at 129° with respect to the rotation axis and a 1.4 kG octupole tilted at 104° with respect to the rotation axis, both with a filling factor of 0.25, best fit our LSD Stokes V profiles. Measurements of several emission lines (He I 5876 Å, Ca II 8498 Å, and 8542 Å) show the presence of strong magnetic fields in the line formation regions of these lines, which are believed to be the base of the accretion footpoints. The field strength measured from these lines shows night-to-night variability consistent with rotation of the star


    Chen, Wei; Johns-Krull, Christopher M., E-mail:, E-mail: [Department of Physics and Astronomy, Rice University, Houston, TX 77005 (United States)


    We implement a least-squares deconvolution (LSD) code to study magnetic fields on cool stars. We first apply our code to high-resolution optical echelle spectra of 53 Cam (a magnetic Ap star) and three well-studied cool stars (Arcturus, 61 Cyg A, and ξ Boo A) as well as the Sun (by observing the asteroid Vesta) as tests of the code and the instrumentation. Our analysis is based on several hundred photospheric lines spanning the wavelength range 5000 Å to 9000 Å. We then apply our LSD code to six nights of data on the Classical T Tauri Star BP Tau. A maximum longitudinal field of 370 ± 80 G is detected from the photospheric lines on BP Tau. A 1.8 kG dipole tilted at 129° with respect to the rotation axis and a 1.4 kG octupole tilted at 104° with respect to the rotation axis, both with a filling factor of 0.25, best fit our LSD Stokes V profiles. Measurements of several emission lines (He I 5876 Å, Ca II 8498 Å, and 8542 Å) show the presence of strong magnetic fields in the line formation regions of these lines, which are believed to be the base of the accretion footpoints. The field strength measured from these lines shows night-to-night variability consistent with rotation of the star.


    S. Fourest


    Full Text Available PLEIADES is the highest resolution civilian earth observing system ever developed in Europe. This imagery program is conducted by the French National Space Agency, CNES. It has been operating since 2012 a first satellite PLEIADES-HR launched on 2011 December 17th, a second one should be launched by the end of the year. Each satellite is designed to provide optical 70 cm resolution colored images to civilian and defense users. Thanks to the extreme agility of the satellite, new calibration methods have been tested, based on the observation of celestial bodies, and stars in particular. It has then been made possible to perform MTF measurement, re-focusing, geometrical bias and focal plane assessment, absolute calibration, ghost images localization, micro-vibrations measurement, etc… Starting from an overview of the star acquisition process, this paper will discuss the methods and present the results obtained during the first four months of the commissioning phase.

  11. HR 8844: A New Transition Object between the Am Stars and the HgMn Stars?

    Monier, R.; Gebran, M.; Royer, F.; Kilicoglu, T.; Frémat, Y.


    While monitoring a sample of apparently slowly rotating superficially normal early-A stars, we have discovered that HR 8844 (A0 V) is actually a new chemically peculiar star. We first compared the high-resolution spectrum of HR 8844 with that of four slow rotators near A0V (ν Cap, ν Cnc, Sirius A, and HD 72660) to highlight similarities and differences. The lines of Ti II, Cr II, Sr II, and Ba II are conspicuous features in the high-resolution high signal-to-noise SOPHIE spectra of HR 8844 and much stronger than in the spectra of the normal star ν Cap. The Hg II line at 3983.93 Å is also present in a 3.5% blend. Selected unblended lines of 31 chemical elements from He up to Hg have been synthesized using model atmospheres computed with ATLAS9 and the spectrum synthesis code SYNSPEC48 including hyperfine structure of various isotopes when relevant. These synthetic spectra have been adjusted to the mean SOPHIE spectrum of HR 8844, and high-resolution spectra of the comparison stars. Chi-squares were minimized to derive abundances or upper limits to the abundances of these elements for HR 8844 and the comparison stars. HR 8844 is found to have underabundances of He, C, O, Mg, Ca, and Sc, mild enhancements of Ti, V, Cr, Mn, and distinct enhancements of the heavy elements Sr, Y, Zr, Ba, La, Pr, Sm, Eu, and Hg, the overabundances increasing steadily with atomic number. This chemical pattern suggests that HR 8844 may actually be a new transition object between the coolest HgMn stars and the Am stars.

  12. A more accurate HR diagram for the cooler stars

    Keenan, P.C.


    The author's objective is to classify the fine structure in the pattern in the luminosity-spectrum domain, and thus to define more precisely the borders of zones which are either occupied or avoided by stars of a given population. It is this pattern which is compared with theoretical evolutionary tracks and it is such a diagram based on the revised MK classification of the recent Atlas of Keenan and McNeil (1976) that is presented. (Auth.)


    Kastner, Joel H.; Montez, Rodolfo; Rodriguez, David; Zuckerman, B.; Perrin, Marshall D.; Grosso, Nicolas; Forveille, Thierry; Graham, James R.


    BP Psc is a remarkable emission-line field star that is orbited by a dusty disk and drives a parsec-scale system of jets. We report the detection by the Chandra X-ray Observatory of a weak X-ray point source coincident with the centroids of optical/IR and submillimeter continuum emission at BP Psc. As the star's photosphere is obscured throughout the visible and near-infrared, the Chandra X-ray source likely represents the first detection of BP Psc itself. The X-rays most likely originate with magnetic activity at BP Psc and hence can be attributed either to a stellar corona or to star-disk interactions. The log of the ratio of X-ray to bolometric luminosity, log(L X /L bol ), lies in the range -5.8 to -4.2. This is smaller than log(L X /L bol ) ratios typical of low-mass, pre-main sequence stars, but is well within the log(L X /L bol ) range observed for rapidly rotating (FK Com-type) G giant stars. Hence, the Chandra results favor an exotic model wherein the disk/jet system of BP Psc is the result of its very recently engulfing a companion star or a giant planet, as the primary star ascended the giant branch.

  14. Magnetic field topology and chemical abundance distributions of the young, rapidly rotating, chemically peculiar star HR 5624

    Kochukhov, O.; Silvester, J.; Bailey, J. D.; Landstreet, J. D.; Wade, G. A.


    Context. The young, rapidly rotating Bp star HR 5624 (HD 133880) shows an unusually strong non-sinusoidal variability of its longitudinal magnetic field. This behaviour was previously interpreted as the signature of an exceptionally strong, quadrupole-dominated surface magnetic field geometry. Aims: We studied the magnetic field structure and chemical abundance distributions of HR 5624 with the aim to verify the unusual quadrupolar nature of its magnetic field and to investigate correlations between the field topology and chemical spots. Methods: We analysed high-resolution, time series Stokes parameter spectra of HR 5624 with the help of a magnetic Doppler imaging inversion code based on detailed polarised radiative transfer modelling of the line profiles. Results: We refined the stellar parameters, revised the rotational period, and obtained new longitudinal magnetic field measurements. Our magnetic Doppler inversions reveal that the field structure of HR 5624 is considerably simpler and the field strength is much lower than proposed by previous studies. We find a maximum local field strength of 12 kG and a mean field strength of 4 kG, which is about a factor of three weaker than predicted by quadrupolar field models. Our model implies that overall large-scale field topology of HR 5624 is better described as a distorted, asymmetric dipole rather than an axisymmetric quadrupole. The chemical abundance maps of Mg, Si, Ti, Cr, Fe, and Nd obtained in our study are characterised by large-scale, high-contrast abundance patterns. These structures correlate weakly with the magnetic field geometry and, in particular, show no distinct element concentrations in the horizontal field regions predicted by theoretical atomic diffusion calculations. Conclusions: We conclude that the surface magnetic field topology of HR 5624 is not as unusual as previously proposed. Considering these results together with other recent magnetic mapping analyses of early-type stars suggests that

  15. The composite nature of the peculiar star HR 6560 (HD 159870)

    Wegner, Gary; Cowley, Charles R.


    Ground-based high-dispersion photographic spectra and ultraviolet spectra obtained with the IUE satellite are described and employed to determine the nature of the peculiar star HR 6560 (HD 159870). Previously this object had been described as both a composite system and as a strong Fm star. The UBVRI, Stromgren, and ultraviolet colors of HR 6560 are compared with objects classified composite from the Bright Star Catalogue and normal dwarfs and giants. The colors of HR 6560 are not unusual for a composite and are consistent with a late-A dwarf, combined with a late-G or early-K giant. The ultraviolet satellite clearly shows the presence of an A component, but its precise spectral type is difficult to assign. The IUE and TD-1 data suggest that the ultraviolet is dominated by light from an A5 V secondary and the visual from a GO III primary. This does not agree well with the most plausible model that fits the visual photometry. The peculiar nature of HR 6560's spectrum is most likely due to its composite nature.

  16. Luminous and Variable Stars in M31 and M33. V. The Upper HR Diagram

    Humphreys, Roberta M.; Davidson, Kris; Hahn, David [Minnesota Institute for Astrophysics, 116 Church St SE, University of Minnesota, Minneapolis, MN 55455 (United States); Martin, John C. [Barber Observatory, University of Illinois, Springfield, IL 62703 (United States); Weis, Kerstin, E-mail: [Astronomical Institute, Ruhr-Universitaet Bochum (Germany)


    We present HR diagrams for the massive star populations in M31 and M33, including several different types of emission-line stars: the confirmed luminous blue variables (LBVs), candidate LBVs, B[e] supergiants, and the warm hypergiants. We estimate their apparent temperatures and luminosities for comparison with their respective massive star populations and evaluate the possible relationships of these different classes of evolved, massive stars, and their evolutionary state. Several of the LBV candidates lie near the LBV/S Dor instability strip that supports their classification. Most of the B[e] supergiants, however, are less luminous than the LBVs. Many are very dusty with the infrared flux contributing one-third or more to their total flux. They are also relatively isolated from other luminous OB stars. Overall, their spatial distribution suggests a more evolved state. Some may be post-RSGs (red supergiants) like the warm hypergiants, and there may be more than one path to becoming a B[e] star. There are sufficient differences in the spectra, luminosities, spatial distribution, and the presence or lack of dust between the LBVs and B[e] supergiants to conclude that one group does not evolve into the other.

  17. Statistical HR diagrams for one hundred and fifteen thousand proper-motion stars

    Luyten, W.J.


    Since regular HR diagrams require apparent magnitudes, colors or spectra, and parallaxes, and such complete data are available for relatively few stars, there may be some advantage in making up diagrams which utilize proper motions instead of parallaxes, and are thus statistically similar to an HR diagram. The reduced proper motion, first used by Hertzsprung, is defined as H=m+5+5log μ, but may also be written as H=M+5log T, where T is the tangential velocity, and is expressed in astronomical units per year. A diagram plotting H against color will thus contain the considerable dispersion in tangential velocity which is a serious disadvantage. However, this is outweighed by two practical advantages. First, the one and the same person who does the proper motion survey can, and does also determine the other two quantities needed. Second, when using data obtained from such a proper motion survey one deals, statistically, with all the stars within a given distance and the results, therefore, are much more representative of the real situation in space than many HR diagrams which often contain an unrealistic preponderance of giants. (Auth.)

  18. Mixed poloidal-toroidal magnetic configuration and surface abundance distributions of the Bp star 36 Lyn

    Oksala, M. E.; Silvester, J.; Kochukhov, O.; Neiner, C.; Wade, G. A.; the MiMeS Collaboration


    Previous studies of the chemically peculiar Bp star 36 Lyn revealed a moderately strong magnetic field, circumstellar material and inhomogeneous surface abundance distributions of certain elements. We present in this paper an analysis of 33 high signal-to-noise ratio, high-resolution Stokes IV observations of 36 Lyn obtained with the Narval spectropolarimeter at the Bernard Lyot Telescope at Pic du Midi Observatory. From these data, we compute new measurements of the mean longitudinal magnetic field, Bℓ, using the multiline least-squares deconvolution (LSD) technique. A rotationally phased Bℓ curve reveals a strong magnetic field, with indications for deviation from a pure dipole field. We derive magnetic maps and chemical abundance distributions from the LSD profiles, produced using the Zeeman-Doppler imaging code INVERSLSD. Using a spherical harmonic expansion to characterize the magnetic field, we find that the harmonic energy is concentrated predominantly in the dipole mode (ℓ = 1), with significant contribution from both the poloidal and toroidal components. This toroidal field component is predicted theoretically, but not typically observed for Ap/Bp stars. Chemical abundance maps reveal a helium enhancement in a distinct region where the radial magnetic field is strong. Silicon enhancements are located in two regions, also where the radial field is stronger. Titanium and iron enhancements are slightly offset from the helium enhancements, and are located in areas where the radial field is weak, close to the magnetic equator.

  19. A combined multiwavelength VLA/ALMA/Chandra study unveils the complex magnetosphere of the B-type star HR5907

    Leto, P.; Trigilio, C.; Oskinova, L. M.; Ignace, R.; Buemi, C. S.; Umana, G.; Ingallinera, A.; Leone, F.; Phillips, N. M.; Agliozzo, C.; Todt, H.; Cerrigone, L.


    We present new radio/millimeter measurements of the hot magnetic star HR 5907 obtained with the VLA and ALMA interferometers. We find that HR 5907 is the most radio luminous early type star in the cm-mm band among those presently known. Its multi-wavelength radio light curves are strongly variable with an amplitude that increases with radio frequency. The radio emission can be explained by the populations of the non-thermal electrons accelerated in the current sheets on the outer border of the magnetosphere of this fast-rotating magnetic star. We classify HR 5907 as another member of the growing class of strongly magnetic fast-rotating hot stars where the gyro-synchrotron emission mechanism efficiently operates in their magnetospheres. The new radio observations of HR 5907 are combined with archival X-ray data to study the physical condition of its magnetosphere. The X-ray spectra of HR 5907 show tentative evidence for the presence of non-thermal spectral component. We suggest that non-thermal X-rays originate a stellar X-ray aurora due to streams of non-thermal electrons impacting on the stellar surface. Taking advantage of the relation between the spectral indices of the X-ray power-law spectrum and the non-thermal electron energy distributions, we perform 3-D modelling of the radio emission for HR 5907. The wavelength-dependent radio light curves probe magnetospheric layers at different heights above the stellar surface. A detailed comparison between simulated and observed radio light curves leads us to conclude that the stellar magnetic field of HR 5907 is likely non-dipolar, providing further indirect evidence of the complex magnetic field topology of HR 5907.

  20. The variable Herbig Ae star HR 5999: VIII. Spectroscopic observations 1975 - 1985 and correlations with simulataneous photometry

    Tjin, A.; Djie, H.R.E.; The, P.S.; Andersen, J.; Nordstroem, B.; Finkenzeller, U.; Jankovics, I.


    Visual spectroscopy of the irregularly variable Herbig Ae star HR 5999 over the past 15 years is summarised. The general features of the spectrum indicate that HR 5999 is an A5-7 III-IVe star with an extended circumstellar atmosphere. Typical lines have a rotationally broadened photospheric component and one or two blue-shifted ''shell'' components. The average radial velocity of the photospheric components, together with the common proper motions of the stars strongly suggest that HR 5999 and the peculiar B6 star HR 6000 from a physical pair, with common age. In order to study the relation between variations in the spectrum and in the brightness of the star, three sequences of simultaneous spectroscopic and photometric observations have been obtained during the past decade. From these and other (isolated) simultaneous observations we concluded that: (a) the photospheric radial velocity component is variable, possibly with a period of about 14 days, which could point to the presence of a close companion, (b) occasionally, sudden variations may occur (within one night) either in the photospheric line components,or in the shell (absorption or emission) components or both; (c) a decreasing brightness is correlated with increasing Hα-emission flux and a decreasing wind velocity in the shell region. An interpretation of these correlations in terms of magnetic activity is proposed

  1. Abundance analysis from the UV spectrum of the He-w star HR 6000

    Castelli, F.; Cornachin, M.; Morossi, C.; Hack, M.


    A high resolution spectrum of the He-w star HR 6000, covering the SW and LW regions, has been analysed. A fully line-blanketed model atmosphere with parameters Tsub(e) = 14000 K, log g = 4, microturbulence xi = 2 km.s -1 has been adopted. This model is in agreement with the photometric data and yields the same abundance for the Fe II and Fe III ions. By using the synthetic spectrum method we compared the observed lines with the computed ones. We find an underabundance of C, Al Si, Mg, S, Sc, Co, Ni, Zn and an overabundance of Be, P, Cl, Ti, Mn, Fe, Ga. B, O, Cr have nearly solar abundances. Circumstellar (or interstellar) shortward-shifted components affect the strong resonance lines of the following ions: C II(1) lambda 1334.535, O I(2) lambda 1302.074,Mg II(1) lambda 2795.523, lambda 2802.698, Si II(3) lambda 1304.369, Fe II(1) lambda 2599.395

  2. Spectrophotometry of peculiar B and A stars. XVIII - The helium rich variable stars HR 1890, Sigma Orionis E, and HD 37776

    Adelman, S. J.; Pyper, D. M.


    Optical region spectrophotometry at 3300-7850 A has been obtained for three helium rich stars, HR 1890, Sigma Ori E, and HD 37776, of the Orion OB1 Association. New uvby-beta photometry of HR 1890 and HD 37776 as well as published data are also used to investigate the variability of these stars. A new period of 1.53862 days was determined for HD 37776. For all three stars H-beta varies in antiphase with strong He I lines. The spectrophotometric bandpass containing the strong He I line at 4471 A varies in phase with the R index of Pedersen and Thomsen (1977). Evidence is found for weak absorption features which appear to be an extension of the 5200 A feature seen in cooler CP stars.

  3. HR Connect

    US Agency for International Development — HR Connect is the USAID HR personnel system which allows HR professionals to process HR actions related to employee's personal and position information. This system...

  4. Elemental abundance analyses with coadded DAO spectrograms. VI - The mercury-manganese stars Nu Cancri, Iota Coronae Borealis and HR 8349

    Adelman, Saul J.


    The elemental abundances of three mercury-manganese stars, Nu Cancri, Iota Coronae Borealis, and HR 8349, were found to be consistent with previous analyses of this series. As Iota CrB is a double-lined spectroscopic binary with a small velocity amplitude for most of its period, its study required determining whether the observed lines were produced in the primary or secondary or both. The derived abundances and effective termperatures were used along with those of mercury-manganese stars previously analyzed in order to extend the study of probable correlations between abundances, with the effective temperature and surface gravity in accordance with radiative diffusion explanations.


    Baraffe, I.; Chabrier, G.; Gallardo, J.


    We present evolutionary models for young low-mass stars and brown dwarfs taking into account episodic phases of accretion at early stages of the evolution, a scenario supported by recent large surveys of embedded protostars. An evolution including short episodes of vigorous accretion followed by longer quiescent phases can explain the observed luminosity spread in H-R diagrams of star-forming regions at ages of a few Myr, for objects ranging from a few Jupiter masses to a few tenths of a solar mass. The gravitational contraction of these accreting objects strongly departs from the standard Hayashi track at constant T eff . The best agreement with the observed luminosity scatter is obtained if most of the accretion shock energy is radiated away. The obtained luminosity spread at 1 Myr in the H-R diagram is equivalent to what can be misinterpreted as an ∼10 Myr age spread for non-accreting objects. We also predict a significant spread in radius at a given T eff , as suggested by recent observations. These calculations bear important consequences for our understanding of star formation and early stages of evolution and on the determination of the initial mass function for young (≤ a few Myr) clusters. Our results also show that the concept of a stellar birthline for low-mass objects has no valid support.

  6. Are coronae of late type stars made of solar-like structures? The Fx-HR diagram and the pressure-temperature correlation

    Peres, G.; Orlando, S.; Reale, F.


    We show that stellar coronae can be composed of X-ray emitting structures like those in the solar corona, using a large set of ROSAT/PSPC observations of late-type-stars, and a large set of solar X-ray data collected with Yohkoh/SXT. We have considered data on the solar corona at various phases of the cycle and various kinds of X-ray coronal structures, from flares to the background corona. The surface flux (F_x) vs. spectral hardness ratio (HR) diagram is a fundamental tool for our study. We...

  7. The stars: an absolute radiometric reference for the on-orbit calibration of PLEIADES-HR satellites

    Meygret, Aimé; Blanchet, Gwendoline; Mounier, Flore; Buil, Christian


    The accurate on-orbit radiometric calibration of optical sensors has become a challenge for space agencies who gather their effort through international working groups such as CEOS/WGCV or GSICS with the objective to insure the consistency of space measurements and to reach an absolute accuracy compatible with more and more demanding scientific needs. Different targets are traditionally used for calibration depending on the sensor or spacecraft specificities: from on-board calibration systems to ground targets, they all take advantage of our capacity to characterize and model them. But achieving the in-flight stability of a diffuser panel is always a challenge while the calibration over ground targets is often limited by their BDRF characterization and the atmosphere variability. Thanks to their agility, some satellites have the capability to view extra-terrestrial targets such as the moon or stars. The moon is widely used for calibration and its albedo is known through ROLO (RObotic Lunar Observatory) USGS model but with a poor absolute accuracy limiting its use to sensor drift monitoring or cross-calibration. Although the spectral irradiance of some stars is known with a very high accuracy, it was not really shown that they could provide an absolute reference for remote sensors calibration. This paper shows that high resolution optical sensors can be calibrated with a high absolute accuracy using stars. The agile-body PLEIADES 1A satellite is used for this demonstration. The star based calibration principle is described and the results are provided for different stars, each one being acquired several times. These results are compared to the official calibration provided by ground targets and the main error contributors are discussed.


    Chen, Wen-Cong [School of Physics and Electrical Information, Shangqiu Normal University, Shangqiu 476000 (China); Podsiadlowski, Philipp, E-mail: [Department of Physics, University of Oxford, Oxford OX1 3RH (United Kingdom)


    It is generally believed that ultracompact X-ray binaries (UCXBs) evolved from binaries consisting of a neutron star accreting from a low-mass white dwarf (WD) or helium star where mass transfer is driven by gravitational radiation. However, the standard WD evolutionary channel cannot produce the relatively long-period (40–60 minutes) UCXBs with a high time-averaged mass-transfer rate. In this work, we explore an alternative evolutionary route toward UCXBs, where the companions evolve from intermediate-mass Ap/Bp stars with an anomalously strong magnetic field (100–10,000 G). Including the magnetic braking caused by the coupling between the magnetic field and an irradiation-driven wind induced by the X-ray flux from the accreting component, we show that intermediate-mass X-ray binaries (IMXBs) can evolve into UCXBs. Using the MESA code, we have calculated evolutionary sequences for a large number of IMXBs. The simulated results indicate that, for a small wind-driving efficiency f = 10{sup −5}, the anomalous magnetic braking can drive IMXBs to an ultra-short period of 11 minutes. Comparing our simulated results with the observed parameters of 15 identified UCXBs, the anomalous magnetic braking evolutionary channel can account for the formation of seven and eight sources with f = 10{sup −3}, and 10{sup −5}, respectively. In particular, a relatively large value of f can fit three of the long-period, persistent sources with a high mass-transfer rate. Though the proportion of Ap/Bp stars in intermediate-mass stars is only 5%, the lifetime of the UCXB phase is ≳2 Gyr, producing a relatively high number of observable systems, making this an alternative evolutionary channel for the formation of UCXBs.

  9. Light variations of massive stars (α Cygni variables). XI. The behaviour of the S Doradus type stars AG Carinae and HR Carinae near minimum light

    Genderen van, A.M.; Kampen van, E.; Larsen, I.; Wanders, I.; Weeren van, N.; The, P.S.; Heemskerk, M.; Kraakman, H.; Remijn, L.; Heynderickx, D.


    VBLUW photometry of the micro variations of AG Car (1987/1988) and HR Car (1981/1982 and 1987/1988) and of the macro variations of HR Car (1984/1987) is presented and discussed. The quasi-periods for the micro variations are antiP = 10 d - 13 d for AG Car and antiP ∼ 20 d for HR Car. Both objects, although at or close to minimum light, show small S Dor eruptions (Δ V J ∼ 0.3 m 3) corresponding to an increase in the mass loss rate of about 20%. The time scale of these eruptions, presumably 0.5-1 yr, is thus much longer than the quasi-periods of the intrinsic variations. Therefore, independency between both phenomena is suggested. The reddening and luminosity of HR Car is discussed, as well as its temperature. A tentative estimation of T eff , based on the fluctuation in the colour indices, amounts to ∼ 14000 K ± 2000 K

  10. High Precision with the Whole Earth Telescope: Lessons and Some Results from XCov20 for the roAp Star HR 1217

    Kurtz D. W.


    Full Text Available HR1217 is a prototypical rapidly oscillating Ap star that has presented a test to the theory of nonradial stellar pulsation. Prior observations showed a clear pattern of five modes with alternating frequency spacings of 33.3 μHz and 34.6 μHz, with a sixth mode at a problematic spacing of 50.0 μHz (which equals 1.5 × 33.3 μHz to the highfrequency side. Asymptotic pulsation theory allowed for a frequency spacing of 34 μHz, but hipparcos observations rule out such a spacing. Theoretical calculations of magnetoacoustic modes in Ap stars by Cunha (2001 predicted that there should be a previously undetected mode 34 μHz higher than the main group, with a smaller spacing between it and the highest one. The 20th extended coverage campaign of the Whole Earth Telescope (XCov20 has discovered this frequency as predicted by Cunha (2001. Amplitude modulation of several of the pulsation modes between the 1986 and 2000 data sets has also been discovered, while important parameters for modelling the geometry of the pulsation modes have been shown to be unchanged. With stringent selection of the best data from the WET network the amplitude spectrum shows highest peaks at only 50 μmag and formal errors on the determined amplitudes are 14 μmag. Some lessons for future use of WET for the highest precision photometry on bright stars are discussed.

  11. HR Explorer

    Möller, M


    At the European Laboratory for Particle Physics Research (CERN), Geneva Switzerland we are using OracleHR for managing our human resources since 1995. After the first year of production it became clear that there was a strong need for an easy-to-use Decision Support Tool exploring the data in OracleHR. This paper illustrates an approach which we have adopted to provide on-line management reporting, multi-dimensional analysis, drill-down and slicing & dicing of data, warehoused from OracleHR. The tool offers strong resource management and planning capabilities including career follow-up. The user management and security monitoring are implemented using the Oracle WebServer.

  12. HR boiler


    A number of manufacturers of central heating boilers in the Netherlands have produced high-efficiency boilers, all carrying the GIVEG-HR seal of approval (GIVEG is the manufacturers' association in the Netherlands, and HR stands for 'hoog rendement': high efficiency). Efficiences were considerably improved by reducing flue, idling and radiation losses. Control and safety, discharges of flue gases and condensate need special attention. Whether installation of a GIVEG-HR boiler is profitable in view of the cost/profit ratio, will have to be determined from case to case. N.V. Nederlandse Gasunie felt it was time to present the facts so far in a way specially aimed at the construction industry. This special edition of 'Gas and Architecture' answers a number of questions which the architect or consultant engineer might have in particular before advising on the installation of the new boiler in houses and other buildings in the interests of energy saving. A technical description of the HR boiler covers the backgrounds of its development and considers the role of the Netherlands government as regards to the introduction of the boiler.

  13. The distribution of silicon on BP Boo

    Hatzes, A.P.


    A version of the Doppler imaging technique which incorporates the principles of maximum entropy reconstruction is used to derive the silicon distribution on the Ap star BP Boo (HR 5857). The method used made it possible to detect an error in the published photometric period and a new value of 1.29557 d was determined. The silicon distribution consists of two depleted spots of unequal area separated by about 180deg in longitude. These spots may coincide with the location of the magnetic poles of the star as in the case of γ 2 Ari. Near the larger of the depleted silicon spots is a spot of enhanced abundance. The unequal area of the depleted spots as well as the close proximity of the enhanced spot to one of the depleted regions suggests the presence of non-axisymmetric magnetic field lines. (author)

  14. Putting atomic diffusion theory of magnetic ApBp stars to the test: evaluation of the predictions of time-dependent diffusion models

    Kochukhov, O.; Ryabchikova, T. A.


    A series of recent theoretical atomic diffusion studies has address the challenging problem of predicting inhomogeneous vertical and horizontal chemical element distributions in the atmospheres of magnetic ApBp stars. Here we critically assess the most sophisticated of such diffusion models - based on a time-dependent treatment of the atomic diffusion in a magnetized stellar atmosphere - by direct comparison with observations as well by testing the widely used surface mapping tools with the spectral line profiles predicted by this theory. We show that the mean abundances of Fe and Cr are grossly underestimated by the time-dependent theoretical diffusion model, with discrepancies reaching a factor of 1000 for Cr. We also demonstrate that Doppler imaging inversion codes, based either on modelling of individual metal lines or line-averaged profiles simulated according to theoretical three-dimensional abundance distribution, are able to reconstruct correct horizontal chemical spot maps despite ignoring the vertical abundance variation. These numerical experiments justify a direct comparison of the empirical two-dimensional Doppler maps with theoretical diffusion calculations. This comparison is generally unfavourable for the current diffusion theory, as very few chemical elements are observed to form overabundance rings in the horizontal field regions as predicted by the theory and there are numerous examples of element accumulations in the vicinity of radial field zones, which cannot be explained by diffusion calculations.

  15. Journeys on the H-R diagram

    Kaler, J.B.


    The evolution of various types of stars along the H-R diagram is discussed. Star birth and youth is addressed, and the events that occur due to core contraction, shell burning, and double-shell burning are described. The evolutionary courses of planetary nebulae, white dwarfs, and supernovas are examined

  16. BP volume reduction equipment

    Kitamura, Yoshinori; Muroo, Yoji; Hamanaka, Isao


    A new type of burnable poison (BP) volume reduction system is currently being developed. Many BP rods, a subcomponent of spent fuel assemblies are discharged from nuclear power reactors. This new system reduces the overall volume of BP rods. The main system consists of BP rod cutting equipment, equipment for the recovery of BP cut pieces, and special transport equipment for the cut rods. The equipment is all operated by hydraulic press cylinders in water to reduce operator exposure to radioactivity. (author)

  17. Digitalisering og HR

    Kühn Pedersen, Mogens


    Digitalisering står ligesom HR for et omfattende fag- og praksisfelt. Såvel praksis som teknologiudvikling styrer feltets stadige forandringer.......Digitalisering står ligesom HR for et omfattende fag- og praksisfelt. Såvel praksis som teknologiudvikling styrer feltets stadige forandringer....

  18. Caretakers or HR Managers

    James Baba Abugre


    Full Text Available Do human resources (HR managers in developing countries have the clout to make strategic decisions during mergers and acquisitions (M&As? This study aims at establishing the major roles played by HR managers in M&As of public sector companies in Ghana. The research examined the M&As of 10 Ghanaian companies where 10 HR managers gave detailed narratives of their roles and the part they played in the M&A processes. The qualitative method used to solicit the narratives of the HR managers resulted in the following findings: that HR managers in Ghana have a limited role in the planning process of the M&A; that indigenous HR managers perform several tasks in the course of the M&A to get employees stable before and after the M&A processes; nevertheless, they are not part of the policy formulators. The article makes a modest input of the significance of indigenous HR role in international M&As as a panacea to solving the global crises by advocating the empowerment of HR managers in developing context to be partners in the initial commencement of M&As.

  19. BP's emissions trading system

    Victor, David G.; House, Joshua C.


    Between 1998 and 2001, BP reduced its emissions of greenhouse gases by more than 10%. BP's success in cutting emissions is often equated with its use of an apparently market-based emissions trading program. However no independent study has ever examined the rules and operation of BP's system and the incentives acting on managers to reduce emissions. We use interviews with key managers and with traders in several critical business units to explore the bound of BP's success with emissions trading. No money actually changed hands when permits were traded, and the main effect of the program was to create awareness of money-saving emission controls rather than strong price incentives. We show that the trading system did not operate like a 'textbook' cap and trade scheme. Rather, the BP system operated much like a 'safety valve' trading system, where managers let the market function until the cost of doing so surpassed what the company was willing to tolerate

  20. FDG goes BP

    Chan, J.G.


    Full text: A monograph for Fluorodeoxyglucose F-18 Injection (FDG) was first released in Supplement 1 of the United States Pharmacopoeia 1990 (USP 90) on 1 November 1989 to become effective on 1 January 1990. As this was the only monograph available until recently it served as the applicable standard to be followed. The Therapeutic Goods Act states that the British Pharmacopoeia (BP) is the precedent to be followed in Australia and implies that if a monograph exists for a finished product then this needs to be applied to achieve a certain standard of quality. If the monograph does not exist in the BP then other pharmacopoeia monographs can be sourced starting with the European Pharmacopoeia (Ph Eur) then the USP. A monograph for FDG first appeared in the Ph Eur in a 1999 Supplement (effective 1 January 1999 and now included in the Ph Eur 2000) and then in the BP 1999 (effective 1 December 1999). The Commonwealth Government Gazette (Notice 48, 1/12/99) published that the BP 99 was adopted on the 1st December 1999. Since then manufacturers have been required to comply with the monograph for FDG in the BP 99. This presentation looks at the content of the BP 99 monograph and compares it with that in the USP. Copyright (2000) The Australian and New Zealand Society of Nuclear Medicine Inc

  1. Er HR ude i tovene?

    Poulfelt, Flemming


    HR: Er der behov for nytænkning i HR-land? Artikler i Harvard Business Review - bakket op af en dansk undersøgelse - konkluderer, at HR stadig mangler gennemslagskraft i virksomhederne. Er HR ude i tovene? ... For i undersøgelsen "Ny Dansk Ledelse" (maj 2015), som er baseret på danske lederes...

  2. Occasioning change through HR sourcing

    van Balen, Mitchell; Bondarouk, Tatiana; Strohmeier, Stefan; Diederichsen, Anke


    This article describes how structuration theory can be used to analyze changes as invoked by two HR Sourcing arrangements: HR Shared Service Centers and HR Outsourcing. This approach allows us to under-stand changing responsibilities, altered HR processes, and the adaptation of web-based tools for

  3. On the evolution of stars

    Kippenhahn, R.


    A popular survey is given of the present knowledge on evolution and ageing of stars. Main sequence stars, white dwarf stars, and red giant stars are classified in the Hertzsprung-Russell (HR)-diagram by measurable quantities: surface temperature and luminosity. From the HR-diagram it can be concluded to star mass and age. Star-forming processes in interstellar clouds as well as stellar burning processes are illustrated. The changes occurring in a star due to the depletion of the nuclear energy reserve are described. In this frame the phenomena of planetary nebulae, supernovae, pulsars, neutron stars as well as of black holes are explained

  4. Hr Pitt mängib hr Smithi / Timo Diener

    Diener, Timo


    Brad Pitt actionkomöödias "Hr ja pr Smith" ("Mr and Mrs Smith") : režissöör Doug Liman : Ameerika Ühendriigid 2005. Filmi ümber puhkenud skandaalist ning näitleja plaanitavatest filmirollidest aastal 2006

  5. Magnetic fields in beta Cep, SPB, and Be stars

    Schoeller, M.; Hubrig, S.; Briquet, M.; Ilyin, I.


    Recent observational and theoretical results emphasize the potential significance of magnetic fields for structure, evolution, and environment of massive stars. Depending on their spectral and photometric behavior, the upper main-sequence B-type stars are assigned to different groups, such as beta Cep stars and slowly pulsating B (SPB) stars, He-rich and He-deficient Bp stars, Be stars, BpSi stars, HgMn stars, or normal B-type stars. All these groups are characterized by different magnetic fi...

  6. Putting HR outsourcing into practice.

    Berger, Michael


    Faced with the time-consuming responsibility of human resources (HR) management, a growing number of medical practices are outsourcing their HR to professional employer organizations (PEOs) so they can concentrate on their core business. A PEO functions as an HR department-minus the high overhead-managing daily administrative tasks such as payroll processing and related tax filings, employee benefits, and workers' compensation coverage and claims resolution. PEOs help physicians' offices keep up with the piles of paperwork that never seem to shrink, freeing doctors to focus on patient care and building their practice. Because of their volume buying power, PEOs are able to offer employees of small medical practices big-company benefits-everything from health, dental, and vision coverage to long-term disability insurance and tuition assistance. A fledgling industry only a decade ago, HR outsourcing has morphed into a blossoming industry. Enlisting the services of a PEO is now considered de rigueur in many small business circles.

  7. Direct detection and orbital analysis of the exoplanets HR 8799 bcd from archival 2005 Keck/NIRC2 data

    Currie, T.; Fukagawa, M.; Thalmann, C.; Matsumura, S.; Plavchan, P.


    We present previously unpublished 2005 July H-band coronagraphic data of the young, planet-hosting star HR 8799 from the newly released Keck/NIRC2 archive. Despite poor observing conditions, we detect three of the planets (HR 8799 bcd), two of them (HR 8799 bc) without advanced image processing.

  8. Inter-Division IV/V WG on Active OB Stars

    Owocki, S.; Aerts, C.; Fabregat, J.; Gies, D.; Henrichs, H.F.; McDavid, D.; Porter, J.; Rivinius, T.; Peters, G.; Stefl, S.


    Our group studies active early-type (OB) stars, with historical focus on classical Be stars, but extending in recent years to include Slowly Pulsating B-stars (SPB), Beta-Cephei stars, the strongly magnetic Bp stars, Luminous Blue Vairiable (LBV) stars, and B[e] stars. An overall goal is to



    Restricted services from 3 to 7 November 2001 Due to the migration of the Oracle HR application to the Web, some services which rely on the application's availability may be disturbed from Friday 2 November at 17:30 until Thursday 8 November at 08:30. Amongst those services: HR Division: records office, recruitment, claims and benefits. FI Division: personnel accounting, advances and claims. ST Division: registration office (access cards). SPL Division: external firm staff records. EP Division: users' office. Experiments' secretariats: PIE, Greybook. Divisional secretariats: externals, internal addresses. All information concerning this migration is available at: We apologize for any inconvenience and thank you in advance for your understanding.

  10. Four new Delta Scuti stars

    Schutt, R. L.


    Four new Delta Scuti stars are reported. Power, modified into amplitude, spectra, and light curves are used to determine periodicities. A complete frequency analysis is not performed due to the lack of a sufficient time base in the data. These new variables help verify the many predictions that Delta Scuti stars probably exist in prolific numbers as small amplitude variables. Two of these stars, HR 4344 and HD 107513, are possibly Am stars. If so, they are among the minority of variable stars which are also Am stars.

  11. Massive stars in galaxies

    Humphreys, R.M.


    The relationship between the morphologic type of a galaxy and the evolution of its massive stars is explored, reviewing observational results for nearby galaxies. The data are presented in diagrams, and it is found that the massive-star populations of most Sc spiral galaxies and irregular galaxies are similar, while those of Sb spirals such as M 31 and M 81 may be affected by morphology (via differences in the initial mass function or star-formation rate). Consideration is also given to the stability-related upper luminosity limit in the H-R diagram of hypergiant stars (attributed to radiation pressure in hot stars and turbulence in cool stars) and the goals of future observation campaigns. 88 references

  12. Neutron stars

    Irvine, J.M.


    The subject is covered in chapters entitled: introduction (resume of stellar evolution, gross characteristics of neutron stars); pulsars (pulsar characteristics, pulsars as neutron stars); neutron star temperatures (neutron star cooling, superfluidity and superconductivity in neutron stars); the exterior of neutron stars (the magnetosphere, the neutron star 'atmosphere', pulses); neutron star structure; neutron star equations of state. (U.K.)

  13. Next HR Department Public meeting


      Dear Colleagues, I am pleased to invite you to the next public meeting organized by HR Department, which will take place on Monday 25 June at 14:30, for the first time in the Globe (in front of the Reception). The agenda will comprise of: ·         the recent staff member survey results ·         the Diversity at CERN ·         the Learning and Development Policy The first topic concerns, more specifically, staff members. All presentations will be made in English, however, we are pleased to inform you that a simultaneous interpretation in French is foreseen. Should you not be able to attend the meeting, it can also be followed via Webcast and the recording will be made available on Indico. Finally, subject to a favourable weather, refreshments...

  14. Next HR Department public meeting


    Dear Colleagues, I am pleased to invite you to the next public meeting organized by the HR Department, which will take place on Tuesday 28 June at 3 p.m. in the Council Chamber. A drink will be served after the meeting as of 16:30 This meeting will be the opportunity to revisit the specificities of the Career Structure measures and Benchmark Jobs, what they entail and how they will be implemented, and to answer your questions. This meeting is also important for me on a personal note, as I will bid you farewell, at least for a few years, taking special leave as of 1 August 2016 to take up the position of Director-General for Human Resources at the European Central Bank in Frankfurt.  Should you not be able to attend the meeting, it can also be followed via Webcast and the recording will be made available on Indico. I look forward to meeting you. Best regards, Anne-Sylvie Catherin Head of the Human Resources Department

  15. Réunion publique HR

    CERN. Geneva


    Chers Collègues,Je me permets de vous rappeler qu'une réunion publique organisée par le Département HR se tiendra aujourd'hui:Vendredi 30 avril 2010 à 9h30 dans l'Amphithéâtre principal (café offert dès 9h00).Durant cette réunion, des informations générales seront données sur:le CERN Admin e-guide, qui est un nouveau guide des procédures administratives du CERN ayant pour but de faciliter la recherche d'informations pratiques et d'offrir un format de lecture convivial;le régime d'Assurance Maladie de l'Organisation (présentation effectuée par Philippe Charpentier, Président du CHIS Board) et;la Caisse de Pensions (présentation effectuée par Théodore Economou, Administrateur de la Caisse de Pensions du CERN).Une transmission simultanée de cette réunion sera assur...

  16. HR diagrams derived from the Michigan Spectral Catalogue

    Houk, N.; Fesen, R.


    The authors present some HR diagrams constructed using data from the Michigan Spectral Catalogues. Houk (1975) has been systematically reclassifying the Henry Draper stars on the MK system, from the south pole northward. Objective-prism plates, with a reciprocal dispersion of 108 A/mm, have been taken with the Michigan Curtis Schmidt telescope at Cerro Tololo Inter-American Observatory in Chile. The spectra are classified visually from the plates, and the results are put onto IBM cards and magnetic tape from which the catalogues are produced. (Auth.)

  17. Ultraviolet colors of subdwarf O stars

    Wesselius, P.R.


    The group of subdwarf O stars consisting of field stars and some central stars of old planetary nebulae does occupy an interesting place in the HR diagram. Greenstein and Sargent (1974) have tried to establish this place, and conclude that especially the hottest ones need ultraviolet data to improve the values of effective temperature and absolute luminosity. The author therefore observed some twenty sdO stars in the far ultraviolet using the spectrophotometer in the Netherlands' satellite ANS. (Auth.)


    Baines, Ellyn K.; White, Russel J.; Jones, Jeremy; Boyajian, Tabetha; McAlister, Harold A.; Ten Brummelaar, Theo A.; Turner, Nils H.; Sturmann, Judit; Sturmann, Laszlo; Goldfinger, P. J.; Farrington, Christopher D.; Riedel, Adric R.; Huber, Daniel; Ireland, Michael; Von Braun, Kaspar; Ridgway, Stephen T.


    HR 8799 is an hF0 mA5 γ Doradus-, λ Bootis-, Vega-type star best known for hosting four directly imaged candidate planetary companions. Using the CHARA Array interferometer, we measure HR 8799's limb-darkened angular diameter to be 0.342 ± 0.008 mas (an error of only 2%). By combining our measurement with the star's parallax and photometry from the literature, we greatly improve upon previous estimates of its fundamental parameters, including stellar radius (1.44 ± 0.06 R ☉ ), effective temperature (7193 ± 87 K, consistent with F0), luminosity (5.05 ± 0.29 L ☉ ), and the extent of the habitable zone (HZ; 1.62-3.32 AU). These improved stellar properties permit much more precise comparisons with stellar evolutionary models, from which a mass and age can be determined, once the metallicity of the star is known. Considering the observational properties of other λ Bootis stars and the indirect evidence for youth of HR 8799, we argue that the internal abundance, and what we refer to as the effective abundance, is most likely near solar. Finally, using the Yonsei-Yale evolutionary models with uniformly scaled solar-like abundances, we estimate HR 8799's mass and age considering two possibilities: 1.516 +0.038 –0.024 M ☉ and 33 +7 –13.2 Myr if the star is contracting toward the zero-age main sequence or 1.513 +0.023 –0.024 M ☉ and 90 +381 –50 Myr if it is expanding from it. This improved estimate of HR 8799's age with realistic uncertainties provides the best constraints to date on the masses of its orbiting companions, and strongly suggests they are indeed planets. They nevertheless all appear to orbit well outside the HZ of this young star.

  19. Origin of faint blue stars

    Tutukov, A.; Iungelson, L.


    The origin of field faint blue stars that are placed in the HR diagram to the left of the main sequence is discussed. These include degenerate dwarfs and O and B subdwarfs. Degenerate dwarfs belong to two main populations with helium and carbon-oxygen cores. The majority of the hot subdwarfs most possibly are helium nondegenerate stars that are produced by mass exchange close binaries of moderate mass cores (3-15 solar masses). The theoretical estimates of the numbers of faint blue stars of different types brighter than certain stellar magnitudes agree with star counts based on the Palomar Green Survey. 28 references

  20. BP, Cardiovascular Disease, and Death in the Folic Acid for Vascular Outcome Reduction in Transplantation Trial

    John, Alin; Weir, Matthew R.; Smith, Stephen R.; Hunsicker, Lawrence; Kasiske, Bertram L.; Kusek, John W.; Bostom, Andrew; Ivanova, Anastasia; Levey, Andrew S.; Solomon, Scott; Pesavento, Todd; Weiner, Daniel E.


    The optimal BP level in kidney transplant recipients remains uncertain. This post hoc analysis of the Folic Acid for Vascular Outcome Reduction in Transplantation (FAVORIT) trial cohort assessed associations of BP with a pooled cardiovascular disease (CVD) outcome and with all-cause mortality. In 3474 prevalent kidney transplant patients, mean age was 52±9 years, 63% were men, 76% were white, 20% had a history of CVD, 40% had a history of diabetes mellitus, and the median time since transplant was 4.1 years (25th to 75th percentiles, 1.7–7.4); mean systolic BP was 136±20 mmHg and mean diastolic BP was 79±12 mmHg. There were 497 CVD events and 406 deaths. After adjustment for demographic and transplant characteristics and CVD risk factors, each 20-mmHg increase in baseline systolic BP associated with a 32% increase in subsequent CVD risk (hazard ratio [HR], 1.32; 95% confidence interval [95% CI], 1.19 to 1.46) and a 13% increase in mortality risk (HR, 1.13; 95% CI, 1.01 to 1.27). Similarly, after adjustment, at diastolic BP levels70 mmHg, there was no significant relationship between diastolic BP and outcomes. Higher systolic BP strongly and independently associated with increased risk of CVD and all-cause mortality, without evidence of a J shape, whereas only lower levels of diastolic BP associated with increased risk of CVD and death in this trial. PMID:24627349

  1. Symbiotic stars

    Boyarchuk, A.A.


    There are some arguments that the symbiotic stars are binary, where one component is a red giant and the other component is a small hot star which is exciting a nebula. The symbiotic stars belong to the old disc population. Probably, symbiotic stars are just such an evolutionary stage for double stars as planetary nebulae for single stars. (Auth.)

  2. The perspective of Malaysian Manufacturing Organizations on Strategy, HR Outsourcing and HR Costs

    Hasliza Abdul HALIM


    Full Text Available The paper discusses the relationship between different types of human resource management (HRM strategy and the human resource outsourcing, and impact on the size of human resource (HR department. Three HRM strategies are considered: Facilitation, accumulation and utilization. The data for the study were obtained from survey responses from 232 organizations, of which 113 were engaged in HR outsourcing. The findings suggest that organizations tend to rely on outsourcing of HR functions when they espouse facilitation and utilization HRM strategy. Concurrently, by relying on HR outsourcing, the organizations manage to experience a reduction in the size of HR department. The results show that it is important for the organizations to better understand the implications of an increased reliance on outsourcing within HR. This allows them to focus on how HR functions are delivered within organizations with the interaction of HRM strategy and the size of HR department will tend to be smaller resulting from outsourcing activities.

  3. Adding intrapreneurial role in HR business partner model: (an extension in the HR business partner model)

    Bashir, Jibran; Afzal, Sara


    Purpose: The Purpose of this paper is to introduce a concept, whereby extending the Dave Ulrich’s HR business partner model by adding fifth Role – The HR Intrapreneur Role – in the existing model. This will be done by combining two separate concepts “Four Roles HR Business Partner Model” and “Intrapreneurial HR”, resulting in a five roles HR Business Partner Model. Design/methodology/approach: This paper is introducing a new concept through theoretical research. Findings: H...

  4. Draft genome sequence of a human-associated isolate of Haloferax alexandrinus strain Arc-hr, an extremely halophilic archaea.

    Khelaifia, S; Caputo, A; Djossou, F; Raoult, D


    We report the draft genome sequence of Haloferax alexandrinus strain Arc-hr (CSUR P798), isolated from the human gut of a 10-year-old Amazonian individual. Its 3 893 626 bp genome exhibits a 66.00% GC content. The genome of the strain Arc-hr contains 37 genes identified as ORFans, seven genes associated to halocin and 11 genes associated with polyketide synthases or nonribosomal peptide synthetases.

  5. BP report of the business year 1979


    The paper presents a survey about the development of the energy- and petroleum market during the year 1979. A commentary of the German BP A.G. and its activities is given here: personnel- and management policy, exploration, supply, refining and distribution, investigation, and development. After a survey about the business situation of the German BP A.G. the detailed annual balance sheets of 1979 of the German BP and of the whole enterprise are given.


    Abbuhl, E.; Mutel, R. L.; Lynch, C. [Department of Physics and Astronomy, University of Iowa, Van Allen Hall, Iowa City, Iowa 52242 (United States); Güedel, M. [Department of Astronomy, University of Vienna, Vienna (Austria)


    The close active binary HR 5110 was observed at six epochs over 26 days using a global very long baseline interferometry array at 15.4 GHz. We used phase referencing to determine the position of the radio centroid at each epoch with an uncertainty significantly smaller than the component separation. After correcting for proper motion and parallax, we find that the centroid locations of all six epochs have barycenter separations consistent with an emission source located on the KIV secondary, and not in an interaction region between the stars or on the F primary. We used a homogeneous power-law gyrosynchrotron emission model to reproduce the observed flux densities and fractional circular polarization. The resulting ranges of mean magnetic field strength and relativistic electron densities are of the order of 10 G and 10{sup 5} cm{sup −3}, respectively, in the source region.

  7. BP - bisnis põhjas? / Erik Aru

    Aru, Erik


    Seoses Mehhiko lahe naftareostusega ootab BP-d kuni 21 mld. dollari suurune trahv, kahjude hüvitamiseks peab BP müüma osa oma varast. Ekspertide hinnangul tähendavad Mehhiko lahe sündmused suuri muutusi kogu naftaäris

  8. The perspective of Malaysian Manufacturing Organizations on Strategy, HR Outsourcing and HR Costs

    Hasliza Abdul HALIM; Norbani CHE-HA


    The paper discusses the relationship between different types of human resource management (HRM) strategy and the human resource outsourcing, and impact on the size of human resource (HR) department. Three HRM strategies are considered: Facilitation, accumulation and utilization. The data for the study were obtained from survey responses from 232 organizations, of which 113 were engaged in HR outsourcing. The findings suggest that organizations tend to rely on outsourcing of HR functions when ...


    SEAL, P


    A H-R diagram is drawn from the bolometric luminosities and effective temperatures of 24 symbiotic stars and compared with theoretical evolutionary tracks of Population I metal-rich stars. It is shown that the S-type and D-type symbiotic stars are classified very clearly in course of their evolution

  10. Which of Kepler's Stars Flare?

    Kohler, Susanna


    The habitability of distant exoplanets is dependent upon many factors one of which is the activity of their host stars. To learn about which stars are most likely to flare, a recent study examines tens of thousands of stellar flares observed by Kepler.Need for a Broader SampleArtists rendering of a flaring dwarf star. [NASAs Goddard Space Flight Center/S. Wiessinger]Most of our understanding of what causes a star to flare is based on observations of the only star near enough to examine in detail the Sun. But in learning from a sample size of one, a challenge arises: we must determine which conclusions are unique to the Sun (or Sun-like stars), and which apply to other stellar types as well.Based on observations and modeling, astronomers think that stellar flares result from the reconnection of magnetic field lines in a stars outer atmosphere, the corona. The magnetic activity is thought to be driven by a dynamo caused by motions in the stars convective zone.HR diagram of the Kepler stars, with flaring main-sequence (yellow), giant (red) and A-star (green) stars in the authors sample indicated. [Van Doorsselaere et al. 2017]To test whether these ideas are true generally, we need to understand what types of stars exhibit flares, and what stellar properties correlate with flaring activity. A team of scientists led by Tom Van Doorsselaere (KU Leuven, Belgium) has now used an enormous sample of flares observed by Kepler to explore these statistics.Intriguing TrendsVan Doorsselaere and collaborators used a new automated flare detection and characterization algorithm to search through the raw light curves from Quarter 15 of the Kepler mission, building a sample of 16,850 flares on 6,662 stars. They then used these to study the dependence of the flare occurrence rate, duration, energy, and amplitude on the stellar spectral type and rotation period.This large statistical study led the authors to several interesting conclusions, including:Flare star incidence rate as a a

  11. Composite Spectra Paper 1: HR 6902


    spectra; in many cases we have used the maximum width permitted by the optics of ... 10 mЕ, corresponding to 1 µm the plate, are the norm. ..... an inequality ..... on the spectra of HR 6902, we have thought it appropriate to weight the four ...

  12. BP Investment Exceeds $4 Bln in china

    Wang Ping


    @@ British Petroleum (BP) recently signed a series of agreements with China including those in clean energy and wind power generation, during British Prime Minister Gordon Brown's visit to China in mid-January.

  13. BP teatas harvast edusammust / Hendrik Vosman

    Vosman, Hendrik


    Naftakompanii BP teatas, et suudab Mehhiko lahest päevas kinni püüda sinna lekkinud 10 000 barrelit naftat. Tegu on ajutise lahendusega, lõplikult peaks naftavoo peatama merepõhja puuritavad nn. asenduskaevud

  14. Stars and Star Myths.

    Eason, Oliver

    Myths and tales from around the world about constellations and facts about stars in the constellations are presented. Most of the stories are from Greek and Roman mythology; however, a few Chinese, Japanese, Polynesian, Arabian, Jewish, and American Indian tales are also included. Following an introduction, myths are presented for the following 32…

  15. Deep Thermal Infrared Imaging of HR 8799 bcde: New Atmospheric Constraints and Limits on a Fifth Planet

    Currie, Thayne; Burrows, Adam; Girard, Julien H.; Cloutier, Ryan; Fukagawa, Misato; Sorahana, Satoko; Kuchner, Marc; Kenyon, Scott J.; Madhusudhan, Nikku; Itoh, Yoichi; Jayawardhana, Ray; Matsumura, Soko; Pyo, Tae-Soo


    We present new $L^\\prime$ (3.8 $\\mu m$) and Br-$\\alpha$ (4.05 $\\mu m$) data and reprocessed archival $L^\\prime$ data for the young, planet-hosting star HR 8799 obtained with Keck/NIRC2, VLT/NaCo and Subaru/IRCS. We detect all four HR 8799 planets in each dataset at a moderate to high signal-to-noise (SNR $\\gtrsim$ 6-15). We fail to identify a fifth planet, "HR 8799 f", at $r$ $

  16. Enabling quaternion derivatives: the generalized HR calculus

    Xu, Dongpo; Jahanchahi, Cyrus; Took, Clive C.; Mandic, Danilo P.


    Quaternion derivatives exist only for a very restricted class of analytic (regular) functions; however, in many applications, functions of interest are real-valued and hence not analytic, a typical case being the standard real mean square error objective function. The recent HR calculus is a step forward and provides a way to calculate derivatives and gradients of both analytic and non-analytic functions of quaternion variables; however, the HR calculus can become cumbersome in complex optimization problems due to the lack of rigorous product and chain rules, a consequence of the non-commutativity of quaternion algebra. To address this issue, we introduce the generalized HR (GHR) derivatives which employ quaternion rotations in a general orthogonal system and provide the left- and right-hand versions of the quaternion derivative of general functions. The GHR calculus also solves the long-standing problems of product and chain rules, mean-value theorem and Taylor's theorem in the quaternion field. At the core of the proposed GHR calculus is quaternion rotation, which makes it possible to extend the principle to other functional calculi in non-commutative settings. Examples in statistical learning theory and adaptive signal processing support the analysis. PMID:26361555

  17. 24 hr non-invasive ambulatory blood pressure and heart rate monitoring in Parkinson’s Disease

    Eva eStübner


    Full Text Available Non-motor symptoms are now commonly recognized in Parkinson’s Disease (PD and can include dysautonomia. Impairment of cardiovascular autonomic function can occur at any stage of PD but is typically prevalent in advanced stages or related to (anti-parkinsonian drugs and can result in atypical blood pressure (BP readings and related symptoms such as orthostatic hypotension (OH and supine hypertension. OH is usually diagnosed with a head-up-tilt test (HUT or an (active standing test (also known as Schellong test in the laboratory, but 24 hour Ambulatory Blood Pressure Monitoring (ABPM in a home setting may have several advantages, such as providing an overview of symptoms in daily life alongside pathophysiology as well as assessment of treatment interventions. This, however, is only possible if ABPM is administrated correctly and an autonomic protocol (including a diary is followed. which will be discussed in this review. A 24hr ABPM does not only allow the detection of OH, if it is present, but also the assessment of cardiovascular autonomic dysfunction during and after various daily stimuli, such as postprandial and alcohol dependent hypotension, as well as exercise and drug induced hypotension. Furthermore, information about the circadian rhythm of BP and heart rate (HR can be obtained and establish whether or not a patient has a fall of BP at night (i.e. ‘dipper’ vs. non-‘dipper’. The information about nocturnal BP may also allow the investigation or detection of disorders such as sleep dysfunction, nocturnal movement disorders and obstructive sleep apnea, which are common in PD. Additionally, a 24hr ABPM should be conducted to examine the effectiveness of OH therapy. This review will outline the methodology of 24 hr ABPM in PD, summarize findings of such studies in PD and briefly consider common daily stimuli that might affect 24 Hr ABPM.

  18. Wave Star

    Kramer, Morten; Brorsen, Michael; Frigaard, Peter

    Denne rapport beskriver numeriske beregninger af forskellige flydergeometrier for bølgeenergianlæget Wave Star.......Denne rapport beskriver numeriske beregninger af forskellige flydergeometrier for bølgeenergianlæget Wave Star....

  19. Stars get dizzy after lunch

    Zhang, Michael; Penev, Kaloyan


    Exoplanet searches have discovered a large number of h ot Jupiters — high-mass planets orbiting very close to their parent stars in nearly circular orbits. A number of these planets are sufficiently massive and close-in to be significantly affected by tidal dissipation in the parent star, to a degree parameterized by the tidal quality factor Q * . This process speeds up their star's rotation rate while reducing the planet's semimajor axis. In this paper, we investigate the tidal destruction of hot Jupiters. Because the orbital angular momenta of these planets are a significant fraction of their star's rotational angular momenta, they spin up their stars significantly while spiraling to their deaths. Using the Monte Carlo simulation, we predict that for Q * = 10 6 , 3.9 × 10 –6 of stars with the Kepler Target Catalog's mass distribution should have a rotation period shorter than 1/3 day (8 hr) due to accreting a planet. Exoplanet surveys such as SuperWASP, HATnet, HATsouth, and KELT have already produced light curves of millions of stars. These two facts suggest that it may be possible to search for tidally destroyed planets by looking for stars with extremely short rotational periods, then looking for remnant planet cores around those candidates, anomalies in the metal distribution, or other signatures of the recent accretion of the planet.

  20. Complete genome sequence of Desulfohalobium retbaense type strain (HR100T)

    Spring, Stefan [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Nolan, Matt [U.S. Department of Energy, Joint Genome Institute; Lapidus, Alla L. [U.S. Department of Energy, Joint Genome Institute; Glavina Del Rio, Tijana [U.S. Department of Energy, Joint Genome Institute; Copeland, A [U.S. Department of Energy, Joint Genome Institute; Tice, Hope [U.S. Department of Energy, Joint Genome Institute; Cheng, Jan-Fang [U.S. Department of Energy, Joint Genome Institute; Lucas, Susan [U.S. Department of Energy, Joint Genome Institute; Land, Miriam L [ORNL; Chen, Feng [U.S. Department of Energy, Joint Genome Institute; Bruce, David [Los Alamos National Laboratory (LANL); Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Pitluck, Sam [U.S. Department of Energy, Joint Genome Institute; Ivanova, N [U.S. Department of Energy, Joint Genome Institute; Mavromatis, K [U.S. Department of Energy, Joint Genome Institute; Mikhailova, Natalia [U.S. Department of Energy, Joint Genome Institute; Pati, Amrita [U.S. Department of Energy, Joint Genome Institute; Chen, Amy [U.S. Department of Energy, Joint Genome Institute; Palaniappan, Krishna [U.S. Department of Energy, Joint Genome Institute; Hauser, Loren John [ORNL; Chang, Yun-Juan [ORNL; Jeffries, Cynthia [Oak Ridge National Laboratory (ORNL); Munk, Christine [U.S. Department of Energy, Joint Genome Institute; Kiss, Hajnalka [Los Alamos National Laboratory (LANL); Chain, Patrick S. G. [Lawrence Livermore National Laboratory (LLNL); Han, Cliff [Los Alamos National Laboratory (LANL); Brettin, Thomas S [ORNL; Detter, J. Chris [U.S. Department of Energy, Joint Genome Institute; Schuler, Esther [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Goker, Markus [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Rohde, Manfred [HZI - Helmholtz Centre for Infection Research, Braunschweig, Germany; Bristow, James [U.S. Department of Energy, Joint Genome Institute; Eisen, Jonathan [U.S. Department of Energy, Joint Genome Institute; Markowitz, Victor [U.S. Department of Energy, Joint Genome Institute; Hugenholtz, Philip [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute; Klenk, Hans-Peter [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany


    Desulfohalobium retbaense (Ollivier et al. 1991) is the type species of the polyphyletic genus Desulfohalobium, which comprises, at the time of writing, two species and represents the family Desulfohalobiaceae within the Deltaproteobacteria. D. retbaense is a moderately halophilic sulfate-reducing bacterium, which can utilize H2 and a limited range of organic substrates, which are incompletely oxidized to acetate and CO2, for growth. The type strain HR100T was isolated from sediments of the hypersaline Retba Lake in Senegal. Here we describe the features of this organism, together with the complete genome sequence and annotation. This is the first completed genome sequence of a member of the family Desulfohalobiaceae. The 2,909,567 bp genome (one chromosome and a 45,263 bp plasmid) with its 2,552 protein-coding and 57 RNA genes is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

  1. To share or not to share: thats the question! When does sharing of HR services maximize perceived HR service value?

    Meijerink, Jeroen Gerard; Hofman, Erwin; Hemels, Hinse


    Nowadays, organizations can rely on a variety of delivery channels for offering HR services to employees, such as HR shared service centres, embedded HR professionals or electronic HRM. However, when should organizations opt for one of the many HR delivery channels that are at their disposal to

  2. Comments on H.R. 2480

    Rezendes, V.S.


    GAO testified on H.R. 2480, the Uranium Enrichment Reorganization Act, which would restructure DOE's uranium enrichment program as a government corporation. Specifically, this legislation would allow the corporation to set prices to maximize long-term returns; establish a fund to meet future decontamination, decommissioning, and remedial action costs associated with past uranium enrichment activities. and require the government to pay its share of the costs to clean up mining waste generated under past government contracts. GAO believes that H.R. 2480 takes needed steps toward establishing clear objectives for the enrichment program and would allow the new corporation to better operate as a business entity. The bill would also resolve several long-term issues that seriously challenge the program's future, including the need to pay billions of dollars in environmental and decommissioning costs at a time when competition is expected to increase. However, GAO believes that the bill could be strengthened by including a specific cost recovery provision. Because DOE projects that the corporation's future earnings could be substantial, GAO suggests that Congress require the repayment of $3 billion, rather than rely solely on unspecified dividends and/or uncertain future stock sales that may not materialize unless problems related to licensing uncertainties, increased competition, and billions of dollars in liabilities are adequately resolved

  3. International HR Strategy of Brazilian Technology Multinationals

    Patricia Morilha Muritiba


    Full Text Available Four cases of Brazilian Multinationals from the information technology [IT] sector were compared in their international Human Resources strategy. The analysis is focused on the development and application of two research models. One analyzes the level of subsidiary autonomy in terms of strategic HR decisions, including difficult decisions regarding coordination in multinationals, following the theoretical approach of the autonomy of subsidiaries (Kidger, 2002; Nohria & Ghoshal, 1997. The other is related to the level of internationalization of HR strategies, defined as the capacity to take advantage of globalization, providing the best resources for the company regardless of where they are located (Sparrow, 2007. Both models were applied in a multiple case study method (Eisenhardt, 1989. Data were collected through semi-structured interviews and company reports, and analyzed through content analysis. The results show: (a a more centralizing characteristic of the multinational companies examined, despite the limitations of this choice as shown by the literature; and (b that Brazilian IT multinationals tend to rely more on their national competencies when managing human resources instead of going global to aggregate differentiated competencies.


    L. Lebègue


    Full Text Available PLEIADES is the highest resolution civilian earth observing system ever developed in Europe. This imagery program is conducted by the French National Space Agency, CNES. It operates since 2012 a first satellite PLEIADES-HR launched on 2011 December 17th, a second one should be launched by the end of the year. Each satellite is designed to provide optical 70 cm resolution coloured images to civilian and defence users. The Image Quality requirements were defined from users studies from the different spatial imaging applications, taking into account the trade-off between on-board technological complexity and ground processing capacity. The assessment of the image quality and the calibration operation have been performed by CNES Image Quality team during the 6 month commissioning phase that followed the satellite launch. These activities cover many topics gathered in two families : radiometric and geometric image quality. The new capabilities offered by PLEIADES-HR agility allowed to imagine new methods of image calibration and performance assessment. Starting from an overview of the satellite characteristics, this paper presents all the calibration operations that were conducted during the commissioning phase and also gives the main results for every image quality performance.

  5. Based on BP Neural Network Stock Prediction

    Liu, Xiangwei; Ma, Xin


    The stock market has a high profit and high risk features, on the stock market analysis and prediction research has been paid attention to by people. Stock price trend is a complex nonlinear function, so the price has certain predictability. This article mainly with improved BP neural network (BPNN) to set up the stock market prediction model, and…

  6. Resolving the planetesimal belt of HR 8799 with ALMA

    Booth, Mark; Jordán, Andrés; Casassus, Simon; Hales, Antonio S.; Dent, William R. F.; Faramaz, Virginie; Matrà, Luca; Barkats, Denis; Brahm, Rafael; Cuadra, Jorge


    The star HR 8799 hosts one of the largest known debris discs and at least four giant planets. Previous observations have found evidence for a warm belt within the orbits of the planets, a cold planetesimal belt beyond their orbits and a halo of small grains. With the infrared data, it is hard to distinguish the planetesimal belt emission from that of the grains in the halo. With this in mind, the system has been observed with ALMA in band 6 (1.34 mm) using a compact array format. These observations allow the inner edge of the planetesimal belt to be resolved for the first time. A radial distribution of dust grains is fitted to the data using an MCMC method. The disc is best fitted by a broad ring between 145^{+12}_{-12} au and 429^{+37}_{-32} au at an inclination of 40^{+5}_{-6}° and a position angle of 51^{+8}_{-8}°. A disc edge at ˜145 au is too far out to be explained simply by interactions with planet b, requiring either a more complicated dynamical history or an extra planet beyond the orbit of planet b.


    D. Greslou


    Full Text Available Since the beginning of 2012, the first Pleiades-HR satellite of the program conducted by the French National Space Agency, CNES, delivers 20 km wide color scenes with a 70 cm ground sampling distance. A second satellite should be launched in 2013 which will achieve an almost world-wide coverage with a revisit interval of 24h. The assessment of the image quality and the calibration operation have been performed by CNES Image Quality team during the 6 month commissioning phase that followed the satellite launch. The geometric commissioning activities consist in improve the geometric quality of the images in order to meet very demanding specifications as localization accuracy, local coherence, dynamic stability, length alteration … This goal has been achieved through the implementation of new methods of calibration and performance assessment. Some of these methods are based on the exploitation of very specific satellite acquisitions that have been achieved thanks to the amazing agility of the Pleiades satellite. Thus, many stars acquisitions and very slow earth pictures have been processed to characterize dynamic phenomena. Similarly, “along-cross track” pairs have been exploited to improve the accuracy of the focal plane description. This paper deals with these new methods. It describes their accuracy and their operational interests.

  8. HR 1362 - A test case for stellar dynamo theories

    Strassmeier, K.G.; Hall, D.S.; Barksdale, W.S.; Jusick, A.T.; Henry, G.W.


    An analysis of 11 yr of photometry of HR 1362 = EK Eri has shown a well-established photometric period of 335 days. This confirms an earlier period determination of about 310 days from 3 yr of APT data and is consistent with a new v sin i determination of 2 + or - 2 km/s. Recent Ca II H and K observations show moderately strong H and K emission lines at a flux level of log F prime (K) of about 6.5 ergs sq m/s. If the photometric period is interpreted as the rotation period, this surface flux is more than one order of magnitude larger than what can be expected from empirical activity versus rotation relationships. The spectrum and the U-B and B-V colors are consistent with a single G8 III-IV spectral classification, while the V-R and V-I values indicate a small color excess, typical of chromospherically active stars. 27 refs

  9. AcEST: BP918406 [AcEST

    Full Text Available YMU001_000113_B06 468 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B06. BP918406 - Show mRNA. clone: YMU001_000113_B06. Accession BP918406 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-vene...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-veneris m

  10. AcEST: BP918011 [AcEST

    Full Text Available YMU001_000108_E11 519 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E11. BP918011 - Show mRNA. clone: YMU001_000108_E11. Accession BP918011 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011| search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiantum cap

  11. 884 Cal.BP and all that

    Switsur, Roy


    A history of the development of the technique of radiocarbon dating highlights the two problems with this method. The first is calibration; the radiocarbon calendar is not linear. However two independent experiments to provide high precision measurements in tree rings have resulted in a high precision calibration curve. The second is how to denote radiocarbon ages and calibrated dates, as this depends on how the dendrochronology time scale used in the calibration is transferred to the actual calendar. If the zero of the dendroscale is transferred from the origin of the Christian calendar to AD 1950, radiocarbon ages are designated CAL BP (BP = before present). There is an alternative method which results in CAL AD and CAL BC. A suggestion for a standard notation is made to avoid the confusion of two systems. (U.K.)

  12. BP Oil Company's approach to risk management

    Fryman, C.E.


    The oil and chemical industries face major challenges in deciding how to handle the numerous recommendations coming from various audits, reviews and studies conducted in the functional areas of personnel health and safety, loss prevention, and environmental protection. And, the number of recommendations continues to grow with time, as regulations and normal business requirements are met. BP Oil has developed a methodology for risk ranking the events leading to specific recommendations and then determining the cost-effectiveness of the recommendations in reducing the risk. The author completed successful pilot tests of this methodology at two of BP Oil's petroleum refineries, examining the recommendations from process hazards analyses and studies completed over the past few years. The methodology has since been implemented throughout their petroleum refining, distribution, transportation, and retail business streams

  13. Radio stars

    Hjellming, R.M.


    Any discussion of the radio emission from stars should begin by emphasizing certain unique problems. First of all, one must clarify a semantic confusion introduced into radio astronomy in the late 1950's when most new radio sources were described as radio stars. All of these early 'radio stars' were eventually identified with other galactic and extra-galactic objects. The study of true radio stars, where the radio emission is produced in the atmosphere of a star, began only in the 1960's. Most of the work on the subject has, in fact, been carried out in only the last few years. Because the real information about radio stars is quite new, it is not surprising that major aspects of the subject are not at all understood. For this reason this paper is organized mainly around three questions: what is the available observational information; what physical processes seem to be involved; and what working hypotheses look potentially fruitful. (Auth.)

  14. BP's driving safety strategy

    Herman, B. [BP Canada Energy Company, Calgary, AB (Canada)


    This presentation focused on why it is important to drive safely. It addressed driver fatigue as well as BP's global driving standard. The Standard applies to all BP employees and contractors that drive any vehicle on BP business and consists of 10 mandatory elements focusing on safety of the driver, the safety of the journey, and the safety of the vehicle. The driving standards focus on several themes, including skill and competency of the driver, safety of the journey, and safety of the vehicle. Fatigue causes more than 20 per cent of motorway accidents and is the most frequent cause of accidental death of truck drivers. The presentation also discussed vehicle data recorders, driving immersion, and Driving Safety Program results. Journey management, driver training, vehicle inspections and policies, and statistics on vehicle incidents were also provided. The presentation revealed that a lack of pre-trip journey management, inadequate training or recall of training, and not following safe driving practices were major contributors to incident occurrences. It also revealed that traveling on gravel or ice and avoiding wildlife were factors in many vehicle incidents. 1 tab., 1 fig.

  15. Shooting stars

    Maurette, M.; Hammer, C.


    A shooting star passage -even a star shower- can be sometimes easily seen during moonless black night. They represent the partial volatilization in earth atmosphere of meteorites or micrometeorites reduced in cosmic dusts. Everywhere on earth, these star dusts are searched to be gathered. This research made one year ago on the Greenland ice-cap is this article object; orbit gathering projects are also presented [fr

  16. Global trends and challenges to the HR profession.

    Prouska, Rea; Cooke, Fang Lee.


    The outsourcing of HR activities is a management strategy that may be adopted in response to a number of pressures that an organization is faced with. It is one aspect of business process outsourcing that is increasingly deployed by firms in order to enhance their organizational competitiveness. HR outsourcing can be defined as ‘placing responsibility for various elements of the HR function with a third-party provider’ (Turnbull, 2002, p.11). In spite of the perceived benefits of HR outsourci...

  17. Learning and Development Policy available on HR web


    The full text of CERN’s “Learning and Development Policy” is now available in English and French on the HR training website: This new policy was presented to all personnel in the HR Public meeting held on Monday 25 June, and the slides and the video recording remain available on Indico. Pascale Goy, Head of the Learning and Development Group in HR, is available for more information: , tel. 62232.


    Aagaard, Annabeth


    This study examines how radical front end innovation can be actively facilitated through selected and targeted HR practices and bundles of HR practices. The empirical field is an explorative case study of front end innovation and HR practices in the pharmaceutical industry, with an in-depth case ...


    J. M. Delevit


    Full Text Available Since SPOT1, the French national space centre (CNES has worked on improving the geometry of Earth observation spacecrafts. The accuracy of sensor calibration is one of the main key points for any Earth observation application such as orthorectification, DEM generation or surface change detection. For the last twenty years CNES has developed two families of methods: absolute methods and relative methods. These methods are used to characterize a pushbroom acquisition along the detector line and the time line. By this way, the viewing directions are measured and the residual of the spacecraft’s attitude angles (not restituted by the Attitude and Orbit Control System is estimated. This information can complete the geometric model of all the scenes acquired by the instrument and is used in all geometric applications. This paper presents new attitude assessment methods taking advantage of the capabilities of Pléiades-HR in terms of agility and focal plane arrangement – panchromatic band and multispectral (MS bands.

  20. Star Polymers.

    Ren, Jing M; McKenzie, Thomas G; Fu, Qiang; Wong, Edgar H H; Xu, Jiangtao; An, Zesheng; Shanmugam, Sivaprakash; Davis, Thomas P; Boyer, Cyrille; Qiao, Greg G


    Recent advances in controlled/living polymerization techniques and highly efficient coupling chemistries have enabled the facile synthesis of complex polymer architectures with controlled dimensions and functionality. As an example, star polymers consist of many linear polymers fused at a central point with a large number of chain end functionalities. Owing to this exclusive structure, star polymers exhibit some remarkable characteristics and properties unattainable by simple linear polymers. Hence, they constitute a unique class of technologically important nanomaterials that have been utilized or are currently under audition for many applications in life sciences and nanotechnologies. This article first provides a comprehensive summary of synthetic strategies towards star polymers, then reviews the latest developments in the synthesis and characterization methods of star macromolecules, and lastly outlines emerging applications and current commercial use of star-shaped polymers. The aim of this work is to promote star polymer research, generate new avenues of scientific investigation, and provide contemporary perspectives on chemical innovation that may expedite the commercialization of new star nanomaterials. We envision in the not-too-distant future star polymers will play an increasingly important role in materials science and nanotechnology in both academic and industrial settings.

  1. Wave Star

    Kramer, Morten; Brorsen, Michael; Frigaard, Peter

    Nærværende rapport beskriver numeriske beregninger af den hydrodynamiske interaktion mellem 5 flydere i bølgeenergianlægget Wave Star.......Nærværende rapport beskriver numeriske beregninger af den hydrodynamiske interaktion mellem 5 flydere i bølgeenergianlægget Wave Star....

  2. Star Imager

    Madsen, Peter Buch; Jørgensen, John Leif; Thuesen, Gøsta


    The version of the star imager developed for Astrid II is described. All functions and features are described as well as the operations and the software protocol.......The version of the star imager developed for Astrid II is described. All functions and features are described as well as the operations and the software protocol....

  3. Welding Metallurgy of Alloy HR-160

    DuPont, J.N.; Michael, J.R.; Newbury, B.D.


    The solidification behavior and resultant solidification cracking susceptibility of autogenous gas tungsten arc fusion welds in alloy HR-160 was investigated by Varestraint testing, differential thermal analysis, and various microstructural characterization techniques. The alloy exhibited a liquidus temperature of 1387 degC and initiated solidification by a primary L - γ reaction in which Ni, Si, and Ti segregated to the interdendritic liquid and Co segregated to the γ dendrite cores. Chromium exhibited no preference for segregation to the solid or liquid phase during solidification. Solidification terminated at ∼ 1162 degC by a eutectic-type L - [γ+ (Ni,Co) 16 (Ti,Cr) 6 Si 7 ] reaction. The (Ni,Co) 16 (Ti,Cr) 6 Si 7 phase is found to be analogous to the G phase which forms in the Ni-Ti-Si and Co-Ti-Si ternary systems, and similarities are found to exist between the solidification behavior of this commercial multicomponent alloy and the simple Ni-Si and Ni-Ti binary systems. Reasonable agreement is obtained between the calculated and measured volume percent of the [γ +(Ni,Co) l6 (Ti,Cr) 6 Si 7 ] eutectic-typr constituent with the Scheil equation using experimentally determined k values for Si and Ti from electron microprobe data. The alloy exhibited a very high susceptibility to solidification cracking in the Varestraint test. This is attributed to a large solidification temperature range of 225 degC and the presence of 2 to 5 vol% solute rich interdendritic liquid which preferentially wets the grain boundaries and interdendritic regions

  4. Radio stars

    Hjellming, R.M.; Gibson, D.M.


    Studies of stellar radio emission became an important field of research in the 1970's and have now expanded to become a major area of radio astronomy with the advent of new instruments such as the Very Large Array in New Mexico and transcontinental telescope arrays. This volume contains papers from the workshop on stellar continuum radio astronomy held in Boulder, Colorado, and is the first book on the rapidly expanding field of radio emission from stars and stellar systems. Subjects covered include the observational and theoretical aspects of stellar winds from both hot and cool stars, radio flares from active double star systems and red dwarf stars, bipolar flows from star-forming regions, and the radio emission from X-ray binaries. (orig.)


    Melis, C.; Zuckerman, B.; Gielen, C.; Chen, C. H.; Rhee, Joseph H.; Song, Inseok


    Spitzer Infrared Spectrograph data support the interpretation that BP Piscium, a gas and dust enshrouded star residing at high Galactic latitude, is a first-ascent giant rather than a classical T Tauri star. Our analysis suggests that BP Piscium's spectral energy distribution can be modeled as a disk with a gap that is opened by a giant planet. Modeling the rich mid-infrared emission line spectrum indicates that the solid-state emitting grains orbiting BP Piscium are primarily composed of ∼75 K crystalline, magnesium-rich olivine; ∼75 K crystalline, magnesium-rich pyroxene; ∼200 K amorphous, magnesium-rich pyroxene; and ∼200 K annealed silica (cristobalite). These dust grains are all sub-micron sized. The giant planet and gap model also naturally explains the location and mineralogy of the small dust grains in the disk. Disk shocks that result from disk-planet interaction generate the highly crystalline dust which is subsequently blown out of the disk mid-plane and into the disk atmosphere.

  6. ATM signaling and 53BP1

    Zgheib, Omar; Huyen, Yentram; DiTullio, Richard A.; Snyder, Andrew; Venere, Monica; Stavridi, Elena S.; Halazonetis, Thanos D.


    The ATM (mutated in Ataxia-Telangiectasia) protein kinase is an important player in signaling the presence of DNA double strand breaks (DSBs) in higher eukaryotes. Recent studies suggest that ATM monitors the presence of DNA DSBs indirectly, through DNA DSB-induced changes in chromatin structure. One of the proteins that sense these chromatin structure changes is 53BP1, a DNA damage checkpoint protein conserved in all eukaryotes and the putative ortholog of the S. cerevisiae RAD9 protein. We review here the mechanisms by which ATM is activated in response to DNA DSBs, as well as key ATM substrates that control cell cycle progression, apoptosis and DNA repair

  7. Sediment Sampling Data for BP Spill/Deepwater Horizon

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  8. Air Sampling Data for BP Spill/Deepwater Horizon

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  9. Waste Sampling Data for BP Spill/Deepwater Horizon

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  10. Air Monitoring Data for BP Spill/Deepwater Horizon

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  11. Surface Water Sampling Data for BP Spill/Deepwater Horizon

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  12. Water Sampling Data for BP Spill/Deepwater Horizon

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  13. Symbiotic stars

    Kafatos, M.; Michalitsianos, A.G.


    Among the several hundred million binary systems estimated to lie within 3000 light years of the solar system, a tiny fraction, no more than a few hundred, belong to a curious subclass whose radiation has a wavelength distribution so peculiar that it long defied explanation. Such systems radiate strongly in the visible region of the spectrum, but some of them do so even more strongly at both shorter and longer wavelengths: in the ultraviolet region and in the infrared and radio regions. This odd distribution of radiation is best explained by the pairing of a cool red giant star and an intensely hot small star that is virtually in contact with its larger companion. Such objects have become known as symbiotic stars. On photographic plate only the giant star can be discerned, but evidence for the existence of the hot companion has been supplied by satellite-born instruments capable of detecting ultraviolet radiation. The spectra of symbiotic stars indicate that the cool red giant is surrounded by a very hot ionized gas. Symbiotic stars also flared up in outbursts indicating the ejection of material in the form of a shell or a ring. Symbiotic stars may therefore represent a transitory phase in the evolution of certain types of binary systems in which there is substantial transfer of matter from the larger partner to the smaller

  14. Deep thermal infrared imaging of HR 8799 bcde: new atmospheric constraints and limits on a fifth planet

    Currie, Thayne; Cloutier, Ryan; Jayawardhana, Ray [Department of Astronomy and Astrophysics, University of Toronto, 50 St. George Street, Toronto, ON M5S 3H4 (Canada); Burrows, Adam [Department of Astrophysical Science, Princeton University, 4 Ivy Lane, Princeton, NJ 08544 (United States); Girard, Julien H. [European Southern Observatory, Alonso de Córdova 3107, Vitacura, Casilla 19001, Santiago (Chile); Fukagawa, Misato [Graduate School of Science, Osaka University, 1-1 Machikaneyama, Toyonaka, Osaka 560-0043 (Japan); Sorahana, Satoko [Department of Astronomy, Graduate School of Science, The University of Tokyo, Bunkyo-ku, Tokyo 113-0033 (Japan); Kuchner, Marc [Exoplanets and Stellar Astrophysics Laboratory, NASA Goddard Space Flight Center, Code 667, Greenbelt, MD 20771 (United States); Kenyon, Scott J. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Madhusudhan, Nikku [Institute of Astronomy, University of Cambridge, Madingley Road, Cambridge CB3 0HA (United Kingdom); Itoh, Yoichi [Nishi-Harima Astronomical Observatory, Center for Astronomy, University of Hyago, 407-2 Nishigaichi, Sayo, Hyogo 679-5313 (Japan); Matsumura, Soko [School of Engineering, Physics, and Mathematics, University of Dundee, Dundee DD1 4HN (United Kingdom); Pyo, Tae-Soo [National Astronomical Observatory of Japan, 650 N. Aohoku Place, Hilo, HI 96720 (United States)


    We present new L' (3.8 μm) and Brα (4.05 μm) data and reprocessed archival L' data for the young, planet-hosting star HR 8799 obtained with Keck/NIRC2, VLT/NaCo, and Subaru/IRCS. We detect all four HR 8799 planets in each data set at a moderate to high signal-to-noise ratio (S/N ≳ 6-15). We fail to identify a fifth planet, 'HR 8799 f', at r < 15 AU at a 5σ confidence level: one suggestive, marginally significant residual at 0.''2 is most likely a point-spread function artifact. Assuming companion ages of 30 Myr and the Baraffe planet cooling models, we rule out an HR 8799 f with a mass of 5 M{sub J} (7 M{sub J} ), 7 M{sub J} (10 M{sub J} ), or 12 M{sub J} (13 M{sub J} ) at r {sub proj} ∼ 12 AU, 9 AU, and 5 AU, respectively. All four HR 8799 planets have red early T dwarf-like L' – [4.05] colors, suggesting that their spectral energy distributions peak in between the L' and M' broadband filters. We find no statistically significant difference in HR 8799 cde's color. Atmosphere models assuming thick, patchy clouds appear to better match HR 8799 bcde's photometry than models assuming a uniform cloud layer. While non-equilibrium carbon chemistry is required to explain HR 8799 b and c's photometry/spectra, evidence for it from HR 8799 d and e's photometry is weaker. Future, deep-IR spectroscopy/spectrophotometry with the Gemini Planet Imager, SCExAO/CHARIS, and other facilities may clarify whether the planets are chemically similar or heterogeneous.

  15. Deep thermal infrared imaging of HR 8799 bcde: new atmospheric constraints and limits on a fifth planet

    Currie, Thayne; Cloutier, Ryan; Jayawardhana, Ray; Burrows, Adam; Girard, Julien H.; Fukagawa, Misato; Sorahana, Satoko; Kuchner, Marc; Kenyon, Scott J.; Madhusudhan, Nikku; Itoh, Yoichi; Matsumura, Soko; Pyo, Tae-Soo


    We present new L' (3.8 μm) and Brα (4.05 μm) data and reprocessed archival L' data for the young, planet-hosting star HR 8799 obtained with Keck/NIRC2, VLT/NaCo, and Subaru/IRCS. We detect all four HR 8799 planets in each data set at a moderate to high signal-to-noise ratio (S/N ≳ 6-15). We fail to identify a fifth planet, 'HR 8799 f', at r < 15 AU at a 5σ confidence level: one suggestive, marginally significant residual at 0.''2 is most likely a point-spread function artifact. Assuming companion ages of 30 Myr and the Baraffe planet cooling models, we rule out an HR 8799 f with a mass of 5 M J (7 M J ), 7 M J (10 M J ), or 12 M J (13 M J ) at r proj ∼ 12 AU, 9 AU, and 5 AU, respectively. All four HR 8799 planets have red early T dwarf-like L' – [4.05] colors, suggesting that their spectral energy distributions peak in between the L' and M' broadband filters. We find no statistically significant difference in HR 8799 cde's color. Atmosphere models assuming thick, patchy clouds appear to better match HR 8799 bcde's photometry than models assuming a uniform cloud layer. While non-equilibrium carbon chemistry is required to explain HR 8799 b and c's photometry/spectra, evidence for it from HR 8799 d and e's photometry is weaker. Future, deep-IR spectroscopy/spectrophotometry with the Gemini Planet Imager, SCExAO/CHARIS, and other facilities may clarify whether the planets are chemically similar or heterogeneous.

  16. AcEST: BP918019 [AcEST

    Full Text Available YMU001_000108_F08 47 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F08. BP918019 - Show BP91801... mRNA. clone: YMU001_000108_F08. Accession BP918019 Tissue type prothallium Developmental stage - Contig ID

  17. Star formation

    Woodward, P.R.


    Theoretical models of star formation are discussed beginning with the earliest stages and ending in the formation of rotating, self-gravitating disks or rings. First a model of the implosion of very diffuse gas clouds is presented which relies upon a shock at the edge of a galactic spiral arm to drive the implosion. Second, models are presented for the formation of a second generation of massive stars in such a cloud once a first generation has formed. These models rely on the ionizing radiation from massive stars or on the supernova shocks produced when these stars explode. Finally, calculations of the gravitational collapse of rotating clouds are discussed with special focus on the question of whether rotating disks or rings are the result of such a collapse. 65 references

  18. Wave Star

    Kramer, Morten; Frigaard, Peter

    Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Byggeri og Anlæg med bølgeenergianlæget Wave Star.......Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Byggeri og Anlæg med bølgeenergianlæget Wave Star....

  19. Wave Star

    Kramer, Morten; Andersen, Thomas Lykke

    Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star.......Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star....

  20. STARS no star on Kauai

    Jones, M.


    The island of Kuai, home to the Pacific Missile Range Facility, is preparing for the first of a series of Star Wars rocket launches expected to begin early this year. The Strategic Defense Initiative plans 40 launches of the Stategic Target System (STARS) over a 10-year period. The focus of the tests appears to be weapons and sensors designed to combat multiple-warhead ICBMs, which will be banned under the START II Treaty that was signed in January. The focus of this article is to express the dubious value of testing the STARS at a time when their application will not be an anticipated problem

  1. Flare stars

    Nicastro, A.J.


    The least massive, but possibly most numerous, stars in a galaxy are the dwarf M stars. It has been observed that some of these dwarfs are characterized by a short increase in brightness. These stars are called flare stars. These flare stars release a lot of energy in a short amount of time. The process producing the eruption must be energetic. The increase in light intensity can be explained by a small area rising to a much higher temperature. Solar flares are looked at to help understand the phenomenon of stellar flares. Dwarfs that flare are observed to have strong magnetic fields. Those dwarf without the strong magnetic field do not seem to flare. It is believed that these regions of strong magnetic fields are associated with star spots. Theories on the energy that power the flares are given. Astrophysicists theorize that the driving force of a stellar flare is the detachment and collapse of a loop of magnetic flux. The mass loss due to stellar flares is discussed. It is believed that stellar flares are a significant contributor to the mass of interstellar medium in the Milky Way

  2. AcEST: BP919406 [AcEST

    Full Text Available YMU001_000124_G04 562 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G04. BP919406 - Show mRNA. clone: YMU001_000124_G04. Accession BP919406 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-...ucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-veneris mRNA, c

  3. AcEST: BP914061 [AcEST

    Full Text Available YMU001_000039_D09 599 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D09. BP91406...1 CL1730Contig1 Show BP914061 Clone id YMU001_000039_D09 Library YMU01 Length 599 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D09. Accession BP914061 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adia...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adiantum capillus-veneris mRNA, c

  4. AcEST: BP914068 [AcEST

    Full Text Available YMU001_000039_E04 420 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E04. BP914068 - Show mRNA. clone: YMU001_000039_E04. Accession BP914068 Tissue type prothallium Developmental stage - Contig I...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914068|Adiantum capillus-veneris mRNA, clone:

  5. AcEST: BP913406 [AcEST

    Full Text Available YMU001_000029_H06 570 Adiantum capillus-veneris mRNA. clone: YMU001_000029_H06. BP913406 - Show mRNA. clone: YMU001_000029_H06. Accession BP913406 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capillus-veneris mRNA, clone: YMU00...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capil...LDVTRGLVNGARGVVVAFES--GKHG---------------LPH 406 Query: 387 VRFACNRAEIVIGPDRQTVESGGMQVARRIQVPLILAWALSVHKCQGM

  6. AcEST: BP915406 [AcEST

    Full Text Available YMU001_000071_B11 433 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B11. BP915406 - Show mRNA. clone: YMU001_000071_B11. Accession BP915406 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: Y...leic Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B11. (433

  7. AcEST: BP914064 [AcEST

    Full Text Available YMU001_000039_D12 560 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D12. BP91406...4 CL532Contig1 Show BP914064 Clone id YMU001_000039_D12 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_D12. Accession BP914064 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adiantum capillus-vener...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adi

  8. AcEST: BP912406 [AcEST

    Full Text Available YMU001_000018_F09 348 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F09. BP912406... CL1894Contig1 Show BP912406 Clone id YMU001_000018_F09 Library YMU01 Length 348 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_F09. Accession BP912406 Tissue type prothallium Developmental database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406|Adiantum capillus-veneris mRNA...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406

  9. AcEST: BP916406 [AcEST

    Full Text Available YMU001_000087_D01 556 Adiantum capillus-veneris mRNA. clone: YMU001_000087_D01. BP916406... CL1913Contig1 Show BP916406 Clone id YMU001_000087_D01 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_D01. Accession BP916406 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capill...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capillus-veneris mRNA, c

  10. AcEST: BP917406 [AcEST

    Full Text Available YMU001_000100_D10 492 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D10. BP917406... CL2033Contig1 Show BP917406 Clone id YMU001_000100_D10 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_D10. Accession BP917406 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917406...Nucleic Acids Res. 25:3389-3402. Query= BP917406|Adiantum capillus-veneris mRNA,

  11. AcEST: BP914406 [AcEST

    Full Text Available YMU001_000058_E09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E09. BP914406... CL513Contig1 Show BP914406 Clone id YMU001_000058_E09 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000058_E09. Accession BP914406 Tissue type prothallium Developmental stage...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406|Adiantum capillus...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406

  12. AcEST: BP921000 [AcEST

    Full Text Available YMU001_000144_D05 407 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D05. BP921000 - Show mRNA. clone: YMU001_000144_D05. Accession BP921000 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum cap...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum capillus-veneris mRN

  13. AcEST: BP920140 [AcEST

    Full Text Available YMU001_000133_E03 489 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E03. BP92014...0 CL2574Contig1 Show BP920140 Clone id YMU001_000133_E03 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E03. Accession BP920140 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920140|Adian... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  14. AcEST: BP920147 [AcEST

    Full Text Available YMU001_000133_F01 365 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F01. BP920147 - Show mRNA. clone: YMU001_000133_F01. Accession BP920147 Tissue type prothallium Developmental stage - Contig programs, Nucleic Acids Res. 25:3389-3402. Query= BP920147|Adiantum capillus-veneris mRNA, clone: YMU001_...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201

  15. AcEST: BP920143 [AcEST

    Full Text Available YMU001_000133_E07 533 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E07. BP92014...3 CL2377Contig1 Show BP920143 Clone id YMU001_000133_E07 Library YMU01 Length 533 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E07. Accession BP920143 Tissue type prothallium Developmental, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E0...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum

  16. AcEST: BP920144 [AcEST

    Full Text Available YMU001_000133_E09 265 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E09. BP920144 - Show mRNA. clone: YMU001_000133_E09. Accession BP920144 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920144|Adiantum capillus-veneris mRNA, clone: YMU001...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  17. AcEST: BP920141 [AcEST

    Full Text Available YMU001_000133_E04 528 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E04. BP920141 - Show mRNA. clone: YMU001_000133_E04. Accession BP920141 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (528 lette...cleic Acids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (52

  18. AcEST: BP920148 [AcEST

    Full Text Available YMU001_000133_F02 429 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F02. BP92014...8 CL3819Contig1 Show BP920148 Clone id YMU001_000133_F02 Library YMU01 Length 429 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F02. Accession BP920148 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920148|Adiantum capillus-vener...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  19. AcEST: BP920145 [AcEST

    Full Text Available YMU001_000133_E11 274 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E11. BP920145 - Show mRNA. clone: YMU001_000133_E11. Accession BP920145 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E11.... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adian

  20. AcEST: BP920142 [AcEST

    Full Text Available YMU001_000133_E05 486 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E05. BP920142 - Show mRNA. clone: YMU001_000133_E05. Accession BP920142 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris ...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  1. AcEST: BP920998 [AcEST

    Full Text Available YMU001_000144_D03 529 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D03. BP92099...8 CL1935Contig1 Show BP920998 Clone id YMU001_000144_D03 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_D03. Accession BP920998 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-veneris mRNA, clon... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-ven

  2. AcEST: BP920996 [AcEST

    Full Text Available YMU001_000144_D01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D01. BP92099...6 CL262Contig1 Show BP920996 Clone id YMU001_000144_D01 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D01. Accession BP920996 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920996|Adiantum capillus-ve

  3. AcEST: BP920995 [AcEST

    Full Text Available YMU001_000144_C12 350 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C12. BP920995 - Show mRNA. clone: YMU001_000144_C12. Accession BP920995 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

  4. AcEST: BP912099 [AcEST

    Full Text Available YMU001_000015_B05 315 Adiantum capillus-veneris mRNA. clone: YMU001_000015_B05. BP912099 - Show mRNA. clone: YMU001_000015_B05. Accession BP912099 Tissue type prothallium Developmental stage - Contig I...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099|Adiantum capillus-vene

  5. AcEST: BP918801 [AcEST

    Full Text Available YMU001_000117_F03 542 Adiantum capillus-veneris mRNA. clone: YMU001_000117_F03. BP918801 - Show mRNA. clone: YMU001_000117_F03. Accession BP918801 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum capillus-veneris mRNA, clone: YMU0...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum ca

  6. AcEST: BP916801 [AcEST

    Full Text Available YMU001_000091_G06 127 Adiantum capillus-veneris mRNA. clone: YMU001_000091_G06. BP916801... CL2168Contig1 Show BP916801 Clone id YMU001_000091_G06 Library YMU01 Length 127 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000091_G06. Accession BP916801 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP916801|Adiantum capillus-veneris mRNA, clone: YMU0...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916801

  7. AcEST: BP918015 [AcEST

    Full Text Available YMU001_000108_F03 437 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F03. BP918015 - Show mRNA. clone: YMU001_000108_F03. Accession BP918015 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP918015|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F03. (437 letters) Data...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  8. AcEST: BP918013 [AcEST

    Full Text Available YMU001_000108_F01 490 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F01. BP918013 - Show mRNA. clone: YMU001_000108_F01. Accession BP918013 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...idylinositol-4-phosphate 5-kinase 1 OS=Oryza sativa subsp. japonica GN=PIPK1 PE=2 SV=2 Length = 801 Score = ..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  9. AcEST: BP918018 [AcEST

    Full Text Available YMU001_000108_F06 436 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F06. BP918018 - Show mRNA. clone: YMU001_000108_F06. Accession BP918018 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918018|Adiantum capillus-veneris mRNA, clone: YM...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  10. AcEST: BP913801 [AcEST

    Full Text Available YMU001_000035_D11 562 Adiantum capillus-veneris mRNA. clone: YMU001_000035_D11. BP913801... CL482Contig1 Show BP913801 Clone id YMU001_000035_D11 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000035_D11. Accession BP913801 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum capillus-veneris mRNA, clone: YMU0

  11. AcEST: BP917801 [AcEST

    Full Text Available YMU001_000105_F04 280 Adiantum capillus-veneris mRNA. clone: YMU001_000105_F04. BP917801 - Show mRNA. clone: YMU001_000105_F04. Accession BP917801 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-ve... Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-veneris mRNA, clone: YMU001_000105_F04.

  12. AcEST: BP918017 [AcEST

    Full Text Available YMU001_000108_F05 267 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F05. BP918017 - Show mRNA. clone: YMU001_000108_F05. Accession BP918017 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris m...cleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F05. (26

  13. AcEST: BP911801 [AcEST

    Full Text Available YMU001_000009_C12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000009_C12. BP911801 - Show mRNA. clone: YMU001_000009_C12. Accession BP911801 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911801.... 25:3389-3402. Query= BP911801|Adiantum capillus-veneris mRNA, clone: YMU001_000

  14. AcEST: BP915801 [AcEST

    Full Text Available YMU001_000077_B02 555 Adiantum capillus-veneris mRNA. clone: YMU001_000077_B02. BP915801 - Show mRNA. clone: YMU001_000077_B02. Accession BP915801 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP915801|Adiantum capillus-veneris mRNA, clone: YMU001_000077_B02. ...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915801|A

  15. AcEST: BP920801 [AcEST

    Full Text Available YMU001_000141_G10 454 Adiantum capillus-veneris mRNA. clone: YMU001_000141_G10. BP920801... CL819Contig1 Show BP920801 Clone id YMU001_000141_G10 Library YMU01 Length 454 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000141_G10. Accession BP920801 Tissue type prothallium Developmental stage... Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-veneris mRNA, clone: ...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-

  16. AcEST: BP912801 [AcEST

    Full Text Available YMU001_000023_A07 527 Adiantum capillus-veneris mRNA. clone: YMU001_000023_A07. BP912801 - Show mRNA. clone: YMU001_000023_A07. Accession BP912801 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= 25:3389-3402. Query= BP912801|Adiantum capillus-veneris mRNA, clone: YMU001_0

  17. AcEST: BP918012 [AcEST

    Full Text Available YMU001_000108_E12 547 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E12. BP918012 - Show mRNA. clone: YMU001_000108_E12. Accession BP918012 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone:, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108_E1

  18. Characterization of the magnetic field of the Herbig Be star HD200775

    Alecian, E.; Catala, C.; Wade, G. A.; Donati, J.-F.; Petit, P.; Landstreet, J. D.; Böhm, T.; Bouret, J.-C.; Bagnulo, S.; Folsom, C.; Grunhut, J.; Silvester, J.


    .3281 +/- 0.0010d, an inclination angle of 60° +/- 11° and a magnetic obliquity angle β = 125° +/- 8°. The polar strength of the magnetic dipole field is 1000 +/- 150G, which is decentred by 0.05 +/- 0.04R* from the centre of the star. The derived magnetic field model is qualitatively identical to those commonly observed in the Ap/Bp stars. Our determination of the inclination of the rotation axis leads to a radius of the primary which is smaller than that derived from the HR diagram position. This can be explained by a larger intrinsic luminosity of the secondary relative to the primary, due to a larger circumstellar extinction of the secondary relative to the primary. Based on observations obtained at the Canada-France-Hawaii Telescope (CFHT) which is operated by the National Research Council of Canada, the Institut National des Sciences de l'Univers of the Centre National de la Recherche Scientifique of France and the University of Hawaii. E-mail:


    Corliss, David J.; Morrison, Nancy D.; Adelman, Saul J.


    A time-series analysis of spectroscopic and photometric observables of the A0 Ia supergiant HR 1040 has been performed, including equivalent widths, radial velocities, and Strömgren photometric indices. The data, obtained from 1993 through 2007, include 152 spectroscopic observations from the Ritter Observatory 1 m telescope and 269 Strömgren photometric observations from the Four College Automated Photoelectric Telescope. Typical of late B- and early A-type supergiants, HR 1040 has a highly variable Hα profile. The star was found to have an intermittent active phase marked by correlation between the Hα absorption equivalent width and blue-edge radial velocity and by photospheric connections observed in correlations to equivalent width, second moment and radial velocity in Si ii λλ6347, 6371. High-velocity absorption (HVA) events were observed only during this active phase. HVA events in the wind were preceded by photospheric activity, including Si ii radial velocity oscillations 19–42 days prior to onset of an HVA event and correlated increases in Si ii W λ and second moment from 13 to 23 days before the start of the HVA event. While increases in various line equivalent widths in the wind prior to HVA events have been reported in the past in other stars, our finding of precursors in enhanced radial velocity variations in the wind and at the photosphere is a new result

  20. A search for magnetic fields in Lambda Bootis stars

    Bohlender, D.A.; Landstreet, J.D.


    We have searched a sample of λ Boo stars for magnetic fields similar to those observed in the magnetic Ap and Bp stars, using a Balmer-line Zeeman analyser. Apart from one dubious measurement, no fields are detected in our sample. It appears that magnetic fields of the λ Boo stars, if they exist, are significantly smaller than those found in magnetic upper main-sequence stars of similar spectral type; this conclusion is supported at about the 90 or 95 per cent confidence level by the present data. (author)

  1. Peptide-Based Membrane Fusion Inhibitors Targeting HCoV-229E Spike Protein HR1 and HR2 Domains

    Shuai Xia


    Full Text Available Human coronavirus 229E (HCoV-229E infection in infants, elderly people, and immunocompromised patients can cause severe disease, thus calling for the development of effective and safe therapeutics to treat it. Here we reported the design, synthesis and characterization of two peptide-based membrane fusion inhibitors targeting HCoV-229E spike protein heptad repeat 1 (HR1 and heptad repeat 2 (HR2 domains, 229E-HR1P and 229E-HR2P, respectively. We found that 229E-HR1P and 229E-HR2P could interact to form a stable six-helix bundle and inhibit HCoV-229E spike protein-mediated cell-cell fusion with IC50 of 5.7 and 0.3 µM, respectively. 229E-HR2P effectively inhibited pseudotyped and live HCoV-229E infection with IC50 of 0.5 and 1.7 µM, respectively. In a mouse model, 229E-HR2P administered intranasally could widely distribute in the upper and lower respiratory tracts and maintain its fusion-inhibitory activity. Therefore, 229E-HR2P is a promising candidate for further development as an antiviral agent for the treatment and prevention of HCoV-229E infection.

  2. Designing HR Organizational Structures in terms of the HR Business Partner Model Principles from the Perspective of Czech Organizations

    Marek Stříteský


    Full Text Available This paper describes new trends related to the concepts contained in HR organizational structures within Czech organizations. In addition, it describes the specifics of the roles played by HR in those organizations which have transformed their HR departments in terms of the principles of the HR Business Partner Model, both in theory based on available resources, and at the practical level based on the results of primary examination. The goal of this paper is to present the key perceptions of the changes made in the HR structure within the organizations, as well as the impact of these changes on the effectiveness of the HR departments concerned. Another goal of the paper is to summarize the responsibilities of the newly created position known as the HR Business Partner in these organizations as well as the demands placed upon the personnel employed in the HR Business Partner role. The paper offers conclusions based on the results of both quantitative and qualitative surveys. It also contains a case study of one organization which has one of the best transformed HR departments, and whose services are classified, by internal clients, as being of high quality.

  3. HR competencies at a merged Higher Education Institution

    Cecile M. Schultz


    Research purposes: The aim of this study was to determine the HR competencies at a merged higher education institution. Other objectives were to establish the satisfaction of academics, administrative staff and management regarding the HR competencies and the importance thereof. Motivation for the study: Human resource professionals require assistance by providing HR competencies necessary to add value at a merged higher education institution. Research designs, approaches and methods: A quantitative research design was employed as the research strategy. The questionnaire was based on the literature, the business plan and the HR balanced scorecard report. The target population was 1363 permanent staff on one campus and the response rate was 28%. A principal factor analysis, spider charts and box plots were utilised for data analysis. The results indicated business knowledge, HR practices, personal skills and management skills as the vital HR competencies. Practical implications: Staff were not satisfied with the current HR competencies and consequently this necessitated attention to improve the deficient areas. Contribution: This study shows that limited research was done with regard to HR competencies in the South African higher education backdrop.

  4. Managing (Sales)People towards Performance: HR Strategy, Leadership & Teamwork

    H.M.S. Dietz (Bart)


    textabstractManaging people towards performance is one of the most critical priorities for managers in practice. This dissertation focuses on this important issue and explores how HR Strategy, Leaders, and Teams, impact performance. It addresses respectively how HR as a system of coherent

  5. Value creation through HR shared services: towards a conceptual framework

    Meijerink, Jeroen Gerard; Bondarouk, Tatiana; Looise, Jan C.


    Purpose – The purpose of this paper is to derive a measure for the performance of human resource shared service providers (HR SSPs) and then to develop a theoretical framework that conceptualises their performance. Design/methodology/approach – This conceptual paper starts from the HR shared

  6. Outsourcing HR Services: The Role of Human Resource Intermediaries

    Kock, Henrik; Wallo, Andreas; Nilsson, Barbro; Hoglund, Cecilia


    Purpose: In this article, the area of interest is an emerging type of organisation called human resource intermediaries (HRIs), which focus on delivering human resource (HR) services to public sector organisations and private companies. The purpose of this article is, thus, to explore HRIs as deliverers of HR services. More specifically, the…

  7. Professional Development of HR Practitioners--A Phenomenographic Study

    Bailey, Moira


    Purpose: The purpose of this paper is an investigation into the experiences of professional development of human resource (HR) practitioners in the North of Scotland, and the use of non-formal learning in that development. Design/methodology/approach: In-depth semi-structured interviews from a purposively selected sample of HR practitioners were…

  8. African American Accounting Majors and the 150-hr Requirement

    Booker, Quinton; Hill, Cecil L.; Wright, Carl


    The study provides information on African American accounting majors' views regarding 150-hr issues. The authors collected data from 152 students at two schools. Students at one school supported the requirement while those at the other school did not. However, students believed that the 150-hr requirement enhances the quality of certified public…

  9. Symbiotic stars

    Kafatos, M.; Michalitsianos, A. G.


    The physical characteristics of symbiotic star systems are discussed, based on a review of recent observational data. A model of a symbiotic star system is presented which illustrates how a cool red-giant star is embedded in a nebula whose atoms are ionized by the energetic radiation from its hot compact companion. UV outbursts from symbiotic systems are explained by two principal models: an accretion-disk-outburst model which describes how material expelled from the tenuous envelope of the red giant forms an inwardly-spiralling disk around the hot companion, and a thermonuclear-outburst model in which the companion is specifically a white dwarf which superheats the material expelled from the red giant to the point where thermonuclear reactions occur and radiation is emitted. It is suspected that the evolutionary course of binary systems is predetermined by the initial mass and angular momentum of the gas cloud within which binary stars are born. Since red giants and Mira variables are thought to be stars with a mass of one or two solar mass, it is believed that the original cloud from which a symbiotic system is formed can consist of no more than a few solar masses of gas.

  10. BP180 dysfunction triggers spontaneous skin inflammation in mice.

    Zhang, Yang; Hwang, Bin-Jin; Liu, Zhen; Li, Ning; Lough, Kendall; Williams, Scott E; Chen, Jinbo; Burette, Susan W; Diaz, Luis A; Su, Maureen A; Xiao, Shengxiang; Liu, Zhi


    BP180, also known as collagen XVII, is a hemidesmosomal component and plays a key role in maintaining skin dermal/epidermal adhesion. Dysfunction of BP180, either through genetic mutations in junctional epidermolysis bullosa (JEB) or autoantibody insult in bullous pemphigoid (BP), leads to subepidermal blistering accompanied by skin inflammation. However, whether BP180 is involved in skin inflammation remains unknown. To address this question, we generated a BP180-dysfunctional mouse strain and found that mice lacking functional BP180 (termed Δ NC16A ) developed spontaneous skin inflammatory disease, characterized by severe itch, defective skin barrier, infiltrating immune cells, elevated serum IgE levels, and increased expression of thymic stromal lymphopoietin (TSLP). Severe itch is independent of adaptive immunity and histamine, but dependent on increased expression of TSLP by keratinocytes. In addition, a high TSLP expression is detected in BP patients. Our data provide direct evidence showing that BP180 regulates skin inflammation independently of adaptive immunity, and BP180 dysfunction leads to a TSLP-mediated itch. The newly developed mouse strain could be a model for elucidation of disease mechanisms and development of novel therapeutic strategies for skin inflammation and BP180-related skin conditions.

  11. Dark stars

    Maselli, Andrea; Pnigouras, Pantelis; Nielsen, Niklas Grønlund


    to the formation of compact objects predominantly made of dark matter. Considering both fermionic and bosonic (scalar φ4) equations of state, we construct the equilibrium structure of rotating dark stars, focusing on their bulk properties and comparing them with baryonic neutron stars. We also show that these dark......Theoretical models of self-interacting dark matter represent a promising answer to a series of open problems within the so-called collisionless cold dark matter paradigm. In case of asymmetric dark matter, self-interactions might facilitate gravitational collapse and potentially lead...... objects admit the I-Love-Q universal relations, which link their moments of inertia, tidal deformabilities, and quadrupole moments. Finally, we prove that stars built with a dark matter equation of state are not compact enough to mimic black holes in general relativity, thus making them distinguishable...

  12. Multivalent display of the antimicrobial peptides BP100 and BP143

    Imma Güell


    Full Text Available Carbohydrates are considered as promising templates for the display of multiple copies of antimicrobial peptides. Herein, we describe the design and synthesis of chimeric structures containing two or four copies of the antimicrobial peptides KKLFKKILKYL-NH2 (BP100 and KKLfKKILKYL-NH2 (BP143 attached to the carbohydrate template cyclodithioerythritol (cDTE or α-D-galactopyranoside (Galp. The synthesis involved the preparation of the corresponding peptide aldehyde followed by coupling to an aminooxy-functionalized carbohydrate template. After purification, the multivalent display systems were obtained in high purities (90–98% and in good yields (42–64%. These compounds were tested against plant and human pathogenic bacteria and screened for their cytotoxicity on eukaryotic cells. They showed lower MIC values than the parent peptides against the bacteria analyzed. In particular, the carbopeptides derived from cDTE and Galp, which contained two or four copies of BP100, respectively, were 2- to 8-fold more active than the monomeric peptide against the phytopathogenic bacteria. These results suggest that preassembling antimicrobial peptides to multimeric structures is not always associated with a significant improvement of the activity. In contrast, the carbopeptides synthesized were active against human red blood cells pointing out that peptide preassembly is critical for the hemolytic activity. Notably, peptide preassembly resulted in an enhanced bactericidal effect.


    Mooley, Kunal; Hillenbrand, Lynne; Rebull, Luisa; Padgett, Deborah; Knapp, Gillian


    We describe the results of a search for early-type stars associated with the Taurus-Auriga molecular cloud complex, a diffuse nearby star-forming region noted as lacking young stars of intermediate and high mass. We investigate several sets of possible O, B, and early A spectral class members. The first is a group of stars for which mid-infrared images show bright nebulae, all of which can be associated with stars of spectral-type B. The second group consists of early-type stars compiled from (1) literature listings in SIMBAD, (2) B stars with infrared excesses selected from the Spitzer Space Telescope survey of the Taurus cloud, (3) magnitude- and color-selected point sources from the Two Micron All Sky Survey, and (4) spectroscopically identified early-type stars from the Sloan Digital Sky Survey coverage of the Taurus region. We evaluated stars for membership in the Taurus-Auriga star formation region based on criteria involving: spectroscopic and parallactic distances, proper motions and radial velocities, and infrared excesses or line emission indicative of stellar youth. For selected objects, we also model the scattered and emitted radiation from reflection nebulosity and compare the results with the observed spectral energy distributions to further test the plausibility of physical association of the B stars with the Taurus cloud. This investigation newly identifies as probable Taurus members three B-type stars: HR 1445 (HD 28929), τ Tau (HD 29763), 72 Tau (HD 28149), and two A-type stars: HD 31305 and HD 26212, thus doubling the number of stars A5 or earlier associated with the Taurus clouds. Several additional early-type sources including HD 29659 and HD 283815 meet some, but not all, of the membership criteria and therefore are plausible, though not secure, members.

  14. Face recognition based on improved BP neural network

    Yue Gaili


    Full Text Available In order to improve the recognition rate of face recognition, face recognition algorithm based on histogram equalization, PCA and BP neural network is proposed. First, the face image is preprocessed by histogram equalization. Then, the classical PCA algorithm is used to extract the features of the histogram equalization image, and extract the principal component of the image. And then train the BP neural network using the trained training samples. This improved BP neural network weight adjustment method is used to train the network because the conventional BP algorithm has the disadvantages of slow convergence, easy to fall into local minima and training process. Finally, the BP neural network with the test sample input is trained to classify and identify the face images, and the recognition rate is obtained. Through the use of ORL database face image simulation experiment, the analysis results show that the improved BP neural network face recognition method can effectively improve the recognition rate of face recognition.

  15. Symbiotic star AG Dra

    Ipatov, A.P.; Yudin, B.F.; Moskovskij Gosudarstvennyj Univ.


    The results obtained from photometric (in the UBVRJHKLM system) and spectrophotometric (in the range 0.33-0.75 μm) observations of symbiotic star AG Dra are presented. The cool component of this star is a red giant with approximately constant brightness (ΔJ ≤ 0 m .3) classified as K4-K5. This red giant fills it's Roche loble and probably is on the assymptotic giant branch of the HR diagramm. The presence of IR excess in 5 μm associated with radiation of the gaseous envelope with the mass of M≅ 10 -6 M sun have been detected. Observations of AG Dra indicate that growing of the bolometric flux of a hot component is accompanied with decreasing effective temperature. The hot component of the system is probably an accerting red dwarf with the mass M≅ 0.4 M sun and disk accretion of matter of cool star with the rate M >or ∼ 10 -4 M sun year in equatorial region. Increase of accretion rate during the outburst of AG Dra leads to the increase of stellar wind from the red dwarf surface and the decrease of it's effective temperature. The hot component of AG Dra may also be considered as a white Dwarf with luminosity L 3 L sun and R eff >or approx. 0.2 R sun . In this case gravitational energy of accreting matter M > or ∼ 10 -6 M sun / year would be the source of the hot component outbursts. The luminosity between outbursts is determined by energy generation from the burning hydrogen layer source

  16. Congenital Arthrogryposis: An Extension of the 15q11.2 BP1-BP2 Microdeletion Syndrome?

    K. M. Usrey


    Full Text Available The proximal 15q11–q13 region contains 5 breakpoints (BP1–BP5. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes. The genes in this region are known to play a role in central nervous system development and/or function. Microdeletions within the 15q11.2 BP1-BP2 region have been reported in patients with neurological dysfunction, developmental delays, behavioral problems, and dysmorphic features. We report two unrelated subjects with the 15q11.2 BP1-BP2 microdeletion and presenting with congenital arthrogryposis, a feature which has not been previously reported as part of this newly recognized microdeletion syndrome. While arthrogryposis seen in these two subjects may be coincidental, we propose that congenital arthrogryposis may result from neurological dysfunction and involvement of the microdeletion of the 15q11.2 BP1-BP2 region, further expanding the phenotype of this microdeletion syndrome. We encourage others to report patients with this chromosome microdeletion and neurological findings to further characterize the clinical phenotype.

  17. Hybrid stars

    Hybrid stars. AsHOK GOYAL. Department of Physics and Astrophysics, University of Delhi, Delhi 110 007, India. Abstract. Recently there have been important developments in the determination of neutron ... number and the electric charge. ... available to the system to rearrange concentration of charges for a given fraction of.

  18. Pulsating stars

    Catelan, M?rcio


    The most recent and comprehensive book on pulsating stars which ties the observations to our present understanding of stellar pulsation and evolution theory.  Written by experienced researchers and authors in the field, this book includes the latest observational results and is valuable reading for astronomers, graduate students, nuclear physicists and high energy physicists.

  19. Variable stars

    Feast, M.W.; Wenzel, W.; Fernie, J.D.; Percy, J.R.; Smak, J.; Gascoigne, S.C.B.; Grindley, J.E.; Lovell, B.; Sawyer Hogg, H.B.; Baker, N.; Fitch, W.S.; Rosino, L.; Gursky, H.


    A critical review of variable stars is presented. A fairly complete summary of major developments and discoveries during the period 1973-1975 is given. The broad developments and new trends are outlined. Essential problems for future research are identified. (B.R.H. )

  20. AcEST: BP912612 [AcEST

    Full Text Available YMU001_000020_H07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H07. BP912612 - Show BP912612... Clone id YMU001_000020_H07 Library YMU01 Length 512 Definition Adiantum mRNA. clone: YMU001_000020_H07. Accession BP912612 Tissue type prothallium Developmental stage - Contig search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912612|Adiantum cap...illus-veneris mRNA, clone: YMU001_000020_H07. (512 letters) Database: uniprot_sprot.fasta 412,525 sequences;

  1. AcEST: BP912712 [AcEST

    Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI

  2. AcEST: BP912126 [AcEST

    Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa

  3. AcEST: BP912212 [AcEST

    Full Text Available YMU001_000016_D11 457 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D11. BP912212... CL1085Contig1 Show BP912212 Clone id YMU001_000016_D11 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D11. Accession BP912212 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912212...|Adiantum capillus-veneris mRNA, clone: YMU001_000016_D11. (457 letters) Database: uniprot_sprot.fasta 412

  4. AcEST: BP912312 [AcEST

    Full Text Available YMU001_000017_F01 489 Adiantum capillus-veneris mRNA. clone: YMU001_000017_F01. BP912312... CL1779Contig1 Show BP912312 Clone id YMU001_000017_F01 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000017_F01. Accession BP912312 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912312...|Adiantum capillus-veneris mRNA, clone: YMU001_000017_F01. (489 letters) Database: uniprot_sprot.fasta 412

  5. AcEST: BP912128 [AcEST

    Full Text Available YMU001_000015_D10 477 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D10. BP91212...8 CL2328Contig1 Show BP912128 Clone id YMU001_000015_D10 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D10. Accession BP912128 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...8|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D10. (461 letters) Database: uniprot_sprot.fasta 412

  6. AcEST: BP912012 [AcEST

    Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP912012... CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...mRNA, clone: YMU001_000012_A06. (542 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 t

  7. AcEST: BP912123 [AcEST

    Full Text Available YMU001_000015_D05 496 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D05. BP91212...3 CL498Contig1 Show BP912123 Clone id YMU001_000015_D05 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D05. Accession BP912123 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...3|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D05. (478 letters) Database: uniprot_sprot.fasta 412

  8. AcEST: BP912912 [AcEST

    Full Text Available YMU001_000024_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000024_C05. BP912912... CL1433Contig1 Show BP912912 Clone id YMU001_000024_C05 Library YMU01 Length 413 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000024_C05. Accession BP912912 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912912|Adiantum capillus-ven...eris mRNA, clone: YMU001_000024_C05. (413 letters) Database: uniprot_sprot.fasta 412

  9. AcEST: BP919999 [AcEST

    Full Text Available YMU001_000131_G09 554 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G09. BP919999... CL2968Contig1 Show BP919999 Clone id YMU001_000131_G09 Library YMU01 Length 554 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_G09. Accession BP919999 Tissue type prothallium Developmental stag...b Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generatio...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919999|Adiantum capillus-ve

  10. AcEST: BP913636 [AcEST

    Full Text Available YMU001_000032_E04 520 Adiantum capillus-veneris mRNA. clone: YMU001_000032_E04. BP913636... CL2643Contig1 Show BP913636 Clone id YMU001_000032_E04 Library YMU01 Length 520 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000032_E04. Accession BP913636 Tissue type prothallium Developmental stag...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP913636|Adiantum capillus-veneris mRNA, clone: YMU001_00003...tative phospholipid-transporting ATPase ... 149 8e-36 sp|Q9LNQ4|ALA4_ARATH Putati

  11. AcEST: BP920997 [AcEST

    Full Text Available YMU001_000144_D02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D02. BP92099...7 CL10Contig1 Show BP920997 Clone id YMU001_000144_D02 Library YMU01 Length 534 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_D02. Accession BP920997 Tissue type prothallium Developmental stage ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920997|Adian...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2

  12. AcEST: BP917373 [AcEST

    Full Text Available YMU001_000100_A08 270 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A08. BP917373 CL2373...Contig1 Show BP917373 Clone id YMU001_000100_A08 Library YMU01 Length 270 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_A08. Accession BP917373 Tissue type prothallium Developmental stage - Contig ID programs, Nucleic Acids Res. 25:3389-3402. Query= BP917373|Adiantum capillus-veneris mRNA, clone: YMU...EGAVKHVGVLSS 206 K+ GC+S G SRHGES V KE H SS Sbjct: 473 KKEKGCSSPGSSRHGESHKGVSHTPI

  13. How to unveil a T Tauri star

    Hartigan, P.; Hartmann, L.; Kenyon, S.; Hewett, R.; Stauffer, J.


    A method for separating the 'veiling' continuum often present in T Tauri stars from the underlying photospheric spectrum is described. Echelle observations from 5100 to 6800 A of the partially veiled T Tauri star BP Tau were analyzed to determine the shape of the veiling spectrum. The residuals of the fit indicate the deviation of the veiling spectrum from a simple continuum and identify the location and strength of any emission-line components. It is shown, by means of goodness-of-fit tests, that the spectrum of BP Tau can be decomposed into a normal stellar spectrum plus a smooth veiling continuum with only a few emission lines superposed. The continuum dominates the veiling spectrum in this spectral region; the veiling does not arise from numerous deep photospheric absorption lines that are filled in by weak emission. 36 refs

  14. Star Products and Applications

    Iida, Mari; Yoshioka, Akira


    Star products parametrized by complex matrices are defined. Especially commutative associative star products are treated, and star exponentials with respect to these star products are considered. Jacobi's theta functions are given as infinite sums of star exponentials. As application, several concrete identities are obtained by properties of the star exponentials.

  15. Heavy Metal Stars


    the interstellar medium and was present in the cloud of dust and gas from which the Solar System and hence our Earth was formed. More information The research described in this Press Release is reported in a scientific article ("Discovery of three Lead stars" by S. Van Eck, S. Goriely, A. Jorissen and B. Plez) that appears in the August 23, 2001 issue of the science journal "Nature". Notes [1]: The team consists of Sophie Van Eck , Stéphane Goriely , Alain Jorissen (all Institut d'Astronomie et d'Astrophysique de l'Université Libre de Bruxelles, Belgium) and Bertrand Plez (Groupe de Recherche en Astronomie et Astrophysique en Languedoc, Université de Montpellier II - GRAAL), France). Sophie Van Eck was an ESO fellow (1999-2000). [2] The "atomic mass" of a chemical element is the total mass of the positively charged protons and neutral neutrons in the atomic nucleus. The "atomic number" of a chemical element is equal to the number of protons in the nucleus. Different isotopes of a chemical element all have the same number of protons in the nuclei, but a different number of neutrons. For the principal (most abundant) isotopes of the elements mentioned in this text, the "atomic mass" (expressed in "atomic mass units" (amu)) is approximately: Hydrogen : 1 atomic mass unit (with 1 proton in the nucleus); Helium : 4 atomic mass units (2 protons + 2 neutrons); Lithium : 7 atomic mass units (3 protons + 4 neutrons); Carbon : 12 atomic mass units (6 protons + 6 neutrons); Oxygen : 16 atomic mass units (8 protons + 8 neutrons); Iron : 56 atomic mass units (26 protons + 30 neutrons); Zirconium : 90 atomic mass units (40 protons + 50 neutrons); Barium : 138 atomic mass units (56 protons + 82 neutrons); Tungsten : 184 atomic mass units (74 protons + 110 neutrons); Lead : 208 atomic mass units (82 protons + 126 neutrons); Bismuth : 209 atomic mass units (83 protons + 126 neutrons) [3] "AGB" stands for "Asymptotic Giant Branch"; a location in the HR-diagramme (a plot of stellar

  16. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    Gago-Ferrero, Pablo, E-mail: [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Badia-Fabregat, Marina, E-mail: [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Olivares, Alba, E-mail: [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Pina, Benjamin, E-mail: [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Blanquez, Paqui, E-mail: [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Vicent, Teresa, E-mail: [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Caminal, Gloria, E-mail: [Unitat de Biocatalisi Aplicada associada al IQAC (CSIC-UAB). Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Diaz-Cruz, M. Silvia, E-mail: [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); and others


    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: Black-Right-Pointing-Pointer Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. Black-Right-Pointing-Pointer BP3 is not degraded under simulated sunlight. Black-Right-Pointing-Pointer Glycoconjugates have been identified as the main intermediate metabolites. Black-Right-Pointing-Pointer Decrease in endocrine activity

  17. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    Gago-Ferrero, Pablo; Badia-Fabregat, Marina; Olivares, Alba; Piña, Benjamin; Blánquez, Paqui; Vicent, Teresa; Caminal, Gloria; Díaz-Cruz, M. Silvia


    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: ► Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. ► BP3 is not degraded under simulated sunlight. ► Glycoconjugates have been identified as the main intermediate metabolites. ► Decrease in endocrine activity was found in both photodegradation and biodegradation.

  18. Employee Work-Life Balance as an HR Imperative | Igbinomwanhia ...

    Employee Work-Life Balance as an HR Imperative. ... With the growing diversity of family structures represented in today‟s workforce, ... of managing an employee's work-life balance have increased markedly over the past 20 years.

  19. HR practices for enhancing sustainable employability : implementation, use, and outcomes

    Ybema, Jan Fekke; van Vuuren, Tinka; van Dam, Karen


    With the aging of the workforce, organizations need to maintain or improve the sustainable employability of their workforce throughout their working life. This raises the question which HR practices increase workers’ sustainable employability at work. The aim of this study is to investigate the extent to which organizations implement HR practices for enhancing sustainable employability in terms of workers’ health, motivation, and skills and knowledge from the employer’s perspective. In total,...

  20. A cell cycle-dependent regulatory circuit composed of 53BP1-RIF1 and BRCA1-CtIP controls DNA repair pathway choice.

    Escribano-Díaz, Cristina; Orthwein, Alexandre; Fradet-Turcotte, Amélie; Xing, Mengtan; Young, Jordan T F; Tkáč, Ján; Cook, Michael A; Rosebrock, Adam P; Munro, Meagan; Canny, Marella D; Xu, Dongyi; Durocher, Daniel


    DNA double-strand break (DSB) repair pathway choice is governed by the opposing activities of 53BP1 and BRCA1. 53BP1 stimulates nonhomologous end joining (NHEJ), whereas BRCA1 promotes end resection and homologous recombination (HR). Here we show that 53BP1 is an inhibitor of BRCA1 accumulation at DSB sites, specifically in the G1 phase of the cell cycle. ATM-dependent phosphorylation of 53BP1 physically recruits RIF1 to DSB sites, and we identify RIF1 as the critical effector of 53BP1 during DSB repair. Remarkably, RIF1 accumulation at DSB sites is strongly antagonized by BRCA1 and its interacting partner CtIP. Lastly, we show that depletion of RIF1 is able to restore end resection and RAD51 loading in BRCA1-depleted cells. This work therefore identifies a cell cycle-regulated circuit, underpinned by RIF1 and BRCA1, that governs DSB repair pathway choice to ensure that NHEJ dominates in G1 and HR is favored from S phase onward. Copyright © 2013 Elsevier Inc. All rights reserved.

  1. Wave Star

    Kramer, Morten; Frigaard, Peter; Brorsen, Michael

    Nærværende rapport beskriver foreløbige hovedkonklusioner på modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star i perioden 13/9 2004 til 12/11 2004.......Nærværende rapport beskriver foreløbige hovedkonklusioner på modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star i perioden 13/9 2004 til 12/11 2004....

  2. AcEST: BP914065 [AcEST

    Full Text Available YMU001_000039_E01 548 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E01. BP91406...5 CL604Contig1 Show BP914065 Clone id YMU001_000039_E01 Library YMU01 Length 548 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_E01. Accession BP914065 Tissue type prothallium Developmental stage...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU0...cids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU001_000039_E01. (548 lette

  3. AcEST: BP914069 [AcEST

    Full Text Available YMU001_000039_E05 368 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E05. BP91406...9 CL2761Contig1 Show BP914069 Clone id YMU001_000039_E05 Library YMU01 Length 368 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_E05. Accession BP914069 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001_0000...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001

  4. AcEST: BP914060 [AcEST

    Full Text Available YMU001_000039_D08 539 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D08. BP91406...0 CL1835Contig1 Show BP914060 Clone id YMU001_000039_D08 Library YMU01 Length 539 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D08. Accession BP914060 Tissue type prothallium Developmental stag...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris ...Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris mRNA, clone: YMU001_000039_D08. (539 lett

  5. AcEST: BP920146 [AcEST

    Full Text Available YMU001_000133_E12 401 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E12. BP92014...6 CL388Contig1 Show BP920146 Clone id YMU001_000133_E12 Library YMU01 Length 401 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_E12. Accession BP920146 Tissue type prothallium Developmental stage...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum ca...rams, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum capillus-veneris mRNA, clone: YMU001_000133_

  6. AcEST: BP920149 [AcEST

    Full Text Available YMU001_000133_F03 624 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F03. BP92014...9 CL2860Contig1 Show BP920149 Clone id YMU001_000133_F03 Library YMU01 Length 624 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F03. Accession BP920149 Tissue type prothallium Developmental stag...ic Acids Res. 25:3389-3402. Query= BP920149|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F03. (624 l...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  7. Around and beyond 53BP1 Nuclear Bodies.

    Fernandez-Vidal, Anne; Vignard, Julien; Mirey, Gladys


    Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs) are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1), a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.

  8. AcEST: BP920994 [AcEST

    Full Text Available YMU001_000144_C10 322 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C10. BP92099...4 CL2871Contig1 Show BP920994 Clone id YMU001_000144_C10 Library YMU01 Length 322 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C10. Accession BP920994 Tissue type prothallium Developmental stag...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

  9. AcEST: BP920990 [AcEST

    Full Text Available YMU001_000144_C03 445 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C03. BP92099...0 CL4123Contig1 Show BP920990 Clone id YMU001_000144_C03 Library YMU01 Length 445 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C03. Accession BP920990 Tissue type prothallium Developmental stag...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9209...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

  10. AcEST: BP920999 [AcEST

    Full Text Available YMU001_000144_D04 588 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D04. BP92099...9 CL317Contig1 Show BP920999 Clone id YMU001_000144_D04 Library YMU01 Length 588 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D04. Accession BP920999 Tissue type prothallium Developmental stage...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

  11. AcEST: BP920993 [AcEST

    Full Text Available YMU001_000144_C06 517 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C06. BP92099...3 CL547Contig1 Show BP920993 Clone id YMU001_000144_C06 Library YMU01 Length 517 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_C06. Accession BP920993 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum capillus-veneris mRNA, clone: YMU001_0001...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum

  12. AcEST: BP920991 [AcEST

    Full Text Available YMU001_000144_C04 521 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C04. BP92099...1 CL3173Contig1 Show BP920991 Clone id YMU001_000144_C04 Library YMU01 Length 521 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C04. Accession BP920991 Tissue type prothallium Developmental stag...s. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (521 letters) Dat...ucleic Acids Res. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (5

  13. AcEST: BP920992 [AcEST

    Full Text Available YMU001_000144_C05 525 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C05. BP92099...2 CL2523Contig1 Show BP920992 Clone id YMU001_000144_C05 Library YMU01 Length 525 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C05. Accession BP920992 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C05. (525 lett...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_00014

  14. Around and beyond 53BP1 Nuclear Bodies

    Anne Fernandez-Vidal


    Full Text Available Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1, a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.

  15. AcEST: BP919801 [AcEST

    Full Text Available YMU001_000129_C11 513 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C11. BP919801... CL1Contig3 Show BP919801 Clone id YMU001_000129_C11 Library YMU01 Length 513 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000129_C11. Accession BP919801 Tissue type prothallium Developmental stage 25:3389-3402. Query= BP919801|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C11. (435 letters) Da...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919801|Adiantum capil

  16. AcEST: BP918016 [AcEST

    Full Text Available YMU001_000108_F04 434 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F04. BP91801...6 CL3779Contig1 Show BP918016 Clone id YMU001_000108_F04 Library YMU01 Length 434 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000108_F04. Accession BP918016 Tissue type prothallium Developmental stag..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...ic Acids Res. 25:3389-3402. Query= BP918016|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F04. (434 l

  17. AcEST: BP914801 [AcEST

    Full Text Available YMU001_000063_A07 396 Adiantum capillus-veneris mRNA. clone: YMU001_000063_A07. BP914801... CL1121Contig1 Show BP914801 Clone id YMU001_000063_A07 Library YMU01 Length 396 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000063_A07. Accession BP914801 Tissue type prothallium Developmental stag...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801|Adiantum capillus-veneris mRNA, clone:

  18. Expanding the BP1-BP2 15q11.2 Microdeletion Phenotype: Tracheoesophageal Fistula and Congenital Cataracts

    D. Wong


    Full Text Available The proximal q arm of chromosome 15 contains breakpoint regions BP1–BP5 with the classic deletion of BP1–BP3 best known to be associated with Prader-Willi and Angelman syndromes. The region is approximately 500 kb and microdeletions within the BP1-BP2 region have been reported in patients with developmental delay, behavioral abnormalities, and motor apraxia as well as dysmorphic features including hypertelorism, cleft or narrow palate, ear abnormalities, and recurrent upper airway infections. We report two patients with unique, never-before-reported 15q11.2 BP1-2 microdeletion syndrome findings, one with proximal esophageal atresia and distal tracheoesophageal fistula (type C and one with congenital cataracts. Cataracts have been described in Prader-Willi syndrome but we could not find any description of cataracts in Angelman syndrome. Esophageal atresia and tracheoesophageal fistula have not been reported to our knowledge in either syndrome. A chance exists that both cases are sporadic birth defects; however, the findings of the concomitant microdeletion cannot be overlooked as a possible cause. Based on our review of the literature and the presentation of our patients, we recommend that esophageal atresia and distal tracheoesophageal fistula as well as congenital cataracts be included in the phenotypic spectrum of 15q11.2 BP1-2 microdeletion syndrome.

  19. The evolution of the Cepheid stars

    Chiosi, C.


    The evolution of intermediate and high mass stars is reviewed focusing on the interpretation of Pop I Cepheids. First, a summary is given of the classical results of stellar evolution theory for the main evolutionary phases (main sequence and core He-burning) all over the HR diagram, putting into evidence the various points of disagreement with current observational data. Second, models incorporating the effect of convective overshoot, are reviewed, and studies are presented on the rich, young clusters in the Large Magellanic Cloud, in which the models are compared with the observational data. Arguments are given to favor the adoption of models with convective overshoot instead of the classical ones. Third, new results are presented for pulsational models of the Cepheid stars, and the shape of the instability strip in the HR diagram, the number frequency-period distribution, and the mass discrepancy are discussed. 81 refs

  20. Massive stars with mass loss: Evolution, nucleosynthesis, and astrophysical implications

    Prantzos, N.


    Evolution and nucleosynthesis of mass loss WR stars is studied, particularly evolution of stars with initial mass between 50 and 100 solar masses, during combustion of H and He. A semi-empirical mass loss formalism, the Roxburgh criterion for convection, and nuclear data are used. Composition of the stellar surface and ejecta (and ejecta contribution to cosmic ray composition) are derived. The contribution of these stars to s elements in our solar system is shown. Their production of 26 Al is compared to the quantity in the galaxy. Gamma ray emission at 1.8 MeV from the decay of this radionuclide is estimated in galactic longitude. The stars evolve as 0 and 0f stars during H combustion and spend 20% of their He combustion period as WN stars and 80% as WC-W0. Evolution always occurs in the blue part of the HR diagram, and satisfies observational constraints on its upper part [fr

  1. News from HR: a word from Anne-Sylvie Catherin


    Anne-Sylvie Catherin, head of HR Department, looks back over her years at CERN before taking up her new position at the European Central Bank.   At the end of July, I will be leaving CERN on a special leave of absence to take up a new position at the European Central Bank. This is a new chapter in my career, in a new context with its own challenges, and as I prepare for it, I would like to take a little time to look back over my years at CERN and share with you the enriching journey it has been, both for myself and for HR. It has always been my strong belief that any organisation’s greatest asset is its people. When an HR professional believes that, it’s only a short step to the conclusion that the best way to nurture those people is by adopting a professional approach to HR. In this respect, I arrived at a very fortuitous time. Enrico Chiaveri was head of HR and, although his background is in physics, we shared that same conviction. Enrico was the icebreaker in driving change, a...

  2. The Link between HR Attributions and Employees’ Turnover Intentions

    Juliana Caesaria Tandung


    Full Text Available Human Resources Management (HRM is part of the organizational functions that contribute to the effectiveness of a firm’s performance, and brings an organization a competitive advantage through the implementation of its Human Resources (HR practices. HR practices adopted by management are perceived or attributed subjectively by individual employees, and can in turn affect the employees’ attitudes and behavior (e.g. Job satisfaction and turnover intention. The purpose of this study is to contribute to the process-based approach by investigating the effect of HR attributions on turnover intentions, with job satisfaction playing a mediating role. The analysis is on the individual level, with 454 respondents from various organizations within the Netherlands. The results show that HR attributions can affect the turnover intention, through the presence of job satisfaction. Thus, it can be said that it is important to always consider the employees’ attitudes and behavior when examining their perception of HR practices, and in predicting their intention to leave.

  3. Tunneling in BP-MoS2 heterostructure

    Liu, Xiaochi; Qu, Deshun; Kim, Changsik; Ahmed, Faisal; Yoo, Won Jong

    Tunnel field effect transistor (TFET) is considered to be a leading option for achieving SS mV/dec. In this work, black phosphorus (BP) and molybdenum disulfide (MoS2) heterojunction devices are fabricated. We find that thin BP flake and MoS2 form normal p-n junctions, tunneling phenomena can be observed when BP thickness increases to certain level. PEO:CsClO4 is applied on the surface of the device together with a side gate electrode patterned together with source and drain electrodes. The Fermi level of MoS2 on top of BP layer can be modulated by the side gating, and this enables to vary the MoS2-BP tunnel diode property from off-state to on-state. Since tunneling is the working mechanism of MoS2-BP junction, and PEO:CsClO4\\ possesses ultra high dielectric constant and small equivalent oxide thickness (EOT), a low SS of 55 mV/dec is obtained from MoS2-BP TFET. This work was supported by the Global Research Laboratory and Global Frontier R&D Programs at the Center for Hybrid Interface Materials, both funded by the Ministry of Science, ICT & Future Planning via the National Research Foundation of Korea (NRF).

  4. New spectro-photometric characterization of the substellar object HR 2562 B using SPHERE

    Mesa, D.; Baudino, J.-L.; Charnay, B.; D'Orazi, V.; Desidera, S.; Boccaletti, A.; Gratton, R.; Bonnefoy, M.; Delorme, P.; Langlois, M.; Vigan, A.; Zurlo, A.; Maire, A.-L.; Janson, M.; Antichi, J.; Baruffolo, A.; Bruno, P.; Cascone, E.; Chauvin, G.; Claudi, R. U.; De Caprio, V.; Fantinel, D.; Farisato, G.; Feldt, M.; Giro, E.; Hagelberg, J.; Incorvaia, S.; Lagadec, E.; Lagrange, A.-M.; Lazzoni, C.; Lessio, L.; Salasnich, B.; Scuderi, S.; Sissa, E.; Turatto, M.


    Aims: HR 2562 is an F5V star located at 33 pc from the Sun hosting a substellar companion that was discovered using the Gemini planet imager (GPI) instrument. The main objective of the present paper is to provide an extensive characterization of the substellar companion, by deriving its fundamental properties. Methods: We observed HR 2562 with the near-infrared branch composed by the integral field spectrograph (IFS) and the infrared dual band spectrograph (IRDIS) of the spectro-polarimetric high-contrast exoplanet research (SPHERE) instrument at the very large telescope (VLT). During our observations IFS was operating in the Y J band, while IRDIS was observing with the H broadband filter. The data were reduced with the dedicated SPHERE GTO pipeline, which is custom designed for this instrument. On the reduced images, we then applied the post-processing procedures that are specifically prepared to subtract the speckle noise. Results: The companion is clearly detected in both IRDIS and IFS datasets. We obtained photometry in three different spectral bands. The comparison with template spectra allowed us to derive a spectral type of T2-T3 for the companion. Using both evolutionary and atmospheric models we inferred the main physical parameters of the companion obtaining a mass of 32 ± 14 MJup, Teff = 1100 ± 200 K, and log g = 4.75 ± 0.41. Based on observations made with European Southern Observatory (ESO) telescopes at Paranal Observatory in Chile, under program ID 198.C-0209(D).

  5. Absence of young white dwarf companions to five technetium stars

    Smith, V.V.; Lambert, D.L.


    A search for hot companions to five stars of type MS and S has been carried out using the IUE satellite. No hot companions were detected for the MS stars HR 85, 4647, 6702, and 8062, and the S star HR 8714. Limits on the luminosities of possible white dwarf companions provide lower limits of 2-5x10 to the 8th yr to the ages of any degenerate companions. All five stars exhibit strong Tc I lines, and the presence of technetium, with a half-life of 2.1x10 to the 5th yr, signifies recent nucleosynthesis. The limits on the ages of possible white dwarf companions that are equal to or greater than 1000 half-lives of Tc exclude the possibility that the s-process elemental enhancement seen in these MS and S stars resulted from mass transfer from a more highly evolved companion (as is probably the mechanism by which barium stars are created). These MS and S stars represent a sample of true thermally pulsing asymptotic giant-branch stars. 41 references.

  6. The Factors of Forming the National HR-Management Model

    Elena P. Kostenko


    Full Text Available There are some factors considered in this article, which influence the forming of national HR-management model. The group-forming criterion is the nature of factors, that determine the system of HR-management as a system of corporate culture values, norms and rules of organizational behavior, ways of realization some important managing functions and dominating approaches to make decisions. This article shows that the plurality of combinations in different factors leads to forming the unique HR-management model. The geoclimatic factor influences the principles of the labor organization (orientation primarily on individual or collective forms of labor, attitude to the management experience of other countries, attitude to resources, etc., the distribution of labor resources, the level of labor mobility, and the psychosocial type of employee. Models of man's labor behavior are constituted In the process of historical development. Attention is focused on the formation of a national HR-model, such as the conducted socio-economic policy, the characteristics of the institutional environment, economic goals and priorities of the country's development, the level of development and the nature of the national productive forces and economic structures. Much attention was paid to the analysis of the historically formed value system and labor traditions, which influence the approaches to HR-management. As far as religion influences the model of person’s inclusion in labor, motives of labor behavior, management culture of a certain employee, preferred payment etc., we examined how the main traditional religions (Christianity, Islam, Judaism, Buddhism, Confucianism, Hinduism influence the HR-management system in different countries.

  7. Elemental abundance analyses with DAO spectrograms: XXXII. HR 6455 (A3 III), δ Aqr (A3 V), η Lep (F2 V), and 1 Boo (A1 V)

    Yüce, K.; Adelman, S. J.; Gulliver, A. F.; Hill, G.


    We examine the sharp-lined stars HR 6455 (A3 III, v sin i = 8.7 km s-1) and η Lep (F2 V, v sin i = 13.5 km s-1) as well as δ Aqr (A3 V, v sin i = 81 km s-1) and 1 Boo (A1 V, v sin i = 59 km s-1) to increase the number consistently analyzed A and F stars using high dispersion and high S/N (≥200) spectrograms obtained with CCD detectors at the long Coudé camera of the 1.22-m telescope of the Dominion Astrophysical Observatory. Such studies contribute to understanding systematic abundance differences between normal and non-magnetic main-sequence band chemically peculiar A and early F stars. LTE fine analyses of HR 6455, δ Aqr, and 1 Boo using Kurucz's ATLAS suite programs show the same general elemental abundance trends with differences in the metal richness. Light and iron-peak element abundances are generally solar or overabundant while heavy element and rare earth element abundances are overabundant. HR 6455 is an evolved Am star while δ Aqr and 1 Boo show the phenomenon to different extents. Most derived abundances of η Lep are solar. Table 3 is available at the CDS via

  8. Esprit HR mattress cover in pressure ulcer prevention.

    Khoulowa, J

    Modern mattresses provide soft dense foam, which permits the redistribution of pressure on the patient over a wider area - away from bony prominences where pressure ulcers usually occur. The material used in producing multistretch covers for the new mattresses had a tendency to delaminate as a result of a combination of heat, moisture and inappropriate cleansing techniques causing the water barriers to fall. In partnership with York Health NHS Trust and the material manufacturer, STM Healthcare produced a mattress cover (Esprit HR) which was able to withstand higher pressure from heat and moisture and greatly extended the life expectancy of the Esprit HR mattress.

  9. Radioactive waste legislation. Hearings before the Subcommittee on Energy and the Environment of the Committee on Interior and Insular Affairs, House of Representatives, Ninety-Seventh Congress, First Session on H.R. 1993; H.R. 2800; H.R. 2840; H.R. 2881; H.R. 3809, June 23 and 25; July 9, 1981



    This three-day hearing was held to consider five bills on radioactive waste, set priorities for a repository construction program, consider an administration proposal to develop a small-scale test facility for deep permanent storage of high-level wastes, and determine what role the public and private sectors should assume. The hearing record includes the text of H.R. 1993, H.R. 2800, H.R. 2840, H.R. 2881, and H.R. 3809; the statements of 10 witnesses and two panels; and three appendices with additional material submitted for the record

  10. AcEST: BP912124 [AcEST

    Full Text Available YMU001_000015_D06 531 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D06. BP91212...4 CL2988Contig1 Show BP912124 Clone id YMU001_000015_D06 Library YMU01 Length 531 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D06. Accession BP912124 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912124|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D06. (531 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total

  11. AcEST: BP912125 [AcEST

    Full Text Available YMU001_000015_D07 558 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D07. BP912125 - Show mRNA. clone: YMU001_000015_D07. Accession BP912125 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912125|Adiantum capillus-veneris mRN...A, clone: YMU001_000015_D07. (558 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...copeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12

  12. AcEST: BP912120 [AcEST

    Full Text Available YMU001_000015_D01 500 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D01. BP912120 - Show mRNA. clone: YMU001_000015_D01. Accession BP912120 Tissue type prothallium Developmental stage - Contig I...elated Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum Align length 130 Score (bit) 124.0 E-va...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...0|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D01. (500 letters) Database: uniprot_sprot.fasta 412

  13. AcEST: BP921212 [AcEST

    Full Text Available YMU001_000147_A09 361 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A09. BP921212 - Show mRNA. clone: YMU001_000147_A09. Accession BP921212 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921212|Adiantum capillus-veneris... mRNA, clone: YMU001_000147_A09. (361 letters) Database: uniprot_sprot.fasta 412,...itol-4,5-bisphosphate 3-ki... 30 2.9 sp|O14338|YB33_SCHPO Uncharacterized serine-rich protein C2F12.0... 29

  14. AcEST: BP912812 [AcEST

    Full Text Available YMU001_000023_B07 575 Adiantum capillus-veneris mRNA. clone: YMU001_000023_B07. BP912812... CL2610Contig1 Show BP912812 Clone id YMU001_000023_B07 Library YMU01 Length 575 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000023_B07. Accession BP912812 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912812| capillus-veneris mRNA, clone: YMU001_000023_B07. (575 letters) Database: uniprot_sprot.fasta 412,525 sequ

  15. AcEST: BP912122 [AcEST

    Full Text Available YMU001_000015_D04 544 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D04. BP91212...2 CL3363Contig1 Show BP912122 Clone id YMU001_000015_D04 Library YMU01 Length 544 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D04. Accession BP912122 Tissue type prothallium Developmental stag...obium aromaticivorans (strain DSM 12444) Align length 58 Score (bit) 33.1 E-value 0.89 Report BLASTX 2.2.19 ...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912122|Adiantum

  16. AcEST: BP912127 [AcEST

    Full Text Available YMU001_000015_D09 582 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D09. BP912127 - Show mRNA. clone: YMU001_000015_D09. Accession BP912127 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912127|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D09. (582 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total ...p|P42825|DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis th... 79 2e-14 sp|Q09912|PSI1_SCHPO Protein psi

  17. AcEST: BP912112 [AcEST

    Full Text Available YMU001_000015_C08 546 Adiantum capillus-veneris mRNA. clone: YMU001_000015_C08. BP912112 - Show mRNA. clone: YMU001_000015_C08. Accession BP912112 Tissue type prothallium Developmental stage - Contig I...Arabidopsis thaliana Align length 171 Score (bit) 121.0 E-value 3.0e-27 Report BLASTX 2.2.19 [Nov-02-2008] R... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912112|Adiantum capillus-veneri...s mRNA, clone: YMU001_000015_C08. (546 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765

  18. AcEST: BP912412 [AcEST

    Full Text Available YMU001_000018_G03 551 Adiantum capillus-veneris mRNA. clone: YMU001_000018_G03. BP912412... CL4248Contig1 Show BP912412 Clone id YMU001_000018_G03 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_G03. Accession BP912412 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912412|Adiantum capillus-veneris mR...NA, clone: YMU001_000018_G03. (551 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tot

  19. AcEST: BP912512 [AcEST

    Full Text Available YMU001_000019_D01 513 Adiantum capillus-veneris mRNA. clone: YMU001_000019_D01. BP912512... CL17Contig1 Show BP912512 Clone id YMU001_000019_D01 Library YMU01 Length 513 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000019_D01. Accession BP912512 Tissue type prothallium Developmental stage ...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP912512|Adiantum capillus-veneris mRNA, clone: YMU0...01_000019_D01. (489 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Sear

  20. AcEST: BP912129 [AcEST

    Full Text Available YMU001_000015_D11 268 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D11. BP91212...9 CL691Contig1 Show BP912129 Clone id YMU001_000015_D11 Library YMU01 Length 268 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D11. Accession BP912129 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912129|Adiantum capillus-veneris mRNA, YMU001_000015_D11. (268 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total lett

  1. BP Spill in the Gulf of Mexico Sediment Data

    U.S. Environmental Protection Agency — In response to the BP oil spill, EPA monitored sediment near the spill. While emergency response data collection has ended, results continue to be available on this...

  2. AcEST: BP913939 [AcEST

    Full Text Available YMU001_000038_B01 468 Adiantum capillus-veneris mRNA. clone: YMU001_000038_B01. BP913939 - Show mRNA. clone: YMU001_000038_B01. Accession BP913939 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP913939|Adiantum capillus-veneris mRNA, ... F member 3... 86 9e-17 sp|Q66H39|ABCF3_RAT ATP-binding cassette sub-family F member 3 O... 85 1e-16 sp|Q5R9...aracterized ABC transporter ATP-binding... 56 6e-08 sp|P63390|YHES_ECO57 Uncharacterized ABC transporter ATP

  3. BP erioperatsioon naftalekke peatamiseks nurjus / Jürgen Tamme

    Tamme, Jürgen


    Naftakompanii BP katse peatada Mehhiko lahe naftaleke ebaõnnestus, nüüd püütakse reostust peatada uue toru paigaldamise abil. USA president Barack Obama avaldas taas rahulolematust naftakompaniiga. Kaart

  4. Evaluation of the Specificity of BP3385 for Bordetella pertussis

    BP3385 has been proposed as a diagnostic PCR target for discriminating between Bordetella pertussis and other Bordetella species that also infect humans. Our results demonstrate this gene is also present in some strains of Bordetella hinzii and Bordetella bronchiseptica....

  5. BP/Mobil. Joint-venture directions for use



    This paper analyzes the economical reasons which have led BP and Mobil companies to join their forces in 1996. Thanks to their complementarity and to their European implantation, the two companies could win the first or second position in petroleum products marketing in 8 European countries. The cumulated petrol sales and the number of petrol stations of the BP/Mobil joint venture are the highest in Europe (800 petrol stations in France). (J.S.)

  6. The human element of right-sizing. BP experiences

    Hollis, J.W.


    BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning

  7. Gear Fault Diagnosis Based on BP Neural Network

    Huang, Yongsheng; Huang, Ruoshi


    Gear transmission is more complex, widely used in machinery fields, which form of fault has some nonlinear characteristics. This paper uses BP neural network to train the gear of four typical failure modes, and achieves satisfactory results. Tested by using test data, test results have an agreement with the actual results. The results show that the BP neural network can effectively solve the complex state of gear fault in the gear fault diagnosis.

  8. Bp'S Baku-Tbilisi-Ceyhan pipeline: the new corporate colonialism.

    Marriott, James; Muttitt, Greg


    An international campaign was waged questioning the benefits of BP's Baku-Tbilisi-Ceyhan pipeline in an effort to avoid a "zone of sacrifice" there. This article is an offshoot of that effort and explains the contemporary struggle over the pipeline project. The authors describe the project's background and evaluate the actual and potential impacts of the project in which they consider eight areas. They also assess BP's capacity to confront resistance to the pipeline.

  9. The human element of right-sizing. BP experiences

    Hollis, J W [BP Norge (Norway)


    BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning

  10. A new interpretation of luminous blue stars

    Stothers, R.


    A major revision of current theoretical ideas about the brightest blue stars must be made if Carson's new radiative opacities are adopted in stellar models. Unlike earlier opacities, the new opacities exhibit a large ''bump'' due to CNO ionization, which leads to very strong central condensation, convective instability, and pulsational instability in hot, diffuse stellar envelopes (typically those in which L/M>10 3 solar units). Despite a number of theoretical uncertainties, the new picture of the structure of very luminous stars is reasonably successful in accounting for a variety of previously unexplained observations. Thus, the new stellar models for the phase of core hydrogen burning predict large radii and rather cool effective temperatures (which are yet to be observationally confirmed) for O stars, and a spreading out of the main-sequence band in the H-R diagram toward luminous cool supergiants for masses higher than approx.20 M/sub sun/, beginning at M/sub v/=-4.5 and Sp=B1. They also predict slower surface rotations for O stars compared with B stars; and, in binary systems, slower apsidal motions, closer rotational-revolutional synchronism, and smaller orbital eccentricities. In massive X-ray binary systems, circular orbits and supergiant-like visual companions are expected to be quite common. Radial pulsations of the models have been calculated by employing linearized nonadiabatic pulsation theory. Long-period variability is predicted to exist for massive blue supergiants of luminosity class Ia. The new models for helium stars predict large radii and rather cool effective temperatures for Wolf-Rayet stars, as well as multimodal pulsational instability and, possibly, surface turbulence for these stars. Ultrashort-period variability, observed in many classes of hot luminous stars, may be due, in part, to high radial overtone pulsations (or, possibly, to nonradial pulsation or convective modes)

  11. Life of a star

    Henbest, Nigel.


    The paper concerns the theory of stellar evolution. A description is given of:- how a star is born, main sequence stars, red giants, white dwarfs, supernovae, neutron stars and black holes. A brief explanation is given of how the death of a star as a supernova can trigger off the birth of a new generation of stars. Classification of stars and the fate of our sun, are also described. (U.K.)

  12. Serum levels of IGF-1 and IGF-BP3 are associated with event-free survival in adult Ewing sarcoma patients treated with chemotherapy

    de Groot S


    Full Text Available Stefanie de Groot,1 Hans Gelderblom,1 Marta Fiocco,2,3 Judith VMG Bovée,4 Jacobus JM van der Hoeven,1 Hanno Pijl,5 Judith R Kroep1 1Department of Medical Oncology, 2Department of Medical Statistics and Bioinformatics, Leiden University Medical Center, 3Mathematical Department, Leiden University, 4Department of Pathology, 5Department of Endocrinology, Leiden University Medical Center, Leiden, the Netherlands Background: Activation of the insulin-like growth factor 1 (IGF-1 pathway is involved in cell growth and proliferation and is associated with tumorigenesis, tumor progression, and therapy resistance in solid tumors. We examined whether variability in serum levels of IGF-1, IGF-2, and IGF-binding protein 3 (IGF-BP3 can predict event-free survival (EFS and overall survival (OS in Ewing sarcoma patients treated with chemotherapy.Patients and methods: Serum levels of IGF-1, IGF-2, and IGF-BP3 of 22 patients with localized or metastasized Ewing sarcoma treated with six cycles of vincristine/ifosfamide/doxorubicin/etoposide (VIDE chemotherapy were recorded. Baseline levels were compared with presixth cycle levels using paired t-tests and were tested for associations with EFS and OS. Continuous variables were dichotomized according to the Contal and O’Quigley procedure. Survival analyses were performed using Cox regression analysis.Results: High baseline IGF-1 and IGF-BP3 serum levels were associated with EFS (hazard ratio [HR] 0.075, 95% confidence interval [CI] 0.009–0.602 and HR 0.090, 95% CI 0.011–0.712, respectively in univariate and multivariate analyses (HR 0.063, 95% CI 0.007–0.590 and HR 0.057, 95% CI 0.005–0.585, respectively. OS was improved, but this was not statistically significant. IGF-BP3 and IGF-2 serum levels increased during treatment with VIDE chemotherapy (P=0.055 and P=0.023, respectively.Conclusion: High circulating serum levels of IGF-1 and IGF-BP3 and the molar ratio of IGF-1:IGF-BP3 serum levels were associated

  13. Can HR practices retain flexworkers with their agency?

    Kroon, B.; Freese, C.


    Purpose Workers have different motives to be employed at specialist contract work agencies, such as career development aspirations, or a desire for freedom and independence. The purpose of this paper is to study how these different motives relate to the appreciation of HR practices applied by

  14. Research on electron beam welding technology of steel HR-4

    Guo Peng; Guan Kai


    The electron beam weldability of HR- 4 steels (J75 and J90) is studied and the welding parameters needed for design and usage are presented. The assessment on the effect of mechanical properties by different processing order of welding and heat-treatment is made

  15. In-sourcing HR: shared service centres in the Netherlands

    Farndale, Elaine; Paauwe, Jaap; Hoeksema, Ludwig


    Due to the impact of now widely-available technologies, new logics behind the organisation of the HR function through the in- and outsourcing of HRM activities have been emerging, particularly addressing issues of integration, cost-efficiency and competitive advantage. In particular, increasing

  16. The Perceived Importance of HR duties to Danish line managers

    Brandl, Julia; Madsen, Mona Toft; Madsen, Henning


    Today, HR scholars widely acknowledge that realising HRM requires the involvement of all managers and that the personal motivation of line managers plays an important role in their successful involvement. Yet, previous research has neglected to study how line managers rate the importance of parti...

  17. HR practices for enhancing sustainable employability : implementation, use, and outcomes

    Ybema, Jan Fekke; van Vuuren, Tinka; van Dam, Karen


    With the aging of the workforce, organizations need to maintain or improve the sustainable employability of their workforce throughout their working life. This raises the question which HR practices increase workers’ sustainable employability at work. The aim of this study is to investigate the

  18. Enrico Chiaveri: The dialogue in the HR Strategy


    Enrico Chiaveri has been Head of the Human Resources Department since 2005. A core part of his department’s mission with the new Management is to develop and implement a strategic HR approach for our forward-looking Organization. He explained key aspects of the HR strategy to the Bulletin. For the first time in CERN’s history, a head of the HR Department and his deputy - Anne-Sylvie Catherin - invited the staff to a general information meeting on 23 February 2009. The scope of the meeting was to present the status of a number of current initiatives that will improve and tailor CERN’s HR strategy to the needs of the Organization and its staff, and also open up dialogue. Presented for the first time in an integrated way, the initiatives include contract policy, MARS, a staff survey, CERN’s values, a performance model, recruitment & outreach, learning & development, internal mobility and the development of a code of condu...


    Andersen, Torben; Krogager, Per


    This paper illustrates, through a case-study of one of the old life sciences and diagnostics companies in Denmark, Radiometer Medical Plc. (now part of the Danaher Corporation), how the HR-department starts to work in a much more systematic way with effectiveness and efficiency, in the attempt...... with a stronger emphasis on core values and rationalizing the function itself....

  20. Learning Culture, Line Manager and HR Professional Practice

    Harrison, Patricia


    Purpose: This paper aims to focus on the role of line management and learning culture in the development of professional practice for the human resource (HR) practitioner. Design/methodology/approach: Three-year longitudinal, matched-pair study involving five participants and their line managers. Findings: Two of the five participants experienced…

  1. Atypical Employment Relationships and Commitment: Wishful Thinking or HR Challenge?

    Torka, Nicole


    Nowadays, simultaneously maintaining flexible working practices and commitment is an important topic for HR managers since they both can contribute to organisational success. However, many HRM researchers and practitioners are unsure whether these can go together as job security is often seen as a

  2. HR Manager Leadership in Quality Improvement in a College Environment

    Sharabi, Moshe


    Purpose: The purpose of this paper is to present the influence of the human resource (HR) manager on the quality of service in an academic college, and the human resource management (HRM) outcomes of the process. Design/methodology/approach: The paper relates to a customer satisfaction survey. More than 120 questionnaires were completed by the…

  3. Stimulating teachers’ team performance through team-oriented HR practices

    Bouwmans, Machiel; Runhaar, Piety; Wesselink, Renate; Mulder, Martin


    Teams of teachers are increasingly held accountable for the quality of education and educational reforms in vocational education and training institutions. However, historically teachers have not been required to engage in deep-level collaboration, thus team-oriented HR practices are being used

  4. 4977-bp mitochondrial DNA deletion in infertile patients with varicocele.

    Gashti, N G; Salehi, Z; Madani, A H; Dalivandan, S T


    Varicocele is the abnormal inflexion and distension of veins of the pampiniform plexus within spermatic cord and is one of the amendable causes of male infertility. It can increase reactive oxygen species (ROS) production in semen and cause oxidative stress. The purpose of this study was to analyse spermatozoa mtDNA 4977-bp deletion in infertile men with varicocele. To detect 4977-bp deletion in spermatozoa mtDNA, semen samples of 60 infertile patients with clinical varicocele and 90 normal men from northern Iran were prepared. After extraction of spermatozoa total DNA, Gap polymerase chain reaction (Gap PCR) was performed. 4977-bp deletion was observed in 81.66% of patients with varicocele, while approximately 15.55% of controls had this deletion. As spermatozoa from patients with varicocele had a high frequency of occurrence of 4977-bp deletion in mtDNA [OR = 24.18, 95% confidence interval (CI) = 10.15-57.57, P deletion in spermatozoa and cause infertility in north Iranian men. However, to determine the relation between sperm mtDNA 4977-bp deletion and varicocele-induced infertility, larger population-based studies are needed. It is concluded that there is an association between sperm mtDNA 4977-bp deletion and varicocele-induced infertility in the population studied. © 2013 Blackwell Verlag GmbH.

  5. IUE observations of new A star candidate proto-planetary systems

    Grady, Carol A.


    As a result of the detection of accreting gas in the A5e PMS Herbig Ae star, HR 5999, most of the observations for this IUE program were devoted to Herbig Ae stars rather than to main sequence A stars. Mid-UV emission at optical minimum light was detected for UX Ori (A1e), BF Ori (A5e), and CQ Tau (F2e). The presence of accreting gas in HD 45677 and HD 50138 prompted reclassification of these stars as Herbig Be stars rather than as protoplanetary nebulae. Detailed results are discussed.

  6. Stellar oscillations in planet-hosting giant stars

    Hatzes, Artie P; Zechmeister, Mathias [Thueringer Landessternwarte, Sternwarte 5, D-07778 (Germany)], E-mail:


    Recently a number of giant extrasolar planets have been discovered around giant stars. These discoveries are important because many of these giant stars have intermediate masses in the range 1.2-3 Msun. Early-type main sequence stars of this mass range have been avoided by radial velocity planet search surveys due the difficulty of getting the requisite radial velocity precision needed for planet discoveries. Thus, giant stars can tell us about planet formation for stars more massive than the sun. However, the determination of stellar masses for giant stars is difficult due to the fact that evolutionary tracks for stars covering a wide range of masses converge to the same region of the H-R diagram. We report here on stellar oscillations in three planet-hosting giant stars: HD 13189, {beta} Gem, and {iota} Dra. Precise stellar radial velocity measurements for these stars show variations whose periods and amplitudes are consistent with solar-like p-mode oscillations. The implied stellar masses for these objects based on the characteristics of the stellar oscillations are consistent with the predictions of stellar isochrones. An investigation of stellar oscillations in planet hosting giant stars offers us the possibility of getting an independent determination of the stellar mass for these objects which is of crucial importance for extrasolar planet studies.

  7. O stars and Wolf-Rayet stars

    Conti, P.S.; Underhill, A.B.; Jordan, S.; Thomas, R.


    Basic information is given about O and Wolf-Rayet stars indicating how these stars are defined and what their chief observable properties are. Part 2 of the volume discussed four related themes pertaining to the hottest and most luminous stars. Presented are: an observational overview of the spectroscopic classification and extrinsic properties of O and Wolf-Rayet stars; the intrinsic parameters of luminosity, effective temperature, mass, and composition of the stars, and a discussion of their viability; stellar wind properties; and the related issues concerning the efforts of stellar radiation and wind on the immediate interstellar environment are presented

  8. O stars and Wolf-Rayet stars

    Conti, Peter S.; Underhill, Anne B.; Jordan, Stuart (Editor); Thomas, Richard (Editor)


    Basic information is given about O and Wolf-Rayet stars indicating how these stars are defined and what their chief observable properties are. Part 2 of the volume discussed four related themes pertaining to the hottest and most luminous stars. Presented are: an observational overview of the spectroscopic classification and extrinsic properties of O and Wolf-Rayet stars; the intrinsic parameters of luminosity, effective temperature, mass, and composition of the stars, and a discussion of their viability; stellar wind properties; and the related issues concerning the efforts of stellar radiation and wind on the immediate interstellar environment are presented.

  9. Human Resource Predictive Analytics HRPA For HR Management In Organizations

    Sujeet N. Mishra


    Full Text Available Human resource predictive analytics is an evolving application field of analytics for HRM purposes. The purpose of HRM is measuring employee performance and engagement studying workforce collaboration patterns analyzing employee churn and turnover and modelling employee lifetime value. The motive of applying HRPA is to optimize performances and produce better return on investment for organizations through decision making based on data collection HR metrics and predictive models. The paper is divided into three sections to understand the emergence of HR predictive analytics for HRM. Firstly the paper introduces the concept of HRPA. Secondly the paper discusses three aspects of HRPA a Need b Approach amp Application c Impact. Lastly the paper leads to the conclusion on HRPA.

  10. LBT observations of the HR8799 planetary system

    Mesa, D.; Arcidiacono, C.; Claudi, R. U.; Desidera, S.; Esposito, S.; Gratton, R.; Masciadri, E.


    We present here observations of the HR8799 planetary system performed in H and Ks band exploiting the AO system at the Large Binocular Telescope and the PISCES camera. Thanks to the excellent performence of the instrument we were able to detect for the first time the inner known planet of the system (HR8799) in the H band. Precise photometric and astrometric measures have been taken for all the four planets. Further, exploiting ours and previous astrometric results, we were able to put some limits on the planetary orbits of the four planets. The analysis of the dinamical stability of the system seems to show lower planetary masses than the ones adopted until now.

  11. The latest on the recent HR staff survey


    The data collected in the framework of the staff survey sent out by the Human Resources (HR) Department in March this year are currently being analysed. The first results concern the response rate and the breakdown of participants. 1328 staff members replied to the questionnaire, representing a response rate of close to 60%. Marie-Luce Falipou, who is in charge of the project within the HR Department, is evidently satisfied with the result: "The high response rate shows that the staff appreciated HR’s efforts to sound out their opinions and felt concerned by the subjects covered in the questionnaire". All the data are now being processed by the team led by Philippe Sarnin, Director of the Social Psychology Department at the University of Lyon2. "The number of responses submitted during the 15 days the form was available on line was very satisfactory. This is a vital factor in ensuring that we are able to build up an accurate pictu...

  12. HR strategy – necessity or fad for business sustainability?

    Ghinea Valentina Mihaela


    Full Text Available The present paper pleads for the awareness of HR strategy importance, in terms of proper design and implementation, as they definitely could impede or sustain the development of an organization. By making use of G.VALI, the model of organizational culture dynamics, we look for revealing the impact that (non-existence of HR strategy, its alignment and coherence could have on the organization success. As proven by human experience, all types of strategies could work and be effective in certain conditions. Even more, no one can say that one strategy is better than other. However, in the same way, there is no guarantee of some strategies success. In this light, the difference lays in the handy and clever interlock of the country specific advantages and firm (-tobe specific advantages. For achieving this specific aim, vertical (alignment and horizontal (coherence integration of each functional strategy must be ensured.

  13. Egyptian "Star Clocks"

    Symons, Sarah

    Diagonal, transit, and Ramesside star clocks are tables of astronomical information occasionally found in ancient Egyptian temples, tombs, and papyri. The tables represent the motions of selected stars (decans and hour stars) throughout the Egyptian civil year. Analysis of star clocks leads to greater understanding of ancient Egyptian constellations, ritual astronomical activities, observational practices, and pharaonic chronology.


    Bychkov, V. D.; Bychkova, L. V.; Madej, J.


    Now it is known about 1212 stars of the main sequence and giants (from them 610 stars - it is chemically peculiarity (CP) stars) for which direct measurements of magnetic fields were spent (Bychkov et al.,2008). Let's consider, what representations were generated about magnetic fields (MT) of stars on the basis of available observations data.

  15. Teaching HR Professionals: The Classroom as a Community of Practice

    Alex Avramenko


    Full Text Available This paper introduces an innovative course design incorporating both communities of practice and reflective practice as a learning strategy for part-time learners in higher education. The new design has been applied to teaching HR practitioners in a UK-based business school. Findings indicate that the suggested way of organizing teaching and learning for part-time professionals is very informative and facilitates a richer engagement with theory whilst addressing issues of practice.

  16. Acute hyperhydration reduces athlete biological passport OFF-hr score

    Bejder Rasmussen, Jacob; Hoffmann, M F; Ashenden, M


    Anecdotal evidence suggests that athletes hyperhydrate to mask prohibited substances in urine and potentially counteract suspicious fluctuations in blood parameters in the athlete biological passport (ABP). It is examined if acute hyperhydration changes parameters included in the ABP. Twenty...... ingestion, and 54% (n = 19), 45%, and 47% (n = 19) were identified 40, 60, and 80 min, respectively, after ingestion. In conclusion, acute hyperhydration reduces ABP OFF-hr and reduces ABP sensitivity....


    Jelena Kuvač Kraljević


    Full Text Available Interest in spoken-language corpora has increased over the past two decades leading to the development of new corpora and the discovery of new facets of spoken language. These types of corpora represent the most comprehensive data source about the language of ordinary speakers. Such corpora are based on spontaneous, unscripted speech defined by a variety of styles, registers and dialects. The aim of this paper is to present the Croatian Adult Spoken Language Corpus (HrAL, its structure and its possible applications in different linguistic subfields. HrAL was built by sampling spontaneous conversations among 617 speakers from all Croatian counties, and it comprises more than 250,000 tokens and more than 100,000 types. Data were collected during three time slots: from 2010 to 2012, from 2014 to 2015 and during 2016. HrAL is today available within TalkBank, a large database of spoken-language corpora covering different languages (, in the Conversational Analyses corpora within the subsection titled Conversational Banks. Data were transcribed, coded and segmented using the transcription format Codes for Human Analysis of Transcripts (CHAT and the Computerised Language Analysis (CLAN suite of programmes within the TalkBank toolkit. Speech streams were segmented into communication units (C-units based on syntactic criteria. Most transcripts were linked to their source audios. The TalkBank is public free, i.e. all data stored in it can be shared by the wider community in accordance with the basic rules of the TalkBank. HrAL provides information about spoken grammar and lexicon, discourse skills, error production and productivity in general. It may be useful for sociolinguistic research and studies of synchronic language changes in Croatian.

  18. High-performance HR practices, positive affect and employee outcomes

    Mostafa, Ahmed


    Purpose – The purpose of this paper is to provide insight into the affective or emotional mechanisms that underlie the relationship between high-performance HR practices (HPHRP) and employee attitudes and behaviours. Drawing on affective events theory (AET), this paper examines a mediation model in which HPHRP influence positive affect which in turn affects job satisfaction and organizational citizenship behaviours (OCBs). Design/methodology/approach – Two-wave data was collected from a sampl...

  19. Profile of NF-κBp(65/NFκBp50) among prostate specific antigen sera levels in prostatic pathologies.

    Bouraoui, Y; Ben Jemaa, A; Rodriguez, G; Ben Rais, N; Fraile, B; Paniagua, R; Sellemi, S; Royuela, M; Oueslati, R


    The aim of this work was to characterise the immunoexpression of NF-κB (p50/p65) in human prostatic pathologies and to study its profiles of activation among sera prostate specific antigen antigen (PSA) according the three groups: 0-4ng/mL, 4-20ng/mL and >20ng/mL. Twenty-four men with benign prostate hyperplasia (BPH); 19 men with prostate cancer (PC) and five men with normal prostates (NP). Immunohistochemical and western blot analysis was performed. Serum levels of PSA were assayed by immulite autoanalyser. In BPH and PC samples, immunoexpressions were observed for NF-κBp65 and NF-κBp50; while in NP samples, only were detected NF-κBp50. PC samples showed immunoreactions to NF-κBp65 and NF-κBp50 more intense (respectively 24.18±0.67 and 28.23±2.01) than that observed in BPH samples (respectively18.46±2.04 and 18.66±1.59) with special localisation in the nucleus. Different profiles of NF-κBp65 immunoexpressions were observed and BPH patients with sera PSA levels between 0-4ng/mL presented a significant weak percentage compared to BPH patients with sera PSA levels between 4-20ng/mL and >20ng/mL. No immunoreactions to NF-κBp65 were observed in PC patients with sera PSA levels between 4-20ng/mL. The sensibility of both NF-κB and PSA to inflammation allowed confirming the relationship between these two molecules and its involvement in prostatic diseases progression (inflammatory and neoplasic). Copyright © 2011 Elsevier Masson SAS. All rights reserved.


    G. Blanchet


    Full Text Available The first Pleiades-HR satellite, part of a constellation of two, has been launched on December 17, 2011. This satellite produces high resolution optical images. In order to achieve good image quality, Pleiades-HR should first undergo an important 6 month commissioning phase period. This phase consists in calibrating and assessing the radiometric and geometric image quality to offer the best images to end users. This new satellite has benefited from technology improvements in various fields which make it stand out from other Earth observation satellites. In particular, its best-in-class agility performance enables new calibration and assessment techniques. This paper is dedicated to presenting these innovative techniques that have been tested for the first time for the Pleiades- HR radiometric commissioning. Radiometric activities concern compression, absolute calibration, detector normalization, and refocusing operations, MTF (Modulation Transfer Function assessment, signal-to-noise ratio (SNR estimation, and tuning of the ground processing parameters. The radiometric performances of each activity are summarized in this paper.

  1. Compact stars

    Estevez-Delgado, Gabino; Estevez-Delgado, Joaquin


    An analysis and construction is presented for a stellar model characterized by two parameters (w, n) associated with the compactness ratio and anisotropy, respectively. The reliability range for the parameter w ≤ 1.97981225149 corresponds with a compactness ratio u ≤ 0.2644959374, the density and pressures are positive, regular and monotonic decrescent functions, the radial and tangential speed of sound are lower than the light speed, moreover, than the plausible stability. The behavior of the speeds of sound are determinate for the anisotropy parameter n, admitting a subinterval where the speeds are monotonic crescent functions and other where we have monotonic decrescent functions for the same speeds, both cases describing a compact object that is also potentially stable. In the bigger value for the observational mass M = 2.05 M⊙ and radii R = 12.957 Km for the star PSR J0348+0432, the model indicates that the maximum central density ρc = 1.283820319 × 1018 Kg/m3 corresponds to the maximum value of the anisotropy parameter and the radial and tangential speed of the sound are monotonic decrescent functions.

  2. Study on MPGA-BP of Gravity Dam Deformation Prediction

    Xiaoyu Wang


    Full Text Available Displacement is an important physical quantity of hydraulic structures deformation monitoring, and its prediction accuracy is the premise of ensuring the safe operation. Most existing metaheuristic methods have three problems: (1 falling into local minimum easily, (2 slowing convergence, and (3 the initial value’s sensitivity. Resolving these three problems and improving the prediction accuracy necessitate the application of genetic algorithm-based backpropagation (GA-BP neural network and multiple population genetic algorithm (MPGA. A hybrid multiple population genetic algorithm backpropagation (MPGA-BP neural network algorithm is put forward to optimize deformation prediction from periodic monitoring surveys of hydraulic structures. This hybrid model is employed for analyzing the displacement of a gravity dam in China. The results show the proposed model is superior to an ordinary BP neural network and statistical regression model in the aspect of global search, convergence speed, and prediction accuracy.

  3. Preliminary Geological Findings on the BP-1 Simulant

    Stoeser, D. B.; Rickman, D. L.; Wilson, S.


    A waste material from an aggregate producing quarry has been used to make an inexpensive lunar simulant called BP-1. The feedstock is the Black Point lava flow in northern Arizona. Although this is part of the San Francisco volcanic field, which is also the source of the JSC-1 series feedstock, BP-1 and JSC-1 are distinct. Chemically, the Black Point flow is an amygdaloidal nepheline-bearing basalt. The amygdules are filled with secondary minerals containing opaline silica, calcium carbonate, and ferric iron minerals. X-ray diffraction (XRD) detected approximately 3% quartz, which is in line with tests done by the Kennedy Space Center Industrial Hygiene Office. Users of this material should use appropriate protective equipment. XRD also showed the presence of significant halite and some bassanite. Both are interpreted to be evaporative residues due to recycling of wash water at the quarry. The size distribution of BP-1 may be superior to some other simulants for some applications.

  4. Neutron Stars and NuSTAR

    Bhalerao, Varun


    My thesis centers around the study of neutron stars, especially those in massive binary systems. To this end, it has two distinct components: the observational study of neutron stars in massive binaries with a goal of measuring neutron star masses and participation in NuSTAR, the first imaging hard X-ray mission, one that is extremely well suited to the study of massive binaries and compact objects in our Galaxy. The Nuclear Spectroscopic Telescope Array (NuSTAR) is a NASA Small Explorer mission that will carry the first focusing high energy X-ray telescope to orbit. NuSTAR has an order-of-magnitude better angular resolution and has two orders of magnitude higher sensitivity than any currently orbiting hard X-ray telescope. I worked to develop, calibrate, and test CdZnTe detectors for NuSTAR. I describe the CdZnTe detectors in comprehensive detail here - from readout procedures to data analysis. Detailed calibration of detectors is necessary for analyzing astrophysical source data obtained by the NuSTAR. I discuss the design and implementation of an automated setup for calibrating flight detectors, followed by calibration procedures and results. Neutron stars are an excellent probe of fundamental physics. The maximum mass of a neutron star can put stringent constraints on the equation of state of matter at extreme pressures and densities. From an astrophysical perspective, there are several open questions in our understanding of neutron stars. What are the birth masses of neutron stars? How do they change in binary evolution? Are there multiple mechanisms for the formation of neutron stars? Measuring masses of neutron stars helps answer these questions. Neutron stars in high-mass X-ray binaries have masses close to their birth mass, providing an opportunity to disentangle the role of "nature" and "nurture" in the observed mass distributions. In 2006, masses had been measured for only six such objects, but this small sample showed the greatest diversity in masses

  5. Acute Toxicity and Ecological Risk Assessment of Benzophenone-3 (BP-3 and Benzophenone-4 (BP-4 in Ultraviolet (UV-Filters

    Yang Du


    Full Text Available Ultraviolet (UV-absorbing chemicals (UV filters are used in personal care products for the protection of human skin and hair from damage by UV radiation. Although these substances are released into the environment in the production and consumption processes, little is known about their ecotoxicology effects. The acute toxicity and potential ecological risk of UV filters benzophenone-3 (BP-3 and benzophenone-4 (BP-4 on Chlorella vulgaris, Daphnia magna, and Brachydanio rerio were analyzed in the present study. The EC50 values (96 h of BP-3 and BP-4 on C. vulgaris were 2.98 and 201.00 mg/L, respectively. The 48 h-LC50 of BP-3 and BP-4 on D. magna were 1.09 and 47.47 mg/L, respectively. The 96 h-LC50 of BP-3 and BP-4 on B. rerio were 3.89 and 633.00 mg/L, respectively. The toxicity of a mixture of BP-3 and BP-4 on C. vulgaris, D. magna, and B. rerio all showed antagonistic effects. The induced predicted no-effect concentrations of BP-3 and BP-4 by the assessment factor method were 1.80 × 10−3 and 0.47 mg/L, respectively, by assessment factor (AF method, which were both lower than the concentrations detected in the environment at present, verifying that BP-3 and BP-4 remain low-risk chemicals to the aquatic ecosystem.

  6. 200-BP-5 operable unit treatability test report



    The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites.

  7. 200-BP-5 operable unit Technical Baseline report

    Jacques, I.D.; Kent, S.K.


    This report supports development of a remedial investigation/feasibility study work plan for the 200-BP-5 operable unit. The report summarizes baseline information for waste sites and unplanned release sites located in the 200-BP-5 operable unit. The sites were investigated by the Technical Baseline Section of the Environmental Engineering Group, Westinghouse Hanford Company (Westinghouse Hanford). The investigation consisted of review and evaluation of current and historical Hanford Site reports, drawings, and photographs, and was supplemented with recent inspections of the Hanford Site and employee interviews. No field investigations or sampling were conducted

  8. 200-BP-5 operable unit treatability test report


    The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites


    Nicoleta Valentina FLOREA


    Today’s organizations are facing new challenges, which require them to make effective decisions in order to solve complex issues. These decisions are generally made at higher levels in the organization’s hierarchical structure, where managers maintain power and control to influence organizational goals, including the behaviors and the attitudes of their subordinates. In this article we will show the importance of having effective managers, especially in HR, who can positively influence attrac...


    Nicoleta Valentina FLOREA


    Full Text Available Today’s organizations are facing new challenges, which require them to make effective decisions in order to solve complex issues. These decisions are generally made at higher levels in the organization’s hierarchical structure, where managers maintain power and control to influence organizational goals, including the behaviors and the attitudes of their subordinates. In this article we will show the importance of having effective managers, especially in HR, who can positively influence attracting intellectual capital and acquire knowledge management, by increasing employees motivation, job satisfaction, performance, and organizational commitment, in order to achieve high levels of productivity and efficiency. Also, we will evaluate the HR managers’ roles in order to obtain performance by managing, controlling, evaluating, analyzing, auditing, forecasting, and integrating effectively knowledge management and intellectual capital in organizations. Our study is made in large organizations from Dambovita County, Romania, and it demonstrates that employees need excellent HR managers to obtain the best from them and to face a changing environment.


    Fekel, Francis C.; Williamson, Michael H.; Tomkin, Jocelyn


    We have determined improved spectroscopic orbits for three double-lined binaries, 66 And (F4 V), HR 6979 (Am), and HR 9059 (F5 IV) using radial velocities from the 2.1 m telescope at McDonald Observatory, the coude feed telescope at Kitt Peak National Observatory, and 2 m telescope at Fairborn Observatory. The orbital periods range from 11.0 to 14.3 days, and all three systems have eccentric orbits. The new orbital dimensions (a 1 sin i and a 2 sin i) and minimum masses (m 1 sin 3 i and m 2 sin 3 i) have accuracies of 0.2% or better. All six components of the three binary systems are rotating more slowly than their predicted pseudosynchronous rotational velocities. Hipparcos photometry of HR 9059 shows that this system has partial eclipses. Its components are nearly identical in mass and are at the very end of their main-sequence lifetimes or perhaps have just begun to traverse the Hertsprung gap.


    Su, Kate Y. L.; Smith, Paul S.; Rieke, George H.; Morrison, Sarah; Malhotra, Renu; Balog, Zoltan


    HD 95086 is a young early-type star that hosts (1) a 5 M J planet at the projected distance of 56 AU revealed by direct imaging, and (2) a prominent debris disk. Here we report the detection of 69 μm crystalline olivine feature from the disk using the Spitzer/MIPS-SED data covering 55-95 μm. Due to the low resolution of the MIPS-SED mode, this feature is not spectrally resolved, but is consistent with the emission from crystalline forsterite contributing ∼5% of the total dust mass. We also present detailed analysis of the disk spectral energy distribution and re-analysis of resolved images obtained by Herschel. Our results suggest that the debris structure around HD 95086 consists of a warm (∼175 K) belt, a cold (∼55 K) disk, and an extended disk halo (up to ∼800 AU), and is very similar to that of HR 8799. We compare the properties of the three debris components, and suggest that HD 95086 is a young analog of HR 8799. We further investigate and constrain single-planet, two-planet, three-planet, and four-planet architectures that can account for the observed debris structure and are compatible with dynamical stability constraints. We find that equal-mass four-planet configurations of geometrically spaced orbits, with each planet of mass ∼ 5 M J , could maintain the gap between the warm and cold debris belts, and also be just marginally stable for timescales comparable to the age of the system


    Su, Kate Y. L.; Smith, Paul S.; Rieke, George H. [Steward Observatory, University of Arizona, 933 N Cherry Ave., Tucson, AZ 85721 (United States); Morrison, Sarah; Malhotra, Renu [Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States); Balog, Zoltan, E-mail: [Max-Planck-Institut für Astronomie, Königstuhl 17 D-69117, Heidelberg (Germany)


    HD 95086 is a young early-type star that hosts (1) a 5 M{sub J} planet at the projected distance of 56 AU revealed by direct imaging, and (2) a prominent debris disk. Here we report the detection of 69 μm crystalline olivine feature from the disk using the Spitzer/MIPS-SED data covering 55-95 μm. Due to the low resolution of the MIPS-SED mode, this feature is not spectrally resolved, but is consistent with the emission from crystalline forsterite contributing ∼5% of the total dust mass. We also present detailed analysis of the disk spectral energy distribution and re-analysis of resolved images obtained by Herschel. Our results suggest that the debris structure around HD 95086 consists of a warm (∼175 K) belt, a cold (∼55 K) disk, and an extended disk halo (up to ∼800 AU), and is very similar to that of HR 8799. We compare the properties of the three debris components, and suggest that HD 95086 is a young analog of HR 8799. We further investigate and constrain single-planet, two-planet, three-planet, and four-planet architectures that can account for the observed debris structure and are compatible with dynamical stability constraints. We find that equal-mass four-planet configurations of geometrically spaced orbits, with each planet of mass ∼ 5 M{sub J} , could maintain the gap between the warm and cold debris belts, and also be just marginally stable for timescales comparable to the age of the system.

  14. Why a well-designed HR shared service provider fails to create end-user value?

    Meijerink, Jeroen Gerard; Bondarouk, Tatiana; Looise, Jan C.


    Human resource shared services centres (HR SSCs) are foreseen as improving HR service delivery for their end-users: employees, line managers and decentralized HR professionals. Although the concept expects the benefits of HR SSCs to come from centralizing knowledge and decentralizing the control

  15. Giant CP stars

    Loden, L.O.; Sundman, A.


    This study is part of an investigation of the possibility of using chemically peculiar (CP) stars to map local galactic structure. Correct luminosities of these stars are therefore crucial. CP stars are generally regarded as main-sequence or near-main-sequence objects. However, some CP stars have been classified as giants. A selection of stars, classified in literature as CP giants, are compared to normal stars in the same effective temperature interval and to ordinary 'non giant' CP stars. There is no clear confirmation of a higher luminosity for 'CP giants', than for CP stars in general. In addition, CP characteristics seem to be individual properties not repeated in a component star or other cluster members. (author). 50 refs., 5 tabs., 3 figs

  16. 100-HR-2 Operable Unit Focused Feasibility study report


    The standard Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) Feasibility Study (FS) includes development and screening of alternatives (Phases 1 and 2) and the detailed analysis of alternatives (Phase 3). This focused feasibility study (FFS) was conducted for the 100-HR-2 Operable Unit (OU) at the Hanford Site in southeastern Washington. This FFS constitutes the Phase 3 portion of the FS process for the remedial alternatives initially developed and screened in the 100 Area Feasibility Study Phases 1 and 2 (DOE-RL 1993a). The objective of this OU-specific FFS is to provide decision makers with sufficient information to allow appropriate and timely selection of interim remedial measures (IRM) for the seven IRM candidate sites associated with the 100-HR-2 OU. The IRM candidate waste sites identified in Table ES-1 are determined in the limited field investigation (DOE-RL 1994b). Site profiles are developed for each of these waste sites. The site profiles are used in the application of the plug-in approach. The waste site either plugs into the analysis of the alternatives for the group, or deviations from the developed group alternatives are described and documented. A summary for the 100-HR-2 IRM candidate waste site is as follows: none of the waste sites require additional alternative development. six of the seven waste sites directly plug into the waste site group alternatives. The site-specific detailed analysis is conducted, referencing the waste site group analysis as appropriate. A waste site detailed analysis summary is presented in Table ES-1.A comparative analysis of remedial alternatives is presented for each waste site. A summary of the comparative analysis is presented in Table ES-2

  17. Bc→BP,BV Decays with the QCD Factorization Approach

    Chang, Qin; Wang, Na; Sun, Junfeng; Yang, Yueling


    We studied the nonleptonic B c →BP, BV decays with the QCD factorization approach. It is found that the Cabibbo favored processes of B c →B s π, B s ρ, B u K - are the promising decay channels with branching ratio larger than 1%, which should be observed earlier by the LHCb collaboration

  18. EST Table: BP124521 [KAIKOcDNA[Archive

    Full Text Available BP124521 epV32477 10/09/28 59 %/164 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  19. EST Table: BP123885 [KAIKOcDNA[Archive

    Full Text Available BP123885 epV31590 10/09/28 57 %/174 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  20. EST Table: BP125106 [KAIKOcDNA[Archive

    Full Text Available BP125106 fbpv0387 10/09/28 58 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/165 aa FBpp0212871|DsimGD14469-PA 10/08/28 n.h 10/09/1

  1. EST Table: BP125521 [KAIKOcDNA[Archive

    Full Text Available BP125521 fbpv0944 10/09/28 59 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/164 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  2. EST Table: BP125005 [KAIKOcDNA[Archive

    Full Text Available BP125005 fbpv0197 10/09/28 58 %/185 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 58 %/173 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  3. TopBP1-mediated DNA processing during mitosis.

    Gallina, Irene; Christiansen, Signe Korbo; Pedersen, Rune Troelsgaard; Lisby, Michael; Oestergaard, Vibe H


    Maintenance of genome integrity is crucial to avoid cancer and other genetic diseases. Thus faced with DNA damage, cells mount a DNA damage response to avoid genome instability. The DNA damage response is partially inhibited during mitosis presumably to avoid erroneous processing of the segregating chromosomes. Yet our recent study shows that TopBP1-mediated DNA processing during mitosis is highly important to reduce transmission of DNA damage to daughter cells. (1) Here we provide an overview of the DNA damage response and DNA repair during mitosis. One role of TopBP1 during mitosis is to stimulate unscheduled DNA synthesis at underreplicated regions. We speculated that such genomic regions are likely to hold stalled replication forks or post-replicative gaps, which become the substrate for DNA synthesis upon entry into mitosis. Thus, we addressed whether the translesion pathways for fork restart or post-replicative gap filling are required for unscheduled DNA synthesis in mitosis. Using genetics in the avian DT40 cell line, we provide evidence that unscheduled DNA synthesis in mitosis does not require the translesion synthesis scaffold factor Rev1 or PCNA ubiquitylation at K164, which serve to recruit translesion polymerases to stalled forks. In line with this finding, translesion polymerase η foci do not colocalize with TopBP1 or FANCD2 in mitosis. Taken together, we conclude that TopBP1 promotes unscheduled DNA synthesis in mitosis independently of the examined translesion polymerases.

  4. EST Table: BP117517 [KAIKOcDNA[Archive

    Full Text Available BP117517 ce--0464 10/09/28 63 %/173 aa ref|XP_002092422.1| GE14184 [Drosophila yakuba] gb|EDW92134.1| GE14...184 [Drosophila yakuba] 10/08/28 63 %/173 aa FBpp0259194|DyakGE14184-PA 10/08/28 35 %

  5. EST Table: BP121749 [KAIKOcDNA[Archive

    Full Text Available BP121749 ceN-5256 10/09/28 100 %/172 aa ref|NP_001036831.1| saposin-related [Bombyx...|GB16561-PA 10/09/10 44 %/178 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 ceN- ...

  6. EST Table: BP121763 [KAIKOcDNA[Archive

    Full Text Available BP121763 ceN-5273 10/09/28 99 %/184 aa ref|NP_001036831.1| saposin-related [Bombyx ...GB16561-PA 10/09/10 43 %/192 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 ceN- ...

  7. Note: Primer Amysat 001; Fragment size is 211bp


    Bhandara : Lanes 1–14 represent different strains of Bhandara Ecorace. Note: Primer Amysat 001; Fragment size is 211bp. Fig. 1. SSR profiles generated from genomic DNA of 16 strains from different individuals of (A.L, D. TV, D. BV, Modal, Sukinda, Raily, Bhandara) ecoraces of tasar silk worm, Antheraea mylitta using the.

  8. EST Table: BP182610 [KAIKOcDNA[Archive

    Full Text Available BP182610 NRPG0829 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 NRPG ...

  9. EST Table: BP121050 [KAIKOcDNA[Archive

    Full Text Available BP121050 ceN-4078 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 ceN- ...

  10. PM : Cabinet likely to choose TNK-BP


    Tõenäoliselt saab Mazeikiu Nafta aktsiate ostjaks Suurbritannia-Vene ettevõte TNK-BP. Endiselt soovib ka Leedu Jukose osa naftakompaniist osta, kuid selleks raha laenamine võib mõjutada riigi majandust ja üleminekut eurole

  11. Cabinet chooses TNK-BP, but doors remain open


    Leedu valitsus alustab Vene-Suurbritannia ühisfirmaga TNK-BP läbirääkimisi Mazeikiu Nafta aktsiaenamuse omandamiseks. Kuid samal ajal on võimalik alustada läbirääkimisi ka teiste võimalike investoritega

  12. 10 MMBt/Hr AFBC Commercial Demonstration Cedar Lane Farms

    Harold M. Keener; Mary H. Wicks; Tom Machamer; Dave Hoecke; Don Bonk; Bob Brown


    The objective of this project was to demonstrate and promote the commercialization of coal-fired atmospheric fluidized bed combustion (AFBC) systems, with limestone addition for SO2 emissions control and a baghouse for particulate emissions control. This AFBC system was targeted for small scale industrial-commercial-institutional space and process heat applications in the 4-40 MMBtu/hr size range. A cost effective and environmentally acceptable AFBC technology in this size range could displace a considerable amount of heating gas and oil with coal, while resulting in significant total cost savings to the owner/operators.

  13. Rates of star formation

    Larson, R.B.


    It is illustrated that a theoretical understanding of the formation and evolution of galaxies depends on an understanding of star formation, and especially of the factors influencing the rate of star formation. Some of the theoretical problems of star formation in galaxies, some approaches that have been considered in models of galaxy evolution, and some possible observational tests that may help to clarify which processes or models are most relevant are reviewed. The material is presented under the following headings: power-law models for star formation, star formation processes (conditions required, ways of achieving these conditions), observational indications and tests, and measures of star formation rates in galaxies. 49 references

  14. Energy production in stars

    Bethe, Hans.


    Energy in stars is released partly by gravitation, partly by nuclear reactions. For ordinary stars like our sun, nuclear reactions predominate. However, at the end of the life of a star very large amounts of energy are released by gravitational collapse; this can amount to as much as 10 times the total energy released nuclear reactions. The rotational energy of pulsars is a small remnant of the energy of gravitation. The end stage of small stars is generally a white dwarf, of heavy stars a neutron star of possibly a black hole

  15. A new look at the origin of the 6.67 hr period X-ray pulsar 1E 161348-5055

    Ikhsanov, N. R.; Kim, V. Y.; Beskrovnaya, N. G.; Pustil'nik, L. A.


    The point X-ray source 1E 161348-5055 is observed to display pulsations with the period 6.67 hr and |dot{P}| ≤1.6 ×10^{-9} s s^{-1}. It is associated with the supernova remnant RCW 103 and is widely believed to be a ˜2000 yr old neutron star. Observations give no evidence for the star to be a member of a binary system. Nevertheless, it resembles an accretion-powered pulsar with the magnetospheric radius ˜3000 km and the mass-accretion rate ˜ 10^{14} g s^{-1}. This situation could be described in terms of accretion from a (residual) fossil disk established from the material falling back towards the star after its birth. However, current fall-back accretion scenarios encounter major difficulties explaining an extremely long spin period of the young neutron star. We show that the problems can be avoided if the accreting material is magnetized. The star in this case is surrounded by a fossil magnetic slab in which the material is confined by the magnetic field of the accretion flow itself. We find that the surface magnetic field of the neutron star within this scenario is ˜1012 G and that a presence of ≳10^{-7} M_{⊙} magnetic slab would be sufficient to explain the origin and current state of the pulsar.

  16. Regular Generalized Star Star closed sets in Bitopological Spaces

    K. Kannan; D. Narasimhan; K. Chandrasekhara Rao; R. Ravikumar


    The aim of this paper is to introduce the concepts of τ1τ2-regular generalized star star closed sets , τ1τ2-regular generalized star star open sets and study their basic properties in bitopological spaces.

  17. The Discovery of λ Bootis Stars: The Southern Survey I

    Gray, R. O.; Riggs, Q. S.; Newsome, I. M. [Department of Physics and Astronomy, Appalachian State University, Boone, NC 26808 (United States); Koen, C. [Department of Statistics, University of the Western Cape, Private Bag X17, Bellville, 7535 Cape Town (South Africa); Murphy, S. J. [Sydney Institute for Astronomy (SIfA), School of Physics, University of Sydney, NSW 2006 (Australia); Corbally, C. J. [Vatican Observatory Research Group, Steward Observatory, Tucson, AZ, 85721-0065 (United States); Cheng, K.-P. [California State University, Fullerton, Fullerton, CA (United States); Neff, J. E. [National Science Foundation, Arlington, VA (United States)


    The λ Boo stars are a class of chemically peculiar Population I A-type stars characterized by under-abundances of the refractory elements, but near-solar abundances of carbon, nitrogen, oxygen, and sulfur. There is some evidence that λ Boo stars have higher frequencies of “bright” debris disks than normal A-type stars. The discovery of four exoplanets orbiting HR 8799, a λ Boo star with a resolved debris disk, suggests that the λ Boo phenomenon may be related to the presence of a dynamic debris disk, perhaps perturbed by migrating planets. However, only 64 λ Boo stars are known, and those stars were discovered with different techniques, making it problematic to use that sample for statistical purposes, including determining the frequency of debris disks. The purpose of this paper is to derive a new sample of λ Boo stars using a technique that does not lead to biases with respect to the presence of infrared excesses. Through spectroscopic observations in the southern hemisphere, we have discovered 33 λ Boo stars and have confirmed 12 others. As a step toward determining the proportion of λ Boo stars with infrared excesses, we have used WISE data to examine the infrared properties of this sample out to 22 μ m. On this basis, we cannot conclude that λ Boo stars have a greater tendency than normal A-type stars to show infrared excesses. However, observing this sample at longer wavelengths may change that conclusion, as many λ Boo debris disks are cool and do not radiate strongly at 22 μ m.

  18. The Discovery of λ Bootis Stars: The Southern Survey I

    Gray, R. O.; Riggs, Q. S.; Newsome, I. M.; Koen, C.; Murphy, S. J.; Corbally, C. J.; Cheng, K.-P.; Neff, J. E.


    The λ Boo stars are a class of chemically peculiar Population I A-type stars characterized by under-abundances of the refractory elements, but near-solar abundances of carbon, nitrogen, oxygen, and sulfur. There is some evidence that λ Boo stars have higher frequencies of “bright” debris disks than normal A-type stars. The discovery of four exoplanets orbiting HR 8799, a λ Boo star with a resolved debris disk, suggests that the λ Boo phenomenon may be related to the presence of a dynamic debris disk, perhaps perturbed by migrating planets. However, only 64 λ Boo stars are known, and those stars were discovered with different techniques, making it problematic to use that sample for statistical purposes, including determining the frequency of debris disks. The purpose of this paper is to derive a new sample of λ Boo stars using a technique that does not lead to biases with respect to the presence of infrared excesses. Through spectroscopic observations in the southern hemisphere, we have discovered 33 λ Boo stars and have confirmed 12 others. As a step toward determining the proportion of λ Boo stars with infrared excesses, we have used WISE data to examine the infrared properties of this sample out to 22 μ m. On this basis, we cannot conclude that λ Boo stars have a greater tendency than normal A-type stars to show infrared excesses. However, observing this sample at longer wavelengths may change that conclusion, as many λ Boo debris disks are cool and do not radiate strongly at 22 μ m.

  19. The Discovery of λ Bootis Stars: The Southern Survey I

    Gray, R. O.; Riggs, Q. S.; Koen, C.; Murphy, S. J.; Newsome, I. M.; Corbally, C. J.; Cheng, K.-P.; Neff, J. E.


    The λ Boo stars are a class of chemically peculiar Population I A-type stars characterized by under-abundances of the refractory elements, but near-solar abundances of carbon, nitrogen, oxygen, and sulfur. There is some evidence that λ Boo stars have higher frequencies of “bright” debris disks than normal A-type stars. The discovery of four exoplanets orbiting HR 8799, a λ Boo star with a resolved debris disk, suggests that the λ Boo phenomenon may be related to the presence of a dynamic debris disk, perhaps perturbed by migrating planets. However, only 64 λ Boo stars are known, and those stars were discovered with different techniques, making it problematic to use that sample for statistical purposes, including determining the frequency of debris disks. The purpose of this paper is to derive a new sample of λ Boo stars using a technique that does not lead to biases with respect to the presence of infrared excesses. Through spectroscopic observations in the southern hemisphere, we have discovered 33 λ Boo stars and have confirmed 12 others. As a step toward determining the proportion of λ Boo stars with infrared excesses, we have used WISE data to examine the infrared properties of this sample out to 22 μm. On this basis, we cannot conclude that λ Boo stars have a greater tendency than normal A-type stars to show infrared excesses. However, observing this sample at longer wavelengths may change that conclusion, as many λ Boo debris disks are cool and do not radiate strongly at 22 μm.


    C. Latry


    Full Text Available 17th of December 2011 from Kourou Space Centre, French Guyana. Like others high resolution optical satellites, it acquires both panchromatic images, with 70cm spatial resolution, and lower resolution multispectral images with 2.8m spatial resolution. Pleiades-HR is an optimized system, which means that the Modulation Transfer Function has a low value at Nyquist frequency, in order to reduce both the telescope diameter and aliasing effects. Shannon sampling condition is thus met at first order, which also makes classical ground processing, such as image matching or resampling, more justified for a mathematical point of view. Raw images are thus blurry which implies a deconvolution stage that restores sharpness but also increases the noise level in the high frequency domain. A denoising step, based upon wavelet packet coefficients thresholding/shrinkage technique, allows controlling the final noise level. Each of these methods includes numerous parameters that have to be assessed during the inflight commissioning period: deconvolution filter that depends on MTF assessment, instrumental noise model, noise level target for denoised images, wavelet packet decomposition level. This paper aims to precisely describe the deconvolution/denoising algorithms and how their main parameters have been set up during the inflight commissioning stage. Special attention will be given to structured noise induced by Pleiades-HR on board wavelet-based compression algorithm

  1. Search for white dwarf companions of cool stars with peculiar element abundances

    Boehm-Vitense, E.


    A search for a white dwarf companions of cool stars with peculiar element abundances was undertaken. One additional star the xi Cet, was found with a white dwarf companion. It was found that HR 1016, 56Uma, 16 Ser, have high excitation emission lines which indicate a high temperature object in the system. It is suggested that since these indications for high temperature companions were seen for all nearby Ba stars, it is highly probable that all Ba stars have white dwarf companions, and that the peculiar element abundances seen in the Ba stars are due to mass transfer. Observations, arguments and conclusions are presented. White dwarf companions were not found. Together with the Li and Be abundances and the chromospheric emission line spectra in these stars were studied. No white dwarf companions were seen for subgiant CH stars.

  2. Search for white dwarf companions of cool stars with peculiar element abundances

    Boehm-Vitense, E.


    A search for a white dwarf companions of cool stars with peculiar element abundances was undertaken. One additional star the xi Cet, was found with a white dwarf companion. It was found that HR 1016, 56Uma, 16 Ser, have high excitation emission lines which indicate a high temperature object in the system. It is suggested that since these indications for high temperature companions were seen for all nearby Ba stars, it is highly probable that all Ba stars have white dwarf companions, and that the peculiar element abundances seen in the Ba stars are due to mass transfer. Observations, arguments and conclusions are presented. White dwarf companions were not found. Together with the Li and Be abundances and the chromospheric emission line spectra in these stars were studied. No white dwarf companions were seen for subgiant CH stars

  3. Quark core stars, quark stars and strange stars

    Grassi, F.


    A recent one flavor quark matter equation of state is generalized to several flavors. It is shown that quarks undergo a first order phase transition. In addition, this equation of state depends on just one parameter in the two flavor case, two parameters in the three flavor case, and these parameters are constrained by phenomenology. This equation of state is then applied to the hadron-quark transition in neutron stars and the determination of quark star stability, the investigation of strange matter stability and possible strange star existence. 43 refs., 6 figs

  4. 76 FR 69712 - Application To Export Electric Energy; BP Energy Company


    ... DEPARTMENT OF ENERGY [OE Docket No. EA-315-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... BP Energy to transmit electric energy from the United States to Canada as a power marketer for a five...

  5. ENERGY STAR Certified Displays

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 7.0 ENERGY STAR Program Requirements for Displays that are effective as of July 1, 2016....

  6. ENERGY STAR Certified Boilers

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 3.0 ENERGY STAR Program Requirements for Boilers that are effective as of October 1,...

  7. ENERGY STAR Certified Televisions

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 7.0 ENERGY STAR Program Requirements for Televisions that are effective as of October 30,...

  8. ENERGY STAR Certified Dehumidifiers

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 4.0 ENERGY STAR Program Requirements for Dehumidifiers that are effective as of October...

  9. Observations of central stars

    Lutz, J.H.


    Difficulties occurring in the observation of central stars of planetary nebulae are reviewed with emphasis on spectral classifications and population types, and temperature determination. Binary and peculiar central stars are discussed. (U.M.G.)

  10. ENERGY STAR Certified Telephones

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 3.0 ENERGY STAR Program Requirements for Telephony (cordless telephones and VoIP...

  11. Wolf-Rayet stars

    Sahade, J


    Aspects of the problems of the Wolf-Rayet stars related to their chemical composition, their evolutionary status, and their apparent dichotomy in two spectral sequences are discussed. Dogmas concerning WR stars are critically discussed, including the belief that WR stars lack hydrogen, that they are helium stars evolved from massive close binaries, and the existence of a second WR stage in which the star is a short-period single-lined binary. The relationship of WR stars with planetary nebulae is addressed, as is the membership of these stars in clusters and associations. The division of WR stars into WN and WC sequences is considered, questioning the reasonability of accounting for WR line formation in terms of abundance differences.

  12. Star formation: Cosmic feast

    Scaringi, Simone


    Low-mass stars form through a process known as disk accretion, eating up material that orbits in a disk around them. It turns out that the same mechanism also describes the formation of more massive stars.

  13. Comparison of Microlife BP A200 Plus and Omron M6 blood pressure monitors to detect atrial fibrillation in hypertensive patients.

    Marazzi, Giuseppe; Iellamo, Ferdinando; Volterrani, Maurizio; Lombardo, Mauro; Pelliccia, Francesco; Righi, Daniela; Grieco, Fabrizia; Cacciotti, Luca; Iaia, Luigi; Caminiti, Giuseppe; Rosano, Giuseppe


    Self-monitoring home blood pressure (BP) devices are currently recommended for long-term follow-up of hypertension and its management. Some of these devices are integrated with algorithms aimed at detecting atrial fibrillation (AF), which is common essential hypertension. This study was designed to compare the diagnostic accuracy of two widely diffused home BP monitoring devices in detecting AF in an unselected population of outpatients referred to a hypertension clinic because of high BP. In 503 consecutive patients the authors simultaneously compared the accuracy of the Microlife(®) BP A200 Plus (Microlife) and the OMRON(®) M6 (OMRON) home BP devices, in detecting AF. Systolic and diastolic BP as well as heart rate (HR) values detected by the two devices were not significantly different. Pulse irregularity was detected in 124 and 112 patients with the OMRON M6 and Microlife BP A200 Plus devices, respectively. Simultaneous electrocardiogram (ECG) recording revealed that pulse irregularity was due to AF in 101 patients. Pulse irregularity detected by the OMRON M6 device corresponded to AF in 101, to supraventricular premature beats in 18, and to frequent premature ventricular beat in five patients, respectively. Pulse irregularity detected by the Microlife BP A200 Plus device corresponded to AF in 93, to supraventricular premature beats in 14, and to ventricular premature beats in five patients. The sensitivity for detecting AF was 100%, the specificity was 92%, and diagnostic accuracy 95% for the OMRON M6 and 100%, 92%, and 95 for the Microlife BP A200 Plus, respectively. AF was newly diagnosed by ECG recordings in 47 patients, and was detected in all patients by the OMRON device, and in 42 patients by the Microlife device. These results indicate that OMRON M6 is more accurate than Microlife BP A200 Plus in detecting AF in patients with essential hypertension. Widespread use of these devices in hypertensive patients could be of clinical benefit for the early

  14. Autonomous Star Tracker Algorithms

    Betto, Maurizio; Jørgensen, John Leif; Kilsgaard, Søren


    Proposal, in response to an ESA R.f.P., to design algorithms for autonomous star tracker operations.The proposal also included the development of a star tracker breadboard to test the algorithms performances.......Proposal, in response to an ESA R.f.P., to design algorithms for autonomous star tracker operations.The proposal also included the development of a star tracker breadboard to test the algorithms performances....

  15. Covering tree with stars

    Baumbach, Jan; Guo, Jian-Ying; Ibragimov, Rashid


    We study the tree edit distance problem with edge deletions and edge insertions as edit operations. We reformulate a special case of this problem as Covering Tree with Stars (CTS): given a tree T and a set of stars, can we connect the stars in by adding edges between them such that the resulting ...

  16. America's Star Libraries

    Lyons, Ray; Lance, Keith Curry


    "Library Journal"'s new national rating of public libraries, the "LJ" Index of Public Library Service, identifies 256 "star" libraries. It rates 7,115 public libraries. The top libraries in each group get five, four, or three Michelin guide-like stars. All included libraries, stars or not, can use their scores to learn from their peers and improve…

  17. Microdeletion/microduplication of proximal 15q11.2 between BP1 and BP2: a susceptibility region for neurological dysfunction including developmental and language delay.

    Burnside, Rachel D; Pasion, Romela; Mikhail, Fady M; Carroll, Andrew J; Robin, Nathaniel H; Youngs, Erin L; Gadi, Inder K; Keitges, Elizabeth; Jaswaney, Vikram L; Papenhausen, Peter R; Potluri, Venkateswara R; Risheg, Hiba; Rush, Brooke; Smith, Janice L; Schwartz, Stuart; Tepperberg, James H; Butler, Merlin G


    The proximal long arm of chromosome 15 has segmental duplications located at breakpoints BP1-BP5 that mediate the generation of NAHR-related microdeletions and microduplications. The classical Prader-Willi/Angelman syndrome deletion is flanked by either of the proximal BP1 or BP2 breakpoints and the distal BP3 breakpoint. The larger Type I deletions are flanked by BP1 and BP3 in both Prader-Willi and Angelman syndrome subjects. Those with this deletion are reported to have a more severe phenotype than individuals with either Type II deletions (BP2-BP3) or uniparental disomy 15. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes that are not imprinted. Reports of mutations or disturbed expression of these genes appear to impact behavioral and neurological function in affected individuals. Recently, reports of deletions and duplications flanked by BP1 and BP2 suggest an association with speech and motor delays, behavioral problems, seizures, and autism. We present a large cohort of subjects with copy number alteration of BP1 to BP2 with common phenotypic features. These include autism, developmental delay, motor and language delays, and behavioral problems, which were present in both cytogenetic groups. Parental studies demonstrated phenotypically normal carriers in several instances, and mildly affected carriers in others, complicating phenotypic association and/or causality. Possible explanations for these results include reduced penetrance, altered gene dosage on a particular genetic background, or a susceptibility region as reported for other areas of the genome implicated in autism and behavior disturbances.

  18. Validation of the Welch Allyn SureBP (inflation) and StepBP (deflation) algorithms by AAMI standard testing and BHS data analysis.

    Alpert, Bruce S


    We evaluated two new Welch Allyn automated blood pressure (BP) algorithms. The first, SureBP, estimates BP during cuff inflation; the second, StepBP, does so during deflation. We followed the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard for testing and data analysis. The data were also analyzed using the British Hypertension Society analysis strategy. We tested children, adolescents, and adults. The requirements of the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard were fulfilled with respect to BP levels, arm sizes, and ages. Association for the Advancement of Medical Instrumentation SP10 Method 1 data analysis was used. The mean±standard deviation for the device readings compared with auscultation by paired, trained, blinded observers in the SureBP mode were -2.14±7.44 mmHg for systolic BP (SBP) and -0.55±5.98 mmHg for diastolic BP (DBP). In the StepBP mode, the differences were -3.61±6.30 mmHg for SBP and -2.03±5.30 mmHg for DBP. Both algorithms achieved an A grade for both SBP and DBP by British Hypertension Society analysis. The SureBP inflation-based algorithm will be available in many new-generation Welch Allyn monitors. Its use will reduce the time it takes to estimate BP in critical patient care circumstances. The device will not need to inflate to excessive suprasystolic BPs to obtain the SBP values. Deflation is rapid once SBP has been determined, thus reducing the total time of cuff inflation and reducing patient discomfort. If the SureBP fails to obtain a BP value, the StepBP algorithm is activated to estimate BP by traditional deflation methodology.

  19. BP-Mobil partnership. The common network takes place



    After the partnership between BP and Mobil was signed, the program of transformation of the petrol stations network started in November 1996 in the UK and concern 3300 stations in Europe and 800 stations in France. About 9100 stations will be transformed by the end of 1998. BP France is the operator for petroleum products (petrol, fuel, bitumens, LPG..) with a 70% share holding (30% for Mobil) while Mobil is the major shareholder (51%) for the lubricants and special products activities. The chemical, aviation nd maritime activities are not concerned. Thanks to the fusion of their down-file activities in Europe, the benefits of the partnership should reach 600 to 700 million of US Dollars each year. However the restructuring cost should reach 740 millions of US Dollars in two years, which doubles the initial estimation. Short paper. (J.S.)

  20. Team and teamwork in modern european HR management

    Usheva Mariana


    Full Text Available One of the major issues occurring in every contemporary organization is the issue of the efficiency of work and obtaining maximum results from work done. Most often when the issue of increasing the efficiency of work is laid the question of teams and teamwork in various projectя of the company comes to the foreground and frequently no proper differentiation is made between a “group of people” and a “team” and this brings to a large number of misunderstandings of managers and employees with regard to the designation and benefits of team organization of work. There are clear traceable differences between the perception of the concept of “team” and the implementation of teamwork by European and Bulgarian companies and it is good to make the differentiation between them with a view to the HR management.

  1. Infrared observations of RS CVn stars

    Berriman, G.; De Campli, W.M.; Werner, M.W.; Hatchett, S.P.


    Infrared photometry is presented of the RS CVn binary stars AR Lac (1.2-10 μm) and MM Her (1.2-3.5 μm) as they egressed from their primary and secondary eclipses; of the eclipsing systems RS CVn and Z Her at maximum light (1.2-10 μm) and of the non-eclipsing systems UX Ari and HR 1099 (1.2-10 μm). An analysis of these and published V data based on flux ratio diagrams (linear analogues of colour-colour diagrams) shows that G and K stars supply the infrared light of these systems. None of these systems shows infrared emission from circumstellar matter. (author)

  2. Evolution of helium rich stars with hydrogen burning

    Roeser, M.


    Evolutionary tracks of stars with an initial chemical composition X = 0.100, Y = 0.8790, Z = 0.021 are calculated for masses of 0.35 M(sun), 0.66 M(sun), 1.00 M(sun), 2.00 M(sun), and 5.00 M(sun) and with X = 0.302, Y = 0.677, Z = 0.021 for masses of 1.00 M(sun), 3.00 M(sun), and 5.00 M(sun). The evolution is followed from hydrogen burning to helium burning and to carbon burning when the occasion arises. The data of evolution are presented and compared with normal Population I-stars. The helium rich stars show higher effective temperatures, much higher luminosities and therefore shorter time scales. They are situated in regions of the HR-diagram where observed helium stars are found. (orig.) [de

  3. EST Table: BP183868 [KAIKOcDNA[Archive

    Full Text Available BP183868 P5PG0462 10/09/28 50 %/126 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 P5PG ...

  4. EST Table: BP126151 [KAIKOcDNA[Archive

    Full Text Available BP126151 ps4M0084 10/09/28 52 %/232 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 ps4M ...

  5. EST Table: BP182659 [KAIKOcDNA[Archive

    Full Text Available BP182659 NRPG0886 10/09/28 51 %/153 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 NRPG ...

  6. Bank Organizational Structure Choice Dilemma. Case of PKO BP

    Adam Szafarczyk


    Full Text Available Organizational structures are differing for different banks. They depend on individual bank economic situation, its technology, strategy and form of competition struggle. Usually the biggest EU banks are consists from formally or really independent divisions. The most common divisions are Retail Banking, Corporate Banking, Treasury and Investment, sometimes Insurance. PKO BP, the biggest Polish Bank, ought to change its structure due to implementation new IT system.

  7. EST Table: BP125370 [KAIKOcDNA[Archive

    Full Text Available 10 56 %/150 aa gi|189241063|ref|XP_967018.2| PREDICTED: similar to restin (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] FS906662 fbpv ... ...n (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] 10/08/29 55...BP125370 fbpv0758 10/09/28 56 %/150 aa ref|XP_967018.2| PREDICTED: similar to resti

  8. EST Table: BP182152 [KAIKOcDNA[Archive

    Full Text Available BP182152 NRPG0186 10/09/28 87 %/125 aa ref|NP_001098702.1| nanos-like protein [Bomb...yx mori] gb|ABS17681.1| nanos-like protein [Bombyx mori] 10/08/29 low homology 10/08/28 n.h 10/09/10 low homology 10/09/10 low homology 10/09/10 low homology NM_001105232 NRPG ...

  9. Bringing human resources to the table: utilization of an HR balanced scorecard at Mayo Clinic.

    Fottler, Myron D; Erickson, Eric; Rivers, Patrick A


    Rather than viewing HR as a critical driver of organizational strategy and outcomes, most health care organizations see HR as a drain on the organization's bottom line. Only by aligning HR with the organizational strategy will HR leaders truly get a seat at the leadership table. HR professionals can overcome impediments and gain a seat at the table by learning the language of business and the ways in which organizational leaders use data to drive their decisions. This article shows how Mayo Clinic uses the popular Balanced Scorecard approach to align its measures of HR performance to the organization's strategic plan.

  10. BP Canada Energy Company energy efficiency and GHG reduction opportunities

    Forsyth, B. [BP Canada Energy Company, Calgary, AB (Canada)


    This paper presented an outline of the BP Canada Energy Company's energy efficiency program, which uses an innovative approach that relies on front line operations staff to generate, evaluate and implement ideas for energy reduction projects. An outline of the organization team was presented, with details of the small central Calgary group responsible for coordination, technical support and tracking of data. Key objectives of the team were identified as: the promotion of energy efficiency; sharing of best practices; and coordination of efforts at operations at both the development and corporate level. An outline of BP upstream operations and emissions reduction strategies was provided along with a timeline of BP Canada greenhouse gas (GHG) emissions and sustainable reductions projects. A chart representing energy savings through conversion to natural gas was also presented, sorted by project type. Results included over 400 GHG or energy reduction projects completed, with an average pay out of 30 months as well as 300,000 tonnes equivalent of GHGs reduced at an estimated value of of $13,000,000. Areas of focus for future projects include: compression; fired equipment; flaring; venting; and fugitive emissions. Strategies to reduce emissions in all areas of future research were also provided. tabs, figs.

  11. White Dwarf Stars

    Kepler, S. O.; Romero, Alejandra Daniela; Pelisoli, Ingrid; Ourique, Gustavo


    White dwarf stars are the final stage of most stars, born single or in multiple systems. We discuss the identification, magnetic fields, and mass distribution for white dwarfs detected from spectra obtained by the Sloan Digital Sky Survey up to Data Release 13 in 2016, which lead to the increase in the number of spectroscopically identified white dwarf stars from 5000 to 39000. This number includes only white dwarf stars with log g >= 6.5 stars, i.e., excluding the Extremely Low Mass white dw...

  12. Rotating Stars in Relativity

    Stergioulas Nikolaos


    Full Text Available Rotating relativistic stars have been studied extensively in recent years, both theoretically and observationally, because of the information they might yield about the equation of state of matter at extremely high densities and because they are considered to be promising sources of gravitational waves. The latest theoretical understanding of rotating stars in relativity is reviewed in this updated article. The sections on the equilibrium properties and on the nonaxisymmetric instabilities in f-modes and r-modes have been updated and several new sections have been added on analytic solutions for the exterior spacetime, rotating stars in LMXBs, rotating strange stars, and on rotating stars in numerical relativity.

  13. Nuclear physics of stars

    Iliadis, Christian


    Most elements are synthesized, or ""cooked"", by thermonuclear reactions in stars. The newly formed elements are released into the interstellar medium during a star's lifetime, and are subsequently incorporated into a new generation of stars, into the planets that form around the stars, and into the life forms that originate on the planets. Moreover, the energy we depend on for life originates from nuclear reactions that occur at the center of the Sun. Synthesis of the elements and nuclear energy production in stars are the topics of nuclear astrophysics, which is the subject of this book

  14. Spectrographic study of λ 4200 silicon particular stars

    Didelon, Pierre


    This research thesis reports a spectrographic study of sample of particular stars belonging to the Si(II) λ 4200 subgroup which builds up the hot end of conventional 'Ap,Bp' stars. Twenty snapshots taken at the Haute-Provence observatory have been studied and compared with the observation of 17 standard stars. All these snapshots have been digitalised and processed. This allowed the identification of lines which indicated the presence of gallium and the absence of manganese which contradicts the close correlation between these elements that was generally admitted. An inexplicable and until now non observed duplication of Si(II) lines has also been observed. The problem of spectral classification of these stars has been studied. In order to study the concerned stars without calculation of atmospheric models, a comparative method between group stars and reference stars has been used. Results are discussed and seem to indicate an erratic and non-correlated behaviour of light elements (C, Mg, Ca, Si), and a presence of heavier elements (Ga, Sr) and rare earths (Eu, Gd) only when elements of the iron peak are stronger [fr

  15. Evolution of variable stars

    Becker, S.A.


    Throughout the domain of the H R diagram lie groupings of stars whose luminosity varies with time. These variable stars can be classified based on their observed properties into distinct types such as β Cephei stars, δ Cephei stars, and Miras, as well as many other categories. The underlying mechanism for the variability is generally felt to be due to four different causes: geometric effects, rotation, eruptive processes, and pulsation. In this review the focus will be on pulsation variables and how the theory of stellar evolution can be used to explain how the various regions of variability on the H R diagram are populated. To this end a generalized discussion of the evolutionary behavior of a massive star, an intermediate mass star, and a low mass star will be presented. 19 refs., 1 fig., 1 tab

  16. Star-Branched Polymers (Star Polymers)

    Hirao, Akira; Hayashi, Mayumi; Ito, Shotaro; Goseki, Raita; Higashihara, Tomoya; Hadjichristidis, Nikolaos


    The synthesis of well-defined regular and asymmetric mixed arm (hereinafter miktoarm) star-branched polymers by the living anionic polymerization is reviewed in this chapter. In particular, much attention is being devoted to the synthetic

  17. Star-Branched Polymers (Star Polymers)

    Hirao, Akira


    The synthesis of well-defined regular and asymmetric mixed arm (hereinafter miktoarm) star-branched polymers by the living anionic polymerization is reviewed in this chapter. In particular, much attention is being devoted to the synthetic development of miktoarm star polymers since 2000. At the present time, the almost all types of multiarmed and multicomponent miktoarm star polymers have become feasible by using recently developed iterative strategy. For example, the following well-defined stars have been successfully synthesized: 3-arm ABC, 4-arm ABCD, 5-arm ABCDE, 6-arm ABCDEF, 7-arm ABCDEFG, 6-arm ABC, 9-arm ABC, 12-arm ABC, 13-arm ABCD, 9-arm AB, 17-arm AB, 33-arm AB, 7-arm ABC, 15-arm ABCD, and 31-arm ABCDE miktoarm star polymers, most of which are quite new and difficult to synthesize by the end of the 1990s. Several new specialty functional star polymers composed of vinyl polymer segments and rigid rodlike poly(acetylene) arms, helical polypeptide, or helical poly(hexyl isocyanate) arms are introduced.

  18. Aquifer test plan for the 100-HR-3 Operable Unit

    Swanson, L.C.; Hartman, M.J.


    This test plan directs hydrologic testing activities planned at three existing Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) wells in the 100-HR-3 Operable Unit of the Hanford Site. Three additional wells will be installed near these existing wells and used as additional testing arid observation points during the field activities. Figure 1 shows the locations of the three test sites. A primary objective of the testing program is to provide more detailed hydraulic characterization information for the unconfined aquifer and targeted test sites than provided by the initial reconnaissance-level slug testing of Vukelich. A second objective is to evaluate the applicability of slug interference and dipole flow tests for detailed hydraulic characterization in an unconfined aquifer. This aquifer testing program will also be useful for substantiating hydraulic conductivities reported from previous slug tests and evaluating the effects of filter pack volume/configuration on slug test data. Vukelich recommended additional testing to address the latter two issues

  19. Feasibility study report for the 200-BP-1 operable unit


    This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9x10 -5

  20. Feasibility study report for the 200-BP-1 operable unit


    This feasibility study (FS) examines a range of alternatives and provides recommendations for selecting a preferred altemative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965-1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-:levels of contamination with cesium-137, radium-226, strontium-90, thorium-228 and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9 x 10 5

  1. Feasibility study report for the 200-BP-1 operable unit


    This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9{times}10{sup {minus}5}.

  2. Evolution of massive stars in very young clusters and associations

    Stothers, R.B.


    The stellar content of very young galactic clusters and associations with well-determined ages has been analyzed statistically to derive information about stellar evolution at high masses. The adopted approach is semiempirical and uses natural spectroscopic groups of stars on the H-R diagram, together with the stars' apparent magnitudes. Cluster distance moduli are not used. Only the most basic elements of stellar evolution theory are required as input. For stellar aggregates with main-sequence turnups at spectral types between O9 and B2, the following conclusions have emerged: (1) O-type main-sequence stars evolve to a spectral type of B1 during core hydrogen burning; (2) most of the O-type blue stragglers are newly formed massive stars, burning core hydrogen; (3) supergiants lying redward of the turnup, as well as most, or all, of the Wolf-Rayet stars, are burning core helium; (4) Wolf-Rayet stars originally had masses greater than 30--40 M/sub sun/, while known M-type supergiants evolved from star less massive than approx.30 M/sub sun/; (5) phases of evolution following core helium burning are unobservably rapid, presumably on account of copious neutrino emission; and (6) formation of stars of high mass continues vigorously in most young clusters and association for approx.8 x 10 6 yr. The important result concerning the evolutionary status of the supergiants depends only on the total number of these stars and not on how they are distributed between blue and red types; the result, however, may be sensitive to the assumed amount of convective core overshooting. Conclusions in the present work refer chiefly to luminous stars in the mass range 10--40 M/sub sun/, belonging to aggregates in the age range (6--25) x 10 6 yr

  3. BP and sustainable development and biodiversity in Azerbaijan

    Grant, Vidrine; Askerov, Faig


    Full text: BP takes its commitment to the environmental extremely seriously. BP believes it is essential to ensure that our operations and activities comply with the environmental standards in our PSAs and with the laws of Azerbaijan. To achieve this we have developed Environmental Operating Procedures. These procedures are currently being audited and we expect to receive ISO 14001 certification for all of our operations. Together with our Emergency Response and Oil Spill Response Plans we are able to manage our operations to ensure minimum impact and regulatory compliance. Additional, AIOC contributed to opening the Caspian Environmental Laboratory in 1999 to provide on a commercial basis, environmental services in Azerbaijan of an internationally recognized standard. We have conducted many other activities to promote biodiversity. In absence of the appropriate infrastructure we have built a waste management site at Serenja where we are currently disposing of synthetic based muds from our offshore drilling operations. We have also developed and implemented a Research and Monitoring Program in co-operation with representatives from SOCAR, Academy of Sciences, Azgipromorneftegaz and State Committee of Ecology. We have conducted Seals mortality investigation, Birds monitoring, Fish monitoring, Offshore surveys studying macrobenthos, water chemistry, sediments, groundwater monitoring, re-vegetation, etc. In developing our overall strategy BP has set some long term environmental aspirations or expectations: stop the use of halocarbons; to reduce Green House Gases by 10% by 20 lOin comparison with baseline data for 1990; stop venting and flaring; stop discharges to water of synthetic and oil based muds. BP recognizes that this is a goal. It is something we commit to and aspire to achieve and something we are wise enough to realize cannot be achieved overnight. None-the-less, it is something we constantly work towards. We also realize that this goal cannot be achieved in

  4. Risk assessment of logistics outsourcing based on BP neural network

    Liu, Xiaofeng; Tian, Zi-you

    The purpose of this article is to evaluate the risk of the enterprises logistics outsourcing. To get this goal, the paper first analysed he main risks existing in the logistics outsourcing, and then set up a risk evaluation index system of the logistics outsourcing; second applied BP neural network into the logistics outsourcing risk evaluation and used MATLAB to the simulation. It proved that the network error is small and has strong practicability. And this method can be used by enterprises to evaluate the risks of logistics outsourcing.

  5. EST Table: BP183486 [KAIKOcDNA[Archive

    Full Text Available n (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] 10/08/29 56...43 aa gnl|Amel|GB30360-PB 10/09/10 54 %/174 aa gi|189241063|ref|XP_967018.2| PREDICTED: similar to restin (Reed-Steinberg cell-expres...sed intermediate filament-associated protein) [Tribolium castaneum] FS906662 NRPG ... ...BP183486 NRPG1970 10/09/28 54 %/174 aa ref|XP_967018.2| PREDICTED: similar to resti

  6. Rotational and translational distortions of the crystal structure of the Sr{sub 2}HrRuO{sub 6} (Hr = Ho, Dy, Gd, Eu) complex perovskites

    Triana, C.A., E-mail: [Grupo de Física de Nuevos Materiales, Departamento de Física, Universidad Nacional de Colombia, A.A. 5997, Bogotá D.C. (Colombia); Landínez Téllez, D.A. [Grupo de Física de Nuevos Materiales, Departamento de Física, Universidad Nacional de Colombia, A.A. 5997, Bogotá D.C. (Colombia); Roa-Rojas, J., E-mail: [Grupo de Física de Nuevos Materiales, Departamento de Física, Universidad Nacional de Colombia, A.A. 5997, Bogotá D.C. (Colombia)


    Sr{sub 2}HrRuO{sub 6} (Hr = Ho, Dy, Gd, Eu) complex perovskites were synthesized through the high-temperature solid-state reaction method, and their crystal structures were analyzed in detail as a function of the Hr-cation ionic radius. Results of powder XRD pattern measurement and Rietveld analysis of the experimental profiles show that the Sr{sub 2}HrRuO{sub 6} compounds crystallize in a monoclinic distorted perovskite-like structure, P2{sub 1}/n (#14) space group, where the unit cell parameters are related to the primitive unit cell a{sub p} by a≈√(2)a{sub p}, b≈√(2)a{sub p} and c ≈ 2a{sub p}. The structures show an alternate distribution of the Ru{sup 5+} (2d: 0.5, 0, 0) and Hr{sup 3+} (2c: 0, 0.5, 0) making up RuO{sub 6} and HrO{sub 6} octahedra alternatively arranged in two interleaving fcc sublattices, where the O(1), O(2), and O(3) ions are localized at the corner of the octahedral, while the Sr{sup 2+} is located at the A-site, occupying the cavities built by the corner-sharing octahedra with Wyckoff position 4e. Due to the existence of mismatched ionic sizes between the ionic radii of the Sr{sub 2}HrRuO{sub 6} compounds, the HrO{sub 6} and RuO{sub 6} octahedra are constrained to tilting around the [111]{sub c}, [001]{sub c}, and [110]{sub c} cubic directions so as to optimize the Sr–O inter-atomic bond lengths, tending to rotate the structure in order to fix the Ru{sup 5+} and Hr{sup 3+} ions on the M′ and M″ sites of the complex perovskites. The cell parameters a, b, and c, the inter-atomic bond angles, the inter-atomic bond lengths, and the tilting angles increase as the Hr-cation ionic radius increases. The mismatch that exists in the Sr{sub 2}HrRuO{sub 6} ionic radius produces a large distortion from the ideal cubic symmetry. The pure perovskite-like phase of Sr{sub 2}HrRuO{sub 6} is thermodynamically and kinetically stable at high temperatures above 1420 K, where it is entirely governed by the average size of the Hr{sup 3+} and Ru

  7. Rotational and translational distortions of the crystal structure of the Sr2HrRuO6 (Hr = Ho, Dy, Gd, Eu) complex perovskites

    Triana, C.A.; Landínez Téllez, D.A.; Roa-Rojas, J.


    Sr 2 HrRuO 6 (Hr = Ho, Dy, Gd, Eu) complex perovskites were synthesized through the high-temperature solid-state reaction method, and their crystal structures were analyzed in detail as a function of the Hr-cation ionic radius. Results of powder XRD pattern measurement and Rietveld analysis of the experimental profiles show that the Sr 2 HrRuO 6 compounds crystallize in a monoclinic distorted perovskite-like structure, P2 1 /n (#14) space group, where the unit cell parameters are related to the primitive unit cell a p by a≈√(2)a p , b≈√(2)a p and c ≈ 2a p . The structures show an alternate distribution of the Ru 5+ (2d: 0.5, 0, 0) and Hr 3+ (2c: 0, 0.5, 0) making up RuO 6 and HrO 6 octahedra alternatively arranged in two interleaving fcc sublattices, where the O(1), O(2), and O(3) ions are localized at the corner of the octahedral, while the Sr 2+ is located at the A-site, occupying the cavities built by the corner-sharing octahedra with Wyckoff position 4e. Due to the existence of mismatched ionic sizes between the ionic radii of the Sr 2 HrRuO 6 compounds, the HrO 6 and RuO 6 octahedra are constrained to tilting around the [111] c , [001] c , and [110] c cubic directions so as to optimize the Sr–O inter-atomic bond lengths, tending to rotate the structure in order to fix the Ru 5+ and Hr 3+ ions on the M′ and M″ sites of the complex perovskites. The cell parameters a, b, and c, the inter-atomic bond angles, the inter-atomic bond lengths, and the tilting angles increase as the Hr-cation ionic radius increases. The mismatch that exists in the Sr 2 HrRuO 6 ionic radius produces a large distortion from the ideal cubic symmetry. The pure perovskite-like phase of Sr 2 HrRuO 6 is thermodynamically and kinetically stable at high temperatures above 1420 K, where it is entirely governed by the average size of the Hr 3+ and Ru 5+ cations. Highlights: ► Crystal structure of Sr 2 HrRuO 6 (Hr = Ho, Dy, Gd, Eu) as a function of Hr ionic radius. ► XRD

  8. Assembly of human C-terminal binding protein (CtBP) into tetramers.

    Bellesis, Andrew G; Jecrois, Anne M; Hayes, Janelle A; Schiffer, Celia A; Royer, William E


    C-terminal binding protein 1 (CtBP1) and CtBP2 are transcriptional coregulators that repress numerous cellular processes, such as apoptosis, by binding transcription factors and recruiting chromatin-remodeling enzymes to gene promoters. The NAD(H)-linked oligomerization of human CtBP is coupled to its co-transcriptional activity, which is implicated in cancer progression. However, the biologically relevant level of CtBP assembly has not been firmly established; nor has the stereochemical arrangement of the subunits above that of a dimer. Here, multi-angle light scattering (MALS) data established the NAD + - and NADH-dependent assembly of CtBP1 and CtBP2 into tetramers. An examination of subunit interactions within CtBP1 and CtBP2 crystal lattices revealed that both share a very similar tetrameric arrangement resulting from assembly of two dimeric pairs, with specific interactions probably being sensitive to NAD(H) binding. Creating a series of mutants of both CtBP1 and CtBP2, we tested the hypothesis that the crystallographically observed interdimer pairing stabilizes the solution tetramer. MALS data confirmed that these mutants disrupt both CtBP1 and CtBP2 tetramers, with the dimer generally remaining intact, providing the first stereochemical models for tetrameric assemblies of CtBP1 and CtBP2. The crystal structure of a subtle destabilizing mutant suggested that small structural perturbations of the hinge region linking the substrate- and NAD-binding domains are sufficient to weaken the CtBP1 tetramer. These results strongly suggest that the tetramer is important in CtBP function, and the series of CtBP mutants reported here can be used to investigate the physiological role of the tetramer. © 2018 Bellesis et al.

  9. Evolution of massive stars

    Loore, C. de


    The evolution of stars with masses larger than 15 sun masses is reviewed. These stars have large convective cores and lose a substantial fraction of their matter by stellar wind. The treatment of convection and the parameterisation of the stellar wind mass loss are analysed within the context of existing disagreements between theory and observation. The evolution of massive close binaries and the origin of Wolf-Rayet Stars and X-ray binaries is also sketched. (author)

  10. The Phases Differential Astrometry Data Archive. 4. The Triple Star Systems 63 Gem A and HR 2896


    3450 Massachusetts Avenue, NW, Washington, DC 20392-5420, USA; wih 5 Division of Physics, Mathematics and Astronomy, 105-24, California...presented to aid in constraining the orbit and measuring the stellar masses. In fact, 63 Gem itself is a sextuple system: the hierarchical triple...that mutual inclination measurements have been rare is because of the observational challenges these sys- tems present. RV signals are largest for

  11. Fast pulsars, strange stars

    Glendenning, N.K.


    The initial motivation for this work was the reported discovery in January 1989 of a 1/2 millisecond pulsar in the remnant of the spectacular supernova, 1987A. The status of this discovery has come into grave doubt as of data taken by the same group in February, 1990. At this time we must consider that the millisecond signal does not belong to the pulsar. The existence of a neutron star in remnant of the supernova is suspected because of recent observations on the light curve of the remnant, and of course by the neutrino burst that announced the supernova. However its frequency is unknown. I can make a strong case that a pulsar rotation period of about 1 ms divides those that can be understood quite comfortably as neutron stars, and those that cannot. What we will soon learn is whether there is an invisible boundary below which pulsar periods do not fall, in which case, all are presumable neutron stars, or whether there exist sub- millisecond pulsars, which almost certainly cannot be neutron stars. Their most plausible structure is that of a self-bound star, a strange-quark-matter star. The existence of such stars would imply that the ground state of the strong interaction is not, as we usually assume, hadronic matter, but rather strange quark matter. Let us look respectively at stars that are bound only by gravity, and hypothetical stars that are self-bound, for which gravity is so to speak, icing on the cake

  12. Covering tree with stars

    Baumbach, Jan; Guo, Jiong; Ibragimov, Rashid


    We study the tree edit distance problem with edge deletions and edge insertions as edit operations. We reformulate a special case of this problem as Covering Tree with Stars (CTS): given a tree T and a set of stars, can we connect the stars in by adding edges between them such that the resulting...... tree is isomorphic to T? We prove that in the general setting, CST is NP-complete, which implies that the tree edit distance considered here is also NP-hard, even when both input trees having diameters bounded by 10. We also show that, when the number of distinct stars is bounded by a constant k, CTS...

  13. Introduction to neutron stars

    Lattimer, James M. [Dept. of Physics and Astronomy, Stony Brook University, Stony Brook, NY 11794-3800 (United States)


    Neutron stars contain the densest form of matter in the present universe. General relativity and causality set important constraints to their compactness. In addition, analytic GR solutions are useful in understanding the relationships that exist among the maximum mass, radii, moments of inertia, and tidal Love numbers of neutron stars, all of which are accessible to observation. Some of these relations are independent of the underlying dense matter equation of state, while others are very sensitive to the equation of state. Recent observations of neutron stars from pulsar timing, quiescent X-ray emission from binaries, and Type I X-ray bursts can set important constraints on the structure of neutron stars and the underlying equation of state. In addition, measurements of thermal radiation from neutron stars has uncovered the possible existence of neutron and proton superfluidity/superconductivity in the core of a neutron star, as well as offering powerful evidence that typical neutron stars have significant crusts. These observations impose constraints on the existence of strange quark matter stars, and limit the possibility that abundant deconfined quark matter or hyperons exist in the cores of neutron stars.

  14. Strangeon and Strangeon Star

    Xiaoyu, Lai; Renxin, Xu


    The nature of pulsar-like compact stars is essentially a central question of the fundamental strong interaction (explained in quantum chromo-dynamics) at low energy scale, the solution of which still remains a challenge though tremendous efforts have been tried. This kind of compact objects could actually be strange quark stars if strange quark matter in bulk may constitute the true ground state of the strong-interaction matter rather than 56Fe (the so-called Witten’s conjecture). From astrophysical points of view, however, it is proposed that strange cluster matter could be absolutely stable and thus those compact stars could be strange cluster stars in fact. This proposal could be regarded as a general Witten’s conjecture: strange matter in bulk could be absolutely stable, in which quarks are either free (for strange quark matter) or localized (for strange cluster matter). Strange cluster with three-light-flavor symmetry is renamed strangeon, being coined by combining “strange nucleon” for the sake of simplicity. A strangeon star can then be thought as a 3-flavored gigantic nucleus, and strangeons are its constituent as an analogy of nucleons which are the constituent of a normal (micro) nucleus. The observational consequences of strangeon stars show that different manifestations of pulsarlike compact stars could be understood in the regime of strangeon stars, and we are expecting more evidence for strangeon star by advanced facilities (e.g., FAST, SKA, and eXTP).

  15. Interacting binary stars

    Sahade, Jorge; Ter Haar, D


    Interacting Binary Stars deals with the development, ideas, and problems in the study of interacting binary stars. The book consolidates the information that is scattered over many publications and papers and gives an account of important discoveries with relevant historical background. Chapters are devoted to the presentation and discussion of the different facets of the field, such as historical account of the development in the field of study of binary stars; the Roche equipotential surfaces; methods and techniques in space astronomy; and enumeration of binary star systems that are studied

  16. Polarization of Be stars

    Johns, M.W.


    Linear polarization of starlight may be produced by electron scattering in the extended atmospheres of early type stars. Techniques are investigated for the measurement and interpretation of this polarization. Polarimetric observations were made of twelve visual double star systems in which at least one member was a B type star as a means of separating the intrinsic stellar polarization from the polarization produced in the interstellar medium. Four of the double stars contained a Be star. Evidence for intrinsic polarization was found in five systems including two of the Be systems, one double star with a short period eclipsing binary, and two systems containing only normal early type stars for which emission lines have not been previously reported. The interpretation of these observations in terms of individual stellar polarizations and their wavelength dependence is discussed. The theoretical basis for the intrinsic polarization of early type stars is explored with a model for the disk-like extended atmospheres of Be stars. Details of a polarimeter for the measurement of the linear polarization of astronomical point sources are also presented with narrow band (Δ lambda = 100A) measurements of the polarization of γ Cas from lambda 4000 to lambda 5800

  17. ENERGY STAR Unit Reports

    Department of Housing and Urban Development — These quarterly Federal Fiscal Year performance reports track the ENERGY STAR qualified HOME units that Participating Jurisdictions record in HUD's Integrated...

  18. Effect of turmeric and curcumin on BP-DNA adducts.

    Mukundan, M A; Chacko, M C; Annapurna, V V; Krishnaswamy, K


    Many human cancers that are widely prevalent today can be prevented through modifications in life-styles, of which diet appears to be an important agent. Several dietary constituents modulate the process of carcinogenesis and prevent genotoxicity. Many plant constituents including turmeric appear to be potent antimutagens and antioxidants. Therefore the modulatory effects of turmeric and curcumin on the levels of benzo[a]pyrene induced DNA adducts in the livers of rats were studied by the newly developed 32P-postlabelling assay method. Turmeric when fed at 0.1, 0.5 and 3% and the active principle of turmeric (curcumin) when fed at a level of 0.03% in the diet for 4 weeks significantly reduced the level of BP-DNA adducts including the major adduct dG-N2-BP, formed within 24 h in response to a single i.p. injection of benzo[a]pyrene. The significance of these effects in terms of the potential anticarcinogenic effects of turmeric is discussed. Further, these results strengthen the various other biological effects of turmeric which have direct relevance to anticarcinogenesis and chemoprevention.

  19. Research on AHP decision algorithms based on BP algorithm

    Ma, Ning; Guan, Jianhe


    Decision making is the thinking activity that people choose or judge, and scientific decision-making has always been a hot issue in the field of research. Analytic Hierarchy Process (AHP) is a simple and practical multi-criteria and multi-objective decision-making method that combines quantitative and qualitative and can show and calculate the subjective judgment in digital form. In the process of decision analysis using AHP method, the rationality of the two-dimensional judgment matrix has a great influence on the decision result. However, in dealing with the real problem, the judgment matrix produced by the two-dimensional comparison is often inconsistent, that is, it does not meet the consistency requirements. BP neural network algorithm is an adaptive nonlinear dynamic system. It has powerful collective computing ability and learning ability. It can perfect the data by constantly modifying the weights and thresholds of the network to achieve the goal of minimizing the mean square error. In this paper, the BP algorithm is used to deal with the consistency of the two-dimensional judgment matrix of the AHP.

  20. Do line managers’ have ‘linking pin’ in HR roles?

    Mohamed Ayyub Hassan


    Full Text Available Purpose: The present article aims to identify the possible line managers’ involvement factors in human resource (HR initiatives and its ‘linking pin’ to the HR roles. In this regard, few factors have been considered pertinent to line managers’ involvement factors in HR initiatives which are desire, self-efficacy, and HR support. Whereas, the considered dimensions of HR roles reviewed are strategic partner, change agent, employee champion, and administrative expert. Design/methodology/approach: The paper intends to provide a conceptual review of the past literature in the areas of HR roles and line managers and further justify the proposed conceptual framework that will move this work further. Findings: The review also showed that HR devolution to line managers will boost line managers’ participation and responsibility to practice HR roles at the workplace. Research limitations/implications: The main limitation of this review is no empirical evidence provided by the authors to support the literature of the article. All the provided literature is written based on the findings gained from the previous studies. Practical implications: Line managers’ involvement in HR Initiatives can increase the competency diversity among line manager. This in turn can help the organization to operate at high efficiency. Originality/value: There is a notable lack of research conducted to identify line managers’ involvement in HR. Therefore, this article contributes to the literature on the relationship between line managers and HR roles.

  1. Cold DUst around NEarby Stars (DUNES). First results. A resolved exo-Kuiper belt around the solar-like star ζ2 Ret

    Eiroa, C.; Fedele, D.; Maldonado, J.; Gonzalez-Garcia, B. M.; Rodmann, J.; Heras, A. M.; Pilbratt, G. L.; Augereau, J. -Ch.; Mora, A.; Montesinos, B.; Ardila, D.; Bryden, G.; Liseau, R.; Stapelfeldt, K.; Launhardt, R.; Solano, E.; Bayo, A.; Absil, O.; Arevalo, M.; Barrado, D.; Beichmann, C.; Danchi, W.; del Burgo, C.; Ertel, S.; Fridlund, M.; Fukagawa, M.; Gutierrez, R.; Gruen, E.; Kamp, I.; Krivov, A.; Lebreton, J.; Loehne, T.; Lorente, R.; Marshall, J.; Martinez-Arnaiz, R.; Meeus, G.; Montes, D.; Morbidelli, A.; Mueller, S.; Mutschke, H.; Nakagawa, T.; Olofsson, G.; Ribas, I.; Roberge, A.; Sanz-Forcada, J.; Thebault, P.; White, G. J.; Wolf, S.; Walker, H.

    We present the first far-IR observations of the solar-type stars δ Pav, HR 8501, 51 Peg and ζ2 Ret, taken within the context of the DUNES Herschel open time key programme (OTKP). This project uses the PACS and SPIRE instruments with the objective of studying infrared excesses due to exo-Kuiper belts

  2. Transgenic mice display hair loss and regrowth overexpressing mutant Hr gene.

    Zhu, Kuicheng; Xu, Cunshuan; Zhang, Jintao; Chen, Yingying; Liu, Mengduan


    Mutations in the hairless (Hr) gene in both mice and humans have been implicated in the development of congenital atrichia, but the role of Hr in skin and hair follicle (HF) biology remains unknown. Here, we established transgenic mice (TG) overexpressing mutant Hr to investigate its specific role in the development of HF. Three transgenic lines were successfully constructed, and two of them (TG3 and TG8) displayed a pattern of hair loss and regrowth with alternation in the expression of HR protein. The mutant Hr gene inhibited the expression of the endogenous gene in transgenic individuals, which led to the development of alopecia. Interestingly, the hair regrew with the increase in the endogenous expression levels resulting from decreased mutant Hr expression. The findings of our study indicate that the changes in the expression of Hr result in hair loss or regrowth.


    Oppenheimer, B. R.; Beichman, C.; Brenner, D.; Nilsson, R.; Parry, I. R.; Rice, E. [Astrophysics Department, American Museum of Natural History, Central Park West at 79th Street, New York, NY 10024 (United States); Baranec, C.; Dekany, R.; Hale, D. [Caltech Optical Observatories, California Institute of Technology, Pasadena, CA 91125 (United States); Burruss, R.; Cady, E.; Ligon, E. R.; Lockhart, T. [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Dr., Pasadena CA 91109 (United States); Crepp, J. R.; Hillenbrand, L.; Hinkley, S. [Department of Astronomy, California Institute of Technology, 1200 E. California Blvd, MC 249-17, Pasadena, CA 91125 (United States); Fergus, R. [Department of Computer Science, Courant Institute of Mathematical Sciences, New York University, 715 Broadway, New York, NY 10003 (United States); Hogg, David W. [Center for Cosmology and Particle Physics, Department of Physics, New York University, 4 Washington Place, New York, NY 10003 (United States); King, D. [Institute of Astronomy, Cambridge University, Madingley Road, Cambridge CB3 0HA (United Kingdom); Pueyo, L., E-mail: [Department of Physics and Astronomy, The Johns Hopkins University, Baltimore, MD 21218 (United States); and others


    We obtained spectra in the wavelength range {lambda} = 995-1769 nm of all four known planets orbiting the star HR 8799. Using the suite of instrumentation known as Project 1640 on the Palomar 5 m Hale Telescope, we acquired data at two epochs. This allowed for multiple imaging detections of the companions and multiple extractions of low-resolution (R {approx} 35) spectra. Data reduction employed two different methods of speckle suppression and spectrum extraction, both yielding results that agree. The spectra do not directly correspond to those of any known objects, although similarities with L and T dwarfs are present, as well as some characteristics similar to planets such as Saturn. We tentatively identify the presence of CH{sub 4} along with NH{sub 3} and/or C{sub 2}H{sub 2}, and possibly CO{sub 2} or HCN in varying amounts in each component of the system. Other studies suggested red colors for these faint companions, and our data confirm those observations. Cloudy models, based on previous photometric observations, may provide the best explanation for the new data presented here. Notable in our data is that these presumably co-eval objects of similar luminosity have significantly different spectra; the diversity of planets may be greater than previously thought. The techniques and methods employed in this paper represent a new capability to observe and rapidly characterize exoplanetary systems in a routine manner over a broad range of planet masses and separations. These are the first simultaneous spectroscopic observations of multiple planets in a planetary system other than our own.

  4. On the absence of young white dwarf companions to five technetium stars

    Smith, Verne V.; Lambert, David L.


    A search for hot companions to five stars of type MS and S has been carried out using the IUE satellite. No hot companions were detected for the MS stars HR 85, 4647, 6702, and 8062, and the S star HR 8714. Limits on the luminosities of possible white dwarf companions provide lower limits of 2-5x10 to the 8th yr to the ages of any degenerate companions. All five stars exhibit strong Tc I lines, and the presence of technetium, with a half-life of 2.1x10 to the 5th yr, signifies recent nucleosynthesis. The limits on the ages of possible white dwarf companions that are equal to or greater than 1000 half-lives of Tc exclude the possibility that the s-process elemental enhancement seen in these MS and S stars resulted from mass transfer from a more highly evolved companion (as is probably the mechanism by which barium stars are created). These MS and S stars represent a sample of true thermally pulsing asymptotic giant-branch stars.

  5. RanBP2 modulates Cox11 and hexokinase I activities and haploinsufficiency of RanBP2 causes deficits in glucose metabolism.

    Azamat Aslanukov


    Full Text Available The Ran-binding protein 2 (RanBP2 is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/- are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/- mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.

  6. RanBP2 modulates Cox11 and hexokinase I activities and haploinsufficiency of RanBP2 causes deficits in glucose metabolism.

    Aslanukov, Azamat; Bhowmick, Reshma; Guruju, Mallikarjuna; Oswald, John; Raz, Dorit; Bush, Ronald A; Sieving, Paul A; Lu, Xinrong; Bock, Cheryl B; Ferreira, Paulo A


    The Ran-binding protein 2 (RanBP2) is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s) of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI) via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/-) are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/-) mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.

  7. Correlation of expression of BP1, a homeobox gene, with estrogen receptor status in breast cancer

    Fu, Sidney W; Poola, Indira; Stephan, Dietrich A; Berg, Patricia E; Schwartz, Arnold; Stevenson, Holly; Pinzone, Joseph J; Davenport, Gregory J; Orenstein, Jan M; Gutierrez, Peter; Simmens, Samuel J; Abraham, Jessy


    BP1 is a novel homeobox gene cloned in our laboratory. Our previous studies in leukemia demonstrated that BP1 has oncogenic properties, including as a modulator of cell survival. Here BP1 expression was examined in breast cancer, and the relationship between BP1 expression and clinicopathological data was determined. Total RNA was isolated from cell lines, tumors, and matched normal adjacent tissue or tissue from autopsy. Reverse transcription polymerase chain reaction was performed to evaluate BP1 expression. Statistical analysis was accomplished with SAS. Analysis of 46 invasive ductal breast tumors demonstrated BP1 expression in 80% of them, compared with a lack of expression in six normal breast tissues and low-level expression in one normal breast tissue. Remarkably, 100% of tumors that were negative for the estrogen receptor (ER) were BP1-positive, whereas 73% of ER-positive tumors expressed BP1 (P = 0.03). BP1 expression was also associated with race: 89% of the tumors of African American women were BP1-positive, whereas 57% of those from Caucasian women expressed BP1 (P = 0.04). However, there was no significant difference in BP1 expression between grades I, II, and III tumors. Interestingly, BP1 mRNA expression was correlated with the ability of malignant cell lines to cause breast cancer in mice. Because BP1 is expressed abnormally in breast tumors, it could provide a useful target for therapy, particularly in patients with ER-negative tumors. The frequent expression of BP1 in all tumor grades suggests that activation of BP1 is an early event

  8. Polymer-Based Black Phosphorus (bP) Hybrid Materials by in Situ Radical Polymerization: An Effective Tool To Exfoliate bP and Stabilize bP Nanoflakes


    Black phosphorus (bP) has been recently investigated for next generation nanoelectronic multifunctional devices. However, the intrinsic instability of exfoliated bP (the bP nanoflakes) toward both moisture and air has so far overshadowed its practical implementation. In order to contribute to fill this gap, we report here the preparation of new hybrid polymer-based materials where bP nanoflakes (bPn) exhibit a significantly improved stability. The new materials have been prepared by different synthetic paths including: (i) the mixing of conventionally liquid-phase exfoliated bP (in dimethyl sulfoxide, DMSO) with poly(methyl methacrylate) (PMMA) solution; (ii) the direct exfoliation of bP in a polymeric solution; (iii) the in situ radical polymerization after exfoliating bP in the liquid monomer (methyl methacrylate, MMA). This last methodology concerns the preparation of stable suspensions of bPn–MMA by sonication-assisted liquid-phase exfoliation (LPE) of bP in the presence of MMA followed by radical polymerization. The hybrids characteristics have been compared in order to evaluate the bP dispersion and the effectiveness of the bPn interfacial interactions with polymer chains aimed at their long-term environmental stabilization. The passivation of the bPn is particularly effective when the hybrid material is prepared by in situ polymerization. By using this synthetic methodology, the nanoflakes, even if with a gradient of dispersion (size of aggregates), preserve their chemical structure from oxidation (as proved by both Raman and 31P-solid state NMR studies) and are particularly stable to air and UV light exposure. The feasibility of this approach, capable of efficiently exfoliating bP while protecting the bPn, has been then verified by using different vinyl monomers (styrene and N-vinylpyrrolidone), thus obtaining hybrids where the nanoflakes are embedded in polymer matrices with a variety of intriguing thermal, mechanical, and solubility characteristics.

  9. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    Kanginakudru, Sriramana, E-mail: [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); DeSmet, Marsha, E-mail: [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Thomas, Yanique, E-mail: [Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States); Morgan, Iain M., E-mail: [VCU Philips Institute for Oral Health Research, Virginia Commonwealth University, Richmond, Virginia (United States); Androphy, Elliot J., E-mail: [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States)


    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication.

  10. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    Kanginakudru, Sriramana; DeSmet, Marsha; Thomas, Yanique; Morgan, Iain M.; Androphy, Elliot J.


    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication


    Reimer, P. J.; Baillie, M. G. L.; Bard, E.; Bayliss, A.; Beck, J. W.; Blackwell, P. G.; Ramsey, C. Bronk; Buck, C. E.; Burr, G. S.; Edwards, R. L.; Friedrich, M.; Grootes, P. M.; Guilderson, T. P.; Hajdas, I.; Heaton, T. J.; Hogg, A. G.; Hughen, K. A.; Kaiser, K. F.; Kromer, B.; McCormac, F. G.; Manning, S. W.; Reimer, R. W.; Richards, D. A.; Southon, J. R.; Talamo, S.; Turney, C. S. M.; van der Plicht, J.; Weyhenmeye, C. E.; Weyhenmeyer, C.E.


    The IntCal04 and Marine04 radiocarbon calibration curves have been updated from 12 cal kBP (cal kBP is here defined as thousands of calibrated years before AD 1950), and extended to 50 cal kBP, utilizing newly available data sets that meet the IntCal Working Group criteria for pristine corals and

  12. 76 FR 69713 - Application To Export Electric Energy; BP Energy Company


    ... DEPARTMENT OF ENERGY [OE Docket No. EA-314-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... electric energy from the United States to Mexico as a power marketer for a five-year term using existing...

  13. Stars and Flowers, Flowers and Stars

    Minti, Hari


    The author, a graduated from the Bucharest University (1964), actually living and working in Israel, concerns his book to variable stars and flowers, two domains of his interest. The analogies includes double stars, eclipsing double stars, eclipses, Big Bang. The book contains 34 chapters, each of which concerns various relations between astronomy and other sciences and pseudosciences such as Psychology, Religion, Geology, Computers and Astrology (to which the author is not an adherent). A special part of the book is dedicated to archeoastronomy and ethnoastronomy, as well as to history of astronomy. Between the main points of interest of these parts: ancient sanctuaries in Sarmizegetusa (Dacia), Stone Henge(UK) and other. The last chapter of the book is dedicated to flowers. The book is richly illustrated. It is designed for a wide circle of readers.

  14. Nuclear planetology: understanding habitable planets as Galactic bulge stellar remnants (black dwarfs) in a Hertzsprung-Russell (HR) diagram

    Roller, Goetz


    The Hertzsprung-Russell (HR) diagram is one of the most important diagrams in astronomy. In a HR diagram, the luminosity of stars and/or stellar remnants (white dwarf stars, WD's), relative to the luminosity of the sun, is plotted versus their surface temperatures (Teff). The Earth shows a striking similarity in size (radius ≈ 6.370 km) and Teff of its outer core surface (Teff ≈ 3800 K at the core-mantle-boundary) with old WD's (radius ≈ 6.300 km) like WD0346+246 (Teff ≈ 3820 K after ≈ 12.7 Ga [1]), which plot in the HR diagram close to the low-mass extension of the stellar population or main sequence. In the light of nuclear planetology [2], Earth-like planets are regarded as old, down-cooled and differentiated black dwarfs (Fe-C BLD's) after massive decompression, the most important nuclear reactions involved being 56Fe(γ,α)52Cr (etc.), possibly responsible for extreme terrestrial glaciations events ("snowball" Earth), together with (γ,n), (γ,p) and fusion reactions like 12C(α,γ)16O. The latter reaction might have caused oxidation of the planet from inside out. Nuclear planetology is a new research field, tightly constrained by a coupled 187Re-232Th-238U systematics. By means of nuclear/quantum physics and taking the theory of relativity into account, it aims at understanding the thermal and chemical evolution of Fe-C BLD's after gravitational contraction (e.g. Mercury) or Fermi-pressure controlled collapse (e.g. Earth) events after massive decompression, leading possibly to an r-process event, towards the end of their cooling period [2]. So far and based upon 187Re-232Th-238U nuclear geochronometry, the Fe-C BLD hypothesis can successfully explain the global terrestrial MORB 232Th/238U signature [3]. Thus, it may help to elucidate the DM (depleted mantle), EMI (enriched mantle 1), EMII (enriched mantle 2) or HIMU (high U/Pb) reservoirs, and the 187Os/188Os isotopic dichotomy in Archean magmatic rocks and sediments [4]. Here I present a conceptual

  15. Modification of the Clinical Global Impressions (CGI) Scale for use in bipolar illness (BP): the CGI-BP.

    Spearing, M K; Post, R M; Leverich, G S; Brandt, D; Nolen, W


    The Clinical Global Impressions Scale (CGI) was modified specifically for use in assessing global illness severity and change in patients with bipolar disorder. Criticisms of the original CGI were addressed by correcting inconsistencies in scaling, identifying time frames for comparison, clarifying definitions of illness severity and change, and separating out assessment of treatment side effects from illness improvement during treatment. A Detailed User's Guide was developed to train clinicians in the use of the new CGI-Bipolar Version (CGI-BP) for rating severity of manic and depressive episodes and the degree of change from the immediately preceding phase and from the worst phase of illness. The revised scale and manual provide a focused set of instructions to facilitate the reliability of these ratings of mania, depression, and overall bipolar illness during treatment of an acute episode or in longer-term illness prophylaxis. Interrater reliability of the scale was demonstrated in preliminary analyses. Thus, the modified CGI-BP is anticipated to be more useful than the original CGI in studies of bipolar disorder.

  16. Molecular characterization of genes of Pseudomonas sp. strain HR199 involved in bioconversion of vanillin to protocatechuate.

    Priefert, H; Rabenhorst, J; Steinbüchel, A


    The gene loci vdh, vanA, and vanB, which are involved in the bioconversion of vanillin to protocatechuate by Pseudomonas sp. strain HR199 (DSM 7063), were identified as the structural genes of a novel vanillin dehydrogenase (vdh) and the two subunits of a vanillate demethylase (vanA and vanB), respectively. These genes were localized on an EcoRI fragment (E230), which was cloned from a Pseudomonas sp. strain HR199 genomic library in the cosmid pVK100. The vdh gene was identified on a subfragment (HE35) of E230, and the vanA and vanB genes were localized on a different subfragment (H110) of E230. The nucleotide sequences of fragment HE35 and part of fragment H110 were determined, revealing open reading frames of 1062, 951, and 1446 bp, representing vanA, vanB, and vdh, respectively. The vdh gene was organized in one operon together with a fourth open reading frame (ORF2), of 735 bp, which was located upstream of vdh. The deduced amino acid sequences of vanA and vanB exhibited 78.8 and 62.1% amino acid identity, respectively, to the corresponding gene products from Pseudomonas sp. strain ATCC 19151 (F. Brunel and J. Davison, J. Bacteriol. 170:4924-4930, 1988). The deduced amino acid sequence of the vdh gene exhibited up to 35.3% amino acid identity to aldehyde dehydrogenases from different sources. The deduced amino acid sequence of ORF2 exhibited up to 28.4% amino acid identity to those of enoyl coenzyme A hydratases. Escherichia coli strains harboring fragment E230 cloned in pBluescript SK- converted vanillin to protocatechuate via vanillate, indicating the functional expression of vdh, vanA, and vanB in E. coli. High expression of vdh in E. coli was achieved with HE35 cloned in pBluescript SK-. The resulting recombinant strains converted vanillin to vanillate at a rate of up to 0.3 micromol per min per ml of culture. Transfer of vanA, vanB, and vdh to Alcaligenes eutrophus and to different Pseudomonas strains, which were unable to utilize vanillin or vanillate as


    Eva Farkas


    Full Text Available Ensuring equal opportunities is a priority for CEO-s and decision makers, however, it is often not put into practice. Changes in recent years along with the priorities of the EU and the efforts made to banish discrimination becoming more prominent brought with themselves a pressure on firms to provide equal opportunities for the different under-privileged social groups. In Hungary the Act CXXV of 2003 on discrimination and equal opportunities lists the groups in need of protection. The law requires employers with more than fifty employees to have an equal opportunities program. In spite of this, these programs are often general and do not implement the changes and goals identified after the assessment. Still, strategies and plans are only worth how much of them are realized. Our article is about the conscious principles of the Hungarian business sector about equality and whether there are regional differences. We compare answers given by both employers and employees on the subject of the extent to which the above mentioned principles are realized by the management and whether the employees experience these changes. Our theory is that the prioritisation of equal opportunities in firms is more the result of access to project funds than that of inner initiative from the firm's management. We analyse our research questions using a quantitative method on a regionally representative national sample. We examined 992 firms with special attention on those and their employees who had some sort of written guidelines on equal opportunities and plans on implementing these. In our paper we give a short review on the importance of equal opportunities, it's manifestation in HR management and it's written declaration, the so called Equal Opportunities Plan (EOP. The efforts of the EU and access to financial resources for the EU projects as a condition our hypotheses are that (1 at least 30% of the firms studied have written guidelines or declaration on equal

  18. Science Through ARts (STAR)

    Kolecki, Joseph; Petersen, Ruth; Williams, Lawrence


    Science Through ARts (STAR) is an educational initiative designed to teach students through a multidisciplinary approach to learning. This presentation describes the STAR pilot project, which will use Mars exploration as the topic to be integrated. Schools from the United Kingdom, Japan, the United States, and possibly eastern Europe are expected to participate in the pilot project.

  19. European Stars and Stripes

    Hendricks, Nancy


    The European Stars and Stripes (ES&S) organization publishes a daily newspaper, The Stars and Stripes, for DoD personnel stationed in Germany, Italy, the United Kingdom, and other DoD activities in the U.S. European Command...

  20. Nebraska STARS: Achieving Results

    Roschewski, Pat; Isernhagen, Jody; Dappen, Leon


    In 2000, the state of Nebraska passed legislation requiring the assessment of student performance on content standards, but its requirements were very different from those of any other state. Nebraska created what has come to be known as STARS (School-based Teacher-led Assessment and Reporting System). Under STARS, each of Nebraska's nearly 500…

  1. Convective overshooting in stars

    Andrássy, R.


    Numerous observations provide evidence that the standard picture, in which convective mixing is limited to the unstable layers of a star, is incomplete. The mixing layers in real stars are significantly more extended than what the standard models predict. Some of the observations require changing

  2. By Draconis Stars

    Bopp, Bernard W.

    An optical spectroscopic survey of dK-M stars has resulted in the discovery of several new H-alpha emission objects. Available optical data suggest these stars have a level of chromospheric activity midway between active BY Dra stars and quiet dM's. These "marginal" BY Dra stars are single objects that have rotation velocities slightly higher than that of quiet field stars but below that of active flare/BY Dra objects. The marginal BY Dra stars provide us with a class of objects rotating very near a "trigger velocity" (believed to be 5 km/s) which appears to divide active flare/BY Dra stars from quiet dM's. UV data on Mg II emission fluxes and strength of transition region features such as C IV will serve to fix activity levels in the marginal objects and determine chromosphere and transition-region heating rates. Simultaneous optical magnetic field measures will be used to explore the connection between fieldstrength/filling-factor and atmospheric heating. Comparison of these data with published information on active and quiet dM stars will yield information on the character of the stellar dynamo as it makes a transition from "low" to "high" activity.

  3. Observing Double Stars

    Genet, Russell M.; Fulton, B. J.; Bianco, Federica B.; Martinez, John; Baxter, John; Brewer, Mark; Carro, Joseph; Collins, Sarah; Estrada, Chris; Johnson, Jolyon; Salam, Akash; Wallen, Vera; Warren, Naomi; Smith, Thomas C.; Armstrong, James D.; McGaughey, Steve; Pye, John; Mohanan, Kakkala; Church, Rebecca


    Double stars have been systematically observed since William Herschel initiated his program in 1779. In 1803 he reported that, to his surprise, many of the systems he had been observing for a quarter century were gravitationally bound binary stars. In 1830 the first binary orbital solution was obtained, leading eventually to the determination of stellar masses. Double star observations have been a prolific field, with observations and discoveries - often made by students and amateurs - routinely published in a number of specialized journals such as the Journal of Double Star Observations. All published double star observations from Herschel's to the present have been incorporated in the Washington Double Star Catalog. In addition to reviewing the history of visual double stars, we discuss four observational technologies and illustrate these with our own observational results from both California and Hawaii on telescopes ranging from small SCTs to the 2-meter Faulkes Telescope North on Haleakala. Two of these technologies are visual observations aimed primarily at published "hands-on" student science education, and CCD observations of both bright and very faint doubles. The other two are recent technologies that have launched a double star renaissance. These are lucky imaging and speckle interferometry, both of which can use electron-multiplying CCD cameras to allow short (30 ms or less) exposures that are read out at high speed with very low noise. Analysis of thousands of high speed exposures allows normal seeing limitations to be overcome so very close doubles can be accurately measured.

  4. The magnetic early B-type stars I: magnetometry and rotation

    Shultz, M. E.; Wade, G. A.; Rivinius, Th; Neiner, C.; Alecian, E.; Bohlender, D.; Monin, D.; Sikora, J.; MiMeS Collaboration; BinaMIcS Collaboration


    The rotational and magnetic properties of many magnetic hot stars are poorly characterized, therefore the Magnetism in Massive Stars and Binarity and Magnetic Interactions in various classes of Stars collaborations have collected extensive high-dispersion spectropolarimetric data sets of these targets. We present longitudinal magnetic field measurements for 52 early B-type stars (B5-B0), with which we attempt to determine their rotational periods Prot. Supplemented with high-resolution spectroscopy, low-resolution Dominion Astrophysical Observatory circular spectropolarimetry, and archival Hipparcos photometry, we determined Prot for 10 stars, leaving only five stars for which Prot could not be determined. Rotational ephemerides for 14 stars were refined via comparison of new to historical magnetic measurements. The distribution of Prot is very similar to that observed for the cooler Ap/Bp stars. We also measured v sin i and vmac for all stars. Comparison to non-magnetic stars shows that v sin i is much lower for magnetic stars, an expected consequence of magnetic braking. We also find evidence that vmac is lower for magnetic stars. Least-squares deconvolution profiles extracted using single-element masks revealed widespread, systematic discrepancies in between different elements: this effect is apparent only for chemically peculiar stars, suggesting it is a consequence of chemical spots. Sinusoidal fits to H line measurements (which should be minimally affected by chemical spots), yielded evidence of surface magnetic fields more complex than simple dipoles in six stars for which this has not previously been reported; however, in all six cases, the second- and third-order amplitudes are small relative to the first-order (dipolar) amplitudes.

  5. Daphnia HR96 is a promiscuous xenobiotic and endobiotic nuclear receptor

    Karimullina, Elina [Environmental Toxicology Program, Clemson University, Clemson, SC 29634 (United States); Institute of Plant and Animal Ecology, Russian Academy of Sciences, Ural Branch, Yekaterinburg 620144 (Russian Federation); Li Yangchun; Ginjupalli, Gautam K. [Environmental Toxicology Program, Clemson University, Clemson, SC 29634 (United States); Baldwin, William S., E-mail: [Environmental Toxicology Program, Clemson University, Clemson, SC 29634 (United States); Biological Sciences, Clemson University, Clemson, SC (United States)


    Daphnia pulex is the first crustacean to have its genome sequenced. The genome project provides new insight and data into how an aquatic crustacean may respond to environmental stressors, including toxicants. We cloned Daphnia pulex HR96 (DappuHR96), a nuclear receptor orthologous to the CAR/PXR/VDR group of nuclear receptors. In Drosophila melanogaster, (hormone receptor 96) HR96 responds to phenobarbital exposure and has been hypothesized as a toxicant receptor. Therefore, we set up a transactivation assay to test whether DappuHR96 is a promiscuous receptor activated by xenobiotics and endobiotics similar to the constitutive androstane receptor (CAR) and the pregnane X-receptor (PXR). Transactivation assays performed with a GAL4-HR96 chimera demonstrate that HR96 is a promiscuous toxicant receptor activated by a diverse set of chemicals such as pesticides, hormones, and fatty acids. Several environmental toxicants activate HR96 including estradiol, pyriproxyfen, chlorpyrifos, atrazine, and methane arsonate. We also observed repression of HR96 activity by chemicals such as triclosan, androstanol, and fluoxetine. Nearly 50% of the chemicals tested activated or inhibited HR96. Interestingly, unsaturated fatty acids were common activators or inhibitors of HR96 activity, indicating a link between diet and toxicant response. The omega-6 and omega-9 unsaturated fatty acids linoleic and oleic acid activated HR96, but the omega-3 unsaturated fatty acids alpha-linolenic acid and docosahexaenoic acid inhibited HR96, suggesting that these two distinct sets of lipids perform opposing roles in Daphnia physiology. This also provides a putative mechanism by which the ratio of dietary unsaturated fats may affect the ability of an organism to respond to a toxic insult. In summary, HR96 is a promiscuous nuclear receptor activated by numerous endo- and xenobiotics.

  6. Daphnia HR96 is a promiscuous xenobiotic and endobiotic nuclear receptor

    Karimullina, Elina; Li Yangchun; Ginjupalli, Gautam K.; Baldwin, William S.


    Daphnia pulex is the first crustacean to have its genome sequenced. The genome project provides new insight and data into how an aquatic crustacean may respond to environmental stressors, including toxicants. We cloned Daphnia pulex HR96 (DappuHR96), a nuclear receptor orthologous to the CAR/PXR/VDR group of nuclear receptors. In Drosophila melanogaster, (hormone receptor 96) HR96 responds to phenobarbital exposure and has been hypothesized as a toxicant receptor. Therefore, we set up a transactivation assay to test whether DappuHR96 is a promiscuous receptor activated by xenobiotics and endobiotics similar to the constitutive androstane receptor (CAR) and the pregnane X-receptor (PXR). Transactivation assays performed with a GAL4-HR96 chimera demonstrate that HR96 is a promiscuous toxicant receptor activated by a diverse set of chemicals such as pesticides, hormones, and fatty acids. Several environmental toxicants activate HR96 including estradiol, pyriproxyfen, chlorpyrifos, atrazine, and methane arsonate. We also observed repression of HR96 activity by chemicals such as triclosan, androstanol, and fluoxetine. Nearly 50% of the chemicals tested activated or inhibited HR96. Interestingly, unsaturated fatty acids were common activators or inhibitors of HR96 activity, indicating a link between diet and toxicant response. The omega-6 and omega-9 unsaturated fatty acids linoleic and oleic acid activated HR96, but the omega-3 unsaturated fatty acids alpha-linolenic acid and docosahexaenoic acid inhibited HR96, suggesting that these two distinct sets of lipids perform opposing roles in Daphnia physiology. This also provides a putative mechanism by which the ratio of dietary unsaturated fats may affect the ability of an organism to respond to a toxic insult. In summary, HR96 is a promiscuous nuclear receptor activated by numerous endo- and xenobiotics.

  7. Radioisotope dating beyond 50,000 years BP

    Beukens, R.P.


    A counting method for radiocarbon dating has been developed by the Toronto-Rochester-General Ionex group over the past two years using electrostatic tandem-accelerators as part of a mass spectrometer. The method uses very small samples of 1 mg or less and reaches high accuracy after counting for only a few hours. In principle this 14 C method can be used to date samples up to 100,000 years old but severe problems are anticipated with respect to sample contamination, particularly beyond 70,000 years BP. The counting method can also be applied to the detection of longer lived radioisotopes created in the upper atmosphere by the interaction of cosmic radiation, such as 36 Cl, 26 Al and 10 Be. (author)

  8. BP and Mobil present a united front in Europe

    Jackson, Kim.


    BP and Mobil announced the pooling of their European refining, marketing and lubricants businesses in February last year in an unprecedented step to cut costs and improve their competitive position in what is becoming an increasingly cut-throat market. Like their competitors, the two companies had been battling to contented with the continuing surplus refining capacity throughout Europe as well as significantly reduced profit margins on gasoline and other products sold at the pumps. This was particularly the case in the United Kingdom which is still reeling from the effects of the petrol pump price war waged over the past year and in France, too, where the hypermarkets are fiercely battling to retain their market share. (author)

  9. Neutron Stars and Pulsars

    Becker, Werner


    Neutron stars are the most compact astronomical objects in the universe which are accessible by direct observation. Studying neutron stars means studying physics in regimes unattainable in any terrestrial laboratory. Understanding their observed complex phenomena requires a wide range of scientific disciplines, including the nuclear and condensed matter physics of very dense matter in neutron star interiors, plasma physics and quantum electrodynamics of magnetospheres, and the relativistic magneto-hydrodynamics of electron-positron pulsar winds interacting with some ambient medium. Not to mention the test bed neutron stars provide for general relativity theories, and their importance as potential sources of gravitational waves. It is this variety of disciplines which, among others, makes neutron star research so fascinating, not only for those who have been working in the field for many years but also for students and young scientists. The aim of this book is to serve as a reference work which not only review...

  10. Spectrophotometry of carbon stars

    Oganesyan, R.K.; Karapetyan, M.S.; Nersisyan, S.E.


    The results are given of the spectrophotometric investigation of 56 carbon stars in the spectral range from 4000 to 6800 A with resolution 3 A. The observed energy distributions of these stars are determined relative to the flux at the wavelength /sub 0/ = 5556; they are presented in the form of graphs. The energy distributions have been obtained for the first time for 35 stars. Variation in the line Ba II 4554 A has been found in the spectra of St Cam, UU Aur, and RV Mon. Large changes have taken place in the spectra of RT UMa and SS Vir. It is noted that the spectra of carbon stars have a depression, this being situated in different spectral regions for individual groups of stars.

  11. Rotating stars in relativity.

    Paschalidis, Vasileios; Stergioulas, Nikolaos


    Rotating relativistic stars have been studied extensively in recent years, both theoretically and observationally, because of the information they might yield about the equation of state of matter at extremely high densities and because they are considered to be promising sources of gravitational waves. The latest theoretical understanding of rotating stars in relativity is reviewed in this updated article. The sections on equilibrium properties and on nonaxisymmetric oscillations and instabilities in f -modes and r -modes have been updated. Several new sections have been added on equilibria in modified theories of gravity, approximate universal relationships, the one-arm spiral instability, on analytic solutions for the exterior spacetime, rotating stars in LMXBs, rotating strange stars, and on rotating stars in numerical relativity including both hydrodynamic and magnetohydrodynamic studies of these objects.

  12. Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers

    Theodorakis, P E [Department of Materials Science and Engineering, University of Ioannina, 45110 Ioannina (Greece); Avgeropoulos, A [Department of Materials Science and Engineering, University of Ioannina, 45110 Ioannina (Greece); Freire, J J [Departamento de Ciencias y Tecnicas FisicoquImicas, Universidad Nacional de Educacion a Distancia, Facultad de Ciencias, Senda del Rey 9, 28040 Madrid (Spain); Kosmas, M [Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece); Vlahos, C [Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece)


    The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results.

  13. Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers

    Theodorakis, P. E.; Avgeropoulos, A.; Freire, J. J.; Kosmas, M.; Vlahos, C.


    The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results.

  14. Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers

    Theodorakis, P E; Avgeropoulos, A; Freire, J J; Kosmas, M; Vlahos, C


    The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results

  15. RanBP3 influences interactions between CRM1 and its nuclear protein export substrates

    Englmeier, Ludwig; Fornerod, Maarten; Bischoff, F. Ralf; Petosa, Carlo; Mattaj, Iain W.; Kutay, Ulrike


    We investigated the role of RanBP3, a nuclear member of the Ran-binding protein 1 family, in CRM1-mediated protein export in higher eukaryotes. RanBP3 interacts directly with CRM1 and also forms a trimeric complex with CRM1 and RanGTP. However, RanBP3 does not bind to CRM1 like an export substrate. Instead, it can stabilize CRM1–export substrate interaction. Nuclear RanBP3 stimulates CRM1-dependent protein export in permeabilized cells. These data indicate that RanBP3 functions by a novel mec...

  16. The effective temperatures of early Wolf-Rayet stars

    Schmutz, W.


    Nussbaumer et al. (1981) (NSSW) have calculated temperatures of 15 Wolf-Rayet stars, which cover most subtypes in the WN and WC sequences. Some Wolf-Rayet stars are found to have a blackbody-like energy distribution and therefore their effective temperature can be well determined, others show deviation from the blackbody shape. This deviation is probably due to an extended continuum emitting region. In view of these later cases NSSW adopted a temperature which they derived from a Zanstra analysis of the He II recombination lines. According to their analysis there should be a continuum jump at 2050 A. New IUE observations of the WN 5 star HD 50896 however did not show any trace of such an absorption edge. This implies that the effective temperature of this WN 5 star and probably of all WR stars with a non blackbody energy distribution is not yet known accurately. Therefore the author started a detailed analysis with a spherically symmetric atmosphere model. Though the model has not yet reached its final shape he has obtained as a first result that the location of HD 50896 in the HR-diagram is to the left of the ZAMS and that the Zanstra analysis is indeed not valid for this star. (Auth.)

  17. Evolving R Coronae Borealis Stars with MESA

    Clayton, Geoffrey C.; Lauer, Amber; Chatzopoulos, Emmanouil; Frank, Juhan


    R Coronae Borealis (RCB) stars form a small class of cool, carbon-rich supergiants that have almost no hydrogen. They undergo extreme, irregular declines in brightness of up to 8 magnitudes due to the formation of thick clouds of carbon dust. Two scenarios have been proposed for the origin of an RCB star: the merger of a CO/He white dwarf (WD) binary and a final helium-shell flash. We are using a combination of 3D hydrodynamics codes and the 1D MESA (Modules for Experiments in Stellar Astrophysics) stellar evolution code including nucleosynthesis to construct post-merger spherical models based on realistic merger progenitor models and on our hydrodynamical simulations, and then following the evolution into the region of the HR diagram where RCB stars are located. We are investigating nucleosynthesis in the dynamically accreting material of CO/He WD mergers which may provide a suitable environment for significant production of 18O and the very low 16O/18O values observed.Our MESA modeling consists of two steps: first mimicking the WD merger event using two different techniques, (a) by choosing a very high mass accretion rate with appropriate abundances and (b) by applying "stellar engineering" to an initial CO WD model to account for the newly merged material by applying an entropy adjusting procedure. Second, we follow the post-merger evolution using a large nuclear reaction network including the effects of convective and rotational instabilities to the mixing of material in order to match the observed RCB abundances. MESA follows the evolution of the merger product as it expands and cools to become an RCB star. We then examine the surface abundances and compare them to the observed RCB abundances. We also investigate how long fusion continues in the He shell near the core and how this processed material is mixed up to the surface of the star. We then model the later evolution of RCB stars to determine their likely lifetimes and endpoints when they have returned to

  18. Impaired TIP60-mediated H4K16 acetylation accounts for the aberrant chromatin accumulation of 53BP1 and RAP80 in Fanconi anemia pathway-deficient cells.

    Renaud, Emilie; Barascu, Aurelia; Rosselli, Filippo


    To rescue collapsed replication forks cells utilize homologous recombination (HR)-mediated mechanisms to avoid the induction of gross chromosomal abnormalities that would be generated by non-homologous end joining (NHEJ). Using DNA interstrand crosslinks as a replication barrier, we investigated how the Fanconi anemia (FA) pathway promotes HR at stalled replication forks. FA pathway inactivation results in Fanconi anemia, which is associated with a predisposition to cancer. FANCD2 monoubiquitination and assembly in subnuclear foci appear to be involved in TIP60 relocalization to the chromatin to acetylates histone H4K16 and prevents the binding of 53BP1 to its docking site, H4K20Me2. Thus, FA pathway loss-of-function results in accumulation of 53BP1, RIF1 and RAP80 at damaged chromatin, which impair DNA resection at stalled replication fork-associated DNA breaks and impede HR. Consequently, DNA repair in FA cells proceeds through the NHEJ pathway, which is likely responsible for the accumulation of chromosome abnormalities. We demonstrate that the inhibition of NHEJ or deacetylase activity rescue HR in FA cells. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.

  19. AMP-activated protein kinase phosphorylates CtBP1 and down-regulates its activity

    Kim, Jae-Hwan; Choi, Soo-Youn; Kang, Byung-Hee; Lee, Soon-Min [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); Park, Hyung Soon; Kang, Gum-Yong; Bang, Joo Young [Center for Biomedical Mass Spectrometry, Diatech Korea Co., Ltd., Seoul (Korea, Republic of); Cho, Eun-Jung [National Research Laboratory for Chromatin Dynamics, College of Pharmacy, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Youn, Hong-Duk, E-mail: [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); WCU Department of Molecular Medicine and Biopharmaceutical Sciences, Graduate School of Convergence and Technology, Seoul National University, Seoul (Korea, Republic of)


    Highlights: ► AMPK phosphorylates CtBP1 on serine 158. ► AMPK-mediated phosphorylation of CtBP1 causes the ubiquitination and nuclear export of CtBP1. ► AMPK downregulates the CtBP1-mediated repression of Bax transcription. -- Abstract: CtBP is a transcriptional repressor which plays a significant role in the regulation of cell proliferation and tumor progression. It was reported that glucose withdrawal causes induction of Bax due to the dissociation of CtBP from the Bax promoter. However, the precise mechanism involved in the regulation of CtBP still remains unclear. In this study, we found that an activated AMP-activated protein kinase (AMPK) phosphorylates CtBP1 on Ser-158 upon metabolic stresses. Moreover, AMPK-mediated phosphorylation of CtBP1 (S158) attenuates the repressive function of CtBP1. We also confirmed that triggering activation of AMPK by various factors resulted in an increase of Bax gene expression. These findings provide connections of AMPK with CtBP1-mediated regulation of Bax expression for cell death under metabolic stresses.

  20. Star Cluster Structure from Hierarchical Star Formation

    Grudic, Michael; Hopkins, Philip; Murray, Norman; Lamberts, Astrid; Guszejnov, David; Schmitz, Denise; Boylan-Kolchin, Michael


    Young massive star clusters (YMCs) spanning 104-108 M⊙ in mass generally have similar radial surface density profiles, with an outer power-law index typically between -2 and -3. This similarity suggests that they are shaped by scale-free physics at formation. Recent multi-physics MHD simulations of YMC formation have also produced populations of YMCs with this type of surface density profile, allowing us to narrow down the physics necessary to form a YMC with properties as observed. We show that the shallow density profiles of YMCs are a natural result of phase-space mixing that occurs as they assemble from the clumpy, hierarchically-clustered configuration imprinted by the star formation process. We develop physical intuition for this process via analytic arguments and collisionless N-body experiments, elucidating the connection between star formation physics and star cluster structure. This has implications for the early-time structure and evolution of proto-globular clusters, and prospects for simulating their formation in the FIRE cosmological zoom-in simulations.

  1. An infrared diagnostic for magnetism in hot stars

    Oksala, M. E.; Grunhut, J. H.; Kraus, M.; Borges Fernandes, M.; Neiner, C.; Condori, C. A. H.; Campagnolo, J. C. N.; Souza, T. B.


    Magnetospheric observational proxies are used for indirect detection of magnetic fields in hot stars in the X-ray, UV, optical, and radio wavelength ranges. To determine the viability of infrared (IR) hydrogen recombination lines as a magnetic diagnostic for these stars, we have obtained low-resolution (R~ 1200), near-IR spectra of the known magnetic B2V stars HR 5907 and HR 7355, taken with the Ohio State Infrared Imager/Spectrometer (OSIRIS) attached to the 4.1 m Southern Astrophysical Research (SOAR) Telescope. Both stars show definite variable emission features in IR hydrogen lines of the Brackett series, with similar properties as those found in optical spectra, including the derived location of the detected magnetospheric plasma. These features also have the added advantage of a lowered contribution of stellar flux at these wavelengths, making circumstellar material more easily detectable. IR diagnostics will be useful for the future study of magnetic hot stars, to detect and analyze lower-density environments, and to detect magnetic candidates in areas obscured from UV and optical observations, increasing the number of known magnetic stars to determine basic formation properties and investigate the origin of their magnetic fields. Based on observations obtained at the Southern Astrophysical Research (SOAR) telescope, which is a joint project of the Ministério da Ciência, Tecnologia, e Inovação (MCTI) da República Federativa do Brasil, the US National Optical Astronomy Observatory (NOAO), the University of North Carolina at Chapel Hill (UNC), and Michigan State University (MSU).

  2. Making star teams out of star players.

    Mankins, Michael; Bird, Alan; Root, James


    Top talent is an invaluable asset: In highly specialized or creative work, for instance, "A" players are likely to be six times as productive as "B" players. So when your company has a crucial strategic project, why not multiply all that firepower and have a team of your best performers tackle it? Yet many companies hesitate to do this, believing that all-star teams don't work: Big egos will get in the way. The stars won't be able to work with one another. They'll drive the team Leader crazy. Mankins, Bird, and Root of Bain & Company believe it's time to set aside that thinking. They have seen all-star teams do extraordinary work. But there is a right way and a wrong way to organize them. Before you can even begin to assemble such a team, you need to have the right talent management practices, so you hire and develop the best people and know what they're capable of. You have to give the team appropriate incentives and leaders and support staffers who are stars in their own right. And projects that are ill-defined or small scale are not for all-star teams. Use them only for critical missions, and make sure their objectives are clear. Even with the right setup, things can still go wrong. The wise executive will take steps to manage egos, prune non-team-players, and prevent average coworkers from feeling completely undervalued. She will also invest a lot of time in choosing the right team Leader and will ask members for lots of feedback to monitor how that leader is doing.

  3. Stability of boson stars

    Gleiser, M.


    Boson stars are gravitationally bound, spherically symmetric equilibrium configurations of cold, free, or interacting complex scalar fields phi. As these equilibrium configurations naturally present local anisotropy, it is sensible to expect departures from the well-known stability criteria for fluid stars. With this in mind, I investigate the dynamical instability of boson stars against charge-conserving, small radial perturbations. Following the method developed by Chandrasekhar, a variational base for determining the eigenfrequencies of the perturbations is found. This approach allows one to find numerically an upper bound for the central density where dynamical instability occurs. As applications of the formalism, I study the stability of equilibrium configurations obtained both for the free and for the self-interacting [with V(phi) = (λ/4)chemical bondphichemical bond 4 ] massive scalar field phi. Instabilities are found to occur not for the critical central density as in fluid stars but for central densities considerably higher. The departure from the results for fluid stars is sensitive to the coupling λ; the higher the value of λ, the more the stability properties of boson stars approach those of a fluid star. These results are linked to the fractional anisotropy at the radius of the configuration

  4. From clouds to stars

    Elmegreen, B.G.


    At the present time, the theory of star formation must be limited to what we know about the lowest density gas, or about the pre-main sequence stars themselves. We would like to understand two basic processes: 1) how star-forming clouds are created from the ambient interstellar gas in the first place, and 2) how small parts of these clouds condense to form individual stars. We are interested also in knowing what pre-main sequence stars are like, and how they can interact with their environment. These topics are reviewed in what follows. In this series of lectures, what we know about the formation of stars is tentatively described. The lectures begin with a description of the interstellar medium, and then they proceed along the same direction that a young star would follow during its creation, namely from clouds through the collapse phase and onto the proto-stellar phase. The evolution of viscous disks and two models for the formation of the solar system are described in the last lectures. The longest lectures, and the topics that are covered in most detail, are not necessarily the ones for which we have the most information. Physically intuitive explanations for the various processes are emphasized, rather then mathematical explanations. In some cases, the mathematical aspects are developed as well, but only when the equations can be used to give important numerical values for comparison with the observations

  5. Studies on the intracellular localization of hHR23B

    Katiyar, Samiksha; Lennarz, William J.


    Yeast Rad23, originally identified as a DNA repair protein, has been proposed to participate in other cellular functions, i.e., the proteasome-degradation pathway, the process of spindle pole body duplication and as a component of the anaphase checkpoint. Two human homologs of yeast Rad23, hHR23A and hHR23B, exhibit high sequence homology with yRad23 and also have been shown to be involved in DNA repair and proteasome-dependent degradation. Previous studies on the intracellular localization of hHR23A and hHR23B revealed their predominant localization in the nucleus during interphase and in the cytoplasm during mitosis. We have analyzed the localization of hHR23B during all the phases of the cell cycle using immunofluorescence. Unlike previous studies, our results suggest localization of hHR23B in the nucleus as well as in the cytoplasm during G1 phase. The nuclear levels of hHR23B decrease during S-phase of the cell cycle. When the cell enters mitosis, hHR23B relocalizes in the cytoplasm without association with chromatin. These results indicate that the intracellular distribution hHR23B is cell cycle dependent

  6. Nuclear physics of stars

    Iliadis, Christian


    Thermonuclear reactions in stars is a major topic in the field of nuclear astrophysics, and deals with the topics of how precisely stars generate their energy through nuclear reactions, and how these nuclear reactions create the elements the stars, planets and - ultimately - we humans consist of. The present book treats these topics in detail. It also presents the nuclear reaction and structure theory, thermonuclear reaction rate formalism and stellar nucleosynthesis. The topics are discussed in a coherent way, enabling the reader to grasp their interconnections intuitively. The book serves bo

  7. Entropy Production of Stars

    Leonid M. Martyushev


    Full Text Available The entropy production (inside the volume bounded by a photosphere of main-sequence stars, subgiants, giants, and supergiants is calculated based on B–V photometry data. A non-linear inverse relationship of thermodynamic fluxes and forces as well as an almost constant specific (per volume entropy production of main-sequence stars (for 95% of stars, this quantity lies within 0.5 to 2.2 of the corresponding solar magnitude is found. The obtained results are discussed from the perspective of known extreme principles related to entropy production.


    Cheng, Kwang-Ping; Johnson, Dustin M.; Tarbell, Erik S.; Romo, Christopher A.; Prabhaker, Arvind [Cal. State Univ., Fullerton, Fullerton, CA (United States); Neff, James E.; Steele, Patricia A. [College of Charleston, Charleston, SC (United States); Gray, Richard O. [Appalachian State Univ., Boone, NC (United States); Corbally, Christopher J. [Vatican Observatory, Tucson, AZ (United States)


    Lambda Boo-type stars are a group of late B to early F-type Population I dwarfs that show mild to extreme deficiencies of iron-peak elements (up to 2 dex), but their C, N, O, and S abundances are near solar. This intriguing stellar class has recently regained the spotlight because of the directly imaged planets around a confirmed Lambda Boo star, HR 8799, and a suggested Lambda Boo star, Beta Pictoris. The discovery of a giant asteroid belt around Vega, another possible Lambda Boo star, also suggests hidden planets. The possible link between Lambda Boo stars and planet-bearing stars motivates us to study Lambda Boo stars systematically. Since the peculiar nature of the prototype Lambda Boötis was first noticed in 1943, Lambda Boo candidates published in the literature have been selected using widely different criteria. In order to determine the origin of Lambda Boo stars’ unique abundance pattern and to better discriminate between theories explaining the Lambda Boo phenomenon, a consistent working definition of Lambda Boo stars is needed. We have re-evaluated all published Lambda Boo candidates and their available ultraviolet and visible spectra. In this paper, using observed and synthetic spectra, we explore the physical basis for the classification of Lambda Boo stars, and develop quantitative criteria that discriminate metal-poor stars from bona fide Lambda Boo stars. Based on these stricter Lambda Boo classification criteria, we conclude that neither Beta Pictoris nor Vega should be classified as Lambda Boo stars.


    Cheng, Kwang-Ping; Johnson, Dustin M.; Tarbell, Erik S.; Romo, Christopher A.; Prabhaker, Arvind; Neff, James E.; Steele, Patricia A.; Gray, Richard O.; Corbally, Christopher J.


    Lambda Boo-type stars are a group of late B to early F-type Population I dwarfs that show mild to extreme deficiencies of iron-peak elements (up to 2 dex), but their C, N, O, and S abundances are near solar. This intriguing stellar class has recently regained the spotlight because of the directly imaged planets around a confirmed Lambda Boo star, HR 8799, and a suggested Lambda Boo star, Beta Pictoris. The discovery of a giant asteroid belt around Vega, another possible Lambda Boo star, also suggests hidden planets. The possible link between Lambda Boo stars and planet-bearing stars motivates us to study Lambda Boo stars systematically. Since the peculiar nature of the prototype Lambda Boötis was first noticed in 1943, Lambda Boo candidates published in the literature have been selected using widely different criteria. In order to determine the origin of Lambda Boo stars’ unique abundance pattern and to better discriminate between theories explaining the Lambda Boo phenomenon, a consistent working definition of Lambda Boo stars is needed. We have re-evaluated all published Lambda Boo candidates and their available ultraviolet and visible spectra. In this paper, using observed and synthetic spectra, we explore the physical basis for the classification of Lambda Boo stars, and develop quantitative criteria that discriminate metal-poor stars from bona fide Lambda Boo stars. Based on these stricter Lambda Boo classification criteria, we conclude that neither Beta Pictoris nor Vega should be classified as Lambda Boo stars

  10. Carbon Stars T. Lloyd Evans

    that the features used in estimating luminosities of ordinary giant stars are just those whose abundance ... This difference between the spectral energy distributions (SEDs) of CH stars and the. J stars, which belong to .... that the first group was binaries, as for the CH stars of the solar vicinity, while those of the second group ...

  11. 4E-BP1 regulates the differentiation of white adipose tissue.

    Tsukiyama-Kohara, Kyoko; Katsume, Asao; Kimura, Kazuhiro; Saito, Masayuki; Kohara, Michinori


    4E Binding protein 1 (4E-BP1) suppresses translation initiation. The absence of 4E-BP1 drastically reduces the amount of adipose tissue in mice. To address the role of 4E-BP1 in adipocyte differentiation, we characterized 4E-BP1(-/-) mice in this study. The lack of 4E-BP1 decreased the amount of white adipose tissue and increased the amount of brown adipose tissue. In 4E-BP1(-/-) MEF cells, PPARγ coactivator 1 alpha (PGC-1α) expression increased and exogenous 4E-BP1 expression suppressed PGC-1α expression. The level of 4E-BP1 expression was higher in white adipocytes than in brown adipocytes and showed significantly greater up-regulation in white adipocytes than in brown adipocytes during preadipocyte differentiation into mature adipocytes. The amount of PGC-1α was consistently higher in HB cells (a brown preadipocyte cell line) than in HW cells (a white preadipocyte cell line) during differentiation. Moreover, the ectopic over-expression of 4E-BP1 suppressed PGC-1α expression in white adipocytes, but not in brown adipocytes. Thus, the results of our study indicate that 4E-BP1 may suppress brown adipocyte differentiation and PGC-1α expression in white adipose tissues. © 2013 The Authors Genes to Cells © 2013 by the Molecular Biology Society of Japan and Wiley Publishing Asia Pty Ltd.

  12. Intensive Versus Standard Blood Pressure Control in SPRINT-Eligible Participants of ACCORD-BP.

    Buckley, Leo F; Dixon, Dave L; Wohlford, George F; Wijesinghe, Dayanjan S; Baker, William L; Van Tassell, Benjamin W


    We sought to determine the effect of intensive blood pressure (BP) control on cardiovascular outcomes in participants with type 2 diabetes mellitus (T2DM) and additional risk factors for cardiovascular disease (CVD). This study was a post hoc, multivariate, subgroup analysis of ACCORD-BP (Action to Control Cardiovascular Risk in Diabetes Blood Pressure) participants. Participants were eligible for the analysis if they were in the standard glucose control arm of ACCORD-BP and also had the additional CVD risk factors required for SPRINT (Systolic Blood Pressure Intervention Trial) eligibility. We used a Cox proportional hazards regression model to compare the effect of intensive versus standard BP control on CVD outcomes. The "SPRINT-eligible" ACCORD-BP participants were pooled with SPRINT participants to determine whether the effects of intensive BP control interacted with T2DM. The mean baseline Framingham 10-year CVD risk scores were 14.5% and 14.8%, respectively, in the intensive and standard BP control groups. The mean achieved systolic BP values were 120 and 134 mmHg in the intensive and standard BP control groups ( P control reduced the composite of CVD death, nonfatal myocardial infarction (MI), nonfatal stroke, any revascularization, and heart failure (hazard ratio 0.79; 95% CI 0.65-0.96; P = 0.02). Intensive BP control also reduced CVD death, nonfatal MI, and nonfatal stroke (hazard ratio 0.69; 95% CI 0.51-0.93; P = 0.01). Treatment-related adverse events occurred more frequently in participants receiving intensive BP control (4.1% vs. 2.1%; P = 0.003). The effect of intensive BP control on CVD outcomes did not differ between patients with and without T2DM ( P > 0.62). Intensive BP control reduced CVD outcomes in a cohort of participants with T2DM and additional CVD risk factors. © 2017 by the American Diabetes Association.

  13. AgSTAR

    AgSTAR promotes biogas recovery projects, which generate renewable energy and other beneficial products from the anaerobic digestion of livestock manure and organic wastes while decreasing greenhouse gas emissions from the agriculture sector.

  14. Orbiting radiation stars

    Foster, Dean P; Langford, John; Perez-Giz, Gabe


    We study a spherically symmetric solution to the Einstein equations in which the source, which we call an orbiting radiation star (OR-star), is a compact object consisting of freely falling null particles. The solution avoids quantum scale regimes and hence neither relies upon nor ignores the interaction of quantum mechanics and gravitation. The OR-star spacetime exhibits a deep gravitational well yet remains singularity free. In fact, it is geometrically flat in the vicinity of the origin, with the flat region being of any desirable scale. The solution is observationally distinct from a black hole because a photon from infinity aimed at an OR-star escapes to infinity with a time delay. (paper)

  15. Cataclysmic Variable Stars

    Hellier, Coel


    Cataclysmic variable stars are the most variable stars in the night sky, fluctuating in brightness continually on timescales from seconds to hours to weeks to years. The changes can be recorded using amateur telescopes, yet are also the subject of intensive study by professional astronomers. That study has led to an understanding of cataclysmic variables as binary stars, orbiting so closely that material transfers from one star to the other. The resulting process of accretion is one of the most important in astrophysics. This book presents the first account of cataclysmic variables at an introductory level. Assuming no previous knowledge of the field, it explains the basic principles underlying the variability, while providing an extensive compilation of cataclysmic variable light curves. Aimed at amateur astronomers, undergraduates, and researchers, the main text is accessible to those with no mathematical background, while supplementary boxes present technical details and equations.

  16. SX Phoenicis stars

    Nemec, J.; Mateo, M.


    The purpose of this paper is to review the basic observational information concerning SX Phe stars, including recent findings such as the discovery of about 40 low-luminosity variable stars in the Carina dwarf galaxy and identification of at least one SX Phe star in the metal-rich globular cluster M71. Direct evidence supporting the hypothesis that at least some BSs are binary systems comes from the discovery of two contact binaries and a semidetached binary among the 50 BSs in the globular cluster NGC 5466. Since these systems will coalesce on a time scale 500 Myr, it stands to reason that many (if not most) BSs are coalesced binaries. The merger hypothesis also explains the relatively-large masses (1.0-1.2 solar masses) that have been derived for SX Phe stars and halo BSs, and may also account for the nonvariable BSs in the 'SX Phe instability strip'. 132 refs

  17. The BP oil spill and the bounty of Plaquemines Parish.

    Fertel, Randy


    The source of 25 to 30 percent of America's seafood, the Mississippi River Delta's cornucopian world is now uncertain. And yet, even if shrimp, oysters, and finfish are unaffected by the BP Oil Spill - a big if - one can already reflect on the passing of the culture once built upon gathering them. For almost three centuries, levees made life possible along the riverbanks and in the wetlands beyond. Those same levees also ensured the wetlands would eventually melt away into the Gulf. Cutting off the silt left behind during annual river inundations subjected the fragile land to erosion. Sulfur, natural gas, and oil production companies dug twenty thousand miles of canals to gain more direct routes to their fields and to pump out their mineral wealth. This caused salt-water intrusion that killed off plant life and caused more erosion. The world that sustained my Plaquemines ancestors was less subject to collapse following disasters not only because the ecosystem before the wetlands' ongoing loss was then more vibrant, complex, and robust; but also because their lives, especially their culinary lives, were more vibrant, complex, and robust. Life was hard, but when it came to putting food on the table, life followed the seasons.

  18. Mid-wavelength infrared unipolar nBp superlattice photodetector

    Kazemi, Alireza; Myers, Stephen; Taghipour, Zahra; Mathews, Sen; Schuler-Sandy, Ted; Lee, Seunghyun; Cowan, Vincent M.; Garduno, Eli; Steenbergen, Elizabeth; Morath, Christian; Ariyawansa, Gamini; Scheihing, John; Krishna, Sanjay


    We report a Mid-Wavelength Infrared (MWIR) barrier photodetector based on the InAs/GaSb/AlSb type-II superlattice (T2SL) material system. The nBp design consists of a single unipolar barrier (InAs/AlSb SL) placed between a 4 μm thick p-doped absorber (InAs/GaSb SL) and an n-type contact layer (InAs/GaSb SL). At 80 K, the device exhibited a 50% cut-off wavelength of 5 μm, was fully turned-ON at zero bias and the measured QE was 50% (front side illumination with no AR coating) at 4.5 μm with a dark current density of 4.7 × 10-6 A/cm2 at Vb = 50 mV. At 150 K and Vb = 50 mV, the 50% cut-off wavelength increased to 5.3 μm, and the QE was 54% at 4.5 μm with a dark current of 5.0 × 10-4 A/cm2.

  19. Photometric Observations of 6000 Stars in the Cygnus Field

    Borucki, W.; Caldwell, D.; Koch, D.; Jenkins, J.; Ninkov, Z.


    A small photometer to detect transits by extrasolar planets has been assembled and is being tested at Lick Observatory on Mt. Hamilton, California. The Vulcan photometer is constructed from a 30 cm focal length, F/2.5 AeroEktar reconnaissance lens and Photometrics PXL16800 CCD camera. A spectral filter is used to confine the pass band from 480 to 763 mn. It simultaneously monitors 6000 stars brighter than 12th magnitude within a single star field in the galactic plane. When the data are folded and phased to discover low amplitude transits, the relative precision of one-hour samples is about 1 part per thousand (10 x l0(exp -3)) for many of the brighter stars. This precision is sufficient to find jovian-size planets orbiting solar-like stars, which have signal amplitudes from 5 to 30 x l0(exp -3) depending on the inflation of the planet and the size of the star. Based on the frequency of giant inner-planets discovered by Doppler-velocity method, one or two planets should be detectable in a rich star field. The goal of the observations is to obtain the sizes of giant extrasolar planets in short-period orbits and to combine these with masses determined from Doppler velocity measurements to determine the densities of these planets. A further goal is to compare the measured planetary diameters with those predicted from theoretical models. From August 10 through September 30 of 1998, a forty nine square degree field in the Cygnus constellation centered at RA and DEC of 19 hr 47 min, +36 deg 55 min was observed. Useful data were obtained on twenty-nine nights. Nearly fifty stars showed some evidence of transits with periods between 0.3 and 8 days. Most had amplitudes too large to be associated with planetary transits. However, several stars showed low amplitude transits. The data for several transits of each of these two stars have been folded and been folded into 30 minute periods. Only Cygl433 shows any evidence of a flattened bottom that is expected when a small object

  20. Sounds of a Star


    Acoustic Oscillations in Solar-Twin "Alpha Cen A" Observed from La Silla by Swiss Team Summary Sound waves running through a star can help astronomers reveal its inner properties. This particular branch of modern astrophysics is known as "asteroseismology" . In the case of our Sun, the brightest star in the sky, such waves have been observed since some time, and have greatly improved our knowledge about what is going on inside. However, because they are much fainter, it has turned out to be very difficult to detect similar waves in other stars. Nevertheless, tiny oscillations in a solar-twin star have now been unambiguously detected by Swiss astronomers François Bouchy and Fabien Carrier from the Geneva Observatory, using the CORALIE spectrometer on the Swiss 1.2-m Leonard Euler telescope at the ESO La Silla Observatory. This telescope is mostly used for discovering exoplanets (see ESO PR 07/01 ). The star Alpha Centauri A is the nearest star visible to the naked eye, at a distance of a little more than 4 light-years. The new measurements show that it pulsates with a 7-minute cycle, very similar to what is observed in the Sun . Asteroseismology for Sun-like stars is likely to become an important probe of stellar theory in the near future. The state-of-the-art HARPS spectrograph , to be mounted on the ESO 3.6-m telescope at La Silla, will be able to search for oscillations in stars that are 100 times fainter than those for which such demanding observations are possible with CORALIE. PR Photo 23a/01 : Oscillations in a solar-like star (schematic picture). PR Photo 23b/01 : Acoustic spectrum of Alpha Centauri A , as observed with CORALIE. Asteroseismology: listening to the stars ESO PR Photo 23a/01 ESO PR Photo 23a/01 [Preview - JPEG: 357 x 400 pix - 96k] [Normal - JPEG: 713 x 800 pix - 256k] [HiRes - JPEG: 2673 x 3000 pix - 2.1Mb Caption : PR Photo 23a/01 is a graphical representation of resonating acoustic waves in the interior of a solar-like star. Red and blue

  1. Spectrophotometry of carbon stars

    Gow, C.E.


    Observations of over one hundred carbon stars have been made with the Indiana rapid spectral scanner in the red and, when possible, in the visual and blue regions of the spectrum. Five distinct subtypes of carbon stars (Barium, CH, R, N, and hydrogen deficient) are represented in the list of observed stars, although the emphasis was placed on the N stars when the observations were made. The rapid scanner was operated in the continuous sweep mode with the exit slit set at twenty angstroms, however, seeing fluctuations and guiding errors smear the spectrum to an effective resolution of approximately thirty angstroms. Nightly observations of Hayes standard stars yielded corrections for atmospheric extinction and instrumental response. The reduction scheme rests on two assumptions, that thin clouds are gray absorbers and the wavelength dependence of the sky transparency does not change during the course of the night. Several stars have been observed in the blue region of the spectrum with the Indiana SIT vidicon spectrometer at two angstroms resolution. It is possible to derive a color temperature for the yellow--red spectral region by fitting a black-body curve through two chosen continuum points. Photometric indices were calculated relative to the blackbody curve to measure the C 2 Swan band strength, the shape of the CN red (6,1) band to provide a measure of the 12 C/ 13 C isotope ratio, and in the hot carbon stars (Barium, CH, and R stars) the strength of an unidentified feature centered at 400 angstroms. An extensive abundance grid of model atmospheres was calculated using a modified version of the computer code ATLAS

  2. Young Stars with SALT

    Riedel, Adric R. [Department of Astronomy, California Institute of Technology, Pasadena, CA 91125 (United States); Alam, Munazza K.; Rice, Emily L.; Cruz, Kelle L. [Department of Astrophysics, The American Museum of Natural History, New York, NY 10024 (United States); Henry, Todd J., E-mail: [RECONS Institute, Chambersburg, PA (United States)


    We present a spectroscopic and kinematic analysis of 79 nearby M dwarfs in 77 systems. All of these dwarfs are low-proper-motion southern hemisphere objects and were identified in a nearby star survey with a demonstrated sensitivity to young stars. Using low-resolution optical spectroscopy from the Red Side Spectrograph on the South African Large Telescope, we have determined radial velocities, H-alpha, lithium 6708 Å, and potassium 7699 Å equivalent widths linked to age and activity, and spectral types for all of our targets. Combined with astrometric information from literature sources, we identify 44 young stars. Eighteen are previously known members of moving groups within 100 pc of the Sun. Twelve are new members, including one member of the TW Hydra moving group, one member of the 32 Orionis moving group, 9 members of Tucana-Horologium, one member of Argus, and two new members of AB Doradus. We also find 14 young star systems that are not members of any known groups. The remaining 33 star systems do not appear to be young. This appears to be evidence of a new population of nearby young stars not related to the known nearby young moving groups.

  3. STAR facility tritium accountancy

    Pawelko, R. J.; Sharpe, J. P.; Denny, B. J.


    The Safety and Tritium Applied Research (STAR) facility has been established to provide a laboratory infrastructure for the fusion community to study tritium science associated with the development of safe fusion energy and other technologies. STAR is a radiological facility with an administrative total tritium inventory limit of 1.5 g (14,429 Ci) [1]. Research studies with moderate tritium quantities and various radionuclides are performed in STAR. Successful operation of the STAR facility requires the ability to receive, inventory, store, dispense tritium to experiments, and to dispose of tritiated waste while accurately monitoring the tritium inventory in the facility. This paper describes tritium accountancy in the STAR facility. A primary accountancy instrument is the tritium Storage and Assay System (SAS): a system designed to receive, assay, store, and dispense tritium to experiments. Presented are the methods used to calibrate and operate the SAS. Accountancy processes utilizing the Tritium Cleanup System (TCS), and the Stack Tritium Monitoring System (STMS) are also discussed. Also presented are the equations used to quantify the amount of tritium being received into the facility, transferred to experiments, and removed from the facility. Finally, the STAR tritium accountability database is discussed. (authors)

  4. Asteroseismology of white dwarf stars

    Córsico, A. H.


    Most of low- and intermediate-mass stars that populate the Universe will end their lives as white dwarf stars. These ancient stellar remnants have encrypted inside a precious record of the evolutionary history of the progenitor stars, providing a wealth of information about the evolution of stars, star formation, and the age of a variety of stellar populations, such as our Galaxy and open and globular clusters. While some information like surface chemical composition, temperature and gravity ...

  5. From Admin to Strategy: The Changing Face of the HR Function. IES Report 332.

    Tamkin, Penny; And Others

    Evidence from academic research and management experts in the United Kingdom and elsewhere confirms that the recent focus in work organizations on cost reductions through downsizing has changed the roles and structures of many human resources (HR) units. HR units have had to prove their contribution to the organization's bottom line, raise their…

  6. Comparison between Pentacam HR and Orbscan II after hyperopic photorefractive keratectomy

    Mahmoud Jabbarvand


    Conclusion: Pentacam HR and Orbscan II after PRK for hyperopia show reasonable agreement for determining A-BFS, P-BFS, A-TG3, and CCT, but not for A-CE, P-CE, A-TG5, or ACD. CCT measurements with Pentacam HR have reasonable agreement with US pachymetry.

  7. Data-driven HR how to use analytics and metrics to drive performance

    Marr, Bernard


    Traditionally seen as a purely people function unconcerned with numbers, HR is now uniquely placed to use company data to drive performance, both of the people in the organization and the organization as a whole. Data-driven HR is a practical guide which enables HR practitioners to leverage the value of the vast amount of data available at their fingertips. Covering how to identify the most useful sources of data, how to collect information in a transparent way that is in line with data protection requirements and how to turn this data into tangible insights, this book marks a turning point for the HR profession. Covering all the key elements of HR including recruitment, employee engagement, performance management, wellbeing and training, Data-driven HR examines the ways data can contribute to organizational success by, among other things, optimizing processes, driving performance and improving HR decision making. Packed with case studies and real-life examples, this is essential reading for all HR profession...

  8. How the impact of HR practices on employee well-being and performance changes with age

    Kooij, T.A.M.; Guest, D.; Clinton, M.; Knight, T.; Jansen, P.G.W.; Dikkers, J.S.E.


    With changing retirement ages and an aging workforce, interest is growing on the potential contribution of relevant bundles of HR practices in eliciting well-being and performance among aging workers. Drawing on theories on lifespan development and self-regulation, we distinguished two bundles of HR

  9. Distribution of ABO and Rh-Hr blood group antigens, alleles and ...

    ABO and Rh-Hr blood group antigens represent a genetically stably determined trait with many-sided biological and clinical significance. The indigenous Ajarian population (105 subjects) was investigated for ABO Rh-Hr red cell blood group antigens. Using immunoserologic methods, seven blood group antigens (A, B, C, c, ...

  10. How the impact of HR Practices on employee well-being and performance changes with age

    Kooij, T.A.M.; Guest, D.; Clinton, M.; Knight, T.; Jansen, P.G.W.; Dikkers, J.S.E.


    With changing retirement ages and an aging workforce, interest is growing on the potential contribution of relevant bundles of HR practices in eliciting well-being and performance among aging workers. Drawing on theories on lifespan development and self-regulation, we distinguished two bundles of HR

  11. The discovery of 13.72-min oscillations in the cool magnetic Ap star HD 217522

    Kurtz, D.W.


    The discovery is announced of oscillations with a period near 13.72 min in the cool magnetic Ap star HD 217522. 97 hr of high-speed photometric observations are presented, obtained on 18 nights spread over a time span of 74 days in 1982. The amplitude of the oscillations in HD 217522 is variable from night to night and also on a longer time-scale. A frequency analysis of the data identifies the principal frequency of oscillation to be 4.37435+-0.00014 hr -1 . Because of the complexities of the amplitude modulation of the light curve and the very low amplitude of the light variations, the data are insufficient for a complete frequency solution. This star is the seventh member of the class of rapidly oscillating Ap stars. (author)

  12. Change of offices for HR Department - disrupted service during the last week of February 2013


    HR Department would like to inform that, due to office renovation work, a number of HR Services currently located on the ground, first and second floors of Building 5 will move to temporary offices as from late February.   The removals will take place from Friday 22 until Tuesday 26 February 2013 inclusive and during this period, telephone and e-mail contact may be disrupted. The following services will be relocated to: Building 510  – ground floor (until mid-June) Head of Department and Deputy Office of the Head of HR Department Group Leaders and Partners Diversity Office HR Legal Section Building 652 – Prefab/Algeco (until September) Human Resources Advisors and assistants Staff Recruitment Service Fellows & Apprentices Service Students & Associates Service Temporary office numbers will be available in the CERN phonebook. Any emergencies during the removals may be addressed to Thank you in advance for your understanding. HR Head O...

  13. Lamin A/C-dependent interaction with 53BP1 promotes cellular responses to DNA damage

    Gibbs-Seymour, Ian; Markiewicz, Ewa; Bekker-Jensen, Simon


    Lamins A/C have been implicated in DNA damage response pathways. We show that the DNA repair protein 53BP1 is a lamin A/C binding protein. In undamaged human dermal fibroblasts (HDF), 53BP1 is a nucleoskeleton protein. 53BP1 binds to lamins A/C via its Tudor domain, and this is abrogated by DNA...... damage. Lamins A/C regulate 53BP1 levels and consequently lamin A/C-null HDF display a 53BP1 null-like phenotype. Our data favour a model in which lamins A/C maintain a nucleoplasmic pool of 53BP1 in order to facilitate its rapid recruitment to sites of DNA damage and could explain why an absence...

  14. Expression of the Transcription Factor E4BP4 in Human Basophils

    Jensen, Bettina Margrethe; Gohr, Maria; Poulsen, Lars Kærgaard


    Rationale The cytokine IL-3 plays an important role for human basophil development, function and survival. IL-3 is also reported to induce the expression of the transcription factor E4BP4, but it is not known whether E4BP4 is expressed in basophils and influences basophil responsiveness. The aim...... by Alcian blue. RNA was extracted (0.005-0.02 µg RNA from 0.5 - 1 x 106 cells), and the corresponding cDNA analyzed by real-time PCR where E4BP4 expression was calculated as 2-(CT(E4BP4) - CT(β-actin)). E4BP4 protein expression was visualized in basophil lysates (107 cells/ml) by Western blot followed...... the transcription factor E4BP4 which might have an impact on basophil histamine release....

  15. A new BP Fourier algorithm and its application in English teaching evaluation

    Pei, Xuehui; Pei, Guixin


    BP neural network algorithm has wide adaptability and accuracy when used in complicated system evaluation, but its calculation defects such as slow convergence have limited its practical application. The paper tries to speed up the calculation convergence of BP neural network algorithm with Fourier basis functions and presents a new BP Fourier algorithm for complicated system evaluation. First, shortages and working principle of BP algorithm are analyzed for subsequent targeted improvement; Second, the presented BP Fourier algorithm adopts Fourier basis functions to simplify calculation structure, designs new calculation transfer function between input and output layers, and conducts theoretical analysis to prove the efficiency of the presented algorithm; Finally, the presented algorithm is used in evaluating university English teaching and the application results shows that the presented BP Fourier algorithm has better performance in calculation efficiency and evaluation accuracy and can be used in evaluating complicated system practically.

  16. Exploring the central characteristics of HR shared services: evidence from a critical case study in the Netherlands

    Meijerink, Jeroen Gerard; Bondarouk, Tatiana


    Human resource shared service centers (HR SSCs) are foreseen as improving HR service delivery for their end-users: employees, line managers and decentralized HR professionals. Although the concept expects the benefits of HR SSCs to come from centralizing knowledge and decentralizing the control

  17. A robust star identification algorithm with star shortlisting

    Mehta, Deval Samirbhai; Chen, Shoushun; Low, Kay Soon


    A star tracker provides the most accurate attitude solution in terms of arc seconds compared to the other existing attitude sensors. When no prior attitude information is available, it operates in "Lost-In-Space (LIS)" mode. Star pattern recognition, also known as star identification algorithm, forms the most crucial part of a star tracker in the LIS mode. Recognition reliability and speed are the two most important parameters of a star pattern recognition technique. In this paper, a novel star identification algorithm with star ID shortlisting is proposed. Firstly, the star IDs are shortlisted based on worst-case patch mismatch, and later stars are identified in the image by an initial match confirmed with a running sequential angular match technique. The proposed idea is tested on 16,200 simulated star images having magnitude uncertainty, noise stars, positional deviation, and varying size of the field of view. The proposed idea is also benchmarked with the state-of-the-art star pattern recognition techniques. Finally, the real-time performance of the proposed technique is tested on the 3104 real star images captured by a star tracker SST-20S currently mounted on a satellite. The proposed technique can achieve an identification accuracy of 98% and takes only 8.2 ms for identification on real images. Simulation and real-time results depict that the proposed technique is highly robust and achieves a high speed of identification suitable for actual space applications.

  18. Interactions of the human MCM-BP protein with MCM complex components and Dbf4.

    Tin Nguyen

    Full Text Available MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.

  19. Interactions of the human MCM-BP protein with MCM complex components and Dbf4.

    Nguyen, Tin; Jagannathan, Madhav; Shire, Kathy; Frappier, Lori


    MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.

  20. Crisis strategies in BP's Deepwater Horizon response : An image repair and situational crisis communication study

    Johansson, Mikael


    The BP Deepwater Horizon crisis in 2010 was one the largest catastrophes in the history of the oil industry. BP was sued over the disaster, and lost several billion dollars. This study examines the crisis response strategies and/or image repair strategies, which can be found in BP's press releases following the Deepwater Horizon crisis. In particular, the study looks closer at what established crisis communication strategies could be discerned in the material, and how they are used discursive...

  1. The photosphere of T. Tauri Stars

    Calvet, Nuria; Marin, Zaida


    We have calculated the absorption spectrum in the wavelength interval 4880-5025A for a set of models with Teff = 4000K and log g = 3.5 and a chromospheric temperature rise. These models are considered as representative of the atmosphere of T Tauri stars. The position of the temperature minimum goes from 0.1 to 2 gr cm -2 in the models. Populations are in LTE and the two level plus continuum approximation is used for the source function. We have compared the calculated spectra with those observed in the program of rotational velocity determination by Vogel and Kuhi (1981). Differences between the spectrum of T Tauri stars can be understood in first approximation in terms of differences in the position of the temperature minimum. In particular, we find that at the moment of the observation, the minimum in BP Tau was located between 1 and 2 cm -2 and in AA Tau between 0.3 and 0.6 gr cm -2 . (Author)

  2. BP reactivity to public speaking in stage 1 hypertension: influence of different task scenarios.

    Palatini, Paolo; Bratti, Paolo; Palomba, Daniela; Bonso, Elisa; Saladini, Francesca; Benetti, Elisabetta; Casiglia, Edoardo


    To investigate the blood pressure (BP) reaction to public speaking performed according to different emotionally distressing scenarios in stage 1 hypertension. METHODS. We assessed 64 hypertensive and 30 normotensive subjects. They performed three speech tasks with neutral, anger and anxiety scenarios. BP was assessed with the Finometer beat-to-beat non-invasive recording system throughout the test procedure. For all types of speech, the systolic BP response was greater in the hypertensive than the normotensive subjects (all p public speaking is increased in stage 1 hypertension. A speech with anxiety or anger scenario elicits a greater diastolic BP reaction than tasks with neutral content.

  3. TopBP1 associates with NBS1 and is involved in homologous recombination repair

    Morishima, Ken-ichi; Sakamoto, Shuichi; Kobayashi, Junya; Izumi, Hideki; Suda, Tetsuji; Matsumoto, Yoshiyuki; Tauchi, Hiroshi; Ide, Hiroshi; Komatsu, Kenshi; Matsuura, Shinya


    TopBP1 is involved in DNA replication and DNA damage checkpoint. Recent studies have demonstrated that TopBP1 is a direct positive effecter of ATR. However, it is not known how TopBP1 recognizes damaged DNA. Here, we show that TopBP1 formed nuclear foci after exposure to ionizing radiation, but such TopBP1 foci were abolished in Nijmegen breakage syndrome cells. We also show that TopBP1 physically associated with NBS1 in vivo. These results suggested that NBS1 might regulate TopBP1 recruitment to the sites of DNA damage. TopBP1-depleted cells showed hypersensitivity to Mitomycin C and ionizing radiation, an increased frequency of sister-chromatid exchange level, and a reduced frequency of DNA double-strand break induced homologous recombination repair. Together, these results suggested that TopBP1 might be a mediator of DNA damage signaling from NBS1 to ATR and promote homologous recombination repair

  4. Prediction of Industrial Electric Energy Consumption in Anhui Province Based on GA-BP Neural Network

    Zhang, Jiajing; Yin, Guodong; Ni, Youcong; Chen, Jinlan


    In order to improve the prediction accuracy of industrial electrical energy consumption, a prediction model of industrial electrical energy consumption was proposed based on genetic algorithm and neural network. The model use genetic algorithm to optimize the weights and thresholds of BP neural network, and the model is used to predict the energy consumption of industrial power in Anhui Province, to improve the prediction accuracy of industrial electric energy consumption in Anhui province. By comparing experiment of GA-BP prediction model and BP neural network model, the GA-BP model is more accurate with smaller number of neurons in the hidden layer.

  5. BP1 Homeoprotein Enhances Metastatic Potential in ER-negative Breast Cancer

    Fu, Yebo; Lian, Yi; Kim, Kyung Soon; Zhang, Lei; Hindle, A. Katharine; Brody, Fred; Siegel, Robert S.; McCaffrey, Timothy A.; Fu, Sidney W.


    Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER-) tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. We sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target for ER- breast cancer. PMID:20842225

  6. Research on wind field algorithm of wind lidar based on BP neural network and grey prediction

    Chen, Yong; Chen, Chun-Li; Luo, Xiong; Zhang, Yan; Yang, Ze-hou; Zhou, Jie; Shi, Xiao-ding; Wang, Lei


    This paper uses the BP neural network and grey algorithm to forecast and study radar wind field. In order to reduce the residual error in the wind field prediction which uses BP neural network and grey algorithm, calculating the minimum value of residual error function, adopting the residuals of the gray algorithm trained by BP neural network, using the trained network model to forecast the residual sequence, using the predicted residual error sequence to modify the forecast sequence of the grey algorithm. The test data show that using the grey algorithm modified by BP neural network can effectively reduce the residual value and improve the prediction precision.

  7. Association of Autoantibodies to BP180 with Disease Activity in Greek Patients with Bullous Pemphigoid

    Aikaterini Patsatsi


    Full Text Available 39 bullous pemphigoid (BP patients were studied to assess the clinical significance of anti-BP180 and anti-BP230 circulating autoantibodies of BP and correlate their titers with the clinical scores of the BP Disease Area Index (BPDAI and the Autoimmune Bullous Skin Disorder Intensity Score (ABSIS as well as with the intensity of pruritus measured by the BPDAI pruritus component. All parameters were evaluated by the time of diagnosis (baseline, month 3, and month 6. Titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with BPDAI component for the intensity of pruritus (, at baseline. At month 3, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . At month 6, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . There was no statistically significant correlation between titers of anti-BP230 autoantibodies and the BPDAI, ABSIS, and BPDAI component for the intensity of pruritus at the same time points.

  8. Nuclear Enterprises portable dose rate meter type PDR4 and external probes types BP1/1, BP8 and GP9

    Burgess, P.H.; Iles, W.J.


    The performance characteristics of Nuclear Enterprises Portable Dose Rate Meter Type PDR4 are evaluated under the headings: general description, facilities and controls, radiation characteristics, electrical characteristics, environmental characteristics, mechanical characteristics, the manual, summary of performance, and conclusions. Results of an investigation of the radiation characteristics of the external probes Type BP1/1, Type BP8, and Type GP9 are also detailed. (U.K.)

  9. Wolf-Rayet Stars

    Hamann, Wolf-Rainer; Sander, Andreas; Todt, Helge

    Nearly 150 years ago, the French astronomers Charles Wolf and Georges Rayet described stars with very conspicuous spectra that are dominated by bright and broad emission lines. Meanwhile termed Wolf-Rayet Stars after their discoverers, those objects turned out to represent important stages in the life of massive stars. As the first conference in a long time that was specifically dedicated to Wolf-Rayet stars, an international workshop was held in Potsdam, Germany, from 1.-5. June 2015. About 100 participants, comprising most of the leading experts in the field as well as as many young scientists, gathered for one week of extensive scientific exchange and discussions. Considerable progress has been reported throughout, e.g. on finding such stars, modeling and analyzing their spectra, understanding their evolutionary context, and studying their circumstellar nebulae. While some major questions regarding Wolf-Rayet stars still remain open 150 years after their discovery, it is clear today that these objects are not just interesting stars as such, but also keystones in the evolution of galaxies. These proceedings summarize the talks and posters presented at the Potsdam Wolf-Rayet workshop. Moreover, they also include the questions, comments, and discussions emerging after each talk, thereby giving a rare overview not only about the research, but also about the current debates and unknowns in the field. The Scientific Organizing Committee (SOC) included Alceste Bonanos (Athens), Paul Crowther (Sheffield), John Eldridge (Auckland), Wolf-Rainer Hamann (Potsdam, Chair), John Hillier (Pittsburgh), Claus Leitherer (Baltimore), Philip Massey (Flagstaff), George Meynet (Geneva), Tony Moffat (Montreal), Nicole St-Louis (Montreal), and Dany Vanbeveren (Brussels).

  10. Models of symbiotic stars

    Friedjung, Michael


    One of the most important features of symbiotic stars is the coexistence of a cool spectral component that is apparently very similar to the spectrum of a cool giant, with at least one hot continuum, and emission lines from very different stages of ionization. The cool component dominates the infrared spectrum of S-type symbiotics; it tends to be veiled in this wavelength range by what appears to be excess emission in D-type symbiotics, this excess usually being attributed to circumstellar dust. The hot continuum (or continua) dominates the ultraviolet. X-rays have sometimes also been observed. Another important feature of symbiotic stars that needs to be explained is the variability. Different forms occur, some variability being periodic. This type of variability can, in a few cases, strongly suggest the presence of eclipses of a binary system. One of the most characteristic forms of variability is that characterizing the active phases. This basic form of variation is traditionally associated in the optical with the veiling of the cool spectrum and the disappearance of high-ionization emission lines, the latter progressively appearing (in classical cases, reappearing) later. Such spectral changes recall those of novae, but spectroscopic signatures of the high-ejection velocities observed for novae are not usually detected in symbiotic stars. However, the light curves of the 'symbiotic nova' subclass recall those of novae. We may also mention in this connection that radio observations (or, in a few cases, optical observations) of nebulae indicate ejection from symbiotic stars, with deviations from spherical symmetry. We shall give a historical overview of the proposed models for symbiotic stars and make a critical analysis in the light of the observations of symbiotic stars. We describe the empirical approach to models and use the observational data to diagnose the physical conditions in the symbiotics stars. Finally, we compare the results of this empirical

  11. Elevated sensitivity to diet-induced obesity and insulin resistance in mice lacking 4E-BP1 and 4E-BP2.

    Le Bacquer, Olivier; Petroulakis, Emmanuel; Paglialunga, Sabina; Poulin, Francis; Richard, Denis; Cianflone, Katherine; Sonenberg, Nahum


    The most common pathology associated with obesity is insulin resistance, which results in the onset of type 2 diabetes mellitus. Several studies have implicated the mammalian target of rapamycin (mTOR) signaling pathway in obesity. Eukaryotic translation initiation factor 4E-binding (eIF4E-binding) proteins (4E-BPs), which repress translation by binding to eIF4E, are downstream effectors of mTOR. We report that the combined disruption of 4E-BP1 and 4E-BP2 in mice increased their sensitivity to diet-induced obesity. Increased adiposity was explained at least in part by accelerated adipogenesis driven by increased expression of CCAAT/enhancer-binding protein delta (C/EBPdelta), C/EBPalpha, and PPARgamma coupled with reduced energy expenditure, reduced lipolysis, and greater fatty acid reesterification in the adipose tissue of 4E-BP1 and 4E-BP2 double KO mice. Increased insulin resistance in 4E-BP1 and 4E-BP2 double KO mice was associated with increased ribosomal protein S6 kinase (S6K) activity and impairment of Akt signaling in muscle, liver, and adipose tissue. These data clearly demonstrate the role of 4E-BPs as a metabolic brake in the development of obesity and reinforce the idea that deregulated mTOR signaling is associated with the development of the metabolic syndrome.


    Casanellas, Jordi; Lopes, IlIdio


    In order to characterize how dark matter (DM) annihilation inside stars changes the aspect of a stellar cluster, we computed the evolution until the ignition of the He burning of stars from 0.7 M sun to 3.5 M sun within halos of DM with different characteristics. We found that, when a cluster is surrounded by a dense DM halo, the positions of the cluster' stars in the H-R diagram have a brighter and hotter turnoff point than in the classical scenario without DM, therefore giving the cluster a younger appearance. The high DM densities required to produce these effects are expected only in very specific locations, such as near the center of our Galaxy. In particular, if DM is formed by the 8 GeV weakly interacting massive particles recently invoked to reconcile the results from direct detection experiments, then this signature is predicted for halos of DM with a density ρ χ = 3 x 10 5 GeV cm -3 . A DM density gradient inside the stellar cluster would result in a broader main sequence, turnoff, and red giant branch regions. Moreover, we found that for very high DM halo densities the bottom of the isochrones in the H-R diagram rises to higher luminosities, leading to a characteristic signature on the stellar cluster. We argue that this signature could be used to indirectly probe the presence of DM particles in the location of a cluster.

  13. Circulation of Stars

    Boitani, P.


    Since the dawn of man, contemplation of the stars has been a primary impulse in human beings, who proliferated their knowledge of the stars all over the world. Aristotle sees this as the product of primeval and perennial “wonder” which gives rise to what we call science, philosophy, and poetry. Astronomy, astrology, and star art (painting, architecture, literature, and music) go hand in hand through millennia in all cultures of the planet (and all use catasterisms to explain certain phenomena). Some of these developments are independent of each other, i.e., they take place in one culture independently of others. Some, on the other hand, are the product of the “circulation of stars.” There are two ways of looking at this. One seeks out forms, the other concentrates on the passing of specific lore from one area to another through time. The former relies on archetypes (for instance, with catasterism), the latter constitutes a historical process. In this paper I present some of the surprising ways in which the circulation of stars has occurred—from East to West, from East to the Far East, and from West to East, at times simultaneously.

  14. BP1, an Isoform of DLX4 Homeoprotein, Negatively Regulates BRCA1 in Sporadic Breast Cancer

    Kluk, Brian J.; Fu, Yebo; Formolo, Trina A.; Zhang, Lei; Hindle, Anne K.; Man, Yan-gao; Siegel, Robert S.; Berg, Patricia E.; Deng, Chuxia; McCaffrey, Timothy A.; Fu, Sidney W.


    Introduction: Several lines of evidence point to an important role for BP1, an isoform of DLX4 homeobox gene, in breast carcinogenesis and progression. BRCA1 is a well-known player in the etiology of breast cancer. While familial breast cancer is often marked by BRCA1 mutation and subsequent loss of heterozygosity, sporadic breast cancers exhibit reduced expression of wild type BRCA1, and loss of BRCA1 expression may result in tumor development and progression. Methods: The Cister algorithm and Genomatix program were used to identify potential BP1 binding sites in BRCA1 gene. Real-time PCR, Western blot and immunohistochemistry analysis were performed to verify the expression of BRCA1 and BP1 in cell lines and breast cancer tissues. Double-stranded siRNA transfection was carried out for silencing BP1 expression. ChIP and EMSA were used to confirm that BP1 specifically binds to BRCA1. Results: A putative BP1 binding site was identified in the first intron of BRCA1, which was confirmed by chromatin immunoprecipiation and electrophoresis mobility shift assay. BP1 and BRCA1 expression were inversely correlated in breast cancer cell lines and tissues, suggesting that BP1 may suppress BRCA1 transcription through consensus sequence binding. Conclusions: BP1 homeoprotein represses BRCA1 expression through direct binding to its first intron, which is consistent with a previous study which identified a novel transcriptional repressor element located more than 500 base pairs into the first intron of BRCA1, suggesting that the first intron plays an important role in the negative regulation of BRCA1. Although further functional studies are necessary to confirm its repressor activity towards BRCA1, the elucidation of the role of BP1 in breast tumorigenesis holds great promise in establishing BP1 as a novel target for drug therapy. PMID:20877436

  15. Elimination of C3 as the Bond-Neff depression opacity source in Hr 774

    Baird, S.R.


    The pseudocontinuum of C 3 has been proposed by Fix as the source of the Bond-Neff depression in HR 774. In such a case the strongest rotational lines of the 4050 A vibrational band of C 3 should be clearly evident at high dispersion. A 2.2 A mm -1 plate of HR 774 is examined in the 4050--4060 A region where the strongest lines should form. The absence of C 3 rotational lines indicates that C 3 cannot be the major contributor to the Bond-Neff depression in HR 774

  16. Neutron star/red giant encounters in globular clusters

    Bailyn, C.D.


    The author presents a simple expression for the amount by which xsub(crit) is diminished as a star evolves xsub(crit) Rsub(crit)/R*, where Rsub(crit) is the maximum distance of closest approach between two stars for which the tidal energy is sufficient to bind the system, and R* is the radius of the star on which tides are being raised. Also it is concluded that tidal capture of giants by neutron stars resulting in binary systems is unlikely in globular clusters. However, collisions between neutron stars and red giants, or an alternative process involving tidal capture of a main-sequence star into an initially detached binary system, may result either in rapidly rotating neutron stars or in white dwarf/neutron star binaries. (author)

  17. Atomic diffusion in stars

    Michaud, Georges; Richer, Jacques


    This book gives an overview of atomic diffusion, a fundamental physical process, as applied to all types of stars, from the main sequence to neutron stars. The superficial abundances of stars as well as their evolution can be significantly affected. The authors show where atomic diffusion plays an essential role and how it can be implemented in modelling.  In Part I, the authors describe the tools that are required to include atomic diffusion in models of stellar interiors and atmospheres. An important role is played by the gradient of partial radiative pressure, or radiative acceleration, which is usually neglected in stellar evolution. In Part II, the authors systematically review the contribution of atomic diffusion to each evolutionary step. The dominant effects of atomic diffusion are accompanied by more subtle effects on a large number of structural properties throughout evolution. One of the goals of this book is to provide the means for the astrophysicist or graduate student to evaluate the importanc...

  18. Dynamical Boson Stars

    Steven L. Liebling


    Full Text Available The idea of stable, localized bundles of energy has strong appeal as a model for particles. In the 1950s, John Wheeler envisioned such bundles as smooth configurations of electromagnetic energy that he called geons, but none were found. Instead, particle-like solutions were found in the late 1960s with the addition of a scalar field, and these were given the name boson stars. Since then, boson stars find use in a wide variety of models as sources of dark matter, as black hole mimickers, in simple models of binary systems, and as a tool in finding black holes in higher dimensions with only a single Killing vector. We discuss important varieties of boson stars, their dynamic properties, and some of their uses, concentrating on recent efforts.

  19. GRACE star camera noise

    Harvey, Nate


    Extending results from previous work by Bandikova et al. (2012) and Inacio et al. (2015), this paper analyzes Gravity Recovery and Climate Experiment (GRACE) star camera attitude measurement noise by processing inter-camera quaternions from 2003 to 2015. We describe a correction to star camera data, which will eliminate a several-arcsec twice-per-rev error with daily modulation, currently visible in the auto-covariance function of the inter-camera quaternion, from future GRACE Level-1B product releases. We also present evidence supporting the argument that thermal conditions/settings affect long-term inter-camera attitude biases by at least tens-of-arcsecs, and that several-to-tens-of-arcsecs per-rev star camera errors depend largely on field-of-view.

  20. Molecules in stars

    Tsuji, T.


    Recently, research related to molecules in stars has rapidly expanded because of progress in related fields. For this reason, it is almost impossible to cover all the topics related to molecules in stars. Thus, here the authors focus their attention on molecules in the atmospheres of cool stars and do not cover in any detail topics related to circumstellar molecules originating from expanding envelopes located far from the stellar surface. However, the authors do discuss molecules in quasi-static circumstellar envelopes (a recently discovered new component of circumstellar envelopes) located near the stellar surface, since molecular lines originating from such envelopes show little velocity shift relative to photospheric lines, and hence they directly affect the interpretation and analysis of stellar spectra


    Suleimanov, V. F.; Klochkov, D.; Werner, K.; Pavlov, G. G.


    The accuracy of measuring the basic parameters of neutron stars is limited in particular by uncertainties in the chemical composition of their atmospheres. For example, the atmospheres of thermally emitting neutron stars in supernova remnants might have exotic chemical compositions, and for one of them, the neutron star in Cas A, a pure carbon atmosphere has recently been suggested by Ho and Heinke. To test this composition for other similar sources, a publicly available detailed grid of the carbon model atmosphere spectra is needed. We have computed this grid using the standard local thermodynamic equilibrium approximation and assuming that the magnetic field does not exceed 10 8  G. The opacities and pressure ionization effects are calculated using the Opacity Project approach. We describe the properties of our models and investigate the impact of the adopted assumptions and approximations on the emergent spectra

  2. Instability and star evolution

    Mirzoyan, L.V.


    The observational data are discussed which testify that the phenomena of dynamical instability of stars and stellar systems are definite manifestations of their evolution. The study of these phenomena has shown that the instability is a regular phase of stellar evolution. It has resulted in the recognition of the most important regularities of the process of star formation concerning its nature. This became possible due to the discovery in 1947 of stellar associations in our Galaxy. The results of the study of the dynamical instability of stellar associations contradict the predictions of classical hypothesis of stellar condensation. These data supplied a basis for a new hypothesis on the formation of stars and nebulae by the decay of superdense protostars [ru

  3. The twinkling of stars

    Jakeman, E.; Parry, G.; Pike, E.R.; Pusey, P.N.


    This article collects together some of the main ideas and experimental results on the twinkling of stars. Statistical methods are used to characterise the features of the scintillation and to investigate the ways in which these depend on the zenith angle of the star, the bandwidth of the light and various other parameters. Some new results are included which demonstrate the advantages of using photon counting methods in experiments on stellar scintillation. Since the twinkling of stars is a consequence of the turbulence in the Earth's magnetic atmosphere then measurements can be used to deduce some features of the structure of the turbulence. Some of the experiments designed to do this are discussed and the results reported. (author)


    Huenemoerder, David P. [Massachusetts Institute of Technology, Kavli Institute for Astrophysics and Space Research, 70 Vassar St., Cambridge, MA 02139 (United States); Phillips, Kenneth J. H. [Visiting Scientist, Space Research Center, Polish Academy of Sciences, 51-622, Kopernika 11, Wroclaw (Poland); Sylwester, Janusz; Sylwester, Barbara, E-mail:, E-mail:, E-mail:, E-mail: [Space Research Center, Polish Academy of Sciences, 51-622, Kopernika 11, Wroclaw (Poland)


    The Chandra High Energy Transmission Grating Spectrometer (HETG) spectra of the coronally active binary stars {sigma} Gem and HR 1099 are among the highest fluence observations for such systems taken at high spectral resolution in X-rays with this instrument. This allows us to compare their properties in detail to solar flare spectra obtained with the Russian CORONAS-F spacecraft's RESIK instrument at similar resolution in an overlapping bandpass. Here we emphasize the detailed comparisons of the 3.3-6.1 A region (including emission from highly ionized S, Si, Ar, and K) from solar flare spectra to the corresponding {sigma} Gem and HR 1099 spectra. We also model the larger wavelength range of the HETG, from 1.7 to 25 A - having emission lines from Fe, Ca, Ar, Si, Al, Mg, Ne, O, and N-to determine coronal temperatures and abundances. {sigma} Gem is a single-lined coronally active long-period binary which has a very hot corona. HR 1099 is a similar, but shorter period, double-lined system. With very deep HETG exposures we can even study emission from some of the weaker species, such as K, Na, and Al, which are important since they have the lowest first ionization potentials, a parameter well known to be correlated with elemental fractionation in the solar corona. The solar flare temperatures reach Almost-Equal-To 20 MK, comparable to the {sigma} Gem and HR 1099 coronae. During the Chandra exposures, {sigma} Gem was slowly decaying from a flare and its spectrum is well characterized by a collisional ionization equilibrium plasma with a broad temperature distribution ranging from 2 to 60 MK, peaking near 25 MK, but with substantial emission from 50 MK plasma. We have detected K XVIII and Na XI emission which allow us to set limits on their abundances. HR 1099 was also quite variable in X-rays, also in a flare state, but had no detectable K XVIII. These measurements provide new comparisons of solar and stellar coronal abundances, especially at the lowest first

  5. Infrared observations of RS CVn stars

    Berriman, G.; De Campli, W. M.; Werner, M. W.; Hatchett, S. P.


    The paper presents infrared photometry of the RS CVn binary stars AR Lac (1.2-10 microns) and MM Her (1.2-3.5 microns) as they egressed from their primary and secondary eclipses; of the eclipsing systems RS CVn and Z Her at maximum light (1.2-10 microns) and of the non-eclipsing systems UX Ari and HR 1099 (1.2-10 microns). An analysis of these and published V data based on flux ratio diagrams (linear analogues of color-color diagrams) shows that G and K stars supply the infrared light of these systems. In AR Lac, the combined light of a G5-K0 subgiant and either a late F dwarf or an early F subgiant can account for the observed visual and infrared light curves. None of these systems shows infrared emission from circumstellar matter. This result is simply understood: dust grains would not be expected to form in the physical conditions surrounding the subgiant, and the corona and chromosphere (whose properties have been deduced from spectroscopic X-ray observations) should not produce appreciable infrared emission.

  6. Time-series photometric spot modeling. 2: Fifteen years of photometry of the bright RS CVn binary HR 7275

    Strassmeier, K. G.; Hall, D. S.; Henry, G. W.


    We present a time-dependent spot modeling analysis of 15 consecutive years of V-band photometry of the long-period (P(sub orb) = 28.6 days) RS CVn binary HR 7275. This baseline in time is one of the longest, uninterrupted intervals a spotted star has been observed. The spot modeling analysis yields a total of 20 different spots throughout the time span of our observations. The distribution of the observed spot migration rates is consistent with solar-type differential rotation and suggests a lower limit of the differential-rotation coefficient of 0.022 +/-0.004. The observed, maximum lifetime of a single spot (or spot group) is 4.5 years, the minimum lifetime is approximately one year, but an average spot lives for 2.2 years. If we assume that the mechanical shear by differential rotation sets the upper limit to the spot lifetime, the observed maximum lifetime in turn sets an upper limit to the differential-rotation coefficient, namely 0.04 +/- 0.01. This would be differential rotation just 5 to 8 times less than the solar value and one of the strongest among active binaries. We found no conclusive evidence for the existence of a periodic phenomenon that could be attributed to a stellar magnetic cycle.

  7. ALMA 1.3 Millimeter Map of the HD 95086 System -- A Young Analog of the HR 8799 System

    Su, Kate; MacGregor, Meredith Ann; Booth, Mark; Wilner, David; Malhotra, Renu; Morrison, Sarah; OST STDT


    Planets and minor bodies such as asteroids, Kuiper-belt objects and comets are integral components of a planetary system. Interactions among them leave clues about the formation process of a planetary system. The signature of such interactions is best illustrated through resolved observations of its debris disk. Here we present ALMA 1.3 mm observations of HD 95086, a young analog of the HR 8799 system, that hosts a directly imaged giant planet b and a massive debris disk with both asteroid- and Kuiper-belt analogs. The location of the Kuiper-belt analog is resolved for the first time. Our deep ALMA map also reveals a bright source located near the edge of the ring. The properties of the source, based on limited data, are consistent with it being a luminous star-forming galaxy at high redshift. We will discuss future, resolved observations of debris disks, highlighting the potential of the Origins Space Telescope (OST), one of the four science and technology definition studies commissioned by NASA Headquarters for the 2020 Astronomy and Astrophysics Decadal survey.

  8. Weighing the Smallest Stars


    VLT Finds Young, Very Low Mass Objects Are Twice As Heavy As Predicted Summary Thanks to the powerful new high-contrast camera installed at the Very Large Telescope, photos have been obtained of a low-mass companion very close to a star. This has allowed astronomers to measure directly the mass of a young, very low mass object for the first time. The object, more than 100 times fainter than its host star, is still 93 times as massive as Jupiter. And it appears to be almost twice as heavy as theory predicts it to be. This discovery therefore suggests that, due to errors in the models, astronomers may have overestimated the number of young "brown dwarfs" and "free floating" extrasolar planets. PR Photo 03/05: Near-infrared image of AB Doradus A and its companion (NACO SDI/VLT) A winning combination A star can be characterised by many parameters. But one is of uttermost importance: its mass. It is the mass of a star that will decide its fate. It is thus no surprise that astronomers are keen to obtain a precise measure of this parameter. This is however not an easy task, especially for the least massive ones, those at the border between stars and brown dwarf objects. Brown dwarfs, or "failed stars", are objects which are up to 75 times more massive than Jupiter, too small for major nuclear fusion processes to have ignited in its interior. To determine the mass of a star, astronomers generally look at the motion of stars in a binary system. And then apply the same method that allows determining the mass of the Earth, knowing the distance of the Moon and the time it takes for its satellite to complete one full orbit (the so-called "Kepler's Third Law"). In the same way, they have also measured the mass of the Sun by knowing the Earth-Sun distance and the time - one year - it takes our planet to make a tour around the Sun. The problem with low-mass objects is that they are very faint and will often be hidden in the glare of the brighter star they orbit, also when viewed

  9. General Relativity and Compact Stars

    Glendenning, Norman K.


    Compact stars--broadly grouped as neutron stars and white dwarfs--are the ashes of luminous stars. One or the other is the fate that awaits the cores of most stars after a lifetime of tens to thousands of millions of years. Whichever of these objects is formed at the end of the life of a particular luminous star, the compact object will live in many respects unchanged from the state in which it was formed. Neutron stars themselves can take several forms--hyperon, hybrid, or strange quark star. Likewise white dwarfs take different forms though only in the dominant nuclear species. A black hole is probably the fate of the most massive stars, an inaccessible region of spacetime into which the entire star, ashes and all, falls at the end of the luminous phase. Neutron stars are the smallest, densest stars known. Like all stars, neutron stars rotate--some as many as a few hundred times a second. A star rotating at such a rate will experience an enormous centrifugal force that must be balanced by gravity or else it will be ripped apart. The balance of the two forces informs us of the lower limit on the stellar density. Neutron stars are 10 14 times denser than Earth. Some neutron stars are in binary orbit with a companion. Application of orbital mechanics allows an assessment of masses in some cases. The mass of a neutron star is typically 1.5 solar masses. They can therefore infer their radii: about ten kilometers. Into such a small object, the entire mass of our sun and more, is compressed

  10. Atmospheres of central stars

    Hummer, D.G.


    The author presents a brief summary of atmospheric models that are of possible relevance to the central stars of planetary nebulae, and then discusses the extent to which these models accord with the observations of both nebulae and central stars. Particular attention is given to the significance of the very high Zanstra temperature implied by the nebulae He II lambda 4686 A line, and to the discrepancy between the Zanstra He II temperature and the considerably lower temperatures suggested by the appearance of the visual spectrum for some of these objects. (Auth.)

  11. The Drifting Star


    By studying in great detail the 'ringing' of a planet-harbouring star, a team of astronomers using ESO's 3.6-m telescope have shown that it must have drifted away from the metal-rich Hyades cluster. This discovery has implications for theories of star and planet formation, and for the dynamics of our Milky Way. ESO PR Photo 09a/08 ESO PR Photo 09a/08 Iota Horologii The yellow-orange star Iota Horologii, located 56 light-years away towards the southern Horologium ("The Clock") constellation, belongs to the so-called "Hyades stream", a large number of stars that move in the same direction. Previously, astronomers using an ESO telescope had shown that the star harbours a planet, more than 2 times as large as Jupiter and orbiting in 320 days (ESO 12/99). But until now, all studies were unable to pinpoint the exact characteristics of the star, and hence to understand its origin. A team of astronomers, led by Sylvie Vauclair from the University of Toulouse, France, therefore decided to use the technique of 'asteroseismology' to unlock the star's secrets. "In the same way as geologists monitor how seismic waves generated by earthquakes propagate through the Earth and learn about the inner structure of our planet, it is possible to study sound waves running through a star, which forms a sort of large, spherical bell," says Vauclair. The 'ringing' from this giant musical instrument provides astronomers with plenty of information about the physical conditions in the star's interior. And to 'listen to the music', the astronomers used one of the best instruments available. The observations were conducted in November 2006 during 8 consecutive nights with the state-of-the-art HARPS spectrograph mounted on the ESO 3.6-m telescope at La Silla. Up to 25 'notes' could be identified in the unique dataset, most of them corresponding to waves having a period of about 6.5 minutes. These observations allowed the astronomers to obtain a very precise portrait of Iota Horologii: its

  12. The star of Bethlehem

    Hughes, D.W.


    It is stated that the cause and form of the star are still uncertain. The astrologically significant triple conjunction of Saturn and Jupiter in the constellation of Pisces appears to be the most likely explanation, although the two comets of March 5 BC and April 4 BC cannot be dismissed, nor can the possibility that the 'star' was simply legendary. The conjunction occurred in 7 BC and there are indications that Jesus Christ was probably born in the Autumn of that year, around October 7 BC. (U.K.)

  13. The formation of stars

    Stahler, Steven W


    This book is a comprehensive treatment of star formation, one of the most active fields of modern astronomy. The reader is guided through the subject in a logically compelling manner. Starting from a general description of stars and interstellar clouds, the authors delineate the earliest phases of stellar evolution. They discuss formation activity not only in the Milky Way, but also in other galaxies, both now and in the remote past. Theory and observation are thoroughly integrated, with the aid of numerous figures and images. In summary, this volume is an invaluable resource, both as a text f

  14. Chaplygin dark star

    Bertolami, O.; Paramos, J.


    We study the general properties of a spherically symmetric body described through the generalized Chaplygin equation of state. We conclude that such an object, dubbed generalized Chaplygin dark star, should exist within the context of the generalized Chaplygin gas (GCG) model of unification of dark energy and dark matter, and derive expressions for its size and expansion velocity. A criteria for the survival of the perturbations in the GCG background that give origin to the dark star are developed, and its main features are analyzed

  15. CacyBP/SIP promotes the proliferation of colon cancer cells.

    Huihong Zhai

    Full Text Available CacyBP/SIP is a component of the ubiquitin pathway and is overexpressed in several transformed tumor tissues, including colon cancer, which is one of the most common cancers worldwide. It is unknown whether CacyBP/SIP promotes the proliferation of colon cancer cells. This study examined the expression level, subcellular localization, and binding activity of CacyBP/SIP in human colon cancer cells in the presence and absence of the hormone gastrin. We found that CacyBP/SIP was expressed in a high percentage of colon cancer cells, but not in normal colonic surface epithelium. CacyBP/SIP promoted the cell proliferation of colon cancer cells under both basal and gastrin stimulated conditions as shown by knockdown studies. Gastrin stimulation triggered the translocation of CacyBP/SIP to the nucleus, and enhanced interaction between CacyBP/SIP and SKP1, a key component of ubiquitination pathway which further mediated the proteasome-dependent degradation of p27kip1 protein. The gastrin induced reduction in p27kip1 was prevented when cells were treated with the proteasome inhibitor MG132. These results suggest that CacyBP/SIP may be promoting growth of colon cancer cells by enhancing ubiquitin-mediated degradation of p27kip1.

  16. TopBP1/Dpb11 binds DNA anaphase bridges to prevent genome instability

    Germann, Susanne Manuela; Schramke, Vera; Pedersen, Rune Troelsgaard


    yeast Saccharomyces cerevisiae and the avian DT40 cell line as model systems for studying DNA anaphase bridges and show that TopBP1/Dpb11 plays an evolutionarily conserved role in their metabolism. Together with the single-stranded DNA binding protein RPA, TopBP1/Dpb11 binds to UFBs, and depletion...

  17. IntCal04 terrestrial radiocarbon age calibration, 0-26 cal kyr BP

    Reimer, Paula J.; Baillie, Mike G.L.; Bard, Edouard; Bayliss, Alex; Beck, J. Warren; Bertrand, Chanda J.H.; Blackwell, Paul G.; Buck, Caitlin E.; Burr, George S.; Cutler, Kirsten B.; Damon, Paul E.; Edwards, R. Lawrence; Fairbanks, Richard G.; Friedrich, Michael; Guilderson, Thomas P.; Hogg, Alan G.; Hughen, Konrad A.; Kromer, Bernd; McCormac, Gerry; Manning, Sturt; Bronk Ramsey, Christopher; Reimer, Ron W.; Remmele, Sabine; Southon, John R.; Stuiver, Minze; Talamo, Sahra; Taylor, F.W.; Plicht, Johannes van der; Weyhenmeyer, Constanze E.


    A new calibration curve for the conversion of radiocarbon ages to calibrated (cal) ages has been constructed and internationally ratified to replace IntCal98, which extended from 0–24 cal kyr BP (Before Present, 0 cal BP = AD 1950). The new calibration data set for terrestrial samples extends from

  18. Marine04 marine radiocarbon age calibration, 0-26 cal kyr BP

    Hughen, Konrad A.; Baillie, Mike G.L.; Bard, Edouard; Beck, J. Warren; Bertrand, Chanda J.H.; Blackwell, Paul G.; Buck, Caitlin E.; Burr, George S.; Cutler, Kirsten B.; Damon, Paul E.; Edwards, Richard L.; Fairbanks, Richard G.; Friedrich, Michael; Guilderson, Thomas P.; Kromer, Bernd; McCormac, Gerry; Manning, Sturt; Bronk Ramsey, Christopher; Reimer, Paula J.; Reimer, Ron W.; Remmele, Sabine; Southon, John R.; Stuiver, Minze; Talamo, Sahra; Taylor, F.W.; Plicht, Johannes van der; Weyhenmeyer, Constanze E.


    New radiocarbon calibration curves, IntCal04 and Marine04, have been constructed and internationally ratified to replace the terrestrial and marine components of IntCal98. The new calibration data sets extend an additional 2000 yr, from 0–26 cal kyr BP (Before Present, 0 cal BP = AD 1950), and

  19. Overexpressed CacyBP/SIP leads to the suppression of growth in renal cell carcinoma

    Sun, Shiren; Ning, Xiaoxuan; Liu, Jie; Liu, Lili; Chen, Yu; Han, Shuang; Zhang, Yanqi; Liang, Jie; Wu, Kaichun; Fan, Daiming


    Calcyclin-binding protein/Siah-1-interacting protein (CacyBP/SIP), a target protein of S100, has been identified as a component of a novel ubiquitinylation complex leading to β-catenin degradation, which was found to be related to the malignant phenotypes of gastric cancer. However, the roles of CacyBP/SIP in renal cell carcinoma still remain unclear. In the present study, we had analyzed the expression of the CacyBP/SIP protein in human renal cancer cells and clinical tissue samples. The possible roles of CacyBP/SIP in regulating the malignant phenotype of renal cancer cells were also investigated. The results demonstrated that the expression of CacyBP/SIP was markedly down-regulated in renal cell carcinoma tissues and cell lines. Ectopic overexpression of CacyBP/SIP in A498 cells inhibited the proliferation of this cell and delayed cell cycle progression significantly, which might be related to the down-regulation of Cyclin D1 through reducing β-catenin protein. CacyBP/SIP also suppressed colony formation in soft agar and its tumorigenicity in nude mice. Taken together, our work showed that CacyBP/SIP, as a novel down-regulated gene in renal cell carcinoma, suppressed proliferation and tumorigenesis of renal cancer cells

  20. InterProScan Result: BP116799 [KAIKOcDNA[Archive

    Full Text Available BP116799 BP116799_1_ORF2 D3F3F8C61868AD4C PANTHER PTHR11792 ARRESTIN 3.5e-15 T IPR000698 Arrestin Biological... Process: signal transduction (GO:0007165)|Biological Process: sensory perception (GO:0007600) ...