Mixed poloidal-toroidal magnetic configuration and surface abundance distributions of the Bp star 36 Lyn

Science.gov (United States)

Oksala, M. E.; Silvester, J.; Kochukhov, O.; Neiner, C.; Wade, G. A.; the MiMeS Collaboration

2018-01-01

Previous studies of the chemically peculiar Bp star 36 Lyn revealed a moderately strong magnetic field, circumstellar material and inhomogeneous surface abundance distributions of certain elements. We present in this paper an analysis of 33 high signal-to-noise ratio, high-resolution Stokes IV observations of 36 Lyn obtained with the Narval spectropolarimeter at the Bernard Lyot Telescope at Pic du Midi Observatory. From these data, we compute new measurements of the mean longitudinal magnetic field, Bℓ, using the multiline least-squares deconvolution (LSD) technique. A rotationally phased Bℓ curve reveals a strong magnetic field, with indications for deviation from a pure dipole field. We derive magnetic maps and chemical abundance distributions from the LSD profiles, produced using the Zeeman-Doppler imaging code INVERSLSD. Using a spherical harmonic expansion to characterize the magnetic field, we find that the harmonic energy is concentrated predominantly in the dipole mode (ℓ = 1), with significant contribution from both the poloidal and toroidal components. This toroidal field component is predicted theoretically, but not typically observed for Ap/Bp stars. Chemical abundance maps reveal a helium enhancement in a distinct region where the radial magnetic field is strong. Silicon enhancements are located in two regions, also where the radial field is stronger. Titanium and iron enhancements are slightly offset from the helium enhancements, and are located in areas where the radial field is weak, close to the magnetic equator.

Journeys on the H-R diagram

International Nuclear Information System (INIS)

Kaler, J.B.

1988-01-01

The evolution of various types of stars along the H-R diagram is discussed. Star birth and youth is addressed, and the events that occur due to core contraction, shell burning, and double-shell burning are described. The evolutionary courses of planetary nebulae, white dwarfs, and supernovas are examined

EVOLUTION OF INTERMEDIATE-MASS X-RAY BINARIES DRIVEN BY THE MAGNETIC BRAKING OF AP/BP STARS. I. ULTRACOMPACT X-RAY BINARIES

Energy Technology Data Exchange (ETDEWEB)

Chen, Wen-Cong [School of Physics and Electrical Information, Shangqiu Normal University, Shangqiu 476000 (China); Podsiadlowski, Philipp, E-mail: chenwc@pku.edu.cn [Department of Physics, University of Oxford, Oxford OX1 3RH (United Kingdom)

2016-10-20

It is generally believed that ultracompact X-ray binaries (UCXBs) evolved from binaries consisting of a neutron star accreting from a low-mass white dwarf (WD) or helium star where mass transfer is driven by gravitational radiation. However, the standard WD evolutionary channel cannot produce the relatively long-period (40–60 minutes) UCXBs with a high time-averaged mass-transfer rate. In this work, we explore an alternative evolutionary route toward UCXBs, where the companions evolve from intermediate-mass Ap/Bp stars with an anomalously strong magnetic field (100–10,000 G). Including the magnetic braking caused by the coupling between the magnetic field and an irradiation-driven wind induced by the X-ray flux from the accreting component, we show that intermediate-mass X-ray binaries (IMXBs) can evolve into UCXBs. Using the MESA code, we have calculated evolutionary sequences for a large number of IMXBs. The simulated results indicate that, for a small wind-driving efficiency f = 10{sup −5}, the anomalous magnetic braking can drive IMXBs to an ultra-short period of 11 minutes. Comparing our simulated results with the observed parameters of 15 identified UCXBs, the anomalous magnetic braking evolutionary channel can account for the formation of seven and eight sources with f = 10{sup −3}, and 10{sup −5}, respectively. In particular, a relatively large value of f can fit three of the long-period, persistent sources with a high mass-transfer rate. Though the proportion of Ap/Bp stars in intermediate-mass stars is only 5%, the lifetime of the UCXB phase is ≳2 Gyr, producing a relatively high number of observable systems, making this an alternative evolutionary channel for the formation of UCXBs.

Elemental abundance analyses with coadded DAO spectrograms. VI - The mercury-manganese stars Nu Cancri, Iota Coronae Borealis and HR 8349

Science.gov (United States)

Adelman, Saul J.

1989-01-01

The elemental abundances of three mercury-manganese stars, Nu Cancri, Iota Coronae Borealis, and HR 8349, were found to be consistent with previous analyses of this series. As Iota CrB is a double-lined spectroscopic binary with a small velocity amplitude for most of its period, its study required determining whether the observed lines were produced in the primary or secondary or both. The derived abundances and effective termperatures were used along with those of mercury-manganese stars previously analyzed in order to extend the study of probable correlations between abundances, with the effective temperature and surface gravity in accordance with radiative diffusion explanations.

On the evolution of stars

International Nuclear Information System (INIS)

Kippenhahn, R.

1989-01-01

A popular survey is given of the present knowledge on evolution and ageing of stars. Main sequence stars, white dwarf stars, and red giant stars are classified in the Hertzsprung-Russell (HR)-diagram by measurable quantities: surface temperature and luminosity. From the HR-diagram it can be concluded to star mass and age. Star-forming processes in interstellar clouds as well as stellar burning processes are illustrated. The changes occurring in a star due to the depletion of the nuclear energy reserve are described. In this frame the phenomena of planetary nebulae, supernovae, pulsars, neutron stars as well as of black holes are explained

Magnetic fields in beta Cep, SPB, and Be stars

OpenAIRE

Schoeller, M.; Hubrig, S.; Briquet, M.; Ilyin, I.

2013-01-01

Recent observational and theoretical results emphasize the potential significance of magnetic fields for structure, evolution, and environment of massive stars. Depending on their spectral and photometric behavior, the upper main-sequence B-type stars are assigned to different groups, such as beta Cep stars and slowly pulsating B (SPB) stars, He-rich and He-deficient Bp stars, Be stars, BpSi stars, HgMn stars, or normal B-type stars. All these groups are characterized by different magnetic fi...

Abundance analysis from the UV spectrum of the He-w star HR 6000

International Nuclear Information System (INIS)

Castelli, F.; Cornachin, M.; Morossi, C.; Hack, M.

1984-01-01

A high resolution spectrum of the He-w star HR 6000, covering the SW and LW regions, has been analysed. A fully line-blanketed model atmosphere with parameters Tsub(e) = 14000 K, log g = 4, microturbulence xi = 2 km.s -1 has been adopted. This model is in agreement with the photometric data and yields the same abundance for the Fe II and Fe III ions. By using the synthetic spectrum method we compared the observed lines with the computed ones. We find an underabundance of C, Al Si, Mg, S, Sc, Co, Ni, Zn and an overabundance of Be, P, Cl, Ti, Mn, Fe, Ga. B, O, Cr have nearly solar abundances. Circumstellar (or interstellar) shortward-shifted components affect the strong resonance lines of the following ions: C II(1) lambda 1334.535, O I(2) lambda 1302.074,Mg II(1) lambda 2795.523, lambda 2802.698, Si II(3) lambda 1304.369, Fe II(1) lambda 2599.395

24 hr non-invasive ambulatory blood pressure and heart rate monitoring in Parkinson’s Disease

Directory of Open Access Journals (Sweden)

Eva eStübner

2013-05-01

Full Text Available Non-motor symptoms are now commonly recognized in Parkinson’s Disease (PD and can include dysautonomia. Impairment of cardiovascular autonomic function can occur at any stage of PD but is typically prevalent in advanced stages or related to (anti-parkinsonian drugs and can result in atypical blood pressure (BP readings and related symptoms such as orthostatic hypotension (OH and supine hypertension. OH is usually diagnosed with a head-up-tilt test (HUT or an (active standing test (also known as Schellong test in the laboratory, but 24 hour Ambulatory Blood Pressure Monitoring (ABPM in a home setting may have several advantages, such as providing an overview of symptoms in daily life alongside pathophysiology as well as assessment of treatment interventions. This, however, is only possible if ABPM is administrated correctly and an autonomic protocol (including a diary is followed. which will be discussed in this review. A 24hr ABPM does not only allow the detection of OH, if it is present, but also the assessment of cardiovascular autonomic dysfunction during and after various daily stimuli, such as postprandial and alcohol dependent hypotension, as well as exercise and drug induced hypotension. Furthermore, information about the circadian rhythm of BP and heart rate (HR can be obtained and establish whether or not a patient has a fall of BP at night (i.e. ‘dipper’ vs. non-‘dipper’. The information about nocturnal BP may also allow the investigation or detection of disorders such as sleep dysfunction, nocturnal movement disorders and obstructive sleep apnea, which are common in PD. Additionally, a 24hr ABPM should be conducted to examine the effectiveness of OH therapy. This review will outline the methodology of 24 hr ABPM in PD, summarize findings of such studies in PD and briefly consider common daily stimuli that might affect 24 Hr ABPM.

Are coronae of late type stars made of solar-like structures? The Fx-HR diagram and the pressure-temperature correlation

OpenAIRE

Peres, G.; Orlando, S.; Reale, F.

2004-01-01

We show that stellar coronae can be composed of X-ray emitting structures like those in the solar corona, using a large set of ROSAT/PSPC observations of late-type-stars, and a large set of solar X-ray data collected with Yohkoh/SXT. We have considered data on the solar corona at various phases of the cycle and various kinds of X-ray coronal structures, from flares to the background corona. The surface flux (F_x) vs. spectral hardness ratio (HR) diagram is a fundamental tool for our study. We...

THE CHARA ARRAY ANGULAR DIAMETER OF HR 8799 FAVORS PLANETARY MASSES FOR ITS IMAGED COMPANIONS

International Nuclear Information System (INIS)

Baines, Ellyn K.; White, Russel J.; Jones, Jeremy; Boyajian, Tabetha; McAlister, Harold A.; Ten Brummelaar, Theo A.; Turner, Nils H.; Sturmann, Judit; Sturmann, Laszlo; Goldfinger, P. J.; Farrington, Christopher D.; Riedel, Adric R.; Huber, Daniel; Ireland, Michael; Von Braun, Kaspar; Ridgway, Stephen T.

2012-01-01

HR 8799 is an hF0 mA5 γ Doradus-, λ Bootis-, Vega-type star best known for hosting four directly imaged candidate planetary companions. Using the CHARA Array interferometer, we measure HR 8799's limb-darkened angular diameter to be 0.342 ± 0.008 mas (an error of only 2%). By combining our measurement with the star's parallax and photometry from the literature, we greatly improve upon previous estimates of its fundamental parameters, including stellar radius (1.44 ± 0.06 R ☉ ), effective temperature (7193 ± 87 K, consistent with F0), luminosity (5.05 ± 0.29 L ☉ ), and the extent of the habitable zone (HZ; 1.62-3.32 AU). These improved stellar properties permit much more precise comparisons with stellar evolutionary models, from which a mass and age can be determined, once the metallicity of the star is known. Considering the observational properties of other λ Bootis stars and the indirect evidence for youth of HR 8799, we argue that the internal abundance, and what we refer to as the effective abundance, is most likely near solar. Finally, using the Yonsei-Yale evolutionary models with uniformly scaled solar-like abundances, we estimate HR 8799's mass and age considering two possibilities: 1.516 +0.038 –0.024 M ☉ and 33 +7 –13.2 Myr if the star is contracting toward the zero-age main sequence or 1.513 +0.023 –0.024 M ☉ and 90 +381 –50 Myr if it is expanding from it. This improved estimate of HR 8799's age with realistic uncertainties provides the best constraints to date on the masses of its orbiting companions, and strongly suggests they are indeed planets. They nevertheless all appear to orbit well outside the HZ of this young star.

EPISODIC ACCRETION AT EARLY STAGES OF EVOLUTION OF LOW-MASS STARS AND BROWN DWARFS: A SOLUTION FOR THE OBSERVED LUMINOSITY SPREAD IN H-R DIAGRAMS?

International Nuclear Information System (INIS)

Baraffe, I.; Chabrier, G.; Gallardo, J.

2009-01-01

We present evolutionary models for young low-mass stars and brown dwarfs taking into account episodic phases of accretion at early stages of the evolution, a scenario supported by recent large surveys of embedded protostars. An evolution including short episodes of vigorous accretion followed by longer quiescent phases can explain the observed luminosity spread in H-R diagrams of star-forming regions at ages of a few Myr, for objects ranging from a few Jupiter masses to a few tenths of a solar mass. The gravitational contraction of these accreting objects strongly departs from the standard Hayashi track at constant T eff . The best agreement with the observed luminosity scatter is obtained if most of the accretion shock energy is radiated away. The obtained luminosity spread at 1 Myr in the H-R diagram is equivalent to what can be misinterpreted as an ∼10 Myr age spread for non-accreting objects. We also predict a significant spread in radius at a given T eff , as suggested by recent observations. These calculations bear important consequences for our understanding of star formation and early stages of evolution and on the determination of the initial mass function for young (≤ a few Myr) clusters. Our results also show that the concept of a stellar birthline for low-mass objects has no valid support.

SHOCKS AND A GIANT PLANET IN THE DISK ORBITING BP PISCIUM?

International Nuclear Information System (INIS)

Melis, C.; Zuckerman, B.; Gielen, C.; Chen, C. H.; Rhee, Joseph H.; Song, Inseok

2010-01-01

Spitzer Infrared Spectrograph data support the interpretation that BP Piscium, a gas and dust enshrouded star residing at high Galactic latitude, is a first-ascent giant rather than a classical T Tauri star. Our analysis suggests that BP Piscium's spectral energy distribution can be modeled as a disk with a gap that is opened by a giant planet. Modeling the rich mid-infrared emission line spectrum indicates that the solid-state emitting grains orbiting BP Piscium are primarily composed of ∼75 K crystalline, magnesium-rich olivine; ∼75 K crystalline, magnesium-rich pyroxene; ∼200 K amorphous, magnesium-rich pyroxene; and ∼200 K annealed silica (cristobalite). These dust grains are all sub-micron sized. The giant planet and gap model also naturally explains the location and mineralogy of the small dust grains in the disk. Disk shocks that result from disk-planet interaction generate the highly crystalline dust which is subsequently blown out of the disk mid-plane and into the disk atmosphere.

BP, Cardiovascular Disease, and Death in the Folic Acid for Vascular Outcome Reduction in Transplantation Trial

Science.gov (United States)

John, Alin; Weir, Matthew R.; Smith, Stephen R.; Hunsicker, Lawrence; Kasiske, Bertram L.; Kusek, John W.; Bostom, Andrew; Ivanova, Anastasia; Levey, Andrew S.; Solomon, Scott; Pesavento, Todd; Weiner, Daniel E.

2014-01-01

The optimal BP level in kidney transplant recipients remains uncertain. This post hoc analysis of the Folic Acid for Vascular Outcome Reduction in Transplantation (FAVORIT) trial cohort assessed associations of BP with a pooled cardiovascular disease (CVD) outcome and with all-cause mortality. In 3474 prevalent kidney transplant patients, mean age was 52±9 years, 63% were men, 76% were white, 20% had a history of CVD, 40% had a history of diabetes mellitus, and the median time since transplant was 4.1 years (25th to 75th percentiles, 1.7–7.4); mean systolic BP was 136±20 mmHg and mean diastolic BP was 79±12 mmHg. There were 497 CVD events and 406 deaths. After adjustment for demographic and transplant characteristics and CVD risk factors, each 20-mmHg increase in baseline systolic BP associated with a 32% increase in subsequent CVD risk (hazard ratio [HR], 1.32; 95% confidence interval [95% CI], 1.19 to 1.46) and a 13% increase in mortality risk (HR, 1.13; 95% CI, 1.01 to 1.27). Similarly, after adjustment, at diastolic BP levels70 mmHg, there was no significant relationship between diastolic BP and outcomes. Higher systolic BP strongly and independently associated with increased risk of CVD and all-cause mortality, without evidence of a J shape, whereas only lower levels of diastolic BP associated with increased risk of CVD and death in this trial. PMID:24627349

Inter-Division IV/V WG on Active OB Stars

NARCIS (Netherlands)

Owocki, S.; Aerts, C.; Fabregat, J.; Gies, D.; Henrichs, H.F.; McDavid, D.; Porter, J.; Rivinius, T.; Peters, G.; Stefl, S.

2007-01-01

Our group studies active early-type (OB) stars, with historical focus on classical Be stars, but extending in recent years to include Slowly Pulsating B-stars (SPB), Beta-Cephei stars, the strongly magnetic Bp stars, Luminous Blue Vairiable (LBV) stars, and B[e] stars. An overall goal is to

Direct detection and orbital analysis of the exoplanets HR 8799 bcd from archival 2005 Keck/NIRC2 data

NARCIS (Netherlands)

Currie, T.; Fukagawa, M.; Thalmann, C.; Matsumura, S.; Plavchan, P.

2012-01-01

We present previously unpublished 2005 July H-band coronagraphic data of the young, planet-hosting star HR 8799 from the newly released Keck/NIRC2 archive. Despite poor observing conditions, we detect three of the planets (HR 8799 bcd), two of them (HR 8799 bc) without advanced image processing.

Four new Delta Scuti stars

Science.gov (United States)

Schutt, R. L.

1991-01-01

Four new Delta Scuti stars are reported. Power, modified into amplitude, spectra, and light curves are used to determine periodicities. A complete frequency analysis is not performed due to the lack of a sufficient time base in the data. These new variables help verify the many predictions that Delta Scuti stars probably exist in prolific numbers as small amplitude variables. Two of these stars, HR 4344 and HD 107513, are possibly Am stars. If so, they are among the minority of variable stars which are also Am stars.

High Precision with the Whole Earth Telescope: Lessons and Some Results from XCov20 for the roAp Star HR 1217

Directory of Open Access Journals (Sweden)

Kurtz D. W.

2003-03-01

Full Text Available HR1217 is a prototypical rapidly oscillating Ap star that has presented a test to the theory of nonradial stellar pulsation. Prior observations showed a clear pattern of five modes with alternating frequency spacings of 33.3 μHz and 34.6 μHz, with a sixth mode at a problematic spacing of 50.0 μHz (which equals 1.5 × 33.3 μHz to the highfrequency side. Asymptotic pulsation theory allowed for a frequency spacing of 34 μHz, but hipparcos observations rule out such a spacing. Theoretical calculations of magnetoacoustic modes in Ap stars by Cunha (2001 predicted that there should be a previously undetected mode 34 μHz higher than the main group, with a smaller spacing between it and the highest one. The 20th extended coverage campaign of the Whole Earth Telescope (XCov20 has discovered this frequency as predicted by Cunha (2001. Amplitude modulation of several of the pulsation modes between the 1986 and 2000 data sets has also been discovered, while important parameters for modelling the geometry of the pulsation modes have been shown to be unchanged. With stringent selection of the best data from the WET network the amplitude spectrum shows highest peaks at only 50 μmag and formal errors on the determined amplitudes are 14 μmag. Some lessons for future use of WET for the highest precision photometry on bright stars are discussed.

Massive stars in galaxies

International Nuclear Information System (INIS)

Humphreys, R.M.

1987-01-01

The relationship between the morphologic type of a galaxy and the evolution of its massive stars is explored, reviewing observational results for nearby galaxies. The data are presented in diagrams, and it is found that the massive-star populations of most Sc spiral galaxies and irregular galaxies are similar, while those of Sb spirals such as M 31 and M 81 may be affected by morphology (via differences in the initial mass function or star-formation rate). Consideration is also given to the stability-related upper luminosity limit in the H-R diagram of hypergiant stars (attributed to radiation pressure in hot stars and turbulence in cool stars) and the goals of future observation campaigns. 88 references

Ultraviolet colors of subdwarf O stars

International Nuclear Information System (INIS)

Wesselius, P.R.

1978-01-01

The group of subdwarf O stars consisting of field stars and some central stars of old planetary nebulae does occupy an interesting place in the HR diagram. Greenstein and Sargent (1974) have tried to establish this place, and conclude that especially the hottest ones need ultraviolet data to improve the values of effective temperature and absolute luminosity. The author therefore observed some twenty sdO stars in the far ultraviolet using the spectrophotometer in the Netherlands' satellite ANS. (Auth.)

Draft genome sequence of a human-associated isolate of Haloferax alexandrinus strain Arc-hr, an extremely halophilic archaea.

Science.gov (United States)

Khelaifia, S; Caputo, A; Djossou, F; Raoult, D

2017-01-01

We report the draft genome sequence of Haloferax alexandrinus strain Arc-hr (CSUR P798), isolated from the human gut of a 10-year-old Amazonian individual. Its 3 893 626 bp genome exhibits a 66.00% GC content. The genome of the strain Arc-hr contains 37 genes identified as ORFans, seven genes associated to halocin and 11 genes associated with polyketide synthases or nonribosomal peptide synthetases.

A more accurate HR diagram for the cooler stars

International Nuclear Information System (INIS)

Keenan, P.C.

1978-01-01

The author's objective is to classify the fine structure in the pattern in the luminosity-spectrum domain, and thus to define more precisely the borders of zones which are either occupied or avoided by stars of a given population. It is this pattern which is compared with theoretical evolutionary tracks and it is such a diagram based on the revised MK classification of the recent Atlas of Keenan and McNeil (1976) that is presented. (Auth.)

Deep Thermal Infrared Imaging of HR 8799 bcde: New Atmospheric Constraints and Limits on a Fifth Planet

OpenAIRE

Currie, Thayne; Burrows, Adam; Girard, Julien H.; Cloutier, Ryan; Fukagawa, Misato; Sorahana, Satoko; Kuchner, Marc; Kenyon, Scott J.; Madhusudhan, Nikku; Itoh, Yoichi; Jayawardhana, Ray; Matsumura, Soko; Pyo, Tae-Soo

2014-01-01

We present new $L^\\prime$ (3.8 $\\mu m$) and Br-$\\alpha$ (4.05 $\\mu m$) data and reprocessed archival $L^\\prime$ data for the young, planet-hosting star HR 8799 obtained with Keck/NIRC2, VLT/NaCo and Subaru/IRCS. We detect all four HR 8799 planets in each dataset at a moderate to high signal-to-noise (SNR $\\gtrsim$ 6-15). We fail to identify a fifth planet, "HR 8799 f", at $r$ $

HR Connect

Data.gov (United States)

US Agency for International Development — HR Connect is the USAID HR personnel system which allows HR professionals to process HR actions related to employee's personal and position information. This system...

X-Ray Flare Oscillations Track Plasma Sloshing along Star-disk Magnetic Tubes in the Orion Star-forming Region

Science.gov (United States)

Reale, Fabio; Lopez-Santiago, Javier; Flaccomio, Ettore; Petralia, Antonino; Sciortino, Salvatore

2018-03-01

Pulsing X-ray emission tracks the plasma “echo” traveling in an extremely long magnetic tube that flares in an Orion pre-main sequence (PMS) star. On the Sun, flares last from minutes to a few hours and the longest-lasting ones typically involve arcades of closed magnetic tubes. Long-lasting X-ray flares are observed in PMS stars. Large-amplitude (∼20%), long-period (∼3 hr) pulsations are detected in the light curve of day-long flares observed by the Advanced CCD Imaging Spectrometer on-board Chandra from PMS stars in the Orion cluster. Detailed hydrodynamic modeling of two flares observed on V772 Ori and OW Ori shows that these pulsations may track the sloshing of plasma along a single long magnetic tube, triggered by a sufficiently short (∼1 hr) heat pulse. These magnetic tubes are ≥20 solar radii long, enough to connect the star with the surrounding disk.

Origin of faint blue stars

International Nuclear Information System (INIS)

Tutukov, A.; Iungelson, L.

1987-01-01

The origin of field faint blue stars that are placed in the HR diagram to the left of the main sequence is discussed. These include degenerate dwarfs and O and B subdwarfs. Degenerate dwarfs belong to two main populations with helium and carbon-oxygen cores. The majority of the hot subdwarfs most possibly are helium nondegenerate stars that are produced by mass exchange close binaries of moderate mass cores (3-15 solar masses). The theoretical estimates of the numbers of faint blue stars of different types brighter than certain stellar magnitudes agree with star counts based on the Palomar Green Survey. 28 references

Absence of young white dwarf companions to five technetium stars

Energy Technology Data Exchange (ETDEWEB)

Smith, V.V.; Lambert, D.L.

1987-10-01

A search for hot companions to five stars of type MS and S has been carried out using the IUE satellite. No hot companions were detected for the MS stars HR 85, 4647, 6702, and 8062, and the S star HR 8714. Limits on the luminosities of possible white dwarf companions provide lower limits of 2-5x10 to the 8th yr to the ages of any degenerate companions. All five stars exhibit strong Tc I lines, and the presence of technetium, with a half-life of 2.1x10 to the 5th yr, signifies recent nucleosynthesis. The limits on the ages of possible white dwarf companions that are equal to or greater than 1000 half-lives of Tc exclude the possibility that the s-process elemental enhancement seen in these MS and S stars resulted from mass transfer from a more highly evolved companion (as is probably the mechanism by which barium stars are created). These MS and S stars represent a sample of true thermally pulsing asymptotic giant-branch stars. 41 references.

A cell cycle-dependent regulatory circuit composed of 53BP1-RIF1 and BRCA1-CtIP controls DNA repair pathway choice.

Science.gov (United States)

Escribano-Díaz, Cristina; Orthwein, Alexandre; Fradet-Turcotte, Amélie; Xing, Mengtan; Young, Jordan T F; Tkáč, Ján; Cook, Michael A; Rosebrock, Adam P; Munro, Meagan; Canny, Marella D; Xu, Dongyi; Durocher, Daniel

2013-03-07

DNA double-strand break (DSB) repair pathway choice is governed by the opposing activities of 53BP1 and BRCA1. 53BP1 stimulates nonhomologous end joining (NHEJ), whereas BRCA1 promotes end resection and homologous recombination (HR). Here we show that 53BP1 is an inhibitor of BRCA1 accumulation at DSB sites, specifically in the G1 phase of the cell cycle. ATM-dependent phosphorylation of 53BP1 physically recruits RIF1 to DSB sites, and we identify RIF1 as the critical effector of 53BP1 during DSB repair. Remarkably, RIF1 accumulation at DSB sites is strongly antagonized by BRCA1 and its interacting partner CtIP. Lastly, we show that depletion of RIF1 is able to restore end resection and RAD51 loading in BRCA1-depleted cells. This work therefore identifies a cell cycle-regulated circuit, underpinned by RIF1 and BRCA1, that governs DSB repair pathway choice to ensure that NHEJ dominates in G1 and HR is favored from S phase onward. Copyright © 2013 Elsevier Inc. All rights reserved.

HR diagrams derived from the Michigan Spectral Catalogue

International Nuclear Information System (INIS)

Houk, N.; Fesen, R.

1978-01-01

The authors present some HR diagrams constructed using data from the Michigan Spectral Catalogues. Houk (1975) has been systematically reclassifying the Henry Draper stars on the MK system, from the south pole northward. Objective-prism plates, with a reciprocal dispersion of 108 A/mm, have been taken with the Michigan Curtis Schmidt telescope at Cerro Tololo Inter-American Observatory in Chile. The spectra are classified visually from the plates, and the results are put onto IBM cards and magnetic tape from which the catalogues are produced. (Auth.)

A DISCUSSION ON THE CLASSIFICATION AND EVOLUTION OF SYMBIOTIC STARS

NARCIS (Netherlands)

SEAL, P

1990-01-01

A H-R diagram is drawn from the bolometric luminosities and effective temperatures of 24 symbiotic stars and compared with theoretical evolutionary tracks of Population I metal-rich stars. It is shown that the S-type and D-type symbiotic stars are classified very clearly in course of their evolution

Serum levels of IGF-1 and IGF-BP3 are associated with event-free survival in adult Ewing sarcoma patients treated with chemotherapy

Directory of Open Access Journals (Sweden)

de Groot S

2017-06-01

Full Text Available Stefanie de Groot,1 Hans Gelderblom,1 Marta Fiocco,2,3 Judith VMG Bovée,4 Jacobus JM van der Hoeven,1 Hanno Pijl,5 Judith R Kroep1 1Department of Medical Oncology, 2Department of Medical Statistics and Bioinformatics, Leiden University Medical Center, 3Mathematical Department, Leiden University, 4Department of Pathology, 5Department of Endocrinology, Leiden University Medical Center, Leiden, the Netherlands Background: Activation of the insulin-like growth factor 1 (IGF-1 pathway is involved in cell growth and proliferation and is associated with tumorigenesis, tumor progression, and therapy resistance in solid tumors. We examined whether variability in serum levels of IGF-1, IGF-2, and IGF-binding protein 3 (IGF-BP3 can predict event-free survival (EFS and overall survival (OS in Ewing sarcoma patients treated with chemotherapy.Patients and methods: Serum levels of IGF-1, IGF-2, and IGF-BP3 of 22 patients with localized or metastasized Ewing sarcoma treated with six cycles of vincristine/ifosfamide/doxorubicin/etoposide (VIDE chemotherapy were recorded. Baseline levels were compared with presixth cycle levels using paired t-tests and were tested for associations with EFS and OS. Continuous variables were dichotomized according to the Contal and O’Quigley procedure. Survival analyses were performed using Cox regression analysis.Results: High baseline IGF-1 and IGF-BP3 serum levels were associated with EFS (hazard ratio [HR] 0.075, 95% confidence interval [CI] 0.009–0.602 and HR 0.090, 95% CI 0.011–0.712, respectively in univariate and multivariate analyses (HR 0.063, 95% CI 0.007–0.590 and HR 0.057, 95% CI 0.005–0.585, respectively. OS was improved, but this was not statistically significant. IGF-BP3 and IGF-2 serum levels increased during treatment with VIDE chemotherapy (P=0.055 and P=0.023, respectively.Conclusion: High circulating serum levels of IGF-1 and IGF-BP3 and the molar ratio of IGF-1:IGF-BP3 serum levels were associated

Complete genome sequence of Desulfohalobium retbaense type strain (HR100T)

Energy Technology Data Exchange (ETDEWEB)

Spring, Stefan [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Nolan, Matt [U.S. Department of Energy, Joint Genome Institute; Lapidus, Alla L. [U.S. Department of Energy, Joint Genome Institute; Glavina Del Rio, Tijana [U.S. Department of Energy, Joint Genome Institute; Copeland, A [U.S. Department of Energy, Joint Genome Institute; Tice, Hope [U.S. Department of Energy, Joint Genome Institute; Cheng, Jan-Fang [U.S. Department of Energy, Joint Genome Institute; Lucas, Susan [U.S. Department of Energy, Joint Genome Institute; Land, Miriam L [ORNL; Chen, Feng [U.S. Department of Energy, Joint Genome Institute; Bruce, David [Los Alamos National Laboratory (LANL); Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Pitluck, Sam [U.S. Department of Energy, Joint Genome Institute; Ivanova, N [U.S. Department of Energy, Joint Genome Institute; Mavromatis, K [U.S. Department of Energy, Joint Genome Institute; Mikhailova, Natalia [U.S. Department of Energy, Joint Genome Institute; Pati, Amrita [U.S. Department of Energy, Joint Genome Institute; Chen, Amy [U.S. Department of Energy, Joint Genome Institute; Palaniappan, Krishna [U.S. Department of Energy, Joint Genome Institute; Hauser, Loren John [ORNL; Chang, Yun-Juan [ORNL; Jeffries, Cynthia [Oak Ridge National Laboratory (ORNL); Munk, Christine [U.S. Department of Energy, Joint Genome Institute; Kiss, Hajnalka [Los Alamos National Laboratory (LANL); Chain, Patrick S. G. [Lawrence Livermore National Laboratory (LLNL); Han, Cliff [Los Alamos National Laboratory (LANL); Brettin, Thomas S [ORNL; Detter, J. Chris [U.S. Department of Energy, Joint Genome Institute; Schuler, Esther [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Goker, Markus [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Rohde, Manfred [HZI - Helmholtz Centre for Infection Research, Braunschweig, Germany; Bristow, James [U.S. Department of Energy, Joint Genome Institute; Eisen, Jonathan [U.S. Department of Energy, Joint Genome Institute; Markowitz, Victor [U.S. Department of Energy, Joint Genome Institute; Hugenholtz, Philip [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute; Klenk, Hans-Peter [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany

2010-01-01

Desulfohalobium retbaense (Ollivier et al. 1991) is the type species of the polyphyletic genus Desulfohalobium, which comprises, at the time of writing, two species and represents the family Desulfohalobiaceae within the Deltaproteobacteria. D. retbaense is a moderately halophilic sulfate-reducing bacterium, which can utilize H2 and a limited range of organic substrates, which are incompletely oxidized to acetate and CO2, for growth. The type strain HR100T was isolated from sediments of the hypersaline Retba Lake in Senegal. Here we describe the features of this organism, together with the complete genome sequence and annotation. This is the first completed genome sequence of a member of the family Desulfohalobiaceae. The 2,909,567 bp genome (one chromosome and a 45,263 bp plasmid) with its 2,552 protein-coding and 57 RNA genes is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

On the absence of young white dwarf companions to five technetium stars

Science.gov (United States)

Smith, Verne V.; Lambert, David L.

1987-01-01

A search for hot companions to five stars of type MS and S has been carried out using the IUE satellite. No hot companions were detected for the MS stars HR 85, 4647, 6702, and 8062, and the S star HR 8714. Limits on the luminosities of possible white dwarf companions provide lower limits of 2-5x10 to the 8th yr to the ages of any degenerate companions. All five stars exhibit strong Tc I lines, and the presence of technetium, with a half-life of 2.1x10 to the 5th yr, signifies recent nucleosynthesis. The limits on the ages of possible white dwarf companions that are equal to or greater than 1000 half-lives of Tc exclude the possibility that the s-process elemental enhancement seen in these MS and S stars resulted from mass transfer from a more highly evolved companion (as is probably the mechanism by which barium stars are created). These MS and S stars represent a sample of true thermally pulsing asymptotic giant-branch stars.

A search for magnetic fields in Lambda Bootis stars

International Nuclear Information System (INIS)

Bohlender, D.A.; Landstreet, J.D.

1990-01-01

We have searched a sample of λ Boo stars for magnetic fields similar to those observed in the magnetic Ap and Bp stars, using a Balmer-line Zeeman analyser. Apart from one dubious measurement, no fields are detected in our sample. It appears that magnetic fields of the λ Boo stars, if they exist, are significantly smaller than those found in magnetic upper main-sequence stars of similar spectral type; this conclusion is supported at about the 90 or 95 per cent confidence level by the present data. (author)

How to unveil a T Tauri star

International Nuclear Information System (INIS)

Hartigan, P.; Hartmann, L.; Kenyon, S.; Hewett, R.; Stauffer, J.

1989-01-01

A method for separating the 'veiling' continuum often present in T Tauri stars from the underlying photospheric spectrum is described. Echelle observations from 5100 to 6800 A of the partially veiled T Tauri star BP Tau were analyzed to determine the shape of the veiling spectrum. The residuals of the fit indicate the deviation of the veiling spectrum from a simple continuum and identify the location and strength of any emission-line components. It is shown, by means of goodness-of-fit tests, that the spectrum of BP Tau can be decomposed into a normal stellar spectrum plus a smooth veiling continuum with only a few emission lines superposed. The continuum dominates the veiling spectrum in this spectral region; the veiling does not arise from numerous deep photospheric absorption lines that are filled in by weak emission. 36 refs

Characterization of the magnetic field of the Herbig Be star HD200775

Science.gov (United States)

Alecian, E.; Catala, C.; Wade, G. A.; Donati, J.-F.; Petit, P.; Landstreet, J. D.; Böhm, T.; Bouret, J.-C.; Bagnulo, S.; Folsom, C.; Grunhut, J.; Silvester, J.

2008-03-01

.3281 +/- 0.0010d, an inclination angle of 60° +/- 11° and a magnetic obliquity angle β = 125° +/- 8°. The polar strength of the magnetic dipole field is 1000 +/- 150G, which is decentred by 0.05 +/- 0.04R* from the centre of the star. The derived magnetic field model is qualitatively identical to those commonly observed in the Ap/Bp stars. Our determination of the inclination of the rotation axis leads to a radius of the primary which is smaller than that derived from the HR diagram position. This can be explained by a larger intrinsic luminosity of the secondary relative to the primary, due to a larger circumstellar extinction of the secondary relative to the primary. Based on observations obtained at the Canada-France-Hawaii Telescope (CFHT) which is operated by the National Research Council of Canada, the Institut National des Sciences de l'Univers of the Centre National de la Recherche Scientifique of France and the University of Hawaii. E-mail: evelyne.alecian@rmc.ca

SPECTROSCOPIC AND PHOTOMETRIC VARIABILITY IN THE A0 SUPERGIANT HR 1040

International Nuclear Information System (INIS)

Corliss, David J.; Morrison, Nancy D.; Adelman, Saul J.

2015-01-01

A time-series analysis of spectroscopic and photometric observables of the A0 Ia supergiant HR 1040 has been performed, including equivalent widths, radial velocities, and Strömgren photometric indices. The data, obtained from 1993 through 2007, include 152 spectroscopic observations from the Ritter Observatory 1 m telescope and 269 Strömgren photometric observations from the Four College Automated Photoelectric Telescope. Typical of late B- and early A-type supergiants, HR 1040 has a highly variable Hα profile. The star was found to have an intermittent active phase marked by correlation between the Hα absorption equivalent width and blue-edge radial velocity and by photospheric connections observed in correlations to equivalent width, second moment and radial velocity in Si ii λλ6347, 6371. High-velocity absorption (HVA) events were observed only during this active phase. HVA events in the wind were preceded by photospheric activity, including Si ii radial velocity oscillations 19–42 days prior to onset of an HVA event and correlated increases in Si ii W λ and second moment from 13 to 23 days before the start of the HVA event. While increases in various line equivalent widths in the wind prior to HVA events have been reported in the past in other stars, our finding of precursors in enhanced radial velocity variations in the wind and at the photosphere is a new result

The evolution of the Cepheid stars

International Nuclear Information System (INIS)

Chiosi, C.

1990-01-01

The evolution of intermediate and high mass stars is reviewed focusing on the interpretation of Pop I Cepheids. First, a summary is given of the classical results of stellar evolution theory for the main evolutionary phases (main sequence and core He-burning) all over the HR diagram, putting into evidence the various points of disagreement with current observational data. Second, models incorporating the effect of convective overshoot, are reviewed, and studies are presented on the rich, young clusters in the Large Magellanic Cloud, in which the models are compared with the observational data. Arguments are given to favor the adoption of models with convective overshoot instead of the classical ones. Third, new results are presented for pulsational models of the Cepheid stars, and the shape of the instability strip in the HR diagram, the number frequency-period distribution, and the mass discrepancy are discussed. 81 refs

Light variations of massive stars (α Cygni variables). XI. The behaviour of the S Doradus type stars AG Carinae and HR Carinae near minimum light

International Nuclear Information System (INIS)

Genderen van, A.M.; Kampen van, E.; Larsen, I.; Wanders, I.; Weeren van, N.; The, P.S.; Heemskerk, M.; Kraakman, H.; Remijn, L.; Heynderickx, D.

1990-01-01

VBLUW photometry of the micro variations of AG Car (1987/1988) and HR Car (1981/1982 and 1987/1988) and of the macro variations of HR Car (1984/1987) is presented and discussed. The quasi-periods for the micro variations are antiP = 10 d - 13 d for AG Car and antiP ∼ 20 d for HR Car. Both objects, although at or close to minimum light, show small S Dor eruptions (Δ V J ∼ 0.3 m 3) corresponding to an increase in the mass loss rate of about 20%. The time scale of these eruptions, presumably 0.5-1 yr, is thus much longer than the quasi-periods of the intrinsic variations. Therefore, independency between both phenomena is suggested. The reddening and luminosity of HR Car is discussed, as well as its temperature. A tentative estimation of T eff , based on the fluctuation in the colour indices, amounts to ∼ 14000 K ± 2000 K

IUE observations of new A star candidate proto-planetary systems

Science.gov (United States)

Grady, Carol A.

1994-01-01

As a result of the detection of accreting gas in the A5e PMS Herbig Ae star, HR 5999, most of the observations for this IUE program were devoted to Herbig Ae stars rather than to main sequence A stars. Mid-UV emission at optical minimum light was detected for UX Ori (A1e), BF Ori (A5e), and CQ Tau (F2e). The presence of accreting gas in HD 45677 and HD 50138 prompted reclassification of these stars as Herbig Be stars rather than as protoplanetary nebulae. Detailed results are discussed.

The stars: an absolute radiometric reference for the on-orbit calibration of PLEIADES-HR satellites

Science.gov (United States)

Meygret, Aimé; Blanchet, Gwendoline; Mounier, Flore; Buil, Christian

2017-09-01

The accurate on-orbit radiometric calibration of optical sensors has become a challenge for space agencies who gather their effort through international working groups such as CEOS/WGCV or GSICS with the objective to insure the consistency of space measurements and to reach an absolute accuracy compatible with more and more demanding scientific needs. Different targets are traditionally used for calibration depending on the sensor or spacecraft specificities: from on-board calibration systems to ground targets, they all take advantage of our capacity to characterize and model them. But achieving the in-flight stability of a diffuser panel is always a challenge while the calibration over ground targets is often limited by their BDRF characterization and the atmosphere variability. Thanks to their agility, some satellites have the capability to view extra-terrestrial targets such as the moon or stars. The moon is widely used for calibration and its albedo is known through ROLO (RObotic Lunar Observatory) USGS model but with a poor absolute accuracy limiting its use to sensor drift monitoring or cross-calibration. Although the spectral irradiance of some stars is known with a very high accuracy, it was not really shown that they could provide an absolute reference for remote sensors calibration. This paper shows that high resolution optical sensors can be calibrated with a high absolute accuracy using stars. The agile-body PLEIADES 1A satellite is used for this demonstration. The star based calibration principle is described and the results are provided for different stars, each one being acquired several times. These results are compared to the official calibration provided by ground targets and the main error contributors are discussed.

B- AND A-TYPE STARS IN THE TAURUS-AURIGA STAR-FORMING REGION

International Nuclear Information System (INIS)

Mooley, Kunal; Hillenbrand, Lynne; Rebull, Luisa; Padgett, Deborah; Knapp, Gillian

2013-01-01

We describe the results of a search for early-type stars associated with the Taurus-Auriga molecular cloud complex, a diffuse nearby star-forming region noted as lacking young stars of intermediate and high mass. We investigate several sets of possible O, B, and early A spectral class members. The first is a group of stars for which mid-infrared images show bright nebulae, all of which can be associated with stars of spectral-type B. The second group consists of early-type stars compiled from (1) literature listings in SIMBAD, (2) B stars with infrared excesses selected from the Spitzer Space Telescope survey of the Taurus cloud, (3) magnitude- and color-selected point sources from the Two Micron All Sky Survey, and (4) spectroscopically identified early-type stars from the Sloan Digital Sky Survey coverage of the Taurus region. We evaluated stars for membership in the Taurus-Auriga star formation region based on criteria involving: spectroscopic and parallactic distances, proper motions and radial velocities, and infrared excesses or line emission indicative of stellar youth. For selected objects, we also model the scattered and emitted radiation from reflection nebulosity and compare the results with the observed spectral energy distributions to further test the plausibility of physical association of the B stars with the Taurus cloud. This investigation newly identifies as probable Taurus members three B-type stars: HR 1445 (HD 28929), τ Tau (HD 29763), 72 Tau (HD 28149), and two A-type stars: HD 31305 and HD 26212, thus doubling the number of stars A5 or earlier associated with the Taurus clouds. Several additional early-type sources including HD 29659 and HD 283815 meet some, but not all, of the membership criteria and therefore are plausible, though not secure, members.

BP volume reduction equipment

International Nuclear Information System (INIS)

Kitamura, Yoshinori; Muroo, Yoji; Hamanaka, Isao

2003-01-01

A new type of burnable poison (BP) volume reduction system is currently being developed. Many BP rods, a subcomponent of spent fuel assemblies are discharged from nuclear power reactors. This new system reduces the overall volume of BP rods. The main system consists of BP rod cutting equipment, equipment for the recovery of BP cut pieces, and special transport equipment for the cut rods. The equipment is all operated by hydraulic press cylinders in water to reduce operator exposure to radioactivity. (author)

HR Explorer

CERN Document Server

Möller, M

1997-01-01

At the European Laboratory for Particle Physics Research (CERN), Geneva Switzerland we are using OracleHR for managing our human resources since 1995. After the first year of production it became clear that there was a strong need for an easy-to-use Decision Support Tool exploring the data in OracleHR. This paper illustrates an approach which we have adopted to provide on-line management reporting, multi-dimensional analysis, drill-down and slicing & dicing of data, warehoused from OracleHR. The tool offers strong resource management and planning capabilities including career follow-up. The user management and security monitoring are implemented using the Oracle WebServer.

The perspective of Malaysian Manufacturing Organizations on Strategy, HR Outsourcing and HR Costs

Directory of Open Access Journals (Sweden)

Hasliza Abdul HALIM

2011-06-01

Full Text Available The paper discusses the relationship between different types of human resource management (HRM strategy and the human resource outsourcing, and impact on the size of human resource (HR department. Three HRM strategies are considered: Facilitation, accumulation and utilization. The data for the study were obtained from survey responses from 232 organizations, of which 113 were engaged in HR outsourcing. The findings suggest that organizations tend to rely on outsourcing of HR functions when they espouse facilitation and utilization HRM strategy. Concurrently, by relying on HR outsourcing, the organizations manage to experience a reduction in the size of HR department. The results show that it is important for the organizations to better understand the implications of an increased reliance on outsourcing within HR. This allows them to focus on how HR functions are delivered within organizations with the interaction of HRM strategy and the size of HR department will tend to be smaller resulting from outsourcing activities.

An infrared diagnostic for magnetism in hot stars

Science.gov (United States)

Oksala, M. E.; Grunhut, J. H.; Kraus, M.; Borges Fernandes, M.; Neiner, C.; Condori, C. A. H.; Campagnolo, J. C. N.; Souza, T. B.

2015-06-01

Magnetospheric observational proxies are used for indirect detection of magnetic fields in hot stars in the X-ray, UV, optical, and radio wavelength ranges. To determine the viability of infrared (IR) hydrogen recombination lines as a magnetic diagnostic for these stars, we have obtained low-resolution (R~ 1200), near-IR spectra of the known magnetic B2V stars HR 5907 and HR 7355, taken with the Ohio State Infrared Imager/Spectrometer (OSIRIS) attached to the 4.1 m Southern Astrophysical Research (SOAR) Telescope. Both stars show definite variable emission features in IR hydrogen lines of the Brackett series, with similar properties as those found in optical spectra, including the derived location of the detected magnetospheric plasma. These features also have the added advantage of a lowered contribution of stellar flux at these wavelengths, making circumstellar material more easily detectable. IR diagnostics will be useful for the future study of magnetic hot stars, to detect and analyze lower-density environments, and to detect magnetic candidates in areas obscured from UV and optical observations, increasing the number of known magnetic stars to determine basic formation properties and investigate the origin of their magnetic fields. Based on observations obtained at the Southern Astrophysical Research (SOAR) telescope, which is a joint project of the Ministério da Ciência, Tecnologia, e Inovação (MCTI) da República Federativa do Brasil, the US National Optical Astronomy Observatory (NOAO), the University of North Carolina at Chapel Hill (UNC), and Michigan State University (MSU).

HR boiler

Energy Technology Data Exchange (ETDEWEB)

1982-08-01

A number of manufacturers of central heating boilers in the Netherlands have produced high-efficiency boilers, all carrying the GIVEG-HR seal of approval (GIVEG is the manufacturers' association in the Netherlands, and HR stands for 'hoog rendement': high efficiency). Efficiences were considerably improved by reducing flue, idling and radiation losses. Control and safety, discharges of flue gases and condensate need special attention. Whether installation of a GIVEG-HR boiler is profitable in view of the cost/profit ratio, will have to be determined from case to case. N.V. Nederlandse Gasunie felt it was time to present the facts so far in a way specially aimed at the construction industry. This special edition of 'Gas and Architecture' answers a number of questions which the architect or consultant engineer might have in particular before advising on the installation of the new boiler in houses and other buildings in the interests of energy saving. A technical description of the HR boiler covers the backgrounds of its development and considers the role of the Netherlands government as regards to the introduction of the boiler.

Caretakers or HR Managers

Directory of Open Access Journals (Sweden)

James Baba Abugre

2014-08-01

Full Text Available Do human resources (HR managers in developing countries have the clout to make strategic decisions during mergers and acquisitions (M&As? This study aims at establishing the major roles played by HR managers in M&As of public sector companies in Ghana. The research examined the M&As of 10 Ghanaian companies where 10 HR managers gave detailed narratives of their roles and the part they played in the M&A processes. The qualitative method used to solicit the narratives of the HR managers resulted in the following findings: that HR managers in Ghana have a limited role in the planning process of the M&A; that indigenous HR managers perform several tasks in the course of the M&A to get employees stable before and after the M&A processes; nevertheless, they are not part of the policy formulators. The article makes a modest input of the significance of indigenous HR role in international M&As as a panacea to solving the global crises by advocating the empowerment of HR managers in developing context to be partners in the initial commencement of M&As.

Impaired TIP60-mediated H4K16 acetylation accounts for the aberrant chromatin accumulation of 53BP1 and RAP80 in Fanconi anemia pathway-deficient cells.

Science.gov (United States)

Renaud, Emilie; Barascu, Aurelia; Rosselli, Filippo

2016-01-29

To rescue collapsed replication forks cells utilize homologous recombination (HR)-mediated mechanisms to avoid the induction of gross chromosomal abnormalities that would be generated by non-homologous end joining (NHEJ). Using DNA interstrand crosslinks as a replication barrier, we investigated how the Fanconi anemia (FA) pathway promotes HR at stalled replication forks. FA pathway inactivation results in Fanconi anemia, which is associated with a predisposition to cancer. FANCD2 monoubiquitination and assembly in subnuclear foci appear to be involved in TIP60 relocalization to the chromatin to acetylates histone H4K16 and prevents the binding of 53BP1 to its docking site, H4K20Me2. Thus, FA pathway loss-of-function results in accumulation of 53BP1, RIF1 and RAP80 at damaged chromatin, which impair DNA resection at stalled replication fork-associated DNA breaks and impede HR. Consequently, DNA repair in FA cells proceeds through the NHEJ pathway, which is likely responsible for the accumulation of chromosome abnormalities. We demonstrate that the inhibition of NHEJ or deacetylase activity rescue HR in FA cells. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.

FDG goes BP

International Nuclear Information System (INIS)

Chan, J.G.

2000-01-01

Full text: A monograph for Fluorodeoxyglucose F-18 Injection (FDG) was first released in Supplement 1 of the United States Pharmacopoeia 1990 (USP 90) on 1 November 1989 to become effective on 1 January 1990. As this was the only monograph available until recently it served as the applicable standard to be followed. The Therapeutic Goods Act states that the British Pharmacopoeia (BP) is the precedent to be followed in Australia and implies that if a monograph exists for a finished product then this needs to be applied to achieve a certain standard of quality. If the monograph does not exist in the BP then other pharmacopoeia monographs can be sourced starting with the European Pharmacopoeia (Ph Eur) then the USP. A monograph for FDG first appeared in the Ph Eur in a 1999 Supplement (effective 1 January 1999 and now included in the Ph Eur 2000) and then in the BP 1999 (effective 1 December 1999). The Commonwealth Government Gazette (Notice 48, 1/12/99) published that the BP 99 was adopted on the 1st December 1999. Since then manufacturers have been required to comply with the monograph for FDG in the BP 99. This presentation looks at the content of the BP 99 monograph and compares it with that in the USP. Copyright (2000) The Australian and New Zealand Society of Nuclear Medicine Inc

Stars get dizzy after lunch

International Nuclear Information System (INIS)

Zhang, Michael; Penev, Kaloyan

2014-01-01

Exoplanet searches have discovered a large number of h ot Jupiters — high-mass planets orbiting very close to their parent stars in nearly circular orbits. A number of these planets are sufficiently massive and close-in to be significantly affected by tidal dissipation in the parent star, to a degree parameterized by the tidal quality factor Q * . This process speeds up their star's rotation rate while reducing the planet's semimajor axis. In this paper, we investigate the tidal destruction of hot Jupiters. Because the orbital angular momenta of these planets are a significant fraction of their star's rotational angular momenta, they spin up their stars significantly while spiraling to their deaths. Using the Monte Carlo simulation, we predict that for Q * = 10 6 , 3.9 × 10 –6 of stars with the Kepler Target Catalog's mass distribution should have a rotation period shorter than 1/3 day (8 hr) due to accreting a planet. Exoplanet surveys such as SuperWASP, HATnet, HATsouth, and KELT have already produced light curves of millions of stars. These two facts suggest that it may be possible to search for tidally destroyed planets by looking for stars with extremely short rotational periods, then looking for remnant planet cores around those candidates, anomalies in the metal distribution, or other signatures of the recent accretion of the planet.

Spectrographic study of λ 4200 silicon particular stars

International Nuclear Information System (INIS)

Didelon, Pierre

1983-01-01

This research thesis reports a spectrographic study of sample of particular stars belonging to the Si(II) λ 4200 subgroup which builds up the hot end of conventional 'Ap,Bp' stars. Twenty snapshots taken at the Haute-Provence observatory have been studied and compared with the observation of 17 standard stars. All these snapshots have been digitalised and processed. This allowed the identification of lines which indicated the presence of gallium and the absence of manganese which contradicts the close correlation between these elements that was generally admitted. An inexplicable and until now non observed duplication of Si(II) lines has also been observed. The problem of spectral classification of these stars has been studied. In order to study the concerned stars without calculation of atmospheric models, a comparative method between group stars and reference stars has been used. Results are discussed and seem to indicate an erratic and non-correlated behaviour of light elements (C, Mg, Ca, Si), and a presence of heavier elements (Ga, Sr) and rare earths (Eu, Gd) only when elements of the iron peak are stronger [fr

Elemental abundance analyses with DAO spectrograms: XXXII. HR 6455 (A3 III), δ Aqr (A3 V), η Lep (F2 V), and 1 Boo (A1 V)

Science.gov (United States)

Yüce, K.; Adelman, S. J.; Gulliver, A. F.; Hill, G.

2011-08-01

We examine the sharp-lined stars HR 6455 (A3 III, v sin i = 8.7 km s-1) and η Lep (F2 V, v sin i = 13.5 km s-1) as well as δ Aqr (A3 V, v sin i = 81 km s-1) and 1 Boo (A1 V, v sin i = 59 km s-1) to increase the number consistently analyzed A and F stars using high dispersion and high S/N (≥200) spectrograms obtained with CCD detectors at the long Coudé camera of the 1.22-m telescope of the Dominion Astrophysical Observatory. Such studies contribute to understanding systematic abundance differences between normal and non-magnetic main-sequence band chemically peculiar A and early F stars. LTE fine analyses of HR 6455, δ Aqr, and 1 Boo using Kurucz's ATLAS suite programs show the same general elemental abundance trends with differences in the metal richness. Light and iron-peak element abundances are generally solar or overabundant while heavy element and rare earth element abundances are overabundant. HR 6455 is an evolved Am star while δ Aqr and 1 Boo show the phenomenon to different extents. Most derived abundances of η Lep are solar. Table 3 is available at the CDS via http://cdsarc.u-strasbg.fr/cgi-bin/qcat?J/AN/332/681

Congenital Arthrogryposis: An Extension of the 15q11.2 BP1-BP2 Microdeletion Syndrome?

Directory of Open Access Journals (Sweden)

K. M. Usrey

2014-01-01

Full Text Available The proximal 15q11–q13 region contains 5 breakpoints (BP1–BP5. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes. The genes in this region are known to play a role in central nervous system development and/or function. Microdeletions within the 15q11.2 BP1-BP2 region have been reported in patients with neurological dysfunction, developmental delays, behavioral problems, and dysmorphic features. We report two unrelated subjects with the 15q11.2 BP1-BP2 microdeletion and presenting with congenital arthrogryposis, a feature which has not been previously reported as part of this newly recognized microdeletion syndrome. While arthrogryposis seen in these two subjects may be coincidental, we propose that congenital arthrogryposis may result from neurological dysfunction and involvement of the microdeletion of the 15q11.2 BP1-BP2 region, further expanding the phenotype of this microdeletion syndrome. We encourage others to report patients with this chromosome microdeletion and neurological findings to further characterize the clinical phenotype.

Digitalisering og HR

DEFF Research Database (Denmark)

Kühn Pedersen, Mogens

2017-01-01

Digitalisering står ligesom HR for et omfattende fag- og praksisfelt. Såvel praksis som teknologiudvikling styrer feltets stadige forandringer.......Digitalisering står ligesom HR for et omfattende fag- og praksisfelt. Såvel praksis som teknologiudvikling styrer feltets stadige forandringer....

Occasioning change through HR sourcing

NARCIS (Netherlands)

van Balen, Mitchell; Bondarouk, Tatiana; Strohmeier, Stefan; Diederichsen, Anke

2010-01-01

This article describes how structuration theory can be used to analyze changes as invoked by two HR Sourcing arrangements: HR Shared Service Centers and HR Outsourcing. This approach allows us to under-stand changing responsibilities, altered HR processes, and the adaptation of web-based tools for

Evolution of helium rich stars with hydrogen burning

International Nuclear Information System (INIS)

Roeser, M.

1975-08-01

Evolutionary tracks of stars with an initial chemical composition X = 0.100, Y = 0.8790, Z = 0.021 are calculated for masses of 0.35 M(sun), 0.66 M(sun), 1.00 M(sun), 2.00 M(sun), and 5.00 M(sun) and with X = 0.302, Y = 0.677, Z = 0.021 for masses of 1.00 M(sun), 3.00 M(sun), and 5.00 M(sun). The evolution is followed from hydrogen burning to helium burning and to carbon burning when the occasion arises. The data of evolution are presented and compared with normal Population I-stars. The helium rich stars show higher effective temperatures, much higher luminosities and therefore shorter time scales. They are situated in regions of the HR-diagram where observed helium stars are found. (orig.) [de

Er HR ude i tovene?

DEFF Research Database (Denmark)

Poulfelt, Flemming

2015-01-01

HR: Er der behov for nytænkning i HR-land? Artikler i Harvard Business Review - bakket op af en dansk undersøgelse - konkluderer, at HR stadig mangler gennemslagskraft i virksomhederne. Er HR ude i tovene? ... For i undersøgelsen "Ny Dansk Ledelse" (maj 2015), som er baseret på danske lederes...

The discovery of 13.72-min oscillations in the cool magnetic Ap star HD 217522

International Nuclear Information System (INIS)

Kurtz, D.W.

1983-01-01

The discovery is announced of oscillations with a period near 13.72 min in the cool magnetic Ap star HD 217522. 97 hr of high-speed photometric observations are presented, obtained on 18 nights spread over a time span of 74 days in 1982. The amplitude of the oscillations in HD 217522 is variable from night to night and also on a longer time-scale. A frequency analysis of the data identifies the principal frequency of oscillation to be 4.37435+-0.00014 hr -1 . Because of the complexities of the amplitude modulation of the light curve and the very low amplitude of the light variations, the data are insufficient for a complete frequency solution. This star is the seventh member of the class of rapidly oscillating Ap stars. (author)

Stellar oscillations in planet-hosting giant stars

Energy Technology Data Exchange (ETDEWEB)

Hatzes, Artie P; Zechmeister, Mathias [Thueringer Landessternwarte, Sternwarte 5, D-07778 (Germany)], E-mail: artie@tls-tautenburg.de

2008-10-15

Recently a number of giant extrasolar planets have been discovered around giant stars. These discoveries are important because many of these giant stars have intermediate masses in the range 1.2-3 Msun. Early-type main sequence stars of this mass range have been avoided by radial velocity planet search surveys due the difficulty of getting the requisite radial velocity precision needed for planet discoveries. Thus, giant stars can tell us about planet formation for stars more massive than the sun. However, the determination of stellar masses for giant stars is difficult due to the fact that evolutionary tracks for stars covering a wide range of masses converge to the same region of the H-R diagram. We report here on stellar oscillations in three planet-hosting giant stars: HD 13189, {beta} Gem, and {iota} Dra. Precise stellar radial velocity measurements for these stars show variations whose periods and amplitudes are consistent with solar-like p-mode oscillations. The implied stellar masses for these objects based on the characteristics of the stellar oscillations are consistent with the predictions of stellar isochrones. An investigation of stellar oscillations in planet hosting giant stars offers us the possibility of getting an independent determination of the stellar mass for these objects which is of crucial importance for extrasolar planet studies.

BP's emissions trading system

International Nuclear Information System (INIS)

Victor, David G.; House, Joshua C.

2006-01-01

Between 1998 and 2001, BP reduced its emissions of greenhouse gases by more than 10%. BP's success in cutting emissions is often equated with its use of an apparently market-based emissions trading program. However no independent study has ever examined the rules and operation of BP's system and the incentives acting on managers to reduce emissions. We use interviews with key managers and with traders in several critical business units to explore the bound of BP's success with emissions trading. No money actually changed hands when permits were traded, and the main effect of the program was to create awareness of money-saving emission controls rather than strong price incentives. We show that the trading system did not operate like a 'textbook' cap and trade scheme. Rather, the BP system operated much like a 'safety valve' trading system, where managers let the market function until the cost of doing so surpassed what the company was willing to tolerate

Infrared observations of RS CVn stars

International Nuclear Information System (INIS)

Berriman, G.; De Campli, W.M.; Werner, M.W.; Hatchett, S.P.

1983-01-01

Infrared photometry is presented of the RS CVn binary stars AR Lac (1.2-10 μm) and MM Her (1.2-3.5 μm) as they egressed from their primary and secondary eclipses; of the eclipsing systems RS CVn and Z Her at maximum light (1.2-10 μm) and of the non-eclipsing systems UX Ari and HR 1099 (1.2-10 μm). An analysis of these and published V data based on flux ratio diagrams (linear analogues of colour-colour diagrams) shows that G and K stars supply the infrared light of these systems. None of these systems shows infrared emission from circumstellar matter. (author)

AcEST: BP918406 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000113_B06 468 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B06. BP918406 - Show BP918406...is mRNA. clone: YMU001_000113_B06. Accession BP918406 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-vene...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-veneris m

AcEST: BP918011 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000108_E11 519 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E11. BP918011 - Show BP91801...is mRNA. clone: YMU001_000108_E11. Accession BP918011 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiant...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiantum cap

Formation and pre-MS Evolution of Massive Stars with Growing Accretion

Science.gov (United States)

Maeder, A.; Behrend, R.

2002-10-01

We briefly describe the three existing scenarios for forming massive stars and emphasize that the arguments often used to reject the accretion scenario for massive stars are misleading. It is usually not accounted for the fact that the turbulent pressure associated to large turbulent velocities in clouds necessarily imply relatively high accretion rates for massive stars. We show the basic difference between the formation of low and high mass stars based on the values of the free fall time and of the Kelvin-Helmholtz timescale, and define the concept of birthline for massive stars. Due to D-burning, the radius and location of the birthline in the HR diagram, as well as the lifetimes are very sensitive to the accretion rate dM/dt(accr). If a form dM/dt(accr) propto A(M/Msun)phi is adopted, the observations in the HR diagram and the lifetimes support a value of A approx 10-5 Msun/yr and a value of phi > 1. Remarkably, such a law is consistent with the relation found by Churchwell and Henning et al. between the outflow rates and the luminosities of ultracompact HII regions, if we assume that a fraction 0.15 to 0.3 of the global inflow is accreted. The above relation implies high dM/dt(accr) approx 10-3 Msun/yr for the most massive stars. The physical possibility of such high dM/dt(accr) is supported by current numerical models. Finally, we give simple analytical arguments in favour of the growth of dM/dt(accr) with the already accreted mass. We also suggest that due to Bondi-Hoyle accretion, the formation of binary stars is largely favoured among massive stars in the accretion scenario.

Polymer-Based Black Phosphorus (bP) Hybrid Materials by in Situ Radical Polymerization: An Effective Tool To Exfoliate bP and Stabilize bP Nanoflakes

Science.gov (United States)

2018-01-01

Black phosphorus (bP) has been recently investigated for next generation nanoelectronic multifunctional devices. However, the intrinsic instability of exfoliated bP (the bP nanoflakes) toward both moisture and air has so far overshadowed its practical implementation. In order to contribute to fill this gap, we report here the preparation of new hybrid polymer-based materials where bP nanoflakes (bPn) exhibit a significantly improved stability. The new materials have been prepared by different synthetic paths including: (i) the mixing of conventionally liquid-phase exfoliated bP (in dimethyl sulfoxide, DMSO) with poly(methyl methacrylate) (PMMA) solution; (ii) the direct exfoliation of bP in a polymeric solution; (iii) the in situ radical polymerization after exfoliating bP in the liquid monomer (methyl methacrylate, MMA). This last methodology concerns the preparation of stable suspensions of bPn–MMA by sonication-assisted liquid-phase exfoliation (LPE) of bP in the presence of MMA followed by radical polymerization. The hybrids characteristics have been compared in order to evaluate the bP dispersion and the effectiveness of the bPn interfacial interactions with polymer chains aimed at their long-term environmental stabilization. The passivation of the bPn is particularly effective when the hybrid material is prepared by in situ polymerization. By using this synthetic methodology, the nanoflakes, even if with a gradient of dispersion (size of aggregates), preserve their chemical structure from oxidation (as proved by both Raman and 31P-solid state NMR studies) and are particularly stable to air and UV light exposure. The feasibility of this approach, capable of efficiently exfoliating bP while protecting the bPn, has been then verified by using different vinyl monomers (styrene and N-vinylpyrrolidone), thus obtaining hybrids where the nanoflakes are embedded in polymer matrices with a variety of intriguing thermal, mechanical, and solubility characteristics.

AcEST: BP911801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000009_C12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000009_C12. BP911801 - Show BP911801...is mRNA. clone: YMU001_000009_C12. Accession BP911801 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911801.... 25:3389-3402. Query= BP911801|Adiantum capillus-veneris mRNA, clone: YMU001_000

The perspective of Malaysian Manufacturing Organizations on Strategy, HR Outsourcing and HR Costs

OpenAIRE

Hasliza Abdul HALIM; Norbani CHE-HA

2011-01-01

The paper discusses the relationship between different types of human resource management (HRM) strategy and the human resource outsourcing, and impact on the size of human resource (HR) department. Three HRM strategies are considered: Facilitation, accumulation and utilization. The data for the study were obtained from survey responses from 232 organizations, of which 113 were engaged in HR outsourcing. The findings suggest that organizations tend to rely on outsourcing of HR functions when ...

Putting atomic diffusion theory of magnetic ApBp stars to the test: evaluation of the predictions of time-dependent diffusion models

Science.gov (United States)

Kochukhov, O.; Ryabchikova, T. A.

2018-02-01

A series of recent theoretical atomic diffusion studies has address the challenging problem of predicting inhomogeneous vertical and horizontal chemical element distributions in the atmospheres of magnetic ApBp stars. Here we critically assess the most sophisticated of such diffusion models - based on a time-dependent treatment of the atomic diffusion in a magnetized stellar atmosphere - by direct comparison with observations as well by testing the widely used surface mapping tools with the spectral line profiles predicted by this theory. We show that the mean abundances of Fe and Cr are grossly underestimated by the time-dependent theoretical diffusion model, with discrepancies reaching a factor of 1000 for Cr. We also demonstrate that Doppler imaging inversion codes, based either on modelling of individual metal lines or line-averaged profiles simulated according to theoretical three-dimensional abundance distribution, are able to reconstruct correct horizontal chemical spot maps despite ignoring the vertical abundance variation. These numerical experiments justify a direct comparison of the empirical two-dimensional Doppler maps with theoretical diffusion calculations. This comparison is generally unfavourable for the current diffusion theory, as very few chemical elements are observed to form overabundance rings in the horizontal field regions as predicted by the theory and there are numerous examples of element accumulations in the vicinity of radial field zones, which cannot be explained by diffusion calculations.

Search for white dwarf companions of cool stars with peculiar element abundances

Energy Technology Data Exchange (ETDEWEB)

Boehm-Vitense, E.

1984-01-01

A search for a white dwarf companions of cool stars with peculiar element abundances was undertaken. One additional star the xi Cet, was found with a white dwarf companion. It was found that HR 1016, 56Uma, 16 Ser, have high excitation emission lines which indicate a high temperature object in the system. It is suggested that since these indications for high temperature companions were seen for all nearby Ba stars, it is highly probable that all Ba stars have white dwarf companions, and that the peculiar element abundances seen in the Ba stars are due to mass transfer. Observations, arguments and conclusions are presented. White dwarf companions were not found. Together with the Li and Be abundances and the chromospheric emission line spectra in these stars were studied. No white dwarf companions were seen for subgiant CH stars.

Search for white dwarf companions of cool stars with peculiar element abundances

International Nuclear Information System (INIS)

Boehm-Vitense, E.

1984-01-01

A search for a white dwarf companions of cool stars with peculiar element abundances was undertaken. One additional star the xi Cet, was found with a white dwarf companion. It was found that HR 1016, 56Uma, 16 Ser, have high excitation emission lines which indicate a high temperature object in the system. It is suggested that since these indications for high temperature companions were seen for all nearby Ba stars, it is highly probable that all Ba stars have white dwarf companions, and that the peculiar element abundances seen in the Ba stars are due to mass transfer. Observations, arguments and conclusions are presented. White dwarf companions were not found. Together with the Li and Be abundances and the chromospheric emission line spectra in these stars were studied. No white dwarf companions were seen for subgiant CH stars

LONG-ORBITAL-PERIOD PREPOLARS CONTAINING EARLY K-TYPE DONOR STARS. BOTTLENECK ACCRETION MECHANISM IN ACTION

International Nuclear Information System (INIS)

Tovmassian, G.; González–Buitrago, D.; Zharikov, S.; Reichart, D. E.; Haislip, J. B.; Ivarsen, K. M.; LaCluyze, A. P.; Moore, J. P.; Miroshnichenko, A. S.

2016-01-01

We studied two objects identified as cataclysmic variables (CVs) with periods exceeding the natural boundary for Roche-lobe-filling zero-age main sequence (ZAMS) secondary stars. We present observational results for V1082 Sgr with a 20.82 hr orbital period, an object that shows a low luminosity state when its flux is totally dominated by a chromospherically active K star with no signs of ongoing accretion. Frequent accretion shutoffs, together with characteristics of emission lines in a high state, indicate that this binary system is probably detached, and the accretion of matter on the magnetic white dwarf takes place through stellar wind from the active donor star via coupled magnetic fields. Its observational characteristics are surprisingly similar to V479 And, a 14.5 hr binary system. They both have early K-type stars as donor stars. We argue that, similar to the shorter-period prepolars containing M dwarfs, these are detached binaries with strong magnetic components. Their magnetic fields are coupled, allowing enhanced stellar wind from the K star to be captured and channeled through the bottleneck connecting the two stars onto the white dwarf’s magnetic pole, mimicking a magnetic CV. Hence, they become interactive binaries before they reach contact. This will help to explain an unexpected lack of systems possessing white dwarfs with strong magnetic fields among detached white+red dwarf systems

LONG-ORBITAL-PERIOD PREPOLARS CONTAINING EARLY K-TYPE DONOR STARS. BOTTLENECK ACCRETION MECHANISM IN ACTION

Energy Technology Data Exchange (ETDEWEB)

Tovmassian, G.; González–Buitrago, D.; Zharikov, S. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Apartado Postal 877, Ensenada, Baja California, 22800 México (Mexico); Reichart, D. E.; Haislip, J. B.; Ivarsen, K. M.; LaCluyze, A. P.; Moore, J. P. [Department of Physics and Astronomy, University of North Carolina at Chapel Hill, Campus Box 3255, Chapel Hill, NC 27599 (United States); Miroshnichenko, A. S., E-mail: gag@astro.unam.mx, E-mail: dgonzalez@astro.unam.mx, E-mail: zhar@astro.unam.mx [Department of Physics and Astronomy, University of North Carolina at Greensboro, Greensboro, NC 27402-6170 (United States)

2016-03-01

We studied two objects identified as cataclysmic variables (CVs) with periods exceeding the natural boundary for Roche-lobe-filling zero-age main sequence (ZAMS) secondary stars. We present observational results for V1082 Sgr with a 20.82 hr orbital period, an object that shows a low luminosity state when its flux is totally dominated by a chromospherically active K star with no signs of ongoing accretion. Frequent accretion shutoffs, together with characteristics of emission lines in a high state, indicate that this binary system is probably detached, and the accretion of matter on the magnetic white dwarf takes place through stellar wind from the active donor star via coupled magnetic fields. Its observational characteristics are surprisingly similar to V479 And, a 14.5 hr binary system. They both have early K-type stars as donor stars. We argue that, similar to the shorter-period prepolars containing M dwarfs, these are detached binaries with strong magnetic components. Their magnetic fields are coupled, allowing enhanced stellar wind from the K star to be captured and channeled through the bottleneck connecting the two stars onto the white dwarf’s magnetic pole, mimicking a magnetic CV. Hence, they become interactive binaries before they reach contact. This will help to explain an unexpected lack of systems possessing white dwarfs with strong magnetic fields among detached white+red dwarf systems.

Deep thermal infrared imaging of HR 8799 bcde: new atmospheric constraints and limits on a fifth planet

Energy Technology Data Exchange (ETDEWEB)

Currie, Thayne; Cloutier, Ryan; Jayawardhana, Ray [Department of Astronomy and Astrophysics, University of Toronto, 50 St. George Street, Toronto, ON M5S 3H4 (Canada); Burrows, Adam [Department of Astrophysical Science, Princeton University, 4 Ivy Lane, Princeton, NJ 08544 (United States); Girard, Julien H. [European Southern Observatory, Alonso de Córdova 3107, Vitacura, Casilla 19001, Santiago (Chile); Fukagawa, Misato [Graduate School of Science, Osaka University, 1-1 Machikaneyama, Toyonaka, Osaka 560-0043 (Japan); Sorahana, Satoko [Department of Astronomy, Graduate School of Science, The University of Tokyo, Bunkyo-ku, Tokyo 113-0033 (Japan); Kuchner, Marc [Exoplanets and Stellar Astrophysics Laboratory, NASA Goddard Space Flight Center, Code 667, Greenbelt, MD 20771 (United States); Kenyon, Scott J. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Madhusudhan, Nikku [Institute of Astronomy, University of Cambridge, Madingley Road, Cambridge CB3 0HA (United Kingdom); Itoh, Yoichi [Nishi-Harima Astronomical Observatory, Center for Astronomy, University of Hyago, 407-2 Nishigaichi, Sayo, Hyogo 679-5313 (Japan); Matsumura, Soko [School of Engineering, Physics, and Mathematics, University of Dundee, Dundee DD1 4HN (United Kingdom); Pyo, Tae-Soo [National Astronomical Observatory of Japan, 650 N. Aohoku Place, Hilo, HI 96720 (United States)

2014-11-10

We present new L' (3.8 μm) and Brα (4.05 μm) data and reprocessed archival L' data for the young, planet-hosting star HR 8799 obtained with Keck/NIRC2, VLT/NaCo, and Subaru/IRCS. We detect all four HR 8799 planets in each data set at a moderate to high signal-to-noise ratio (S/N ≳ 6-15). We fail to identify a fifth planet, 'HR 8799 f', at r < 15 AU at a 5σ confidence level: one suggestive, marginally significant residual at 0.''2 is most likely a point-spread function artifact. Assuming companion ages of 30 Myr and the Baraffe planet cooling models, we rule out an HR 8799 f with a mass of 5 M{sub J} (7 M{sub J} ), 7 M{sub J} (10 M{sub J} ), or 12 M{sub J} (13 M{sub J} ) at r {sub proj} ∼ 12 AU, 9 AU, and 5 AU, respectively. All four HR 8799 planets have red early T dwarf-like L' – [4.05] colors, suggesting that their spectral energy distributions peak in between the L' and M' broadband filters. We find no statistically significant difference in HR 8799 cde's color. Atmosphere models assuming thick, patchy clouds appear to better match HR 8799 bcde's photometry than models assuming a uniform cloud layer. While non-equilibrium carbon chemistry is required to explain HR 8799 b and c's photometry/spectra, evidence for it from HR 8799 d and e's photometry is weaker. Future, deep-IR spectroscopy/spectrophotometry with the Gemini Planet Imager, SCExAO/CHARIS, and other facilities may clarify whether the planets are chemically similar or heterogeneous.

Deep thermal infrared imaging of HR 8799 bcde: new atmospheric constraints and limits on a fifth planet

International Nuclear Information System (INIS)

Currie, Thayne; Cloutier, Ryan; Jayawardhana, Ray; Burrows, Adam; Girard, Julien H.; Fukagawa, Misato; Sorahana, Satoko; Kuchner, Marc; Kenyon, Scott J.; Madhusudhan, Nikku; Itoh, Yoichi; Matsumura, Soko; Pyo, Tae-Soo

2014-01-01

We present new L' (3.8 μm) and Brα (4.05 μm) data and reprocessed archival L' data for the young, planet-hosting star HR 8799 obtained with Keck/NIRC2, VLT/NaCo, and Subaru/IRCS. We detect all four HR 8799 planets in each data set at a moderate to high signal-to-noise ratio (S/N ≳ 6-15). We fail to identify a fifth planet, 'HR 8799 f', at r < 15 AU at a 5σ confidence level: one suggestive, marginally significant residual at 0.''2 is most likely a point-spread function artifact. Assuming companion ages of 30 Myr and the Baraffe planet cooling models, we rule out an HR 8799 f with a mass of 5 M J (7 M J ), 7 M J (10 M J ), or 12 M J (13 M J ) at r proj ∼ 12 AU, 9 AU, and 5 AU, respectively. All four HR 8799 planets have red early T dwarf-like L' – [4.05] colors, suggesting that their spectral energy distributions peak in between the L' and M' broadband filters. We find no statistically significant difference in HR 8799 cde's color. Atmosphere models assuming thick, patchy clouds appear to better match HR 8799 bcde's photometry than models assuming a uniform cloud layer. While non-equilibrium carbon chemistry is required to explain HR 8799 b and c's photometry/spectra, evidence for it from HR 8799 d and e's photometry is weaker. Future, deep-IR spectroscopy/spectrophotometry with the Gemini Planet Imager, SCExAO/CHARIS, and other facilities may clarify whether the planets are chemically similar or heterogeneous.

AcEST: BP920145 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_E11 274 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E11. BP920145 - Show BP92014...is mRNA. clone: YMU001_000133_E11. Accession BP920145 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E11.... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adian

AcEST: BP920142 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_E05 486 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E05. BP920142 - Show BP92014...is mRNA. clone: YMU001_000133_E05. Accession BP920142 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris ...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris mRNA, clone: YMU001_0001

AcEST: BP919406 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000124_G04 562 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G04. BP919406 - Show BP919406...is mRNA. clone: YMU001_000124_G04. Accession BP919406 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-...ucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-veneris mRNA, c

AcEST: BP921000 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_D05 407 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D05. BP921000 - Show BP921000...is mRNA. clone: YMU001_000144_D05. Accession BP921000 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum cap...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum capillus-veneris mRN

AcEST: BP920995 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_C12 350 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C12. BP920995 - Show BP92099...is mRNA. clone: YMU001_000144_C12. Accession BP920995 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

AcEST: BP918015 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000108_F03 437 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F03. BP918015 - Show BP91801...is mRNA. clone: YMU001_000108_F03. Accession BP918015 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP918015|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F03. (437 letters) Data...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

AcEST: BP918018 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000108_F06 436 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F06. BP918018 - Show BP91801...is mRNA. clone: YMU001_000108_F06. Accession BP918018 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918018|Adiantum capillus-veneris mRNA, clone: YM...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

AcEST: BP912801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000023_A07 527 Adiantum capillus-veneris mRNA. clone: YMU001_000023_A07. BP912801 - Show BP912801...is mRNA. clone: YMU001_000023_A07. Accession BP912801 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912801...es. 25:3389-3402. Query= BP912801|Adiantum capillus-veneris mRNA, clone: YMU001_0

AcEST: BP914068 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000039_E04 420 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E04. BP914068 - Show BP91406...is mRNA. clone: YMU001_000039_E04. Accession BP914068 Tissue type prothallium Developmental stage - Contig I...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914068|Adiantum capillus-veneris mRNA, clone:

AcEST: BP915406 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000071_B11 433 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B11. BP915406 - Show BP915406...is mRNA. clone: YMU001_000071_B11. Accession BP915406 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: Y...leic Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B11. (433

AcEST: BP912099 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_B05 315 Adiantum capillus-veneris mRNA. clone: YMU001_000015_B05. BP912099 - Show BP912099...is mRNA. clone: YMU001_000015_B05. Accession BP912099 Tissue type prothallium Developmental stage - Contig I...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099|Adiantum capillus-vene

AcEST: BP918801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000117_F03 542 Adiantum capillus-veneris mRNA. clone: YMU001_000117_F03. BP918801 - Show BP918801...is mRNA. clone: YMU001_000117_F03. Accession BP918801 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum capillus-veneris mRNA, clone: YMU0...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum ca

AcEST: BP917801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000105_F04 280 Adiantum capillus-veneris mRNA. clone: YMU001_000105_F04. BP917801 - Show BP917801...is mRNA. clone: YMU001_000105_F04. Accession BP917801 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-ve... Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-veneris mRNA, clone: YMU001_000105_F04.

AcEST: BP918017 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000108_F05 267 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F05. BP918017 - Show BP91801...is mRNA. clone: YMU001_000108_F05. Accession BP918017 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris m...cleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F05. (26

AcEST: BP915801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000077_B02 555 Adiantum capillus-veneris mRNA. clone: YMU001_000077_B02. BP915801 - Show BP915801...is mRNA. clone: YMU001_000077_B02. Accession BP915801 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP915801|Adiantum capillus-veneris mRNA, clone: YMU001_000077_B02. ...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915801|A

AcEST: BP920147 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_F01 365 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F01. BP920147 - Show BP92014...is mRNA. clone: YMU001_000133_F01. Accession BP920147 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920147|Adiantum capillus-veneris mRNA, clone: YMU001_...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201

AcEST: BP920144 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_E09 265 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E09. BP920144 - Show BP92014...is mRNA. clone: YMU001_000133_E09. Accession BP920144 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920144|Adiantum capillus-veneris mRNA, clone: YMU001...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

AcEST: BP920141 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_E04 528 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E04. BP920141 - Show BP92014...is mRNA. clone: YMU001_000133_E04. Accession BP920141 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (528 lette...cleic Acids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (52

AcEST: BP913406 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000029_H06 570 Adiantum capillus-veneris mRNA. clone: YMU001_000029_H06. BP913406 - Show BP913406...is mRNA. clone: YMU001_000029_H06. Accession BP913406 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capillus-veneris mRNA, clone: YMU00...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capil...LDVTRGLVNGARGVVVAFES--GKHG---------------LPH 406 Query: 387 VRFACNRAEIVIGPDRQTVESGGMQVARRIQVPLILAWALSVHKCQGM

AcEST: BP918012 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000108_E12 547 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E12. BP918012 - Show BP91801...is mRNA. clone: YMU001_000108_E12. Accession BP918012 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108_E1

Massive stars with mass loss: Evolution, nucleosynthesis, and astrophysical implications

International Nuclear Information System (INIS)

Prantzos, N.

1986-06-01

Evolution and nucleosynthesis of mass loss WR stars is studied, particularly evolution of stars with initial mass between 50 and 100 solar masses, during combustion of H and He. A semi-empirical mass loss formalism, the Roxburgh criterion for convection, and nuclear data are used. Composition of the stellar surface and ejecta (and ejecta contribution to cosmic ray composition) are derived. The contribution of these stars to s elements in our solar system is shown. Their production of 26 Al is compared to the quantity in the galaxy. Gamma ray emission at 1.8 MeV from the decay of this radionuclide is estimated in galactic longitude. The stars evolve as 0 and 0f stars during H combustion and spend 20% of their He combustion period as WN stars and 80% as WC-W0. Evolution always occurs in the blue part of the HR diagram, and satisfies observational constraints on its upper part [fr

Discovery of three x-ray luminous pre-main-sequence stars

International Nuclear Information System (INIS)

Feigelson, E.D.; Kriss, G.A.

1981-01-01

Three X-ray sources found serendipitously in Einstein images of the Taurus-Auriga cloud complex were observed at the McGraw-Hill Observatory and are found to be associated with approx.12 mag stars with weak Hα emission. The stars lie on the edges of dark clouds and are spectroscopically similar to the least active emission-line pre-main-sequence stars. Although they lie well above the ZAMS in the H-R diagram, they do not exhibit ultraviolet excess, strong optical variability, or evidence for mass outflow/inflow characteristics of the more active T Tauri stars. Their only unusual property is high X-ray luminosity (approx.10 30 ergs s1). It is suggested that the X-ray emission from pre-main-sequence stars is not closely linked to the conditions giving rise to their unusual spectroscopic properties. The emission may instead represent an enhanced form of the coronal activity producing X-rays observed in late-type main-sequence stars

Heart rate and blood pressure interactions during attempts to consciously raise or lower heart rate and blood pressure in normotensive subjects

International Nuclear Information System (INIS)

Lowdon, Peter; Murray, Alan; Langley, Philip

2011-01-01

This study investigated the interaction between heart rate (HR) and blood pressure (BP) during conscious control under visual biofeedback and background noise conditions. Normotensive volunteers were instructed to (i) decrease and (ii) increase HR (group A, n = 16) or BP (group B, n = 16). After instructions to lower HR or BP there was no significant change in HR or BP for either group. After instructions to raise HR, HR increased significantly (13.8 ± 1.3 beats min −1 , P < 0.0001) and BP did not change. However, following instructions to raise BP, both HR and BP increased significantly: systolic BP (5.2 ± 1.5 mmHg, P < 0.001), diastolic BP (3.5 ± 0.9 mmHg, P < 0.001) and HR (8.6 ± 1.3 beats min −1 , P < 0.0001). Biofeedback and background noise did not alter the relative change in HR or BP. In conclusion, normotensive subjects were unable to reduce BP or HR under conscious control. Subjects were able to increase both HR and BP, and voluntary increases in HR did not alter BP, while voluntary increases in BP also increased HR indicating distinct HR/BP interactions during conscious control

AcEST: BP912406 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000018_F09 348 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F09. BP912406... CL1894Contig1 Show BP912406 Clone id YMU001_000018_F09 Library YMU01 Length 348 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_F09. Accession BP912406 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406|Adiantum capillus-veneris mRNA...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406

AcEST: BP917406 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000100_D10 492 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D10. BP917406... CL2033Contig1 Show BP917406 Clone id YMU001_000100_D10 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_D10. Accession BP917406 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917406...Nucleic Acids Res. 25:3389-3402. Query= BP917406|Adiantum capillus-veneris mRNA,

AcEST: BP916801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000091_G06 127 Adiantum capillus-veneris mRNA. clone: YMU001_000091_G06. BP916801... CL2168Contig1 Show BP916801 Clone id YMU001_000091_G06 Library YMU01 Length 127 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000091_G06. Accession BP916801 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP916801|Adiantum capillus-veneris mRNA, clone: YMU0...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916801

AcEST: BP913801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000035_D11 562 Adiantum capillus-veneris mRNA. clone: YMU001_000035_D11. BP913801... CL482Contig1 Show BP913801 Clone id YMU001_000035_D11 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000035_D11. Accession BP913801 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum capillus-veneris mRNA, clone: YMU0

AcEST: BP920801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000141_G10 454 Adiantum capillus-veneris mRNA. clone: YMU001_000141_G10. BP920801... CL819Contig1 Show BP920801 Clone id YMU001_000141_G10 Library YMU01 Length 454 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000141_G10. Accession BP920801 Tissue type prothallium Developmental stage... Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-veneris mRNA, clone: ...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-

Cold DUst around NEarby Stars (DUNES). First results. A resolved exo-Kuiper belt around the solar-like star ζ2 Ret

NARCIS (Netherlands)

Eiroa, C.; Fedele, D.; Maldonado, J.; Gonzalez-Garcia, B. M.; Rodmann, J.; Heras, A. M.; Pilbratt, G. L.; Augereau, J. -Ch.; Mora, A.; Montesinos, B.; Ardila, D.; Bryden, G.; Liseau, R.; Stapelfeldt, K.; Launhardt, R.; Solano, E.; Bayo, A.; Absil, O.; Arevalo, M.; Barrado, D.; Beichmann, C.; Danchi, W.; del Burgo, C.; Ertel, S.; Fridlund, M.; Fukagawa, M.; Gutierrez, R.; Gruen, E.; Kamp, I.; Krivov, A.; Lebreton, J.; Loehne, T.; Lorente, R.; Marshall, J.; Martinez-Arnaiz, R.; Meeus, G.; Montes, D.; Morbidelli, A.; Mueller, S.; Mutschke, H.; Nakagawa, T.; Olofsson, G.; Ribas, I.; Roberge, A.; Sanz-Forcada, J.; Thebault, P.; White, G. J.; Wolf, S.; Walker, H.

We present the first far-IR observations of the solar-type stars δ Pav, HR 8501, 51 Peg and ζ2 Ret, taken within the context of the DUNES Herschel open time key programme (OTKP). This project uses the PACS and SPIRE instruments with the objective of studying infrared excesses due to exo-Kuiper belts

AcEST: BP920140 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_E03 489 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E03. BP92014...0 CL2574Contig1 Show BP920140 Clone id YMU001_000133_E03 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E03. Accession BP920140 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920140|Adian... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

AcEST: BP920143 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_E07 533 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E07. BP92014...3 CL2377Contig1 Show BP920143 Clone id YMU001_000133_E07 Library YMU01 Length 533 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E07. Accession BP920143 Tissue type prothallium Developmental stag...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E0...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum

AcEST: BP920146 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_E12 401 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E12. BP92014...6 CL388Contig1 Show BP920146 Clone id YMU001_000133_E12 Library YMU01 Length 401 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_E12. Accession BP920146 Tissue type prothallium Developmental stage...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum ca...rams, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum capillus-veneris mRNA, clone: YMU001_000133_

AcEST: BP920148 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_F02 429 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F02. BP92014...8 CL3819Contig1 Show BP920148 Clone id YMU001_000133_F02 Library YMU01 Length 429 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F02. Accession BP920148 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920148|Adiantum capillus-vener...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

AcEST: BP920149 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000133_F03 624 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F03. BP92014...9 CL2860Contig1 Show BP920149 Clone id YMU001_000133_F03 Library YMU01 Length 624 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F03. Accession BP920149 Tissue type prothallium Developmental stag...ic Acids Res. 25:3389-3402. Query= BP920149|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F03. (624 l...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

AcEST: BP914065 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000039_E01 548 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E01. BP91406...5 CL604Contig1 Show BP914065 Clone id YMU001_000039_E01 Library YMU01 Length 548 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_E01. Accession BP914065 Tissue type prothallium Developmental stage...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU0...cids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU001_000039_E01. (548 lette

AcEST: BP914061 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000039_D09 599 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D09. BP91406...1 CL1730Contig1 Show BP914061 Clone id YMU001_000039_D09 Library YMU01 Length 599 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D09. Accession BP914061 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adia...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adiantum capillus-veneris mRNA, c

AcEST: BP914069 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000039_E05 368 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E05. BP91406...9 CL2761Contig1 Show BP914069 Clone id YMU001_000039_E05 Library YMU01 Length 368 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_E05. Accession BP914069 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001_0000...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001

AcEST: BP914064 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000039_D12 560 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D12. BP91406...4 CL532Contig1 Show BP914064 Clone id YMU001_000039_D12 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_D12. Accession BP914064 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adiantum capillus-vener...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adi

AcEST: BP916406 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000087_D01 556 Adiantum capillus-veneris mRNA. clone: YMU001_000087_D01. BP916406... CL1913Contig1 Show BP916406 Clone id YMU001_000087_D01 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_D01. Accession BP916406 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capill...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capillus-veneris mRNA, c

AcEST: BP914406 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000058_E09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E09. BP914406... CL513Contig1 Show BP914406 Clone id YMU001_000058_E09 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000058_E09. Accession BP914406 Tissue type prothallium Developmental stage...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406|Adiantum capillus...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406

AcEST: BP914060 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000039_D08 539 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D08. BP91406...0 CL1835Contig1 Show BP914060 Clone id YMU001_000039_D08 Library YMU01 Length 539 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D08. Accession BP914060 Tissue type prothallium Developmental stag...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris ...Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris mRNA, clone: YMU001_000039_D08. (539 lett

AcEST: BP920998 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_D03 529 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D03. BP92099...8 CL1935Contig1 Show BP920998 Clone id YMU001_000144_D03 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_D03. Accession BP920998 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-veneris mRNA, clon... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-ven

AcEST: BP920999 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_D04 588 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D04. BP92099...9 CL317Contig1 Show BP920999 Clone id YMU001_000144_D04 Library YMU01 Length 588 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D04. Accession BP920999 Tissue type prothallium Developmental stage...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

AcEST: BP920996 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_D01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D01. BP92099...6 CL262Contig1 Show BP920996 Clone id YMU001_000144_D01 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D01. Accession BP920996 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920996|Adiantum capillus-ve

AcEST: BP920993 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_C06 517 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C06. BP92099...3 CL547Contig1 Show BP920993 Clone id YMU001_000144_C06 Library YMU01 Length 517 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_C06. Accession BP920993 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum capillus-veneris mRNA, clone: YMU001_0001...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum

AcEST: BP920992 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_C05 525 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C05. BP92099...2 CL2523Contig1 Show BP920992 Clone id YMU001_000144_C05 Library YMU01 Length 525 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C05. Accession BP920992 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C05. (525 lett...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_00014

AcEST: BP919801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000129_C11 513 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C11. BP919801... CL1Contig3 Show BP919801 Clone id YMU001_000129_C11 Library YMU01 Length 513 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000129_C11. Accession BP919801 Tissue type prothallium Developmental stage -...es. 25:3389-3402. Query= BP919801|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C11. (435 letters) Da...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919801|Adiantum capil

AcEST: BP918013 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000108_F01 490 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F01. BP918013 - Show BP91801...is mRNA. clone: YMU001_000108_F01. Accession BP918013 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...idylinositol-4-phosphate 5-kinase 1 OS=Oryza sativa subsp. japonica GN=PIPK1 PE=2 SV=2 Length = 801 Score = ..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

AcEST: BP914801 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000063_A07 396 Adiantum capillus-veneris mRNA. clone: YMU001_000063_A07. BP914801... CL1121Contig1 Show BP914801 Clone id YMU001_000063_A07 Library YMU01 Length 396 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000063_A07. Accession BP914801 Tissue type prothallium Developmental stag...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801|Adiantum capillus-veneris mRNA, clone:

[right] - DUST RING AROUND STAR OFFERS NEW CLUES INTO PLANET FORMATION

Science.gov (United States)

2002-01-01

A NASA Hubble Space Telescope false-color near infrared image of a novel type of structure seen in space - a dust ring around a star. Superficially resembling Saturn's rings -- but on a vastly larger scale -- the 'hula-hoop' around the star called HR 4796A offers new clues into the possible presence of young planets. The near-infrared light reflecting off the dust ring is about 1,000 times fainter than the illuminating central star. Astronomers used a coronagraphic camera on Hubble's Near Infrared Camera and Multi-Object Spectrometer (NICMOS), specifically designed to enable observations of very faint and low surface brightness objects in the close proximity to bright stars. Even with the coronagraph, the glare from HR 4796A overwhelms the much-fainter ring at distances less than about 4 billion miles (inside the blacked-out circle, centered on the star). Hubble's crisp view was able to resolve the ring, seen at lower resolution at longer wavelengths, in ground-based thermal infrared images, as a disk with some degree of central clearing. The ring has an angular radius of 1.05 arc seconds, equivalent to the apparent size of a dime seen more than 4 miles away. Unlike the extensive disks of dust seen around other young stars, the HR 4796A dust ring, 6.5 billion miles from the star, is tightly confined within a relatively narrow zone less than 17 Astronomical Units wide. An Astronomical Unit is the distance from the Earth to the Sun). For comparison, the ring width is approximately equal to the distance separating the orbits of Mars and Uranus in our own Solar System. All dust rings, whether around stars or planets, can only stay intact by some mechanism confining the dust, likely the gravitational tug of unseen planets. The image was taken on March 15, 1998, centered at a near infrared wavelength of 1.1 microns. The false-color corresponds to the ring's brightness (yellow is bright, purple is faint). The ring, which is undoubtedly circular, appears elliptical since

AcEST: BP920994 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_C10 322 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C10. BP92099...4 CL2871Contig1 Show BP920994 Clone id YMU001_000144_C10 Library YMU01 Length 322 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C10. Accession BP920994 Tissue type prothallium Developmental stag...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

AcEST: BP920990 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_C03 445 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C03. BP92099...0 CL4123Contig1 Show BP920990 Clone id YMU001_000144_C03 Library YMU01 Length 445 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C03. Accession BP920990 Tissue type prothallium Developmental stag...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9209...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

AcEST: BP920991 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_C04 521 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C04. BP92099...1 CL3173Contig1 Show BP920991 Clone id YMU001_000144_C04 Library YMU01 Length 521 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C04. Accession BP920991 Tissue type prothallium Developmental stag...s. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (521 letters) Dat...ucleic Acids Res. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (5

AcEST: BP918016 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000108_F04 434 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F04. BP91801...6 CL3779Contig1 Show BP918016 Clone id YMU001_000108_F04 Library YMU01 Length 434 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000108_F04. Accession BP918016 Tissue type prothallium Developmental stag..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...ic Acids Res. 25:3389-3402. Query= BP918016|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F04. (434 l

Adding intrapreneurial role in HR business partner model: (an extension in the HR business partner model)

OpenAIRE

Bashir, Jibran; Afzal, Sara

2009-01-01

Purpose: The Purpose of this paper is to introduce a concept, whereby extending the Dave Ulrich’s HR business partner model by adding fifth Role – The HR Intrapreneur Role – in the existing model. This will be done by combining two separate concepts “Four Roles HR Business Partner Model” and “Intrapreneurial HR”, resulting in a five roles HR Business Partner Model. Design/methodology/approach: This paper is introducing a new concept through theoretical research. Findings: H...

AcEST: BP918019 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000108_F08 47 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F08. BP918019 - Show BP91801... mRNA. clone: YMU001_000108_F08. Accession BP918019 Tissue type prothallium Developmental stage - Contig ID

Radioactive waste legislation. Hearings before the Subcommittee on Energy and the Environment of the Committee on Interior and Insular Affairs, House of Representatives, Ninety-Seventh Congress, First Session on H.R. 1993; H.R. 2800; H.R. 2840; H.R. 2881; H.R. 3809, June 23 and 25; July 9, 1981

International Nuclear Information System (INIS)

Anon.

1981-01-01

This three-day hearing was held to consider five bills on radioactive waste, set priorities for a repository construction program, consider an administration proposal to develop a small-scale test facility for deep permanent storage of high-level wastes, and determine what role the public and private sectors should assume. The hearing record includes the text of H.R. 1993, H.R. 2800, H.R. 2840, H.R. 2881, and H.R. 3809; the statements of 10 witnesses and two panels; and three appendices with additional material submitted for the record

Acute Toxicity and Ecological Risk Assessment of Benzophenone-3 (BP-3 and Benzophenone-4 (BP-4 in Ultraviolet (UV-Filters

Directory of Open Access Journals (Sweden)

Yang Du

2017-11-01

Full Text Available Ultraviolet (UV-absorbing chemicals (UV filters are used in personal care products for the protection of human skin and hair from damage by UV radiation. Although these substances are released into the environment in the production and consumption processes, little is known about their ecotoxicology effects. The acute toxicity and potential ecological risk of UV filters benzophenone-3 (BP-3 and benzophenone-4 (BP-4 on Chlorella vulgaris, Daphnia magna, and Brachydanio rerio were analyzed in the present study. The EC50 values (96 h of BP-3 and BP-4 on C. vulgaris were 2.98 and 201.00 mg/L, respectively. The 48 h-LC50 of BP-3 and BP-4 on D. magna were 1.09 and 47.47 mg/L, respectively. The 96 h-LC50 of BP-3 and BP-4 on B. rerio were 3.89 and 633.00 mg/L, respectively. The toxicity of a mixture of BP-3 and BP-4 on C. vulgaris, D. magna, and B. rerio all showed antagonistic effects. The induced predicted no-effect concentrations of BP-3 and BP-4 by the assessment factor method were 1.80 × 10−3 and 0.47 mg/L, respectively, by assessment factor (AF method, which were both lower than the concentrations detected in the environment at present, verifying that BP-3 and BP-4 remain low-risk chemicals to the aquatic ecosystem.

Expanding the BP1-BP2 15q11.2 Microdeletion Phenotype: Tracheoesophageal Fistula and Congenital Cataracts

Directory of Open Access Journals (Sweden)

D. Wong

2013-01-01

Full Text Available The proximal q arm of chromosome 15 contains breakpoint regions BP1–BP5 with the classic deletion of BP1–BP3 best known to be associated with Prader-Willi and Angelman syndromes. The region is approximately 500 kb and microdeletions within the BP1-BP2 region have been reported in patients with developmental delay, behavioral abnormalities, and motor apraxia as well as dysmorphic features including hypertelorism, cleft or narrow palate, ear abnormalities, and recurrent upper airway infections. We report two patients with unique, never-before-reported 15q11.2 BP1-2 microdeletion syndrome findings, one with proximal esophageal atresia and distal tracheoesophageal fistula (type C and one with congenital cataracts. Cataracts have been described in Prader-Willi syndrome but we could not find any description of cataracts in Angelman syndrome. Esophageal atresia and tracheoesophageal fistula have not been reported to our knowledge in either syndrome. A chance exists that both cases are sporadic birth defects; however, the findings of the concomitant microdeletion cannot be overlooked as a possible cause. Based on our review of the literature and the presentation of our patients, we recommend that esophageal atresia and distal tracheoesophageal fistula as well as congenital cataracts be included in the phenotypic spectrum of 15q11.2 BP1-2 microdeletion syndrome.

AcEST: BP912612 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000020_H07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H07. BP912612 - Show BP912612... Clone id YMU001_000020_H07 Library YMU01 Length 512 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000020_H07. Accession BP912612 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912612|Adiantum cap...illus-veneris mRNA, clone: YMU001_000020_H07. (512 letters) Database: uniprot_sprot.fasta 412,525 sequences;

AcEST: BP912712 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show BP912712...is mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, cl...one: YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI

AcEST: BP912212 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000016_D11 457 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D11. BP912212... CL1085Contig1 Show BP912212 Clone id YMU001_000016_D11 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D11. Accession BP912212 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912212...|Adiantum capillus-veneris mRNA, clone: YMU001_000016_D11. (457 letters) Database: uniprot_sprot.fasta 412

AcEST: BP912312 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000017_F01 489 Adiantum capillus-veneris mRNA. clone: YMU001_000017_F01. BP912312... CL1779Contig1 Show BP912312 Clone id YMU001_000017_F01 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000017_F01. Accession BP912312 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912312...|Adiantum capillus-veneris mRNA, clone: YMU001_000017_F01. (489 letters) Database: uniprot_sprot.fasta 412

AcEST: BP912128 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_D10 477 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D10. BP91212...8 CL2328Contig1 Show BP912128 Clone id YMU001_000015_D10 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D10. Accession BP912128 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...8|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D10. (461 letters) Database: uniprot_sprot.fasta 412

AcEST: BP912912 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000024_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000024_C05. BP912912... CL1433Contig1 Show BP912912 Clone id YMU001_000024_C05 Library YMU01 Length 413 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000024_C05. Accession BP912912 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912912|Adiantum capillus-ven...eris mRNA, clone: YMU001_000024_C05. (413 letters) Database: uniprot_sprot.fasta 412

AcEST: BP919999 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000131_G09 554 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G09. BP919999... CL2968Contig1 Show BP919999 Clone id YMU001_000131_G09 Library YMU01 Length 554 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_G09. Accession BP919999 Tissue type prothallium Developmental stag...b Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generatio...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919999|Adiantum capillus-ve

AcEST: BP920997 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000144_D02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D02. BP92099...7 CL10Contig1 Show BP920997 Clone id YMU001_000144_D02 Library YMU01 Length 534 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_D02. Accession BP920997 Tissue type prothallium Developmental stage ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920997|Adian...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2

RADIO ASTROMETRY OF THE CLOSE ACTIVE BINARY HR 5110

Energy Technology Data Exchange (ETDEWEB)

Abbuhl, E.; Mutel, R. L.; Lynch, C. [Department of Physics and Astronomy, University of Iowa, Van Allen Hall, Iowa City, Iowa 52242 (United States); Güedel, M. [Department of Astronomy, University of Vienna, Vienna (Austria)

2015-09-20

The close active binary HR 5110 was observed at six epochs over 26 days using a global very long baseline interferometry array at 15.4 GHz. We used phase referencing to determine the position of the radio centroid at each epoch with an uncertainty significantly smaller than the component separation. After correcting for proper motion and parallax, we find that the centroid locations of all six epochs have barycenter separations consistent with an emission source located on the KIV secondary, and not in an interaction region between the stars or on the F primary. We used a homogeneous power-law gyrosynchrotron emission model to reproduce the observed flux densities and fractional circular polarization. The resulting ranges of mean magnetic field strength and relativistic electron densities are of the order of 10 G and 10{sup 5} cm{sup −3}, respectively, in the source region.

Comparison of Microlife BP A200 Plus and Omron M6 blood pressure monitors to detect atrial fibrillation in hypertensive patients.

Science.gov (United States)

Marazzi, Giuseppe; Iellamo, Ferdinando; Volterrani, Maurizio; Lombardo, Mauro; Pelliccia, Francesco; Righi, Daniela; Grieco, Fabrizia; Cacciotti, Luca; Iaia, Luigi; Caminiti, Giuseppe; Rosano, Giuseppe

2012-01-01

Self-monitoring home blood pressure (BP) devices are currently recommended for long-term follow-up of hypertension and its management. Some of these devices are integrated with algorithms aimed at detecting atrial fibrillation (AF), which is common essential hypertension. This study was designed to compare the diagnostic accuracy of two widely diffused home BP monitoring devices in detecting AF in an unselected population of outpatients referred to a hypertension clinic because of high BP. In 503 consecutive patients the authors simultaneously compared the accuracy of the Microlife(®) BP A200 Plus (Microlife) and the OMRON(®) M6 (OMRON) home BP devices, in detecting AF. Systolic and diastolic BP as well as heart rate (HR) values detected by the two devices were not significantly different. Pulse irregularity was detected in 124 and 112 patients with the OMRON M6 and Microlife BP A200 Plus devices, respectively. Simultaneous electrocardiogram (ECG) recording revealed that pulse irregularity was due to AF in 101 patients. Pulse irregularity detected by the OMRON M6 device corresponded to AF in 101, to supraventricular premature beats in 18, and to frequent premature ventricular beat in five patients, respectively. Pulse irregularity detected by the Microlife BP A200 Plus device corresponded to AF in 93, to supraventricular premature beats in 14, and to ventricular premature beats in five patients. The sensitivity for detecting AF was 100%, the specificity was 92%, and diagnostic accuracy 95% for the OMRON M6 and 100%, 92%, and 95 for the Microlife BP A200 Plus, respectively. AF was newly diagnosed by ECG recordings in 47 patients, and was detected in all patients by the OMRON device, and in 42 patients by the Microlife device. These results indicate that OMRON M6 is more accurate than Microlife BP A200 Plus in detecting AF in patients with essential hypertension. Widespread use of these devices in hypertensive patients could be of clinical benefit for the early

Peptide-Based Membrane Fusion Inhibitors Targeting HCoV-229E Spike Protein HR1 and HR2 Domains

Directory of Open Access Journals (Sweden)

Shuai Xia

2018-02-01

Full Text Available Human coronavirus 229E (HCoV-229E infection in infants, elderly people, and immunocompromised patients can cause severe disease, thus calling for the development of effective and safe therapeutics to treat it. Here we reported the design, synthesis and characterization of two peptide-based membrane fusion inhibitors targeting HCoV-229E spike protein heptad repeat 1 (HR1 and heptad repeat 2 (HR2 domains, 229E-HR1P and 229E-HR2P, respectively. We found that 229E-HR1P and 229E-HR2P could interact to form a stable six-helix bundle and inhibit HCoV-229E spike protein-mediated cell-cell fusion with IC50 of 5.7 and 0.3 µM, respectively. 229E-HR2P effectively inhibited pseudotyped and live HCoV-229E infection with IC50 of 0.5 and 1.7 µM, respectively. In a mouse model, 229E-HR2P administered intranasally could widely distribute in the upper and lower respiratory tracts and maintain its fusion-inhibitory activity. Therefore, 229E-HR2P is a promising candidate for further development as an antiviral agent for the treatment and prevention of HCoV-229E infection.

The effective temperatures of early Wolf-Rayet stars

International Nuclear Information System (INIS)

Schmutz, W.

1982-01-01

Nussbaumer et al. (1981) (NSSW) have calculated temperatures of 15 Wolf-Rayet stars, which cover most subtypes in the WN and WC sequences. Some Wolf-Rayet stars are found to have a blackbody-like energy distribution and therefore their effective temperature can be well determined, others show deviation from the blackbody shape. This deviation is probably due to an extended continuum emitting region. In view of these later cases NSSW adopted a temperature which they derived from a Zanstra analysis of the He II recombination lines. According to their analysis there should be a continuum jump at 2050 A. New IUE observations of the WN 5 star HD 50896 however did not show any trace of such an absorption edge. This implies that the effective temperature of this WN 5 star and probably of all WR stars with a non blackbody energy distribution is not yet known accurately. Therefore the author started a detailed analysis with a spherically symmetric atmosphere model. Though the model has not yet reached its final shape he has obtained as a first result that the location of HD 50896 in the HR-diagram is to the left of the ZAMS and that the Zanstra analysis is indeed not valid for this star. (Auth.)

A new look at the origin of the 6.67 hr period X-ray pulsar 1E 161348-5055

Science.gov (United States)

Ikhsanov, N. R.; Kim, V. Y.; Beskrovnaya, N. G.; Pustil'nik, L. A.

2013-07-01

The point X-ray source 1E 161348-5055 is observed to display pulsations with the period 6.67 hr and |dot{P}| ≤1.6 ×10^{-9} s s^{-1}. It is associated with the supernova remnant RCW 103 and is widely believed to be a ˜2000 yr old neutron star. Observations give no evidence for the star to be a member of a binary system. Nevertheless, it resembles an accretion-powered pulsar with the magnetospheric radius ˜3000 km and the mass-accretion rate ˜ 10^{14} g s^{-1}. This situation could be described in terms of accretion from a (residual) fossil disk established from the material falling back towards the star after its birth. However, current fall-back accretion scenarios encounter major difficulties explaining an extremely long spin period of the young neutron star. We show that the problems can be avoided if the accreting material is magnetized. The star in this case is surrounded by a fossil magnetic slab in which the material is confined by the magnetic field of the accretion flow itself. We find that the surface magnetic field of the neutron star within this scenario is ˜1012 G and that a presence of ≳10^{-7} M_{⊙} magnetic slab would be sufficient to explain the origin and current state of the pulsar.

Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

International Nuclear Information System (INIS)

Gago-Ferrero, Pablo; Badia-Fabregat, Marina; Olivares, Alba; Piña, Benjamin; Blánquez, Paqui; Vicent, Teresa; Caminal, Gloria; Díaz-Cruz, M. Silvia

2012-01-01

Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: ► Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. ► BP3 is not degraded under simulated sunlight. ► Glycoconjugates have been identified as the main intermediate metabolites. ► Decrease in endocrine activity was found in both photodegradation and biodegradation.

AcEST: BP913636 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000032_E04 520 Adiantum capillus-veneris mRNA. clone: YMU001_000032_E04. BP913636... CL2643Contig1 Show BP913636 Clone id YMU001_000032_E04 Library YMU01 Length 520 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000032_E04. Accession BP913636 Tissue type prothallium Developmental stag...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP913636|Adiantum capillus-veneris mRNA, clone: YMU001_00003...tative phospholipid-transporting ATPase ... 149 8e-36 sp|Q9LNQ4|ALA4_ARATH Putati

AcEST: BP912124 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_D06 531 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D06. BP91212...4 CL2988Contig1 Show BP912124 Clone id YMU001_000015_D06 Library YMU01 Length 531 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D06. Accession BP912124 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912124|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D06. (531 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total

AcEST: BP912125 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_D07 558 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D07. BP912125 - Show BP91212...is mRNA. clone: YMU001_000015_D07. Accession BP912125 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912125|Adiantum capillus-veneris mRN...A, clone: YMU001_000015_D07. (558 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...copeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12

AcEST: BP912120 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_D01 500 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D01. BP912120 - Show BP91212...is mRNA. clone: YMU001_000015_D01. Accession BP912120 Tissue type prothallium Developmental stage - Contig I...elated Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum Align length 130 Score (bit) 124.0 E-va...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...0|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D01. (500 letters) Database: uniprot_sprot.fasta 412

AcEST: BP921212 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000147_A09 361 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A09. BP921212 - Show BP921212...is mRNA. clone: YMU001_000147_A09. Accession BP921212 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921212|Adiantum capillus-veneris... mRNA, clone: YMU001_000147_A09. (361 letters) Database: uniprot_sprot.fasta 412,...itol-4,5-bisphosphate 3-ki... 30 2.9 sp|O14338|YB33_SCHPO Uncharacterized serine-rich protein C2F12.0... 29

AcEST: BP912126 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa

AcEST: BP912812 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000023_B07 575 Adiantum capillus-veneris mRNA. clone: YMU001_000023_B07. BP912812... CL2610Contig1 Show BP912812 Clone id YMU001_000023_B07 Library YMU01 Length 575 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000023_B07. Accession BP912812 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912812|Adiant...um capillus-veneris mRNA, clone: YMU001_000023_B07. (575 letters) Database: uniprot_sprot.fasta 412,525 sequ

AcEST: BP912122 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_D04 544 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D04. BP91212...2 CL3363Contig1 Show BP912122 Clone id YMU001_000015_D04 Library YMU01 Length 544 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D04. Accession BP912122 Tissue type prothallium Developmental stag...obium aromaticivorans (strain DSM 12444) Align length 58 Score (bit) 33.1 E-value 0.89 Report BLASTX 2.2.19 ...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912122|Adiantum

AcEST: BP912412 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000018_G03 551 Adiantum capillus-veneris mRNA. clone: YMU001_000018_G03. BP912412... CL4248Contig1 Show BP912412 Clone id YMU001_000018_G03 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_G03. Accession BP912412 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912412|Adiantum capillus-veneris mR...NA, clone: YMU001_000018_G03. (551 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tot

AcEST: BP912012 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP912012... CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...mRNA, clone: YMU001_000012_A06. (542 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 t

AcEST: BP912123 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_D05 496 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D05. BP91212...3 CL498Contig1 Show BP912123 Clone id YMU001_000015_D05 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D05. Accession BP912123 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...3|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D05. (478 letters) Database: uniprot_sprot.fasta 412

AcEST: BP912512 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000019_D01 513 Adiantum capillus-veneris mRNA. clone: YMU001_000019_D01. BP912512... CL17Contig1 Show BP912512 Clone id YMU001_000019_D01 Library YMU01 Length 513 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000019_D01. Accession BP912512 Tissue type prothallium Developmental stage ...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP912512|Adiantum capillus-veneris mRNA, clone: YMU0...01_000019_D01. (489 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Sear

AcEST: BP912129 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_D11 268 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D11. BP91212...9 CL691Contig1 Show BP912129 Clone id YMU001_000015_D11 Library YMU01 Length 268 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D11. Accession BP912129 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912129|Adiantum capillus-veneris mRNA, clo...ne: YMU001_000015_D11. (268 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total lett

AcEST: BP917373 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000100_A08 270 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A08. BP917373 CL2373...Contig1 Show BP917373 Clone id YMU001_000100_A08 Library YMU01 Length 270 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_A08. Accession BP917373 Tissue type prothallium Developmental stage - Contig ID CL2373...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917373|Adiantum capillus-veneris mRNA, clone: YMU...EGAVKHVGVLSS 206 K+ GC+S G SRHGES V KE H SS Sbjct: 473 KKEKGCSSPGSSRHGESHKGVSHTPI

The magnetic early B-type stars I: magnetometry and rotation

Science.gov (United States)

Shultz, M. E.; Wade, G. A.; Rivinius, Th; Neiner, C.; Alecian, E.; Bohlender, D.; Monin, D.; Sikora, J.; MiMeS Collaboration; BinaMIcS Collaboration

2018-04-01

The rotational and magnetic properties of many magnetic hot stars are poorly characterized, therefore the Magnetism in Massive Stars and Binarity and Magnetic Interactions in various classes of Stars collaborations have collected extensive high-dispersion spectropolarimetric data sets of these targets. We present longitudinal magnetic field measurements for 52 early B-type stars (B5-B0), with which we attempt to determine their rotational periods Prot. Supplemented with high-resolution spectroscopy, low-resolution Dominion Astrophysical Observatory circular spectropolarimetry, and archival Hipparcos photometry, we determined Prot for 10 stars, leaving only five stars for which Prot could not be determined. Rotational ephemerides for 14 stars were refined via comparison of new to historical magnetic measurements. The distribution of Prot is very similar to that observed for the cooler Ap/Bp stars. We also measured v sin i and vmac for all stars. Comparison to non-magnetic stars shows that v sin i is much lower for magnetic stars, an expected consequence of magnetic braking. We also find evidence that vmac is lower for magnetic stars. Least-squares deconvolution profiles extracted using single-element masks revealed widespread, systematic discrepancies in between different elements: this effect is apparent only for chemically peculiar stars, suggesting it is a consequence of chemical spots. Sinusoidal fits to H line measurements (which should be minimally affected by chemical spots), yielded evidence of surface magnetic fields more complex than simple dipoles in six stars for which this has not previously been reported; however, in all six cases, the second- and third-order amplitudes are small relative to the first-order (dipolar) amplitudes.

An optical spectroscopic study of T Tauri stars. I. Photospheric properties

Energy Technology Data Exchange (ETDEWEB)

Herczeg, Gregory J. [Kavli Institute for Astronomy and Astrophysics, Peking University, Yi He Yuan Lu 5, Haidian Qu, Beijing 100871 (China); Hillenbrand, Lynne A. [Caltech, MC105-24, 1200 East California Boulevard, Pasadena, CA 91125 (United States)

2014-05-10

Estimates of the mass and age of young stars from their location in the H-R diagram are limited by not only the typical observational uncertainties that apply to field stars, but also by large systematic uncertainties related to circumstellar phenomena. In this paper, we analyze flux-calibrated optical spectra to measure accurate spectral types and extinctions of 281 nearby T Tauri stars (TTSs). The primary advances in this paper are (1) the incorporation of a simplistic accretion continuum in optical spectral type and extinction measurements calculated over the full optical wavelength range and (2) the uniform analysis of a large sample of stars, many of which are well known and can serve as benchmarks. Comparisons between the non-accreting TTS photospheric templates and stellar photosphere models are used to derive conversions from spectral type to temperature. Differences between spectral types can be subtle and difficult to discern, especially when accounting for accretion and extinction. The spectral types measured here are mostly consistent with spectral types measured over the past decade. However, our new spectral types are one to two subclasses later than literature spectral types for the original members of the TW Hya Association (TWA) and are discrepant with literature values for some well-known members of the Taurus Molecular Cloud. Our extinction measurements are consistent with other optical extinction measurements but are typically 1 mag lower than near-IR measurements, likely the result of methodological differences and the presence of near-IR excesses in most CTTSs. As an illustration of the impact of accretion, spectral type, and extinction uncertainties on the H-R diagrams of young clusters, we find that the resulting luminosity spread of stars in the TWA is 15%-30%. The luminosity spread in the TWA and previously measured for binary stars in Taurus suggests that for a majority of stars, protostellar accretion rates are not large enough to

A search for strong, ordered magnetic fields in Herbig Ae/Be stars

Science.gov (United States)

Wade, G. A.; Bagnulo, S.; Drouin, D.; Landstreet, J. D.; Monin, D.

2007-04-01

The origin of magnetic fields in intermediate- and high-mass stars is fundamentally a mystery. Clues towards solving this basic astrophysical problem can likely be found at the pre-main-sequence (PMS) evolutionary stage. With this work, we perform the largest and most sensitive search for magnetic fields in PMS Herbig Ae/Be (HAeBe) stars. We seek to determine whether strong, ordered magnetic fields, similar to those of main-sequence Ap/Bp stars, can be detected in these objects, and if so, to determine the intensities, geometrical characteristics, and statistical incidence of such fields. 68 observations of 50 HAeBe stars have been obtained in circularly polarized light using the FORS1 spectropolarimeter at the ESO VLT. An analysis of both Balmer and metallic lines reveals the possible presence of weak longitudinal magnetic fields in photospheric lines of two HAeBe stars, HD 101412 and BF Ori. Results for two additional stars, CPD-53 295 and HD 36112, are suggestive of the presence of magnetic fields, but no firm conclusions can be drawn based on the available data. The intensity of the longitudinal fields detected in HD 101412 and BF Ori suggest that they correspond to globally ordered magnetic fields with surface intensities of order 1 kG. On the other hand, no magnetic field is detected in 4 other HAeBe stars in our sample in which magnetic fields had previously been confirmed. Monte Carlo simulations of the longitudinal field measurements of the undetected stars allow us to place an upper limit of about 300 G on the general presence of aligned magnetic dipole magnetic fields, and of about 500 G on perpendicular dipole fields. Taking into account the results of our survey and other published results, we find that the observed bulk incidence of magnetic HAeBe stars in our sample is 8-12 per cent, in good agreement with that of magnetic main-sequence stars of similar masses. We also find that the rms longitudinal field intensity of magnetically detected HAe

Designing HR Organizational Structures in terms of the HR Business Partner Model Principles from the Perspective of Czech Organizations

Directory of Open Access Journals (Sweden)

Marek Stříteský

2014-03-01

Full Text Available This paper describes new trends related to the concepts contained in HR organizational structures within Czech organizations. In addition, it describes the specifics of the roles played by HR in those organizations which have transformed their HR departments in terms of the principles of the HR Business Partner Model, both in theory based on available resources, and at the practical level based on the results of primary examination. The goal of this paper is to present the key perceptions of the changes made in the HR structure within the organizations, as well as the impact of these changes on the effectiveness of the HR departments concerned. Another goal of the paper is to summarize the responsibilities of the newly created position known as the HR Business Partner in these organizations as well as the demands placed upon the personnel employed in the HR Business Partner role. The paper offers conclusions based on the results of both quantitative and qualitative surveys. It also contains a case study of one organization which has one of the best transformed HR departments, and whose services are classified, by internal clients, as being of high quality.

Asteroseismology of solar-type stars: particular physical effects

Energy Technology Data Exchange (ETDEWEB)

Carrier, F [Instituut voor Sterrenkunde, Katholieke Universiteit Leuven, Celestijnenlaan 200D, 3001 Leuven (Belgium); Eggenberger, P; Leyder, J-C [Institut d' Astrophysique et de Geophysique de l' Universite de Liege, 17 Allee du 6 aout, 4000 Liege (Belgium)], E-mail: fabien@ster.kuleuven.be

2008-10-15

Since the success of helioseismology, numerous efforts have been made to detect solar-like oscillations on other stars. The measurement of the frequencies of p-mode oscillations provides an insight into the internal structure and is nowadays the most powerful constraint on the theory of stellar evolution. The existing asteroseismic observations were mainly motivated by the need to explore the seismological properties of stars with various global parameters, i.e. various locations in the HR diagram. With the aim of testing different physical effects on solar-like oscillations, we report here detection of acoustic modes on solar-like targets achieved with the spectrograph HARPS installed on the 3.6-m telescope at ESO La Silla Observatory.

Validation of the Welch Allyn SureBP (inflation) and StepBP (deflation) algorithms by AAMI standard testing and BHS data analysis.

Science.gov (United States)

Alpert, Bruce S

2011-04-01

We evaluated two new Welch Allyn automated blood pressure (BP) algorithms. The first, SureBP, estimates BP during cuff inflation; the second, StepBP, does so during deflation. We followed the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard for testing and data analysis. The data were also analyzed using the British Hypertension Society analysis strategy. We tested children, adolescents, and adults. The requirements of the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard were fulfilled with respect to BP levels, arm sizes, and ages. Association for the Advancement of Medical Instrumentation SP10 Method 1 data analysis was used. The mean±standard deviation for the device readings compared with auscultation by paired, trained, blinded observers in the SureBP mode were -2.14±7.44 mmHg for systolic BP (SBP) and -0.55±5.98 mmHg for diastolic BP (DBP). In the StepBP mode, the differences were -3.61±6.30 mmHg for SBP and -2.03±5.30 mmHg for DBP. Both algorithms achieved an A grade for both SBP and DBP by British Hypertension Society analysis. The SureBP inflation-based algorithm will be available in many new-generation Welch Allyn monitors. Its use will reduce the time it takes to estimate BP in critical patient care circumstances. The device will not need to inflate to excessive suprasystolic BPs to obtain the SBP values. Deflation is rapid once SBP has been determined, thus reducing the total time of cuff inflation and reducing patient discomfort. If the SureBP fails to obtain a BP value, the StepBP algorithm is activated to estimate BP by traditional deflation methodology.

AcEST: BP913939 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000038_B01 468 Adiantum capillus-veneris mRNA. clone: YMU001_000038_B01. BP913939 - Show BP913939...is mRNA. clone: YMU001_000038_B01. Accession BP913939 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP913939|Adiantum capillus-veneris mRNA, ... F member 3... 86 9e-17 sp|Q66H39|ABCF3_RAT ATP-binding cassette sub-family F member 3 O... 85 1e-16 sp|Q5R9...aracterized ABC transporter ATP-binding... 56 6e-08 sp|P63390|YHES_ECO57 Uncharacterized ABC transporter ATP

AcEST: BP912127 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_D09 582 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D09. BP912127 - Show BP91212...is mRNA. clone: YMU001_000015_D09. Accession BP912127 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912127|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D09. (582 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total ...p|P42825|DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis th... 79 2e-14 sp|Q09912|PSI1_SCHPO Protein psi

AcEST: BP912112 [AcEST

Lifescience Database Archive (English)

Full Text Available YMU001_000015_C08 546 Adiantum capillus-veneris mRNA. clone: YMU001_000015_C08. BP912112 - Show BP912112...is mRNA. clone: YMU001_000015_C08. Accession BP912112 Tissue type prothallium Developmental stage - Contig I...Arabidopsis thaliana Align length 171 Score (bit) 121.0 E-value 3.0e-27 Report BLASTX 2.2.19 [Nov-02-2008] R... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912112|Adiantum capillus-veneri...s mRNA, clone: YMU001_000015_C08. (546 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765

Hr Pitt mängib hr Smithi / Timo Diener

Index Scriptorium Estoniae

Diener, Timo

2005-01-01

Brad Pitt actionkomöödias "Hr ja pr Smith" ("Mr and Mrs Smith") : režissöör Doug Liman : Ameerika Ühendriigid 2005. Filmi ümber puhkenud skandaalist ning näitleja plaanitavatest filmirollidest aastal 2006

A search for lithium-rich giant stars

International Nuclear Information System (INIS)

Brown, J.A.; Sneden, C.; Lambert, D.L.; Dutchover, E. Jr.

1989-01-01

Lithium abundances or upper limits have been determined for 644 bright G-K giant stars selected from the DDO photometric catalog. Two of these giants possess surface lithium abundances approaching the cosmic value of the interstellar medium and young main-sequence stars, and eight more giants have Li contents far in excess of standard predictions. At least some of these Li-rich giants are shown to be evolved to the stage of having convectively mixed envelopes, either from the direct evidence of low surface carbon isotope ratios, or from the indirect evidence of their H-R diagram positions. Suggestions are given for the unique conditions that might have allowed these stars to produce or accrete new lithium for their surface layers, or simply to preserve from destruction their initial lithium contents. The lithium abundance of the remaining stars demonstrates that giants only very rarely meet the expectations of standard first dredge-up theories; the average extra Li destruction required is about 1.5 dex. The evolutionary states of these giants and their average masses are discussed briefly, and the Li distribution of the giants is compared to predictions of Galactic chemical evolution. 110 refs

Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

Energy Technology Data Exchange (ETDEWEB)

Gago-Ferrero, Pablo, E-mail: pablo.gago@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Badia-Fabregat, Marina, E-mail: marina.badia@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Olivares, Alba, E-mail: esalba.olivares@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Pina, Benjamin, E-mail: benjami.pina@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Blanquez, Paqui, E-mail: paqui.blanquez@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Vicent, Teresa, E-mail: teresa.vicent@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Caminal, Gloria, E-mail: gloria.caminal@uab.cat [Unitat de Biocatalisi Aplicada associada al IQAC (CSIC-UAB). Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Diaz-Cruz, M. Silvia, E-mail: silvia.diaz@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); and others

2012-06-15

Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: Black-Right-Pointing-Pointer Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. Black-Right-Pointing-Pointer BP3 is not degraded under simulated sunlight. Black-Right-Pointing-Pointer Glycoconjugates have been identified as the main intermediate metabolites. Black-Right-Pointing-Pointer Decrease in endocrine activity

RanBP2 modulates Cox11 and hexokinase I activities and haploinsufficiency of RanBP2 causes deficits in glucose metabolism.

Directory of Open Access Journals (Sweden)

Azamat Aslanukov

2006-10-01

Full Text Available The Ran-binding protein 2 (RanBP2 is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/- are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/- mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.

RanBP2 modulates Cox11 and hexokinase I activities and haploinsufficiency of RanBP2 causes deficits in glucose metabolism.

Science.gov (United States)

Aslanukov, Azamat; Bhowmick, Reshma; Guruju, Mallikarjuna; Oswald, John; Raz, Dorit; Bush, Ronald A; Sieving, Paul A; Lu, Xinrong; Bock, Cheryl B; Ferreira, Paulo A

2006-10-01

The Ran-binding protein 2 (RanBP2) is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s) of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI) via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/-) are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/-) mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.

HR 1362 - A test case for stellar dynamo theories

International Nuclear Information System (INIS)

Strassmeier, K.G.; Hall, D.S.; Barksdale, W.S.; Jusick, A.T.; Henry, G.W.

1990-01-01

An analysis of 11 yr of photometry of HR 1362 = EK Eri has shown a well-established photometric period of 335 days. This confirms an earlier period determination of about 310 days from 3 yr of APT data and is consistent with a new v sin i determination of 2 + or - 2 km/s. Recent Ca II H and K observations show moderately strong H and K emission lines at a flux level of log F prime (K) of about 6.5 ergs sq m/s. If the photometric period is interpreted as the rotation period, this surface flux is more than one order of magnitude larger than what can be expected from empirical activity versus rotation relationships. The spectrum and the U-B and B-V colors are consistent with a single G8 III-IV spectral classification, while the V-R and V-I values indicate a small color excess, typical of chromospherically active stars. 27 refs

SIGNATURES OF DARK MATTER BURNING IN NUCLEAR STAR CLUSTERS

International Nuclear Information System (INIS)

Casanellas, Jordi; Lopes, IlIdio

2011-01-01

In order to characterize how dark matter (DM) annihilation inside stars changes the aspect of a stellar cluster, we computed the evolution until the ignition of the He burning of stars from 0.7 M sun to 3.5 M sun within halos of DM with different characteristics. We found that, when a cluster is surrounded by a dense DM halo, the positions of the cluster' stars in the H-R diagram have a brighter and hotter turnoff point than in the classical scenario without DM, therefore giving the cluster a younger appearance. The high DM densities required to produce these effects are expected only in very specific locations, such as near the center of our Galaxy. In particular, if DM is formed by the 8 GeV weakly interacting massive particles recently invoked to reconcile the results from direct detection experiments, then this signature is predicted for halos of DM with a density ρ χ = 3 x 10 5 GeV cm -3 . A DM density gradient inside the stellar cluster would result in a broader main sequence, turnoff, and red giant branch regions. Moreover, we found that for very high DM halo densities the bottom of the isochrones in the H-R diagram rises to higher luminosities, leading to a characteristic signature on the stellar cluster. We argue that this signature could be used to indirectly probe the presence of DM particles in the location of a cluster.

Putting HR outsourcing into practice.

Science.gov (United States)

Berger, Michael

2007-01-01

Faced with the time-consuming responsibility of human resources (HR) management, a growing number of medical practices are outsourcing their HR to professional employer organizations (PEOs) so they can concentrate on their core business. A PEO functions as an HR department-minus the high overhead-managing daily administrative tasks such as payroll processing and related tax filings, employee benefits, and workers' compensation coverage and claims resolution. PEOs help physicians' offices keep up with the piles of paperwork that never seem to shrink, freeing doctors to focus on patient care and building their practice. Because of their volume buying power, PEOs are able to offer employees of small medical practices big-company benefits-everything from health, dental, and vision coverage to long-term disability insurance and tuition assistance. A fledgling industry only a decade ago, HR outsourcing has morphed into a blossoming industry. Enlisting the services of a PEO is now considered de rigueur in many small business circles.

A new interpretation of luminous blue stars

International Nuclear Information System (INIS)

Stothers, R.

1976-01-01

A major revision of current theoretical ideas about the brightest blue stars must be made if Carson's new radiative opacities are adopted in stellar models. Unlike earlier opacities, the new opacities exhibit a large ''bump'' due to CNO ionization, which leads to very strong central condensation, convective instability, and pulsational instability in hot, diffuse stellar envelopes (typically those in which L/M>10 3 solar units). Despite a number of theoretical uncertainties, the new picture of the structure of very luminous stars is reasonably successful in accounting for a variety of previously unexplained observations. Thus, the new stellar models for the phase of core hydrogen burning predict large radii and rather cool effective temperatures (which are yet to be observationally confirmed) for O stars, and a spreading out of the main-sequence band in the H-R diagram toward luminous cool supergiants for masses higher than approx.20 M/sub sun/, beginning at M/sub v/=-4.5 and Sp=B1. They also predict slower surface rotations for O stars compared with B stars; and, in binary systems, slower apsidal motions, closer rotational-revolutional synchronism, and smaller orbital eccentricities. In massive X-ray binary systems, circular orbits and supergiant-like visual companions are expected to be quite common. Radial pulsations of the models have been calculated by employing linearized nonadiabatic pulsation theory. Long-period variability is predicted to exist for massive blue supergiants of luminosity class Ia. The new models for helium stars predict large radii and rather cool effective temperatures for Wolf-Rayet stars, as well as multimodal pulsational instability and, possibly, surface turbulence for these stars. Ultrashort-period variability, observed in many classes of hot luminous stars, may be due, in part, to high radial overtone pulsations (or, possibly, to nonradial pulsation or convective modes)

The Discovery of λ Bootis Stars: The Southern Survey I

Energy Technology Data Exchange (ETDEWEB)

Gray, R. O.; Riggs, Q. S.; Newsome, I. M. [Department of Physics and Astronomy, Appalachian State University, Boone, NC 26808 (United States); Koen, C. [Department of Statistics, University of the Western Cape, Private Bag X17, Bellville, 7535 Cape Town (South Africa); Murphy, S. J. [Sydney Institute for Astronomy (SIfA), School of Physics, University of Sydney, NSW 2006 (Australia); Corbally, C. J. [Vatican Observatory Research Group, Steward Observatory, Tucson, AZ, 85721-0065 (United States); Cheng, K.-P. [California State University, Fullerton, Fullerton, CA (United States); Neff, J. E. [National Science Foundation, Arlington, VA (United States)

2017-07-01

The λ Boo stars are a class of chemically peculiar Population I A-type stars characterized by under-abundances of the refractory elements, but near-solar abundances of carbon, nitrogen, oxygen, and sulfur. There is some evidence that λ Boo stars have higher frequencies of “bright” debris disks than normal A-type stars. The discovery of four exoplanets orbiting HR 8799, a λ Boo star with a resolved debris disk, suggests that the λ Boo phenomenon may be related to the presence of a dynamic debris disk, perhaps perturbed by migrating planets. However, only 64 λ Boo stars are known, and those stars were discovered with different techniques, making it problematic to use that sample for statistical purposes, including determining the frequency of debris disks. The purpose of this paper is to derive a new sample of λ Boo stars using a technique that does not lead to biases with respect to the presence of infrared excesses. Through spectroscopic observations in the southern hemisphere, we have discovered 33 λ Boo stars and have confirmed 12 others. As a step toward determining the proportion of λ Boo stars with infrared excesses, we have used WISE data to examine the infrared properties of this sample out to 22 μ m. On this basis, we cannot conclude that λ Boo stars have a greater tendency than normal A-type stars to show infrared excesses. However, observing this sample at longer wavelengths may change that conclusion, as many λ Boo debris disks are cool and do not radiate strongly at 22 μ m.

The Discovery of λ Bootis Stars: The Southern Survey I

International Nuclear Information System (INIS)

Gray, R. O.; Riggs, Q. S.; Newsome, I. M.; Koen, C.; Murphy, S. J.; Corbally, C. J.; Cheng, K.-P.; Neff, J. E.

2017-01-01

The λ Boo stars are a class of chemically peculiar Population I A-type stars characterized by under-abundances of the refractory elements, but near-solar abundances of carbon, nitrogen, oxygen, and sulfur. There is some evidence that λ Boo stars have higher frequencies of “bright” debris disks than normal A-type stars. The discovery of four exoplanets orbiting HR 8799, a λ Boo star with a resolved debris disk, suggests that the λ Boo phenomenon may be related to the presence of a dynamic debris disk, perhaps perturbed by migrating planets. However, only 64 λ Boo stars are known, and those stars were discovered with different techniques, making it problematic to use that sample for statistical purposes, including determining the frequency of debris disks. The purpose of this paper is to derive a new sample of λ Boo stars using a technique that does not lead to biases with respect to the presence of infrared excesses. Through spectroscopic observations in the southern hemisphere, we have discovered 33 λ Boo stars and have confirmed 12 others. As a step toward determining the proportion of λ Boo stars with infrared excesses, we have used WISE data to examine the infrared properties of this sample out to 22 μ m. On this basis, we cannot conclude that λ Boo stars have a greater tendency than normal A-type stars to show infrared excesses. However, observing this sample at longer wavelengths may change that conclusion, as many λ Boo debris disks are cool and do not radiate strongly at 22 μ m.

The Discovery of λ Bootis Stars: The Southern Survey I

Science.gov (United States)

Gray, R. O.; Riggs, Q. S.; Koen, C.; Murphy, S. J.; Newsome, I. M.; Corbally, C. J.; Cheng, K.-P.; Neff, J. E.

2017-07-01

The λ Boo stars are a class of chemically peculiar Population I A-type stars characterized by under-abundances of the refractory elements, but near-solar abundances of carbon, nitrogen, oxygen, and sulfur. There is some evidence that λ Boo stars have higher frequencies of “bright” debris disks than normal A-type stars. The discovery of four exoplanets orbiting HR 8799, a λ Boo star with a resolved debris disk, suggests that the λ Boo phenomenon may be related to the presence of a dynamic debris disk, perhaps perturbed by migrating planets. However, only 64 λ Boo stars are known, and those stars were discovered with different techniques, making it problematic to use that sample for statistical purposes, including determining the frequency of debris disks. The purpose of this paper is to derive a new sample of λ Boo stars using a technique that does not lead to biases with respect to the presence of infrared excesses. Through spectroscopic observations in the southern hemisphere, we have discovered 33 λ Boo stars and have confirmed 12 others. As a step toward determining the proportion of λ Boo stars with infrared excesses, we have used WISE data to examine the infrared properties of this sample out to 22 μm. On this basis, we cannot conclude that λ Boo stars have a greater tendency than normal A-type stars to show infrared excesses. However, observing this sample at longer wavelengths may change that conclusion, as many λ Boo debris disks are cool and do not radiate strongly at 22 μm.

To share or not to share: thats the question! When does sharing of HR services maximize perceived HR service value?

NARCIS (Netherlands)

Meijerink, Jeroen Gerard; Hofman, Erwin; Hemels, Hinse

2011-01-01

Nowadays, organizations can rely on a variety of delivery channels for offering HR services to employees, such as HR shared service centres, embedded HR professionals or electronic HRM. However, when should organizations opt for one of the many HR delivery channels that are at their disposal to

Palaeolithic Timekeepers Looking At The Golden Gate Of The Ecliptic; The Lunar Cycle And The Pleiades In The Cave Of La-TETe-Du-Lion (Ardéche, France) - 21,000 BP

Science.gov (United States)

Rappenglück, Michael A.

Decades of research work done by several scientists all over the world since the beginning of the 20th century confirmed the idea, that Palaeolithic man looked up to the starry sky and recognized prominent patterns of stars as well as the course of the celestial bodies. Though sometimes highly speculative, the investigations made clear, that time-factored notations played an important role in the archaic cultures of Palaeolithic epochs (from 33,000 to 10,000 BP). There are some distinct and detailed examples of lunar-, solar- and lunisolar-calendars sometimes combined with pictures of seasonality, mostly discovered on transportable bones and stones, but also on the fixed walls of certain caves. The investigations showed that in Palaeolithic epochs time-reckoning, in particular the lunar cycle, had been related to the pregnancy of women too (Figure 2a-d). Recently I showed, that in the Magdalenian time (16,000-12,000 BP) man also recognized single and very complex star patterns, including the Milky Way: the Northern Crown in the cave of El Castillo (Spain), the Pleiades in the cave of Lascaux (France) and the main constellations of the sky at the same location. They were used by the Palaeolithic hunter-gatherers for orientation in space and for time-reckoning. These star patterns also played an important role in the cosmovisions of archaic cultures. Together with the depictions of the course of the moon and the sun, they helped to organize the spatiotemporal structure of daily and spiritual life of Palaeolithic man. Now I present a rock panel in the cave of La-T^ete-du-Lion (France) that shows the combination of a star pattern - Aldebaran in the Bull and the Pleiades - with a drawing of the moons cycle above. This picture comes from the Solutrean epoch ca 21,000-22,000 BP. It shows not only a remarkable similarity with the representation in the Lascaux cave, but clearly connects the star pattern with a part of the lunar cycle.

Tunneling in BP-MoS2 heterostructure

Science.gov (United States)

Liu, Xiaochi; Qu, Deshun; Kim, Changsik; Ahmed, Faisal; Yoo, Won Jong

Tunnel field effect transistor (TFET) is considered to be a leading option for achieving SS mV/dec. In this work, black phosphorus (BP) and molybdenum disulfide (MoS2) heterojunction devices are fabricated. We find that thin BP flake and MoS2 form normal p-n junctions, tunneling phenomena can be observed when BP thickness increases to certain level. PEO:CsClO4 is applied on the surface of the device together with a side gate electrode patterned together with source and drain electrodes. The Fermi level of MoS2 on top of BP layer can be modulated by the side gating, and this enables to vary the MoS2-BP tunnel diode property from off-state to on-state. Since tunneling is the working mechanism of MoS2-BP junction, and PEO:CsClO4\\ possesses ultra high dielectric constant and small equivalent oxide thickness (EOT), a low SS of 55 mV/dec is obtained from MoS2-BP TFET. This work was supported by the Global Research Laboratory and Global Frontier R&D Programs at the Center for Hybrid Interface Materials, both funded by the Ministry of Science, ICT & Future Planning via the National Research Foundation of Korea (NRF).

The photosphere of T. Tauri Stars

International Nuclear Information System (INIS)

Calvet, Nuria; Marin, Zaida

1987-01-01

We have calculated the absorption spectrum in the wavelength interval 4880-5025A for a set of models with Teff = 4000K and log g = 3.5 and a chromospheric temperature rise. These models are considered as representative of the atmosphere of T Tauri stars. The position of the temperature minimum goes from 0.1 to 2 gr cm -2 in the models. Populations are in LTE and the two level plus continuum approximation is used for the source function. We have compared the calculated spectra with those observed in the program of rotational velocity determination by Vogel and Kuhi (1981). Differences between the spectrum of T Tauri stars can be understood in first approximation in terms of differences in the position of the temperature minimum. In particular, we find that at the moment of the observation, the minimum in BP Tau was located between 1 and 2 cm -2 and in AA Tau between 0.3 and 0.6 gr cm -2 . (Author)

Amplitude modulation in δ Sct stars: statistics from an ensemble of Kepler targets

Science.gov (United States)

Bowman, Dominic M.; Kurtz, Donald W.; Breger, Michel; Murphy, Simon J.; Holdsworth, Daniel L.

2017-10-01

The results of a search for amplitude modulation of pulsation modes in 983 δ Sct stars, which have effective temperatures between 6400 ⩽ Teff ⩽ 10 000 K in the Kepler Input Catalogue and were continuously observed by the Kepler Space Telescope for 4 yr, are presented. A total of 603 δ Sct stars (61.3 per cent) are found to exhibit at least one pulsation mode that varies significantly in amplitude over 4 yr. Furthermore, it is found that amplitude modulation is not restricted to a specific region within the classical instability strip in the HR diagram, therefore its cause is not necessarily dependent on stellar parameters such as Teff or log g. On the other hand, many δ Sct stars show constant pulsation amplitudes demonstrating that the cause of pulsational non-linearity in these stars is not well understood.

Variations of the high-level Balmer line spectrum of the helium-strong star σ Orionis E

Science.gov (United States)

Smith, M. A.; Bohlender, D. A.

2007-12-01

Using the high-level Balmer lines and continuum, we trace the density structure of two magnetospheric disk segments of the prototypical Bp star σ Orionis E (B2p) as these segments occult portions of the star during the rotational cycle. High-resolution spectra of the Balmer lines ≥H9 and Balmer edge were obtained on seven nights in January-February 2007 at an average sampling of 0.01 cycles. We measured equivalent width variations due to the star occultations by two disk segments 0.4 cycles apart and constructed differential spectra of the migrations of the corresponding absorptions across the Balmer line profiles. We first estimated the rotational and magnetic obliquity angles. We then simulated the observed Balmer jump variation using the model atmosphere codes synspec/circus and evaluated the disk geometry and gas thermodynamics. We find that the two occultations are caused by two disk segments. The first of these transits quickly, indicating that the segment resides in a range of distances, perhaps 2.5-6 R*, from the star. The second consists of a more slowly moving segment situated closer to the surface and causing two semi-resolved absorbing maxima. During its transit this segment brushes across the star's “lower” limb. Judging from the line visibility up to H23-H24 during the occultations, both disk segments have mean densities near 1012 cm-3 and are opaque in the lines and continuum. They have semiheights less than 1/2 R*, and their temperatures are near 10 500 K and 12 000 K, respectively. In all, the disks of Bp stars have a much more complicated geometry than has been anticipated, as evidenced by their (sometimes) non-coplanarity, de-centerness, and from star to star, differences in disk height. Based on observations obtained at the the Dominion Astrophysical Observatory, Herzberg Institute of Astrophysics, National Research Council of Canada.

HR competencies at a merged Higher Education Institution

Directory of Open Access Journals (Sweden)

Cecile M. Schultz

2010-06-01

Research purposes: The aim of this study was to determine the HR competencies at a merged higher education institution. Other objectives were to establish the satisfaction of academics, administrative staff and management regarding the HR competencies and the importance thereof. Motivation for the study: Human resource professionals require assistance by providing HR competencies necessary to add value at a merged higher education institution. Research designs, approaches and methods: A quantitative research design was employed as the research strategy. The questionnaire was based on the literature, the business plan and the HR balanced scorecard report. The target population was 1363 permanent staff on one campus and the response rate was 28%. A principal factor analysis, spider charts and box plots were utilised for data analysis. The results indicated business knowledge, HR practices, personal skills and management skills as the vital HR competencies. Practical implications: Staff were not satisfied with the current HR competencies and consequently this necessitated attention to improve the deficient areas. Contribution: This study shows that limited research was done with regard to HR competencies in the South African higher education backdrop.

BP180 dysfunction triggers spontaneous skin inflammation in mice.

Science.gov (United States)

Zhang, Yang; Hwang, Bin-Jin; Liu, Zhen; Li, Ning; Lough, Kendall; Williams, Scott E; Chen, Jinbo; Burette, Susan W; Diaz, Luis A; Su, Maureen A; Xiao, Shengxiang; Liu, Zhi

2018-06-04

BP180, also known as collagen XVII, is a hemidesmosomal component and plays a key role in maintaining skin dermal/epidermal adhesion. Dysfunction of BP180, either through genetic mutations in junctional epidermolysis bullosa (JEB) or autoantibody insult in bullous pemphigoid (BP), leads to subepidermal blistering accompanied by skin inflammation. However, whether BP180 is involved in skin inflammation remains unknown. To address this question, we generated a BP180-dysfunctional mouse strain and found that mice lacking functional BP180 (termed Δ NC16A ) developed spontaneous skin inflammatory disease, characterized by severe itch, defective skin barrier, infiltrating immune cells, elevated serum IgE levels, and increased expression of thymic stromal lymphopoietin (TSLP). Severe itch is independent of adaptive immunity and histamine, but dependent on increased expression of TSLP by keratinocytes. In addition, a high TSLP expression is detected in BP patients. Our data provide direct evidence showing that BP180 regulates skin inflammation independently of adaptive immunity, and BP180 dysfunction leads to a TSLP-mediated itch. The newly developed mouse strain could be a model for elucidation of disease mechanisms and development of novel therapeutic strategies for skin inflammation and BP180-related skin conditions.

The nature of the nebula associated with the luminous blue variable star WRA 751

OpenAIRE

Hutsemekers, Damien; van Drom, E.

1991-01-01

Narrow-band filter imagery as well as medium to high resolution spectroscopy of the nebula surrounding the luminous blue variable (LBV) star WRA 751 are presented. The nebula appears as a slowly expanding H II region of low excitation characterized by a significant N/O overabundance which may be due to the presence in the nebula of nuclear processed material ejected by the star. With the recent discovery of a nebula around HR Car, all but one known galactic LBVs are now shown to be associated...

BP - bisnis põhjas? / Erik Aru

Index Scriptorium Estoniae

Aru, Erik

2010-01-01

Seoses Mehhiko lahe naftareostusega ootab BP-d kuni 21 mld. dollari suurune trahv, kahjude hüvitamiseks peab BP müüma osa oma varast. Ekspertide hinnangul tähendavad Mehhiko lahe sündmused suuri muutusi kogu naftaäris

Which of Kepler's Stars Flare?

Science.gov (United States)

Kohler, Susanna

2017-12-01

The habitability of distant exoplanets is dependent upon many factors one of which is the activity of their host stars. To learn about which stars are most likely to flare, a recent study examines tens of thousands of stellar flares observed by Kepler.Need for a Broader SampleArtists rendering of a flaring dwarf star. [NASAs Goddard Space Flight Center/S. Wiessinger]Most of our understanding of what causes a star to flare is based on observations of the only star near enough to examine in detail the Sun. But in learning from a sample size of one, a challenge arises: we must determine which conclusions are unique to the Sun (or Sun-like stars), and which apply to other stellar types as well.Based on observations and modeling, astronomers think that stellar flares result from the reconnection of magnetic field lines in a stars outer atmosphere, the corona. The magnetic activity is thought to be driven by a dynamo caused by motions in the stars convective zone.HR diagram of the Kepler stars, with flaring main-sequence (yellow), giant (red) and A-star (green) stars in the authors sample indicated. [Van Doorsselaere et al. 2017]To test whether these ideas are true generally, we need to understand what types of stars exhibit flares, and what stellar properties correlate with flaring activity. A team of scientists led by Tom Van Doorsselaere (KU Leuven, Belgium) has now used an enormous sample of flares observed by Kepler to explore these statistics.Intriguing TrendsVan Doorsselaere and collaborators used a new automated flare detection and characterization algorithm to search through the raw light curves from Quarter 15 of the Kepler mission, building a sample of 16,850 flares on 6,662 stars. They then used these to study the dependence of the flare occurrence rate, duration, energy, and amplitude on the stellar spectral type and rotation period.This large statistical study led the authors to several interesting conclusions, including:Flare star incidence rate as a a

Multivalent display of the antimicrobial peptides BP100 and BP143

Directory of Open Access Journals (Sweden)

Imma Güell

2012-12-01

Full Text Available Carbohydrates are considered as promising templates for the display of multiple copies of antimicrobial peptides. Herein, we describe the design and synthesis of chimeric structures containing two or four copies of the antimicrobial peptides KKLFKKILKYL-NH2 (BP100 and KKLfKKILKYL-NH2 (BP143 attached to the carbohydrate template cyclodithioerythritol (cDTE or α-D-galactopyranoside (Galp. The synthesis involved the preparation of the corresponding peptide aldehyde followed by coupling to an aminooxy-functionalized carbohydrate template. After purification, the multivalent display systems were obtained in high purities (90–98% and in good yields (42–64%. These compounds were tested against plant and human pathogenic bacteria and screened for their cytotoxicity on eukaryotic cells. They showed lower MIC values than the parent peptides against the bacteria analyzed. In particular, the carbopeptides derived from cDTE and Galp, which contained two or four copies of BP100, respectively, were 2- to 8-fold more active than the monomeric peptide against the phytopathogenic bacteria. These results suggest that preassembling antimicrobial peptides to multimeric structures is not always associated with a significant improvement of the activity. In contrast, the carbopeptides synthesized were active against human red blood cells pointing out that peptide preassembly is critical for the hemolytic activity. Notably, peptide preassembly resulted in an enhanced bactericidal effect.

BP report of the business year 1979

Energy Technology Data Exchange (ETDEWEB)

1980-01-01

The paper presents a survey about the development of the energy- and petroleum market during the year 1979. A commentary of the German BP A.G. and its activities is given here: personnel- and management policy, exploration, supply, refining and distribution, investigation, and development. After a survey about the business situation of the German BP A.G. the detailed annual balance sheets of 1979 of the German BP and of the whole enterprise are given.

Face recognition based on improved BP neural network

Directory of Open Access Journals (Sweden)

Yue Gaili

2017-01-01

Full Text Available In order to improve the recognition rate of face recognition, face recognition algorithm based on histogram equalization, PCA and BP neural network is proposed. First, the face image is preprocessed by histogram equalization. Then, the classical PCA algorithm is used to extract the features of the histogram equalization image, and extract the principal component of the image. And then train the BP neural network using the trained training samples. This improved BP neural network weight adjustment method is used to train the network because the conventional BP algorithm has the disadvantages of slow convergence, easy to fall into local minima and training process. Finally, the BP neural network with the test sample input is trained to classify and identify the face images, and the recognition rate is obtained. Through the use of ORL database face image simulation experiment, the analysis results show that the improved BP neural network face recognition method can effectively improve the recognition rate of face recognition.

International Deep Planet Survey, 317 stars to determine the wide-separated planet frequency

Science.gov (United States)

Galicher, R.; Marois, C.; Macintosh, B.; Zuckerman, B.; Song, I.; Barman, T.; Patience, J.

2013-09-01

Since 2000, more than 300 nearby young stars were observed for the International Deep Planet Survey with adaptive optics systems at Gemini (NIRI/NICI), Keck (Nirc2), and VLT (Naco). Massive young AF stars were included in our sample whereas they have generally been neglected in first generation surveys because the contrast and target distances are less favorable to image substellar companions. The most significant discovery of the campaign is the now well-known HR 8799 multi-planet system. This remarkable finding allows, for the first time, an estimate of the Jovians planet population at large separations (further than a few AUs) instead of deriving upper limits. During my presentation, I will present the survey showing images of multiple stars and planets. I will then propose a statistic study of the observed stars deriving constraints on the Jupiter-like planet frequency at large separations.

First results from the LIFE project: discovery of two magnetic hot evolved stars

Science.gov (United States)

Martin, A. J.; Neiner, C.; Oksala, M. E.; Wade, G. A.; Keszthelyi, Z.; Fossati, L.; Marcolino, W.; Mathis, S.; Georgy, C.

2018-04-01

We present the initial results of the Large Impact of magnetic Fields on the Evolution of hot stars (LIFE) project. The focus of this project is the search for magnetic fields in evolved OBA giants and supergiants with visual magnitudes between 4 and 8, with the aim to investigate how the magnetic fields observed in upper main-sequence (MS) stars evolve from the MS until the late post-MS stages. In this paper, we present spectropolarimetric observations of 15 stars observed using the ESPaDOnS instrument of the Canada-France-Hawaii Telescope. For each star, we have determined the fundamental parameters and have used stellar evolution models to calculate their mass, age, and radius. Using the least-squared deconvolution technique, we have produced averaged line profiles for each star. From these profiles, we have measured the longitudinal magnetic field strength and have calculated the detection probability. We report the detection of magnetic fields in two stars of our sample: a weak field of Bl = 1.0 ± 0.2 G is detected in the post-MS A5 star 19 Aur and a stronger field of Bl = -230 ± 10 G is detected in the MS/post-MS B8/9 star HR 3042.

VizieR Online Data Catalog: Li abundances and velocities in F and G stars (Mallik+, 2003)

Science.gov (United States)

Mallik, S. V.; Parthasarathy, M.; Pati, A.

2003-09-01

Lithium abundances have been determined in 127 F and G Pop I stars based on new measurements of the equivalent width of the λ6707Å Li I line from their high resolution CCD spectra. Distances and absolute magnitudes of these stars have been obtained from the Hipparcos Catalogue () and their masses and ages derived, enabling us to investigate the behaviour of lithium as a function of these parameters. Based on their location on the HR diagram superposed on theoretical evolutionary tracks, the sample of the stars has been chosen to ensure that they have more or less completed their Li depletion on the main sequence. (2 data files).

Microdeletion/microduplication of proximal 15q11.2 between BP1 and BP2: a susceptibility region for neurological dysfunction including developmental and language delay.

Science.gov (United States)

Burnside, Rachel D; Pasion, Romela; Mikhail, Fady M; Carroll, Andrew J; Robin, Nathaniel H; Youngs, Erin L; Gadi, Inder K; Keitges, Elizabeth; Jaswaney, Vikram L; Papenhausen, Peter R; Potluri, Venkateswara R; Risheg, Hiba; Rush, Brooke; Smith, Janice L; Schwartz, Stuart; Tepperberg, James H; Butler, Merlin G

2011-10-01

The proximal long arm of chromosome 15 has segmental duplications located at breakpoints BP1-BP5 that mediate the generation of NAHR-related microdeletions and microduplications. The classical Prader-Willi/Angelman syndrome deletion is flanked by either of the proximal BP1 or BP2 breakpoints and the distal BP3 breakpoint. The larger Type I deletions are flanked by BP1 and BP3 in both Prader-Willi and Angelman syndrome subjects. Those with this deletion are reported to have a more severe phenotype than individuals with either Type II deletions (BP2-BP3) or uniparental disomy 15. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes that are not imprinted. Reports of mutations or disturbed expression of these genes appear to impact behavioral and neurological function in affected individuals. Recently, reports of deletions and duplications flanked by BP1 and BP2 suggest an association with speech and motor delays, behavioral problems, seizures, and autism. We present a large cohort of subjects with copy number alteration of BP1 to BP2 with common phenotypic features. These include autism, developmental delay, motor and language delays, and behavioral problems, which were present in both cytogenetic groups. Parental studies demonstrated phenotypically normal carriers in several instances, and mildly affected carriers in others, complicating phenotypic association and/or causality. Possible explanations for these results include reduced penetrance, altered gene dosage on a particular genetic background, or a susceptibility region as reported for other areas of the genome implicated in autism and behavior disturbances.

Profile of NF-κBp(65/NFκBp50) among prostate specific antigen sera levels in prostatic pathologies.

Science.gov (United States)

Bouraoui, Y; Ben Jemaa, A; Rodriguez, G; Ben Rais, N; Fraile, B; Paniagua, R; Sellemi, S; Royuela, M; Oueslati, R

2012-10-01

The aim of this work was to characterise the immunoexpression of NF-κB (p50/p65) in human prostatic pathologies and to study its profiles of activation among sera prostate specific antigen antigen (PSA) according the three groups: 0-4ng/mL, 4-20ng/mL and >20ng/mL. Twenty-four men with benign prostate hyperplasia (BPH); 19 men with prostate cancer (PC) and five men with normal prostates (NP). Immunohistochemical and western blot analysis was performed. Serum levels of PSA were assayed by immulite autoanalyser. In BPH and PC samples, immunoexpressions were observed for NF-κBp65 and NF-κBp50; while in NP samples, only were detected NF-κBp50. PC samples showed immunoreactions to NF-κBp65 and NF-κBp50 more intense (respectively 24.18±0.67 and 28.23±2.01) than that observed in BPH samples (respectively18.46±2.04 and 18.66±1.59) with special localisation in the nucleus. Different profiles of NF-κBp65 immunoexpressions were observed and BPH patients with sera PSA levels between 0-4ng/mL presented a significant weak percentage compared to BPH patients with sera PSA levels between 4-20ng/mL and >20ng/mL. No immunoreactions to NF-κBp65 were observed in PC patients with sera PSA levels between 4-20ng/mL. The sensibility of both NF-κB and PSA to inflammation allowed confirming the relationship between these two molecules and its involvement in prostatic diseases progression (inflammatory and neoplasic). Copyright © 2011 Elsevier Masson SAS. All rights reserved.

Learning and Development Policy available on HR web

CERN Multimedia

2012-01-01

The full text of CERN’s “Learning and Development Policy” is now available in English and French on the HR training website: cern.ch/hr-training/. This new policy was presented to all personnel in the HR Public meeting held on Monday 25 June, and the slides and the video recording remain available on Indico. Pascale Goy, Head of the Learning and Development Group in HR, is available for more information: pascale.goy@cern.ch , tel. 62232.

Absolute Nuv magnitudes of Gaia DR1 astrometric stars and a search for hot companions in nearby systems

Science.gov (United States)

Makarov, V. V.

2017-10-01

Accurate parallaxes from Gaia DR1 (TGAS) are combined with GALEX visual Nuv magnitudes to produce absolute Mnuv magnitudes and an ultraviolet HR diagram for a large sample of astrometric stars. A functional fit is derived of the lower envelope main sequence of the nearest 1403 stars (distance Pleiades, or, most likely, tight interacting binaries of the BY Dra-type. A separate collection of 40 stars with precise trigonometric parallaxes and Nuv-G colors bluer than 2 mag is presented. It includes several known novae, white dwarfs, and binaries with hot subdwarf (sdOB) components, but most remain unexplored.

Rotational and translational distortions of the crystal structure of the Sr2HrRuO6 (Hr = Ho, Dy, Gd, Eu) complex perovskites

International Nuclear Information System (INIS)

Triana, C.A.; Landínez Téllez, D.A.; Roa-Rojas, J.

2013-01-01

Sr 2 HrRuO 6 (Hr = Ho, Dy, Gd, Eu) complex perovskites were synthesized through the high-temperature solid-state reaction method, and their crystal structures were analyzed in detail as a function of the Hr-cation ionic radius. Results of powder XRD pattern measurement and Rietveld analysis of the experimental profiles show that the Sr 2 HrRuO 6 compounds crystallize in a monoclinic distorted perovskite-like structure, P2 1 /n (#14) space group, where the unit cell parameters are related to the primitive unit cell a p by a≈√(2)a p , b≈√(2)a p and c ≈ 2a p . The structures show an alternate distribution of the Ru 5+ (2d: 0.5, 0, 0) and Hr 3+ (2c: 0, 0.5, 0) making up RuO 6 and HrO 6 octahedra alternatively arranged in two interleaving fcc sublattices, where the O(1), O(2), and O(3) ions are localized at the corner of the octahedral, while the Sr 2+ is located at the A-site, occupying the cavities built by the corner-sharing octahedra with Wyckoff position 4e. Due to the existence of mismatched ionic sizes between the ionic radii of the Sr 2 HrRuO 6 compounds, the HrO 6 and RuO 6 octahedra are constrained to tilting around the [111] c , [001] c , and [110] c cubic directions so as to optimize the Sr–O inter-atomic bond lengths, tending to rotate the structure in order to fix the Ru 5+ and Hr 3+ ions on the M′ and M″ sites of the complex perovskites. The cell parameters a, b, and c, the inter-atomic bond angles, the inter-atomic bond lengths, and the tilting angles increase as the Hr-cation ionic radius increases. The mismatch that exists in the Sr 2 HrRuO 6 ionic radius produces a large distortion from the ideal cubic symmetry. The pure perovskite-like phase of Sr 2 HrRuO 6 is thermodynamically and kinetically stable at high temperatures above 1420 K, where it is entirely governed by the average size of the Hr 3+ and Ru 5+ cations. Highlights: ► Crystal structure of Sr 2 HrRuO 6 (Hr = Ho, Dy, Gd, Eu) as a function of Hr ionic radius. ► XRD

Pig StAR: mRNA expression and alternative splicing in testis and Leydig cells, and association analyses with testicular morphology traits.

Science.gov (United States)

Zhang, Yanghai; Cui, Yang; Zhang, Xuelian; Wang, Yimin; Gao, Jiayang; Yu, Ting; Lv, Xiaoyan; Pan, Chuanying

2018-05-31

Steroidogenic acute regulatory protein (StAR), primarily expressed in Leydig cells (LCs) in the mammalian testes, is essential for testosterone biosynthesis and male fertility. However, no previous reports have explored the expression profiles, alternative splicing and genetic variations of StAR gene in pig. The aim of current study was to explore the expression profiles in different tissues and different types of testicular cells (LCs; spermatogonial stem cells, SSCs; Sertoli cells, SCs), to identify different splice variants and their expression levels, as well as to detect the indel polymorphism in pig StAR gene. Expression analysis results revealed that StAR was widely expressed in all tested tissues and the expression level in testis was significantly higher than that in other tissues (P StAR mRNA expression level was significantly higher in LCs than others (P StAR-a, StAR-b and StAR-c, were first found in pig. Further study showed StAR-a was highly expressed in both testis and LCs when compared with other variants (P StAR-a was the primary variant at StAR gene post-transcription and may facilitate the combination and transportation of cholesterol with StAR. In addition, a 5-bp duplicated deletion (NC_010457.5:g.5524-5528 delACTTG) was verified in the porcine StAR gene, which was closely related to male testicular morphology traits (P StAR gene might be a positive allele. Briefly, the current findings suggest that StAR and StAR-a play imperative roles in male fertility and the 5-bp indel can be a potential DNA marker for the marker-assisted selection in boar. Copyright © 2018 Elsevier Inc. All rights reserved.

Global trends and challenges to the HR profession.

OpenAIRE

Prouska, Rea; Cooke, Fang Lee.

2006-01-01

The outsourcing of HR activities is a management strategy that may be adopted in response to a number of pressures that an organization is faced with. It is one aspect of business process outsourcing that is increasingly deployed by firms in order to enhance their organizational competitiveness. HR outsourcing can be defined as ‘placing responsibility for various elements of the HR function with a third-party provider’ (Turnbull, 2002, p.11). In spite of the perceived benefits of HR outsourci...

Interferometric diameters of five evolved intermediate-mass planet-hosting stars measured with PAVO at the CHARA Array

Science.gov (United States)

White, T. R.; Huber, D.; Mann, A. W.; Casagrande, L.; Grunblatt, S. K.; Justesen, A. B.; Silva Aguirre, V.; Bedding, T. R.; Ireland, M. J.; Schaefer, G. H.; Tuthill, P. G.

2018-04-01

Debate over the planet occurrence rates around intermediate-mass stars has hinged on the accurate determination of masses of evolved stars, and has been exacerbated by a paucity of reliable, directly-measured fundamental properties for these stars. We present long-baseline optical interferometry of five evolved intermediate-mass (˜ 1.5 M⊙) planet-hosting stars using the PAVO beam combiner at the CHARA Array, which we combine with bolometric flux measurements and parallaxes to determine their radii and effective temperatures. We measured the radii and effective temperatures of 6 Lyncis (5.12±0.16 R⊙, 4949±58 K), 24 Sextantis (5.49±0.18 R⊙, 4908±65 K), κ Coronae Borealis (4.77±0.07 R⊙, 4870±47 K), HR 6817 (4.45±0.08 R⊙, 5013±59 K), and HR 8641 (4.91±0.12 R⊙, 4950±68 K). We find disagreements of typically 15 % in angular diameter and ˜ 200 K in temperature compared to interferometric measurements in the literature, yet good agreement with spectroscopic and photometric temperatures, concluding that the previous interferometric measurements may have been affected by systematic errors exceeding their formal uncertainties. Modelling based on BaSTI isochrones using various sets of asteroseismic, spectroscopic, and interferometric constraints tends to favour slightly (˜ 15 %) lower masses than generally reported in the literature.

Evolution of massive stars in very young clusters and associations

International Nuclear Information System (INIS)

Stothers, R.B.

1985-01-01

The stellar content of very young galactic clusters and associations with well-determined ages has been analyzed statistically to derive information about stellar evolution at high masses. The adopted approach is semiempirical and uses natural spectroscopic groups of stars on the H-R diagram, together with the stars' apparent magnitudes. Cluster distance moduli are not used. Only the most basic elements of stellar evolution theory are required as input. For stellar aggregates with main-sequence turnups at spectral types between O9 and B2, the following conclusions have emerged: (1) O-type main-sequence stars evolve to a spectral type of B1 during core hydrogen burning; (2) most of the O-type blue stragglers are newly formed massive stars, burning core hydrogen; (3) supergiants lying redward of the turnup, as well as most, or all, of the Wolf-Rayet stars, are burning core helium; (4) Wolf-Rayet stars originally had masses greater than 30--40 M/sub sun/, while known M-type supergiants evolved from star less massive than approx.30 M/sub sun/; (5) phases of evolution following core helium burning are unobservably rapid, presumably on account of copious neutrino emission; and (6) formation of stars of high mass continues vigorously in most young clusters and association for approx.8 x 10 6 yr. The important result concerning the evolutionary status of the supergiants depends only on the total number of these stars and not on how they are distributed between blue and red types; the result, however, may be sensitive to the assumed amount of convective core overshooting. Conclusions in the present work refer chiefly to luminous stars in the mass range 10--40 M/sub sun/, belonging to aggregates in the age range (6--25) x 10 6 yr

Frequency analysis of the 5.65-min oscillations in the rapidly oscillating Ap star HD 134214

International Nuclear Information System (INIS)

Kreidl, T.J.; Kurtz, D.W.

1986-01-01

High-speed photometric observations of HD 134214 obtained during 35 hr of observation in 1985 from Lowell Observatory and the South African Astronomical Observatory are presented. A frequency analysis of these data indicate the presence of only one frequency of oscillation in this star at f 1 = 2.94960 + - 0.00004 mHz. This is the highest frequency which is demonstrably not a harmonic of a lower frequency yet discovered in a rapidly oscillating Ap star. This frequency is above the critical frequency calculated for A star models by previous authors. The phase shift has been calculated for HD 134214 for simultaneous B and V observations obtained on three nights from Lowell Observatory. (author)

Assembly of human C-terminal binding protein (CtBP) into tetramers.

Science.gov (United States)

Bellesis, Andrew G; Jecrois, Anne M; Hayes, Janelle A; Schiffer, Celia A; Royer, William E

2018-06-08

C-terminal binding protein 1 (CtBP1) and CtBP2 are transcriptional coregulators that repress numerous cellular processes, such as apoptosis, by binding transcription factors and recruiting chromatin-remodeling enzymes to gene promoters. The NAD(H)-linked oligomerization of human CtBP is coupled to its co-transcriptional activity, which is implicated in cancer progression. However, the biologically relevant level of CtBP assembly has not been firmly established; nor has the stereochemical arrangement of the subunits above that of a dimer. Here, multi-angle light scattering (MALS) data established the NAD + - and NADH-dependent assembly of CtBP1 and CtBP2 into tetramers. An examination of subunit interactions within CtBP1 and CtBP2 crystal lattices revealed that both share a very similar tetrameric arrangement resulting from assembly of two dimeric pairs, with specific interactions probably being sensitive to NAD(H) binding. Creating a series of mutants of both CtBP1 and CtBP2, we tested the hypothesis that the crystallographically observed interdimer pairing stabilizes the solution tetramer. MALS data confirmed that these mutants disrupt both CtBP1 and CtBP2 tetramers, with the dimer generally remaining intact, providing the first stereochemical models for tetrameric assemblies of CtBP1 and CtBP2. The crystal structure of a subtle destabilizing mutant suggested that small structural perturbations of the hinge region linking the substrate- and NAD-binding domains are sufficient to weaken the CtBP1 tetramer. These results strongly suggest that the tetramer is important in CtBP function, and the series of CtBP mutants reported here can be used to investigate the physiological role of the tetramer. © 2018 Bellesis et al.

Around and beyond 53BP1 Nuclear Bodies.

Science.gov (United States)

Fernandez-Vidal, Anne; Vignard, Julien; Mirey, Gladys

2017-12-05

Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs) are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1), a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.

Around and beyond 53BP1 Nuclear Bodies

Directory of Open Access Journals (Sweden)

Anne Fernandez-Vidal

2017-12-01

Full Text Available Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1, a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.

Resolving the planetesimal belt of HR 8799 with ALMA

Science.gov (United States)

Booth, Mark; Jordán, Andrés; Casassus, Simon; Hales, Antonio S.; Dent, William R. F.; Faramaz, Virginie; Matrà, Luca; Barkats, Denis; Brahm, Rafael; Cuadra, Jorge

2016-07-01

The star HR 8799 hosts one of the largest known debris discs and at least four giant planets. Previous observations have found evidence for a warm belt within the orbits of the planets, a cold planetesimal belt beyond their orbits and a halo of small grains. With the infrared data, it is hard to distinguish the planetesimal belt emission from that of the grains in the halo. With this in mind, the system has been observed with ALMA in band 6 (1.34 mm) using a compact array format. These observations allow the inner edge of the planetesimal belt to be resolved for the first time. A radial distribution of dust grains is fitted to the data using an MCMC method. The disc is best fitted by a broad ring between 145^{+12}_{-12} au and 429^{+37}_{-32} au at an inclination of 40^{+5}_{-6}° and a position angle of 51^{+8}_{-8}°. A disc edge at ˜145 au is too far out to be explained simply by interactions with planet b, requiring either a more complicated dynamical history or an extra planet beyond the orbit of planet b.

Symbiotic star AG Dra

International Nuclear Information System (INIS)

Ipatov, A.P.; Yudin, B.F.; Moskovskij Gosudarstvennyj Univ.

1986-01-01

The results obtained from photometric (in the UBVRJHKLM system) and spectrophotometric (in the range 0.33-0.75 μm) observations of symbiotic star AG Dra are presented. The cool component of this star is a red giant with approximately constant brightness (ΔJ ≤ 0 m .3) classified as K4-K5. This red giant fills it's Roche loble and probably is on the assymptotic giant branch of the HR diagramm. The presence of IR excess in 5 μm associated with radiation of the gaseous envelope with the mass of M≅ 10 -6 M sun have been detected. Observations of AG Dra indicate that growing of the bolometric flux of a hot component is accompanied with decreasing effective temperature. The hot component of the system is probably an accerting red dwarf with the mass M≅ 0.4 M sun and disk accretion of matter of cool star with the rate M >or ∼ 10 -4 M sun year in equatorial region. Increase of accretion rate during the outburst of AG Dra leads to the increase of stellar wind from the red dwarf surface and the decrease of it's effective temperature. The hot component of AG Dra may also be considered as a white Dwarf with luminosity L 3 L sun and R eff >or approx. 0.2 R sun . In this case gravitational energy of accreting matter M > or ∼ 10 -6 M sun / year would be the source of the hot component outbursts. The luminosity between outbursts is determined by energy generation from the burning hydrogen layer source

The barium-to-iron enrichment versus age relation of ancient disc stars

Science.gov (United States)

Fuhrmann, K.; Chini, R.; Kaderhandt, L.; Chen, Z.; Lachaume, R.

2017-11-01

We report an intrinsically precise relation of the barium-to-iron enrichment as a function of age for a local, volume-complete (N = 30) sample of ancient Population II (τ ≥ 12 Gyr) and intermediate-disc stars (τ ≃ 10 Gyr), which suggests a common, r-process-dominated nucleosynthesis site for both elements in the early stages of the Milky Way. Deviants from this empirical relation are to a large extent identified as formerly known or new blue straggler stars. We report in particular the striking case of the Population II star HD 159062, whose barium overabundance is difficult to explain without wind accretion of s-process material from a former asymptotic giant branch (AGB) primary that very likely survived as a white dwarf companion. The weak but significant barium enhancement that we measure for HR 3578 and 104 Tau also suggests that both may be accompanied by faint degenerate companions. If confirmed through precision astrometry or direct imaging observations, this would mean a very efficient method to uncover ancient stellar remnant companions around solar-type stars.

Infrared observations of RS CVn stars

Science.gov (United States)

Berriman, G.; De Campli, W. M.; Werner, M. W.; Hatchett, S. P.

1983-01-01

The paper presents infrared photometry of the RS CVn binary stars AR Lac (1.2-10 microns) and MM Her (1.2-3.5 microns) as they egressed from their primary and secondary eclipses; of the eclipsing systems RS CVn and Z Her at maximum light (1.2-10 microns) and of the non-eclipsing systems UX Ari and HR 1099 (1.2-10 microns). An analysis of these and published V data based on flux ratio diagrams (linear analogues of color-color diagrams) shows that G and K stars supply the infrared light of these systems. In AR Lac, the combined light of a G5-K0 subgiant and either a late F dwarf or an early F subgiant can account for the observed visual and infrared light curves. None of these systems shows infrared emission from circumstellar matter. This result is simply understood: dust grains would not be expected to form in the physical conditions surrounding the subgiant, and the corona and chromosphere (whose properties have been deduced from spectroscopic X-ray observations) should not produce appreciable infrared emission.

Narrow-band radio flares from red dwarf stars

Science.gov (United States)

White, Stephen M.; Kundu, Mukul R.; Jackson, Peter D.

1986-01-01

VLA observations of narrow-band behavior in 20 cm flares from two red dwarf stars, L726 - 8A and AD Leo, are reported. The flare on L726 - 8A was observed at 1415 and 1515 MHz; the flux and the evolution differed significantly at the two frequencies. The flare on AD Leo lasted for 2 hr at 1415 MHz but did not appear at 1515 MHz. The AD Leo flare appears to rule out a source drifting through the stellar corona and is unlikely to be due to plasma emission. In the cyclotron maser model the narrow-band behavior reflects the range of magnetic fields present within the source. The apparent constancy of this field for 2 hr is difficult to understand if magnetic reconnection is the source of energy for the flare. The consistent polarization exhibited by red dwarf flares at 20 cm may be related to stellar activity cycles, and changes in this polarization will permit measuring the length of these cycles.

Evolution of a 30 solar mass star: the interplay of nuclear burning and mass loss

International Nuclear Information System (INIS)

Falk, H.J.; Mitalas, R.

1981-01-01

Evolutionary tracks for a 30 solar mass star with various mass loss rates (MLR) were evolved to core He exhaustion. The 'overluminosity' of mass losing (ML) stars is explained in terms of the well known mass-luminosity (M-L) law. A critical ZAMS MLR above which mass loss leads to evolution to fainter luminosities is derived. Two tracks showed reversals in their direction of evolution across the HR diagram. These have been shown to be a consequence of mass loss dominating over the effects of the shell source. An analytic criterion for this condition has been derived. (Auth.)

Do line managers’ have ‘linking pin’ in HR roles?

Directory of Open Access Journals (Sweden)

Mohamed Ayyub Hassan

2015-01-01

Full Text Available Purpose: The present article aims to identify the possible line managers’ involvement factors in human resource (HR initiatives and its ‘linking pin’ to the HR roles. In this regard, few factors have been considered pertinent to line managers’ involvement factors in HR initiatives which are desire, self-efficacy, and HR support. Whereas, the considered dimensions of HR roles reviewed are strategic partner, change agent, employee champion, and administrative expert. Design/methodology/approach: The paper intends to provide a conceptual review of the past literature in the areas of HR roles and line managers and further justify the proposed conceptual framework that will move this work further. Findings: The review also showed that HR devolution to line managers will boost line managers’ participation and responsibility to practice HR roles at the workplace. Research limitations/implications: The main limitation of this review is no empirical evidence provided by the authors to support the literature of the article. All the provided literature is written based on the findings gained from the previous studies. Practical implications: Line managers’ involvement in HR Initiatives can increase the competency diversity among line manager. This in turn can help the organization to operate at high efficiency. Originality/value: There is a notable lack of research conducted to identify line managers’ involvement in HR. Therefore, this article contributes to the literature on the relationship between line managers and HR roles.

A single inhalation exposure to acrolein desensitizes baroreflex responsiveness in Wistar-Kyoto and Spontaneously Hypertensive rats.

Science.gov (United States)

Arterial baroreflex is one of the body's homeostatic mechanisms that regulate blood pressure (BP) by changing heart rate (HR) and vasoconstriction. Increases in BP reflexively cause HR to decrease, whereas decreases in BP depress the baroreflex and cause HR to rise. As such, baro...

FACILITATING RADICAL FRONT-END INNOVATION THROUGH TARGETED HR PRACTICES

DEFF Research Database (Denmark)

Aagaard, Annabeth

2017-01-01

This study examines how radical front end innovation can be actively facilitated through selected and targeted HR practices and bundles of HR practices. The empirical field is an explorative case study of front end innovation and HR practices in the pharmaceutical industry, with an in-depth case ...

Elevated sensitivity to diet-induced obesity and insulin resistance in mice lacking 4E-BP1 and 4E-BP2.

Science.gov (United States)

Le Bacquer, Olivier; Petroulakis, Emmanuel; Paglialunga, Sabina; Poulin, Francis; Richard, Denis; Cianflone, Katherine; Sonenberg, Nahum

2007-02-01

The most common pathology associated with obesity is insulin resistance, which results in the onset of type 2 diabetes mellitus. Several studies have implicated the mammalian target of rapamycin (mTOR) signaling pathway in obesity. Eukaryotic translation initiation factor 4E-binding (eIF4E-binding) proteins (4E-BPs), which repress translation by binding to eIF4E, are downstream effectors of mTOR. We report that the combined disruption of 4E-BP1 and 4E-BP2 in mice increased their sensitivity to diet-induced obesity. Increased adiposity was explained at least in part by accelerated adipogenesis driven by increased expression of CCAAT/enhancer-binding protein delta (C/EBPdelta), C/EBPalpha, and PPARgamma coupled with reduced energy expenditure, reduced lipolysis, and greater fatty acid reesterification in the adipose tissue of 4E-BP1 and 4E-BP2 double KO mice. Increased insulin resistance in 4E-BP1 and 4E-BP2 double KO mice was associated with increased ribosomal protein S6 kinase (S6K) activity and impairment of Akt signaling in muscle, liver, and adipose tissue. These data clearly demonstrate the role of 4E-BPs as a metabolic brake in the development of obesity and reinforce the idea that deregulated mTOR signaling is associated with the development of the metabolic syndrome.

IUE and Einstein survey of late-type giant and supergiant stars and the dividing line

Science.gov (United States)

Haisch, Bernhard M.; Bookbinder, Jay A.; Maggio, A.; Vaiana, G. S.; Bennett, Jeffrey O.

1990-01-01

Results are presented on an IUE UV survey of 255 late-type G, K, and M stars, complementing the Maggio et al. (1990) Einstein X-ray survey of 380 late-type stars. The large data sample of X-ray and UV detections make it possible to examine the activity relationship between the X-ray and the UV emissions. The results confirm previous finding of a trend involving a steeply-dropping upper envelope of the transition region line fluxes, f(line)/f(V), as the dividing line is approached. This suggests that a sharp decrease in maximum activity accompanies the advancing spectral type, with the dividing line corresponding to this steep gradient region. The results confirm the rotation-activity connection for stars in this region of the H-R diagram.

Air Sampling Data for BP Spill/Deepwater Horizon

Data.gov (United States)

U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

Waste Sampling Data for BP Spill/Deepwater Horizon

Data.gov (United States)

U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

Air Monitoring Data for BP Spill/Deepwater Horizon

Data.gov (United States)

U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

Water Sampling Data for BP Spill/Deepwater Horizon

Data.gov (United States)

U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

Sediment Sampling Data for BP Spill/Deepwater Horizon

Data.gov (United States)

U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

New spectro-photometric characterization of the substellar object HR 2562 B using SPHERE

Science.gov (United States)

Mesa, D.; Baudino, J.-L.; Charnay, B.; D'Orazi, V.; Desidera, S.; Boccaletti, A.; Gratton, R.; Bonnefoy, M.; Delorme, P.; Langlois, M.; Vigan, A.; Zurlo, A.; Maire, A.-L.; Janson, M.; Antichi, J.; Baruffolo, A.; Bruno, P.; Cascone, E.; Chauvin, G.; Claudi, R. U.; De Caprio, V.; Fantinel, D.; Farisato, G.; Feldt, M.; Giro, E.; Hagelberg, J.; Incorvaia, S.; Lagadec, E.; Lagrange, A.-M.; Lazzoni, C.; Lessio, L.; Salasnich, B.; Scuderi, S.; Sissa, E.; Turatto, M.

2018-05-01

Aims: HR 2562 is an F5V star located at 33 pc from the Sun hosting a substellar companion that was discovered using the Gemini planet imager (GPI) instrument. The main objective of the present paper is to provide an extensive characterization of the substellar companion, by deriving its fundamental properties. Methods: We observed HR 2562 with the near-infrared branch composed by the integral field spectrograph (IFS) and the infrared dual band spectrograph (IRDIS) of the spectro-polarimetric high-contrast exoplanet research (SPHERE) instrument at the very large telescope (VLT). During our observations IFS was operating in the Y J band, while IRDIS was observing with the H broadband filter. The data were reduced with the dedicated SPHERE GTO pipeline, which is custom designed for this instrument. On the reduced images, we then applied the post-processing procedures that are specifically prepared to subtract the speckle noise. Results: The companion is clearly detected in both IRDIS and IFS datasets. We obtained photometry in three different spectral bands. The comparison with template spectra allowed us to derive a spectral type of T2-T3 for the companion. Using both evolutionary and atmospheric models we inferred the main physical parameters of the companion obtaining a mass of 32 ± 14 MJup, Teff = 1100 ± 200 K, and log g = 4.75 ± 0.41. Based on observations made with European Southern Observatory (ESO) telescopes at Paranal Observatory in Chile, under program ID 198.C-0209(D).

DEBRIS DISTRIBUTION IN HD 95086—A YOUNG ANALOG OF HR 8799

International Nuclear Information System (INIS)

Su, Kate Y. L.; Smith, Paul S.; Rieke, George H.; Morrison, Sarah; Malhotra, Renu; Balog, Zoltan

2015-01-01

HD 95086 is a young early-type star that hosts (1) a 5 M J planet at the projected distance of 56 AU revealed by direct imaging, and (2) a prominent debris disk. Here we report the detection of 69 μm crystalline olivine feature from the disk using the Spitzer/MIPS-SED data covering 55-95 μm. Due to the low resolution of the MIPS-SED mode, this feature is not spectrally resolved, but is consistent with the emission from crystalline forsterite contributing ∼5% of the total dust mass. We also present detailed analysis of the disk spectral energy distribution and re-analysis of resolved images obtained by Herschel. Our results suggest that the debris structure around HD 95086 consists of a warm (∼175 K) belt, a cold (∼55 K) disk, and an extended disk halo (up to ∼800 AU), and is very similar to that of HR 8799. We compare the properties of the three debris components, and suggest that HD 95086 is a young analog of HR 8799. We further investigate and constrain single-planet, two-planet, three-planet, and four-planet architectures that can account for the observed debris structure and are compatible with dynamical stability constraints. We find that equal-mass four-planet configurations of geometrically spaced orbits, with each planet of mass ∼ 5 M J , could maintain the gap between the warm and cold debris belts, and also be just marginally stable for timescales comparable to the age of the system

DEBRIS DISTRIBUTION IN HD 95086—A YOUNG ANALOG OF HR 8799

Energy Technology Data Exchange (ETDEWEB)

Su, Kate Y. L.; Smith, Paul S.; Rieke, George H. [Steward Observatory, University of Arizona, 933 N Cherry Ave., Tucson, AZ 85721 (United States); Morrison, Sarah; Malhotra, Renu [Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States); Balog, Zoltan, E-mail: ksu@as.arizona.edu [Max-Planck-Institut für Astronomie, Königstuhl 17 D-69117, Heidelberg (Germany)

2015-02-01

HD 95086 is a young early-type star that hosts (1) a 5 M{sub J} planet at the projected distance of 56 AU revealed by direct imaging, and (2) a prominent debris disk. Here we report the detection of 69 μm crystalline olivine feature from the disk using the Spitzer/MIPS-SED data covering 55-95 μm. Due to the low resolution of the MIPS-SED mode, this feature is not spectrally resolved, but is consistent with the emission from crystalline forsterite contributing ∼5% of the total dust mass. We also present detailed analysis of the disk spectral energy distribution and re-analysis of resolved images obtained by Herschel. Our results suggest that the debris structure around HD 95086 consists of a warm (∼175 K) belt, a cold (∼55 K) disk, and an extended disk halo (up to ∼800 AU), and is very similar to that of HR 8799. We compare the properties of the three debris components, and suggest that HD 95086 is a young analog of HR 8799. We further investigate and constrain single-planet, two-planet, three-planet, and four-planet architectures that can account for the observed debris structure and are compatible with dynamical stability constraints. We find that equal-mass four-planet configurations of geometrically spaced orbits, with each planet of mass ∼ 5 M{sub J} , could maintain the gap between the warm and cold debris belts, and also be just marginally stable for timescales comparable to the age of the system.

CacyBP/SIP promotes the proliferation of colon cancer cells.

Directory of Open Access Journals (Sweden)

Huihong Zhai

Full Text Available CacyBP/SIP is a component of the ubiquitin pathway and is overexpressed in several transformed tumor tissues, including colon cancer, which is one of the most common cancers worldwide. It is unknown whether CacyBP/SIP promotes the proliferation of colon cancer cells. This study examined the expression level, subcellular localization, and binding activity of CacyBP/SIP in human colon cancer cells in the presence and absence of the hormone gastrin. We found that CacyBP/SIP was expressed in a high percentage of colon cancer cells, but not in normal colonic surface epithelium. CacyBP/SIP promoted the cell proliferation of colon cancer cells under both basal and gastrin stimulated conditions as shown by knockdown studies. Gastrin stimulation triggered the translocation of CacyBP/SIP to the nucleus, and enhanced interaction between CacyBP/SIP and SKP1, a key component of ubiquitination pathway which further mediated the proteasome-dependent degradation of p27kip1 protein. The gastrin induced reduction in p27kip1 was prevented when cells were treated with the proteasome inhibitor MG132. These results suggest that CacyBP/SIP may be promoting growth of colon cancer cells by enhancing ubiquitin-mediated degradation of p27kip1.

Studies on the intracellular localization of hHR23B

International Nuclear Information System (INIS)

Katiyar, Samiksha; Lennarz, William J.

2005-01-01

Yeast Rad23, originally identified as a DNA repair protein, has been proposed to participate in other cellular functions, i.e., the proteasome-degradation pathway, the process of spindle pole body duplication and as a component of the anaphase checkpoint. Two human homologs of yeast Rad23, hHR23A and hHR23B, exhibit high sequence homology with yRad23 and also have been shown to be involved in DNA repair and proteasome-dependent degradation. Previous studies on the intracellular localization of hHR23A and hHR23B revealed their predominant localization in the nucleus during interphase and in the cytoplasm during mitosis. We have analyzed the localization of hHR23B during all the phases of the cell cycle using immunofluorescence. Unlike previous studies, our results suggest localization of hHR23B in the nucleus as well as in the cytoplasm during G1 phase. The nuclear levels of hHR23B decrease during S-phase of the cell cycle. When the cell enters mitosis, hHR23B relocalizes in the cytoplasm without association with chromatin. These results indicate that the intracellular distribution hHR23B is cell cycle dependent

Rotational and translational distortions of the crystal structure of the Sr{sub 2}HrRuO{sub 6} (Hr = Ho, Dy, Gd, Eu) complex perovskites

Energy Technology Data Exchange (ETDEWEB)

Triana, C.A., E-mail: ctrianae@unal.edu.co [Grupo de Física de Nuevos Materiales, Departamento de Física, Universidad Nacional de Colombia, A.A. 5997, Bogotá D.C. (Colombia); Landínez Téllez, D.A. [Grupo de Física de Nuevos Materiales, Departamento de Física, Universidad Nacional de Colombia, A.A. 5997, Bogotá D.C. (Colombia); Roa-Rojas, J., E-mail: jroar@unal.edu.co [Grupo de Física de Nuevos Materiales, Departamento de Física, Universidad Nacional de Colombia, A.A. 5997, Bogotá D.C. (Colombia)

2013-05-15

Sr{sub 2}HrRuO{sub 6} (Hr = Ho, Dy, Gd, Eu) complex perovskites were synthesized through the high-temperature solid-state reaction method, and their crystal structures were analyzed in detail as a function of the Hr-cation ionic radius. Results of powder XRD pattern measurement and Rietveld analysis of the experimental profiles show that the Sr{sub 2}HrRuO{sub 6} compounds crystallize in a monoclinic distorted perovskite-like structure, P2{sub 1}/n (#14) space group, where the unit cell parameters are related to the primitive unit cell a{sub p} by a≈√(2)a{sub p}, b≈√(2)a{sub p} and c ≈ 2a{sub p}. The structures show an alternate distribution of the Ru{sup 5+} (2d: 0.5, 0, 0) and Hr{sup 3+} (2c: 0, 0.5, 0) making up RuO{sub 6} and HrO{sub 6} octahedra alternatively arranged in two interleaving fcc sublattices, where the O(1), O(2), and O(3) ions are localized at the corner of the octahedral, while the Sr{sup 2+} is located at the A-site, occupying the cavities built by the corner-sharing octahedra with Wyckoff position 4e. Due to the existence of mismatched ionic sizes between the ionic radii of the Sr{sub 2}HrRuO{sub 6} compounds, the HrO{sub 6} and RuO{sub 6} octahedra are constrained to tilting around the [111]{sub c}, [001]{sub c}, and [110]{sub c} cubic directions so as to optimize the Sr–O inter-atomic bond lengths, tending to rotate the structure in order to fix the Ru{sup 5+} and Hr{sup 3+} ions on the M′ and M″ sites of the complex perovskites. The cell parameters a, b, and c, the inter-atomic bond angles, the inter-atomic bond lengths, and the tilting angles increase as the Hr-cation ionic radius increases. The mismatch that exists in the Sr{sub 2}HrRuO{sub 6} ionic radius produces a large distortion from the ideal cubic symmetry. The pure perovskite-like phase of Sr{sub 2}HrRuO{sub 6} is thermodynamically and kinetically stable at high temperatures above 1420 K, where it is entirely governed by the average size of the Hr{sup 3+} and Ru

FG Sagittae, a test of the theory of evolution of double shell source stars

International Nuclear Information System (INIS)

Fadeyev, Yu.A.

1984-01-01

FG Sge is a unique stellar object possessing a number of unusual properties which are as follows: (1) FG Sge is a core of a planetary nebula, (2) at least since 1894 this star has crossed the HR diagram from the left to the right, (3) the atmosphere of FG Sge was enriched in s-elements, (4) FG Sge is a pulsating variable the period of which progressively increases from 15 days in 1962 to 110 days in 1980. The author estimates the distance and age of FG Sge from the hypothesis that it moves in the HR diagram along the horizontal loop due to a helium shell flash in its interior. (Auth.)

MIGRATION OF ORACLE HR DATABASE

CERN Multimedia

ais.support@cern.ch

2001-01-01

Restricted services from 3 to 7 November 2001 Due to the migration of the Oracle HR application to the Web, some services which rely on the application's availability may be disturbed from Friday 2 November at 17:30 until Thursday 8 November at 08:30. Amongst those services: HR Division: records office, recruitment, claims and benefits. FI Division: personnel accounting, advances and claims. ST Division: registration office (access cards). SPL Division: external firm staff records. EP Division: users' office. Experiments' secretariats: PIE, Greybook. Divisional secretariats: externals, internal addresses. All information concerning this migration is available at: http://ais.cern.ch We apologize for any inconvenience and thank you in advance for your understanding.

76 FR 69712 - Application To Export Electric Energy; BP Energy Company

Science.gov (United States)

2011-11-09

... DEPARTMENT OF ENERGY [OE Docket No. EA-315-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... BP Energy to transmit electric energy from the United States to Canada as a power marketer for a five...

A search for β Cephei variable stars in the Magellanic Clouds: motivation and first results for the LMC

International Nuclear Information System (INIS)

Sterken, C.; Jerzykiewicz, M.

1988-01-01

Motivation for starting a programme of detecting and investigating β Cephei variables in the Magellanic Clouds is given. Differential photoelectric observations are then reported of six LMC stars which fall in the instability strip defined by the galactic β Cephei variables. Three programme stars are found to exhibit short-term brightness variations. One of them, showing a sinusoidal light-curve with an amplitude (half-range) equal to 0.0070 ± 0.0011 mag and a period equal to about 5 hr, is a promising β Cephei candidate. In the case of the other two variable programme stars, the interpretation of the results is less straightforward. The remaining three programme stars are shown to be constant on a short time-scale, two to within ± 0.010 mag, and one to within ± 0.005 magn. (author)

PLEIADES-HR INNOVATIVE TECHNIQUES FOR GEOMETRIC IMAGE QUALITY COMMISSIONING

Directory of Open Access Journals (Sweden)

D. Greslou

2012-07-01

Full Text Available Since the beginning of 2012, the first Pleiades-HR satellite of the program conducted by the French National Space Agency, CNES, delivers 20 km wide color scenes with a 70 cm ground sampling distance. A second satellite should be launched in 2013 which will achieve an almost world-wide coverage with a revisit interval of 24h. The assessment of the image quality and the calibration operation have been performed by CNES Image Quality team during the 6 month commissioning phase that followed the satellite launch. The geometric commissioning activities consist in improve the geometric quality of the images in order to meet very demanding specifications as localization accuracy, local coherence, dynamic stability, length alteration … This goal has been achieved through the implementation of new methods of calibration and performance assessment. Some of these methods are based on the exploitation of very specific satellite acquisitions that have been achieved thanks to the amazing agility of the Pleiades satellite. Thus, many stars acquisitions and very slow earth pictures have been processed to characterize dynamic phenomena. Similarly, “along-cross track” pairs have been exploited to improve the accuracy of the focal plane description. This paper deals with these new methods. It describes their accuracy and their operational interests.

NEW PRECISION ORBITS OF BRIGHT DOUBLE-LINED SPECTROSCOPIC BINARIES. IV. 66 ANDROMEDAE, HR 6979, AND HR 9059

International Nuclear Information System (INIS)

Fekel, Francis C.; Williamson, Michael H.; Tomkin, Jocelyn

2010-01-01

We have determined improved spectroscopic orbits for three double-lined binaries, 66 And (F4 V), HR 6979 (Am), and HR 9059 (F5 IV) using radial velocities from the 2.1 m telescope at McDonald Observatory, the coude feed telescope at Kitt Peak National Observatory, and 2 m telescope at Fairborn Observatory. The orbital periods range from 11.0 to 14.3 days, and all three systems have eccentric orbits. The new orbital dimensions (a 1 sin i and a 2 sin i) and minimum masses (m 1 sin 3 i and m 2 sin 3 i) have accuracies of 0.2% or better. All six components of the three binary systems are rotating more slowly than their predicted pseudosynchronous rotational velocities. Hipparcos photometry of HR 9059 shows that this system has partial eclipses. Its components are nearly identical in mass and are at the very end of their main-sequence lifetimes or perhaps have just begun to traverse the Hertsprung gap.

THE IMPACT OF HR MANAGERS’ ROLES ON IMPLEMENTING BEST HR PRACTICES AND ATTRACTING AND RETAINING BEST EMPLOYEES

Directory of Open Access Journals (Sweden)

Nicoleta Valentina FLOREA

2014-10-01

Full Text Available Today’s organizations are facing new challenges, which require them to make effective decisions in order to solve complex issues. These decisions are generally made at higher levels in the organization’s hierarchical structure, where managers maintain power and control to influence organizational goals, including the behaviors and the attitudes of their subordinates. In this article we will show the importance of having effective managers, especially in HR, who can positively influence attracting intellectual capital and acquire knowledge management, by increasing employees motivation, job satisfaction, performance, and organizational commitment, in order to achieve high levels of productivity and efficiency. Also, we will evaluate the HR managers’ roles in order to obtain performance by managing, controlling, evaluating, analyzing, auditing, forecasting, and integrating effectively knowledge management and intellectual capital in organizations. Our study is made in large organizations from Dambovita County, Romania, and it demonstrates that employees need excellent HR managers to obtain the best from them and to face a changing environment.

BP1 Homeoprotein Enhances Metastatic Potential in ER-negative Breast Cancer

Science.gov (United States)

Fu, Yebo; Lian, Yi; Kim, Kyung Soon; Zhang, Lei; Hindle, A. Katharine; Brody, Fred; Siegel, Robert S.; McCaffrey, Timothy A.; Fu, Sidney W.

2010-01-01

Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER-) tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. We sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target for ER- breast cancer. PMID:20842225

4E-BP1 regulates the differentiation of white adipose tissue.

Science.gov (United States)

Tsukiyama-Kohara, Kyoko; Katsume, Asao; Kimura, Kazuhiro; Saito, Masayuki; Kohara, Michinori

2013-07-01

4E Binding protein 1 (4E-BP1) suppresses translation initiation. The absence of 4E-BP1 drastically reduces the amount of adipose tissue in mice. To address the role of 4E-BP1 in adipocyte differentiation, we characterized 4E-BP1(-/-) mice in this study. The lack of 4E-BP1 decreased the amount of white adipose tissue and increased the amount of brown adipose tissue. In 4E-BP1(-/-) MEF cells, PPARγ coactivator 1 alpha (PGC-1α) expression increased and exogenous 4E-BP1 expression suppressed PGC-1α expression. The level of 4E-BP1 expression was higher in white adipocytes than in brown adipocytes and showed significantly greater up-regulation in white adipocytes than in brown adipocytes during preadipocyte differentiation into mature adipocytes. The amount of PGC-1α was consistently higher in HB cells (a brown preadipocyte cell line) than in HW cells (a white preadipocyte cell line) during differentiation. Moreover, the ectopic over-expression of 4E-BP1 suppressed PGC-1α expression in white adipocytes, but not in brown adipocytes. Thus, the results of our study indicate that 4E-BP1 may suppress brown adipocyte differentiation and PGC-1α expression in white adipose tissues. © 2013 The Authors Genes to Cells © 2013 by the Molecular Biology Society of Japan and Wiley Publishing Asia Pty Ltd.

A NuSTAR Observation of the Gamma-Ray Emitting Millisecond Pulsar PSR J1723–2837

Energy Technology Data Exchange (ETDEWEB)

Kong, A. K. H. [Institute of Astronomy and Department of Physics, National Tsing Hua University, Hsinchu 30013, Taiwan (China); Hui, C. Y. [Department of Astronomy and Space Science, Chungnam National University, Daejeon (Korea, Republic of); Takata, J. [Institute of Particle Physics and Astronomy, Huazhong University of Science and Technology (China); Li, K. L. [Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States); Tam, P. H. T., E-mail: akong@phys.nthu.edu.tw, E-mail: cyhui@cnu.ac.kr [School of Physics and Astronomy, Sun Yat-sen University, Zhuhai 519082 (China)

2017-04-20

We report on the first NuSTAR observation of the gamma-ray emitting millisecond pulsar binary PSR J1723–2837. X-ray radiation up to 79 keV is clearly detected, and the simultaneous NuSTAR and Swift spectrum is well described by an absorbed power law with a photon index of ∼1.3. We also find X-ray modulations in the 3–10, 10–20, 20–79, and 3–79 keV bands at the 14.8 hr binary orbital period. All of these are entirely consistent with previous X-ray observations below 10 keV. This new hard X-ray observation of PSR J1723–2837 provides strong evidence that the X-rays are from the intrabinary shock via an interaction between the pulsar wind and the outflow from the companion star. We discuss how the NuSTAR observation constrains the physical parameters of the intrabinary shock model.

Evolving R Coronae Borealis Stars with MESA

Science.gov (United States)

Clayton, Geoffrey C.; Lauer, Amber; Chatzopoulos, Emmanouil; Frank, Juhan

2018-01-01

R Coronae Borealis (RCB) stars form a small class of cool, carbon-rich supergiants that have almost no hydrogen. They undergo extreme, irregular declines in brightness of up to 8 magnitudes due to the formation of thick clouds of carbon dust. Two scenarios have been proposed for the origin of an RCB star: the merger of a CO/He white dwarf (WD) binary and a final helium-shell flash. We are using a combination of 3D hydrodynamics codes and the 1D MESA (Modules for Experiments in Stellar Astrophysics) stellar evolution code including nucleosynthesis to construct post-merger spherical models based on realistic merger progenitor models and on our hydrodynamical simulations, and then following the evolution into the region of the HR diagram where RCB stars are located. We are investigating nucleosynthesis in the dynamically accreting material of CO/He WD mergers which may provide a suitable environment for significant production of 18O and the very low 16O/18O values observed.Our MESA modeling consists of two steps: first mimicking the WD merger event using two different techniques, (a) by choosing a very high mass accretion rate with appropriate abundances and (b) by applying "stellar engineering" to an initial CO WD model to account for the newly merged material by applying an entropy adjusting procedure. Second, we follow the post-merger evolution using a large nuclear reaction network including the effects of convective and rotational instabilities to the mixing of material in order to match the observed RCB abundances. MESA follows the evolution of the merger product as it expands and cools to become an RCB star. We then examine the surface abundances and compare them to the observed RCB abundances. We also investigate how long fusion continues in the He shell near the core and how this processed material is mixed up to the surface of the star. We then model the later evolution of RCB stars to determine their likely lifetimes and endpoints when they have returned to

Daphnia HR96 is a promiscuous xenobiotic and endobiotic nuclear receptor

International Nuclear Information System (INIS)

Karimullina, Elina; Li Yangchun; Ginjupalli, Gautam K.; Baldwin, William S.

2012-01-01

Daphnia pulex is the first crustacean to have its genome sequenced. The genome project provides new insight and data into how an aquatic crustacean may respond to environmental stressors, including toxicants. We cloned Daphnia pulex HR96 (DappuHR96), a nuclear receptor orthologous to the CAR/PXR/VDR group of nuclear receptors. In Drosophila melanogaster, (hormone receptor 96) HR96 responds to phenobarbital exposure and has been hypothesized as a toxicant receptor. Therefore, we set up a transactivation assay to test whether DappuHR96 is a promiscuous receptor activated by xenobiotics and endobiotics similar to the constitutive androstane receptor (CAR) and the pregnane X-receptor (PXR). Transactivation assays performed with a GAL4-HR96 chimera demonstrate that HR96 is a promiscuous toxicant receptor activated by a diverse set of chemicals such as pesticides, hormones, and fatty acids. Several environmental toxicants activate HR96 including estradiol, pyriproxyfen, chlorpyrifos, atrazine, and methane arsonate. We also observed repression of HR96 activity by chemicals such as triclosan, androstanol, and fluoxetine. Nearly 50% of the chemicals tested activated or inhibited HR96. Interestingly, unsaturated fatty acids were common activators or inhibitors of HR96 activity, indicating a link between diet and toxicant response. The omega-6 and omega-9 unsaturated fatty acids linoleic and oleic acid activated HR96, but the omega-3 unsaturated fatty acids alpha-linolenic acid and docosahexaenoic acid inhibited HR96, suggesting that these two distinct sets of lipids perform opposing roles in Daphnia physiology. This also provides a putative mechanism by which the ratio of dietary unsaturated fats may affect the ability of an organism to respond to a toxic insult. In summary, HR96 is a promiscuous nuclear receptor activated by numerous endo- and xenobiotics.

Daphnia HR96 is a promiscuous xenobiotic and endobiotic nuclear receptor

Energy Technology Data Exchange (ETDEWEB)

Karimullina, Elina [Environmental Toxicology Program, Clemson University, Clemson, SC 29634 (United States); Institute of Plant and Animal Ecology, Russian Academy of Sciences, Ural Branch, Yekaterinburg 620144 (Russian Federation); Li Yangchun; Ginjupalli, Gautam K. [Environmental Toxicology Program, Clemson University, Clemson, SC 29634 (United States); Baldwin, William S., E-mail: baldwin@clemson.edu [Environmental Toxicology Program, Clemson University, Clemson, SC 29634 (United States); Biological Sciences, Clemson University, Clemson, SC (United States)

2012-07-15

Daphnia pulex is the first crustacean to have its genome sequenced. The genome project provides new insight and data into how an aquatic crustacean may respond to environmental stressors, including toxicants. We cloned Daphnia pulex HR96 (DappuHR96), a nuclear receptor orthologous to the CAR/PXR/VDR group of nuclear receptors. In Drosophila melanogaster, (hormone receptor 96) HR96 responds to phenobarbital exposure and has been hypothesized as a toxicant receptor. Therefore, we set up a transactivation assay to test whether DappuHR96 is a promiscuous receptor activated by xenobiotics and endobiotics similar to the constitutive androstane receptor (CAR) and the pregnane X-receptor (PXR). Transactivation assays performed with a GAL4-HR96 chimera demonstrate that HR96 is a promiscuous toxicant receptor activated by a diverse set of chemicals such as pesticides, hormones, and fatty acids. Several environmental toxicants activate HR96 including estradiol, pyriproxyfen, chlorpyrifos, atrazine, and methane arsonate. We also observed repression of HR96 activity by chemicals such as triclosan, androstanol, and fluoxetine. Nearly 50% of the chemicals tested activated or inhibited HR96. Interestingly, unsaturated fatty acids were common activators or inhibitors of HR96 activity, indicating a link between diet and toxicant response. The omega-6 and omega-9 unsaturated fatty acids linoleic and oleic acid activated HR96, but the omega-3 unsaturated fatty acids alpha-linolenic acid and docosahexaenoic acid inhibited HR96, suggesting that these two distinct sets of lipids perform opposing roles in Daphnia physiology. This also provides a putative mechanism by which the ratio of dietary unsaturated fats may affect the ability of an organism to respond to a toxic insult. In summary, HR96 is a promiscuous nuclear receptor activated by numerous endo- and xenobiotics.

DETECTION OF THE CENTRAL STAR OF THE PLANETARY NEBULA NGC 6302

International Nuclear Information System (INIS)

Szyszka, C.; Walsh, J. R.; Zijlstra, Albert A.; Tsamis, Y. G.

2009-01-01

NGC 6302 is one of the highest ionization planetary nebulae (PNe) known and shows emission from species with ionization potential > 300 eV. The temperature of the central star must be > 200,000 K to photoionize the nebula, and has been suggested to be up to ∼400,000 K. On account of the dense dust and molecular disk, the central star has not convincingly been directly imaged until now. NGC 6302 was imaged in six narrowband filters by Wide Field Camera 3 on the Hubble Space Telescope as part of the Servicing Mission 4 Early Release Observations. The central star is directly detected for the first time, and is situated at the nebula center on the foreground side of the tilted equatorial disk. The magnitudes of the central star have been reliably measured in two filters (F469N and F673N). Assuming a hot blackbody, the reddening has been measured from the (4688-6766 A) color and a value of c = 3.1, A v = 6.6 mag determined. A G-K main-sequence binary companion can be excluded. The position of the star on the H-R diagram suggests a fairly massive PN central star of about 0.64 M sun close to the white dwarf cooling track. A fit to the evolutionary tracks for (T, L, t) = (200,000 K, 2000 L sun , 2200 yr), where t is the nebular age, is obtained; however, the luminosity and temperature remain uncertain. The model tracks predict that the star is rapidly evolving, and fading at a rate of almost 1% per year. Future observations could test this prediction.

BP1 Homeoprotein Enhances Metastatic Potential in Er-Negative Breast Cancer

Directory of Open Access Journals (Sweden)

Yebo Fu, Yi Lian, Kyung Soon Kim, Lei Zhang, A. Katharine Hindle, Fred Brody, Robert S. Siegel, Timothy A. McCaffrey, Sidney W. Fu

2010-01-01

Full Text Available Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER- tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. I sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p<0.005, and enhanced the in vitro invasive activity by 25-65 fold (p<0.001. Microarray experiments were performed to identify differentially expressed genes when BP1 is overexpressed. The gene expression profile of the transfected cell lines were compared, resulting in 71 differentially expressed genes with a fold-change of >=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target.

The Link between HR Attributions and Employees’ Turnover Intentions

Directory of Open Access Journals (Sweden)

Juliana Caesaria Tandung

2016-02-01

Full Text Available Human Resources Management (HRM is part of the organizational functions that contribute to the effectiveness of a firm’s performance, and brings an organization a competitive advantage through the implementation of its Human Resources (HR practices. HR practices adopted by management are perceived or attributed subjectively by individual employees, and can in turn affect the employees’ attitudes and behavior (e.g. Job satisfaction and turnover intention. The purpose of this study is to contribute to the process-based approach by investigating the effect of HR attributions on turnover intentions, with job satisfaction playing a mediating role. The analysis is on the individual level, with 454 respondents from various organizations within the Netherlands. The results show that HR attributions can affect the turnover intention, through the presence of job satisfaction. Thus, it can be said that it is important to always consider the employees’ attitudes and behavior when examining their perception of HR practices, and in predicting their intention to leave.

Neutron Stars and NuSTAR

Science.gov (United States)

Bhalerao, Varun

2012-05-01

My thesis centers around the study of neutron stars, especially those in massive binary systems. To this end, it has two distinct components: the observational study of neutron stars in massive binaries with a goal of measuring neutron star masses and participation in NuSTAR, the first imaging hard X-ray mission, one that is extremely well suited to the study of massive binaries and compact objects in our Galaxy. The Nuclear Spectroscopic Telescope Array (NuSTAR) is a NASA Small Explorer mission that will carry the first focusing high energy X-ray telescope to orbit. NuSTAR has an order-of-magnitude better angular resolution and has two orders of magnitude higher sensitivity than any currently orbiting hard X-ray telescope. I worked to develop, calibrate, and test CdZnTe detectors for NuSTAR. I describe the CdZnTe detectors in comprehensive detail here - from readout procedures to data analysis. Detailed calibration of detectors is necessary for analyzing astrophysical source data obtained by the NuSTAR. I discuss the design and implementation of an automated setup for calibrating flight detectors, followed by calibration procedures and results. Neutron stars are an excellent probe of fundamental physics. The maximum mass of a neutron star can put stringent constraints on the equation of state of matter at extreme pressures and densities. From an astrophysical perspective, there are several open questions in our understanding of neutron stars. What are the birth masses of neutron stars? How do they change in binary evolution? Are there multiple mechanisms for the formation of neutron stars? Measuring masses of neutron stars helps answer these questions. Neutron stars in high-mass X-ray binaries have masses close to their birth mass, providing an opportunity to disentangle the role of "nature" and "nurture" in the observed mass distributions. In 2006, masses had been measured for only six such objects, but this small sample showed the greatest diversity in masses

X-ray emission on hybird stars: ROSAT observations of alpha Trianguli Australis and iota Aurigae

Science.gov (United States)

Kashyap, V.; Rosner, R.; Harnden, F. R., Jr.; Maggio, A.; Micela, G.; Sciortino, S.

1994-01-01

We report on deep ROSAT observations of two Hybrid atmosphere stars, alpha TrA and iota Aur, and our analysis of these observations. We detect high-energy transient phenomena on alpha TrA and consider the implications of this discovery to the atmospheres of Hybrid stars. We detect iota Aur in the high-energy passband of ROSAT, implying the existence of multimillion degree plasma on the star. Our major results include the following: discovery of two large flare events, detected during pointed observations of alpha TrA; the demonstration that the flare emission most likely comes from the giant itself, rather than from a previously unseen low-mass companion star; the demonstration that the plasma characteristics associated with the flares and with the 'quiescent' component are essentially indistinguishable; and that the geometric dimensions of the emitting plasma are considerably smaller than the critical dimension characterizing stable 'hot' coronal loop structures. Our results suggest that alpha TrA does not have any steady X-ray emission consistent with theoretical expectations, and support the argument that Hybrid stars constitute a transitional type of object in which large-scale magnetic dynamo activity ceases, and the dominant spatial scales characterizing coronal structure rapidly decline as such stars evolve across the X-ray 'Dividing Line' in the H-R diagram.

Molecular characterization of genes of Pseudomonas sp. strain HR199 involved in bioconversion of vanillin to protocatechuate.

Science.gov (United States)

Priefert, H; Rabenhorst, J; Steinbüchel, A

1997-01-01

The gene loci vdh, vanA, and vanB, which are involved in the bioconversion of vanillin to protocatechuate by Pseudomonas sp. strain HR199 (DSM 7063), were identified as the structural genes of a novel vanillin dehydrogenase (vdh) and the two subunits of a vanillate demethylase (vanA and vanB), respectively. These genes were localized on an EcoRI fragment (E230), which was cloned from a Pseudomonas sp. strain HR199 genomic library in the cosmid pVK100. The vdh gene was identified on a subfragment (HE35) of E230, and the vanA and vanB genes were localized on a different subfragment (H110) of E230. The nucleotide sequences of fragment HE35 and part of fragment H110 were determined, revealing open reading frames of 1062, 951, and 1446 bp, representing vanA, vanB, and vdh, respectively. The vdh gene was organized in one operon together with a fourth open reading frame (ORF2), of 735 bp, which was located upstream of vdh. The deduced amino acid sequences of vanA and vanB exhibited 78.8 and 62.1% amino acid identity, respectively, to the corresponding gene products from Pseudomonas sp. strain ATCC 19151 (F. Brunel and J. Davison, J. Bacteriol. 170:4924-4930, 1988). The deduced amino acid sequence of the vdh gene exhibited up to 35.3% amino acid identity to aldehyde dehydrogenases from different sources. The deduced amino acid sequence of ORF2 exhibited up to 28.4% amino acid identity to those of enoyl coenzyme A hydratases. Escherichia coli strains harboring fragment E230 cloned in pBluescript SK- converted vanillin to protocatechuate via vanillate, indicating the functional expression of vdh, vanA, and vanB in E. coli. High expression of vdh in E. coli was achieved with HE35 cloned in pBluescript SK-. The resulting recombinant strains converted vanillin to vanillate at a rate of up to 0.3 micromol per min per ml of culture. Transfer of vanA, vanB, and vdh to Alcaligenes eutrophus and to different Pseudomonas strains, which were unable to utilize vanillin or vanillate as

BP/Mobil. Joint-venture directions for use

International Nuclear Information System (INIS)

Anon.

1997-01-01

This paper analyzes the economical reasons which have led BP and Mobil companies to join their forces in 1996. Thanks to their complementarity and to their European implantation, the two companies could win the first or second position in petroleum products marketing in 8 European countries. The cumulated petrol sales and the number of petrol stations of the BP/Mobil joint venture are the highest in Europe (800 petrol stations in France). (J.S.)

Narrow-band radio flares from red dwarf stars

Energy Technology Data Exchange (ETDEWEB)

White, S.M.; Kundu, M.R.; Jackson, P.D.

1986-12-01

VLA observations of narrow-band behavior in 20 cm flares from two red dwarf stars, L726 - 8A and AD Leo, are reported. The flare on L726 - 8A was observed at 1415 and 1515 MHz; the flux and the evolution differed significantly at the two frequencies. The flare on AD Leo lasted for 2 hr at 1415 MHz but did not appear at 1515 MHz. The AD Leo flare appears to rule out a source drifting through the stellar corona and is unlikely to be due to plasma emission. In the cyclotron maser model the narrow-band behavior reflects the range of magnetic fields present within the source. The apparent constancy of this field for 2 hr is difficult to understand if magnetic reconnection is the source of energy for the flare. The consistent polarization exhibited by red dwarf flares at 20 cm may be related to stellar activity cycles, and changes in this polarization will permit measuring the length of these cycles. 22 references.

Enrico Chiaveri: The dialogue in the HR Strategy

CERN Multimedia

2009-01-01

Enrico Chiaveri has been Head of the Human Resources Department since 2005. A core part of his department’s mission with the new Management is to develop and implement a strategic HR approach for our forward-looking Organization. He explained key aspects of the HR strategy to the Bulletin. For the first time in CERN’s history, a head of the HR Department and his deputy - Anne-Sylvie Catherin - invited the staff to a general information meeting on 23 February 2009. The scope of the meeting was to present the status of a number of current initiatives that will improve and tailor CERN’s HR strategy to the needs of the Organization and its staff, and also open up dialogue. Presented for the first time in an integrated way, the initiatives include contract policy, MARS, a staff survey, CERN’s values, a performance model, recruitment & outreach, learning & development, internal mobility and the development of a code of condu...

Transgenic mice display hair loss and regrowth overexpressing mutant Hr gene.

Science.gov (United States)

Zhu, Kuicheng; Xu, Cunshuan; Zhang, Jintao; Chen, Yingying; Liu, Mengduan

2017-10-30

Mutations in the hairless (Hr) gene in both mice and humans have been implicated in the development of congenital atrichia, but the role of Hr in skin and hair follicle (HF) biology remains unknown. Here, we established transgenic mice (TG) overexpressing mutant Hr to investigate its specific role in the development of HF. Three transgenic lines were successfully constructed, and two of them (TG3 and TG8) displayed a pattern of hair loss and regrowth with alternation in the expression of HR protein. The mutant Hr gene inhibited the expression of the endogenous gene in transgenic individuals, which led to the development of alopecia. Interestingly, the hair regrew with the increase in the endogenous expression levels resulting from decreased mutant Hr expression. The findings of our study indicate that the changes in the expression of Hr result in hair loss or regrowth.

AMP-activated protein kinase phosphorylates CtBP1 and down-regulates its activity

Energy Technology Data Exchange (ETDEWEB)

Kim, Jae-Hwan; Choi, Soo-Youn; Kang, Byung-Hee; Lee, Soon-Min [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); Park, Hyung Soon; Kang, Gum-Yong; Bang, Joo Young [Center for Biomedical Mass Spectrometry, Diatech Korea Co., Ltd., Seoul (Korea, Republic of); Cho, Eun-Jung [National Research Laboratory for Chromatin Dynamics, College of Pharmacy, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Youn, Hong-Duk, E-mail: hdyoun@snu.ac.kr [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); WCU Department of Molecular Medicine and Biopharmaceutical Sciences, Graduate School of Convergence and Technology, Seoul National University, Seoul (Korea, Republic of)

2013-02-01

Highlights: ► AMPK phosphorylates CtBP1 on serine 158. ► AMPK-mediated phosphorylation of CtBP1 causes the ubiquitination and nuclear export of CtBP1. ► AMPK downregulates the CtBP1-mediated repression of Bax transcription. -- Abstract: CtBP is a transcriptional repressor which plays a significant role in the regulation of cell proliferation and tumor progression. It was reported that glucose withdrawal causes induction of Bax due to the dissociation of CtBP from the Bax promoter. However, the precise mechanism involved in the regulation of CtBP still remains unclear. In this study, we found that an activated AMP-activated protein kinase (AMPK) phosphorylates CtBP1 on Ser-158 upon metabolic stresses. Moreover, AMPK-mediated phosphorylation of CtBP1 (S158) attenuates the repressive function of CtBP1. We also confirmed that triggering activation of AMPK by various factors resulted in an increase of Bax gene expression. These findings provide connections of AMPK with CtBP1-mediated regulation of Bax expression for cell death under metabolic stresses.

Surface Water Sampling Data for BP Spill/Deepwater Horizon

Data.gov (United States)

U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

Spectroscopic confirmation of the first symbiotic star in a globular cluster

Science.gov (United States)

Zurek, David

2013-10-01

We have recently discovered an 18-minute period in the ultraviolet of a star in the globular cluster NGC 1851. In the redder optical bands, this star is red and bright, while it shows a clear UV excess relative to other stars at similar positions in the HR diagram. The system is most likely a symbiotic binary, composed of a cool evolved star and a white dwarf, with an 18 minute spin period, accreting the cool star's wind. The binary would be the first such object ever found in a globular cluster, and only the third in the Galaxy where the white dwarf spin period is measured. The only viable alternatives are that the two components are a chance superposition - something with a nontrivial chance of happening in a globular cluster core. In such a case, the 18 minute period would most likely be the spin period of a magnetic white dwarf in an intermediate polar cataclysmic variable {this would be the first confirmed magnetic CV in a globular cluster}, or the orbital period of a double-degenerate AM CVn binary. Each of these three possibilities show unique {and very different} emission line spectra in the blue wavelength range. Two orbits of HST with STIS/G430L will produce a spectrum of sufficient signal-to-noise to distinguish between these 3 scenarios. The result will be an important constraint on N-body models of globular clusters.

UTILIZING SYNTHETIC UV SPECTRA TO EXPLORE THE PHYSICAL BASIS FOR THE CLASSIFICATION OF LAMBDA BOÖTIS STARS

Energy Technology Data Exchange (ETDEWEB)

Cheng, Kwang-Ping; Johnson, Dustin M.; Tarbell, Erik S.; Romo, Christopher A.; Prabhaker, Arvind [Cal. State Univ., Fullerton, Fullerton, CA (United States); Neff, James E.; Steele, Patricia A. [College of Charleston, Charleston, SC (United States); Gray, Richard O. [Appalachian State Univ., Boone, NC (United States); Corbally, Christopher J. [Vatican Observatory, Tucson, AZ (United States)

2016-04-15

Lambda Boo-type stars are a group of late B to early F-type Population I dwarfs that show mild to extreme deficiencies of iron-peak elements (up to 2 dex), but their C, N, O, and S abundances are near solar. This intriguing stellar class has recently regained the spotlight because of the directly imaged planets around a confirmed Lambda Boo star, HR 8799, and a suggested Lambda Boo star, Beta Pictoris. The discovery of a giant asteroid belt around Vega, another possible Lambda Boo star, also suggests hidden planets. The possible link between Lambda Boo stars and planet-bearing stars motivates us to study Lambda Boo stars systematically. Since the peculiar nature of the prototype Lambda Boötis was first noticed in 1943, Lambda Boo candidates published in the literature have been selected using widely different criteria. In order to determine the origin of Lambda Boo stars’ unique abundance pattern and to better discriminate between theories explaining the Lambda Boo phenomenon, a consistent working definition of Lambda Boo stars is needed. We have re-evaluated all published Lambda Boo candidates and their available ultraviolet and visible spectra. In this paper, using observed and synthetic spectra, we explore the physical basis for the classification of Lambda Boo stars, and develop quantitative criteria that discriminate metal-poor stars from bona fide Lambda Boo stars. Based on these stricter Lambda Boo classification criteria, we conclude that neither Beta Pictoris nor Vega should be classified as Lambda Boo stars.

UTILIZING SYNTHETIC UV SPECTRA TO EXPLORE THE PHYSICAL BASIS FOR THE CLASSIFICATION OF LAMBDA BOÖTIS STARS

International Nuclear Information System (INIS)

Cheng, Kwang-Ping; Johnson, Dustin M.; Tarbell, Erik S.; Romo, Christopher A.; Prabhaker, Arvind; Neff, James E.; Steele, Patricia A.; Gray, Richard O.; Corbally, Christopher J.

2016-01-01

Lambda Boo-type stars are a group of late B to early F-type Population I dwarfs that show mild to extreme deficiencies of iron-peak elements (up to 2 dex), but their C, N, O, and S abundances are near solar. This intriguing stellar class has recently regained the spotlight because of the directly imaged planets around a confirmed Lambda Boo star, HR 8799, and a suggested Lambda Boo star, Beta Pictoris. The discovery of a giant asteroid belt around Vega, another possible Lambda Boo star, also suggests hidden planets. The possible link between Lambda Boo stars and planet-bearing stars motivates us to study Lambda Boo stars systematically. Since the peculiar nature of the prototype Lambda Boötis was first noticed in 1943, Lambda Boo candidates published in the literature have been selected using widely different criteria. In order to determine the origin of Lambda Boo stars’ unique abundance pattern and to better discriminate between theories explaining the Lambda Boo phenomenon, a consistent working definition of Lambda Boo stars is needed. We have re-evaluated all published Lambda Boo candidates and their available ultraviolet and visible spectra. In this paper, using observed and synthetic spectra, we explore the physical basis for the classification of Lambda Boo stars, and develop quantitative criteria that discriminate metal-poor stars from bona fide Lambda Boo stars. Based on these stricter Lambda Boo classification criteria, we conclude that neither Beta Pictoris nor Vega should be classified as Lambda Boo stars

BP's driving safety strategy

Energy Technology Data Exchange (ETDEWEB)

Herman, B. [BP Canada Energy Company, Calgary, AB (Canada)

2006-07-01

This presentation focused on why it is important to drive safely. It addressed driver fatigue as well as BP's global driving standard. The Standard applies to all BP employees and contractors that drive any vehicle on BP business and consists of 10 mandatory elements focusing on safety of the driver, the safety of the journey, and the safety of the vehicle. The driving standards focus on several themes, including skill and competency of the driver, safety of the journey, and safety of the vehicle. Fatigue causes more than 20 per cent of motorway accidents and is the most frequent cause of accidental death of truck drivers. The presentation also discussed vehicle data recorders, driving immersion, and Driving Safety Program results. Journey management, driver training, vehicle inspections and policies, and statistics on vehicle incidents were also provided. The presentation revealed that a lack of pre-trip journey management, inadequate training or recall of training, and not following safe driving practices were major contributors to incident occurrences. It also revealed that traveling on gravel or ice and avoiding wildlife were factors in many vehicle incidents. 1 tab., 1 fig.

InterProScan Result: BP184018 [KAIKOcDNA[Archive

Lifescience Database Archive (English)

Full Text Available BP184018 BP184018_2_ORF2 4FEA411FDBEADEDD PANTHER PTHR21347 CLEFT LIP AND PALATE ASSOCIATED TRANSME...MBRANE PROTEIN-RELATED 6.1e-73 T IPR008429 Cleft lip and palate transmembrane 1 ...

Professional Development of HR Practitioners--A Phenomenographic Study

Science.gov (United States)

Bailey, Moira

2015-01-01

Purpose: The purpose of this paper is an investigation into the experiences of professional development of human resource (HR) practitioners in the North of Scotland, and the use of non-formal learning in that development. Design/methodology/approach: In-depth semi-structured interviews from a purposively selected sample of HR practitioners were…

Modelling the evolution of solar-mass stars with a range of metallicities using MESA

Directory of Open Access Journals (Sweden)

Jones E.F.

2015-01-01

Full Text Available The nuclides 1,2H, 3,4He, 7Li, 7Be, 8B, 12,13C, 13-15N, 14-18O, 17-19F, 18-22Ne, 22Mg, and 24Mg were used in the code package MESA (Modules for Experiments in Stellar Astrophysics[Paxton] to model a one-solar-mass star with a range of metallicities, z, from 0 to 0.1. On HR diagrams of each star model’s luminosity and effective temperature from before zero-age main sequence (pre-ZAMS to white dwarf, oscillations were noted in the horizontal branch at intervals from z = 0 to 0.0070. At z, = 0, the calculated stellar lifetime is 6.09x109 years. The calculated lifetime of the model stars increases to a maximum of 1.25x1010 years at z = 0.022 and then decreases to 2.59x109 years at z = 0.1. A piecewise fit of the model lifetimes vs. metallicity was obtained.

Central and peripheral mechanisms underlying gastric distention inhibitory reflex responses in hypercapnic-acidotic rats.

Science.gov (United States)

Tjen-A-Looi, Stephanie C; Hsiao, An-Fu; Longhurst, John C

2011-03-01

We have observed that in chloralose-anesthetized animals, gastric distension (GD) typically increases blood pressure (BP) under normoxic normocapnic conditions. However, we recently noted repeatable decreases in BP and heart rate (HR) in hypercapnic-acidotic rats in response to GD. The neural pathways, central processing, and autonomic effector mechanisms involved in this cardiovascular reflex response are unknown. We hypothesized that GD-induced decrease in BP and HR reflex responses are mediated during both withdrawal of sympathetic tone and increased parasympathetic activity, involving the rostral (rVLM) and caudal ventrolateral medulla (cVLM) and the nucleus ambiguus (NA). Rats anesthetized with ketamine and xylazine or α-chloralose were ventilated and monitored for HR and BP changes. The extent of cardiovascular inhibition was related to the extent of hypercapnia and acidosis. Repeated GD with both anesthetics induced consistent falls in BP and HR. The hemodynamic inhibitory response was reduced after blockade of the celiac ganglia or the intraabdominal vagal nerves with lidocaine, suggesting that the decreased BP and HR responses were mediated by both sympathetic and parasympathetic afferents. Blockade of the NA decreased the bradycardia response. Microinjection of kainic acid into the cVLM reduced the inhibitory BP response, whereas depolarization blockade of the rVLM decreased both BP and HR inhibitory responses. Blockade of GABA(A) receptors in the rVLM also reduced the BP and HR reflex responses. Atropine methyl bromide completely blocked the reflex bradycardia, and atenolol blocked the negative chronotropic response. Finally, α(1)-adrenergic blockade with prazosin reversed the depressor. Thus, in the setting of hypercapnic-acidosis, a sympathoinhibitory cardiovascular response is mediated, in part, by splanchnic nerves and is processed through the rVLM and cVLM. Additionally, a vagal excitatory reflex, which involves the NA, facilitates the GD

Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers

Energy Technology Data Exchange (ETDEWEB)

Theodorakis, P E [Department of Materials Science and Engineering, University of Ioannina, 45110 Ioannina (Greece); Avgeropoulos, A [Department of Materials Science and Engineering, University of Ioannina, 45110 Ioannina (Greece); Freire, J J [Departamento de Ciencias y Tecnicas FisicoquImicas, Universidad Nacional de Educacion a Distancia, Facultad de Ciencias, Senda del Rey 9, 28040 Madrid (Spain); Kosmas, M [Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece); Vlahos, C [Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece)

2007-11-21

The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results.

Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers

Science.gov (United States)

Theodorakis, P. E.; Avgeropoulos, A.; Freire, J. J.; Kosmas, M.; Vlahos, C.

2007-11-01

The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results.

Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers

International Nuclear Information System (INIS)

Theodorakis, P E; Avgeropoulos, A; Freire, J J; Kosmas, M; Vlahos, C

2007-01-01

The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results

Photometric Observations of 6000 Stars in the Cygnus Field

Science.gov (United States)

Borucki, W.; Caldwell, D.; Koch, D.; Jenkins, J.; Ninkov, Z.

1999-01-01

A small photometer to detect transits by extrasolar planets has been assembled and is being tested at Lick Observatory on Mt. Hamilton, California. The Vulcan photometer is constructed from a 30 cm focal length, F/2.5 AeroEktar reconnaissance lens and Photometrics PXL16800 CCD camera. A spectral filter is used to confine the pass band from 480 to 763 mn. It simultaneously monitors 6000 stars brighter than 12th magnitude within a single star field in the galactic plane. When the data are folded and phased to discover low amplitude transits, the relative precision of one-hour samples is about 1 part per thousand (10 x l0(exp -3)) for many of the brighter stars. This precision is sufficient to find jovian-size planets orbiting solar-like stars, which have signal amplitudes from 5 to 30 x l0(exp -3) depending on the inflation of the planet and the size of the star. Based on the frequency of giant inner-planets discovered by Doppler-velocity method, one or two planets should be detectable in a rich star field. The goal of the observations is to obtain the sizes of giant extrasolar planets in short-period orbits and to combine these with masses determined from Doppler velocity measurements to determine the densities of these planets. A further goal is to compare the measured planetary diameters with those predicted from theoretical models. From August 10 through September 30 of 1998, a forty nine square degree field in the Cygnus constellation centered at RA and DEC of 19 hr 47 min, +36 deg 55 min was observed. Useful data were obtained on twenty-nine nights. Nearly fifty stars showed some evidence of transits with periods between 0.3 and 8 days. Most had amplitudes too large to be associated with planetary transits. However, several stars showed low amplitude transits. The data for several transits of each of these two stars have been folded and been folded into 30 minute periods. Only Cygl433 shows any evidence of a flattened bottom that is expected when a small object

4977-bp mitochondrial DNA deletion in infertile patients with varicocele.

Science.gov (United States)

Gashti, N G; Salehi, Z; Madani, A H; Dalivandan, S T

2014-04-01

Varicocele is the abnormal inflexion and distension of veins of the pampiniform plexus within spermatic cord and is one of the amendable causes of male infertility. It can increase reactive oxygen species (ROS) production in semen and cause oxidative stress. The purpose of this study was to analyse spermatozoa mtDNA 4977-bp deletion in infertile men with varicocele. To detect 4977-bp deletion in spermatozoa mtDNA, semen samples of 60 infertile patients with clinical varicocele and 90 normal men from northern Iran were prepared. After extraction of spermatozoa total DNA, Gap polymerase chain reaction (Gap PCR) was performed. 4977-bp deletion was observed in 81.66% of patients with varicocele, while approximately 15.55% of controls had this deletion. As spermatozoa from patients with varicocele had a high frequency of occurrence of 4977-bp deletion in mtDNA [OR = 24.18, 95% confidence interval (CI) = 10.15-57.57, P deletion in spermatozoa and cause infertility in north Iranian men. However, to determine the relation between sperm mtDNA 4977-bp deletion and varicocele-induced infertility, larger population-based studies are needed. It is concluded that there is an association between sperm mtDNA 4977-bp deletion and varicocele-induced infertility in the population studied. © 2013 Blackwell Verlag GmbH.

Blockade of central vasopressin receptors reduces the cardiovascular response to acute stress in freely moving rats.

Science.gov (United States)

Stojicić, S; Milutinović-Smiljanić, S; Sarenac, O; Milosavljević, S; Paton, J F R; Murphy, D; Japundzić-Zigon, N

2008-04-01

To investigate the contribution of central vasopressin receptors to blood pressure (BP) and heart rate (HR) response to stress we injected non-peptide selective V(1a) (SR49059), V(1b) (SSR149415), V(2) (SR121463) receptor antagonists, diazepam or vehicle in the lateral cerebral ventricle of conscious freely moving rats stressed by blowing air on their heads for 2 min. Cardiovascular effects of stress were evaluated by analyzing maximum increase of BP and HR (MAX), latency of maximum response (LAT), integral under BP and HR curve (integral), duration of their recovery and spectral parameters of BP and HR indicative of increased sympathetic outflow (LF(BP) and LF/HF(HR)). Moreover, the increase of serum corticosterone was measured. Exposure to air-jet stress induced simultaneous increase in BP and HR followed by gradual decline during recovery while LF(BP) oscillation remained increased as well as serum corticosterone level. Rats pre-treated with vasopressin receptor antagonists were not sedated while diazepam induced sedation that persisted during exposure to stress. V(1a), V(1b) and V(2) receptor antagonists applied separately did not modify basal values of cardiovascular parameters but prevented the increase in integral(BP). In addition, V(1b) and V(2) receptor antagonists reduced BP(MAX) whereas V(1a), V(1b) antagonist and diazepam reduced HR(MAX) induced by exposure to air-jet stress. All drugs shortened the recovery period, prevented the increase of LF(BP) without affecting the increase in serum corticosterone levels. Results indicate that vasopressin receptors located within the central nervous system mediate, in part, the cardiovascular response to air-jet stress without affecting either the neuroendocrine component or inducing sedation. They support the view that the V(1b) receptor antagonist may be of potential therapeutic value in reducing arterial pressure induced by stress-related disorders.

InterProScan Result: BP116799 [KAIKOcDNA[Archive

Lifescience Database Archive (English)

Full Text Available BP116799 BP116799_1_ORF2 D3F3F8C61868AD4C PANTHER PTHR11792 ARRESTIN 3.5e-15 T IPR000698 Arrestin Biological... Process: signal transduction (GO:0007165)|Biological Process: sensory perception (GO:0007600) ...

InterProScan Result: BP116799 [KAIKOcDNA[Archive

Lifescience Database Archive (English)

Full Text Available BP116799 BP116799_1_ORF2 D3F3F8C61868AD4C PRINTS PR00309 ARRESTIN 6e-17 T IPR000698 Arrestin Biological... Process: signal transduction (GO:0007165)|Biological Process: sensory perception (GO:0007600) ...

News from HR: a word from Anne-Sylvie Catherin

CERN Multimedia

2016-01-01

Anne-Sylvie Catherin, head of HR Department, looks back over her years at CERN before taking up her new position at the European Central Bank.   At the end of July, I will be leaving CERN on a special leave of absence to take up a new position at the European Central Bank. This is a new chapter in my career, in a new context with its own challenges, and as I prepare for it, I would like to take a little time to look back over my years at CERN and share with you the enriching journey it has been, both for myself and for HR. It has always been my strong belief that any organisation’s greatest asset is its people. When an HR professional believes that, it’s only a short step to the conclusion that the best way to nurture those people is by adopting a professional approach to HR. In this respect, I arrived at a very fortuitous time. Enrico Chiaveri was head of HR and, although his background is in physics, we shared that same conviction. Enrico was the icebreaker in driving change, a...

Star Formation in the Orion Nebula Cluster

Science.gov (United States)

Palla, Francesco; Stahler, Steven W.

1999-11-01

We study the record of star formation activity within the dense cluster associated with the Orion Nebula. The bolometric luminosity function of 900 visible members is well matched by a simplified theoretical model for cluster formation. This model assumes that stars are produced at a constant rate and distributed according to the field-star initial mass function. Our best-fit age for the system, within this framework, is 2×106 yr. To undertake a more detailed analysis, we present a new set of theoretical pre-main-sequence tracks. These cover all masses from 0.1 to 6.0 Msolar, and start from a realistic stellar birthline. The tracks end along a zero-age main-sequence that is in excellent agreement with the empirical one. As a further aid to cluster studies, we offer an heuristic procedure for the correction of pre-main-sequence luminosities and ages to account for the effects of unresolved binary companions. The Orion Nebula stars fall neatly between our birthline and zero-age main-sequence in the H-R diagram. All those more massive than about 8 Msolar lie close to the main sequence, as also predicted by theory. After accounting for the finite sensitivity of the underlying observations, we confirm that the population between 0.4 and 6.0 Msolar roughly follows a standard initial mass function. We see no evidence for a turnover at lower masses. We next use our tracks to compile stellar ages, also between 0.4 and 6.0 Msolar. Our age histogram reveals that star formation began at a low level some 107 yr ago and has gradually accelerated to the present epoch. The period of most active formation is indeed confined to a few×106 yr, and has recently ended with gas dispersal from the Trapezium. We argue that the acceleration in stellar births, which extends over a wide range in mass, reflects the gravitational contraction of the parent cloud spawning this cluster.

Neutron stars

International Nuclear Information System (INIS)

Irvine, J.M.

1978-01-01

The subject is covered in chapters entitled: introduction (resume of stellar evolution, gross characteristics of neutron stars); pulsars (pulsar characteristics, pulsars as neutron stars); neutron star temperatures (neutron star cooling, superfluidity and superconductivity in neutron stars); the exterior of neutron stars (the magnetosphere, the neutron star 'atmosphere', pulses); neutron star structure; neutron star equations of state. (U.K.)

The MCM-associated protein MCM-BP is important for human nuclear morphology.

Science.gov (United States)

Jagannathan, Madhav; Sakwe, Amos M; Nguyen, Tin; Frappier, Lori

2012-01-01

Mini-chromosome maintenance complex-binding protein (MCM-BP) was discovered as a protein that is strongly associated with human MCM proteins, known to be crucial for DNA replication in providing DNA helicase activity. The Xenopus MCM-BP homologue appears to play a role in unloading MCM complexes from chromatin after DNA synthesis; however, the importance of MCM-BP and its functional contribution to human cells has been unclear. Here we show that depletion of MCM-BP by sustained expression of short hairpin RNA (shRNA) results in highly abnormal nuclear morphology and centrosome amplification. The abnormal nuclear morphology was not seen with depletion of other MCM proteins and was rescued with shRNA-resistant MCM-BP. MCM-BP depletion was also found to result in transient activation of the G2 checkpoint, slowed progression through G2 and increased replication protein A foci, indicative of replication stress. In addition, MCM-BP depletion led to increased cellular levels of MCM proteins throughout the cell cycle including soluble MCM pools. The results suggest that MCM-BP makes multiple contributions to human cells that are not limited to unloading of the MCM complex.

Regulation of StAR by the N-terminal Domain and Coinduction of SIK1 and TIS11b/Znf36l1 in Single Cells.

Science.gov (United States)

Lee, Jinwoo; Tong, Tiegang; Duan, Haichuan; Foong, Yee Hoon; Musaitif, Ibrahim; Yamazaki, Takeshi; Jefcoate, Colin

2016-01-01

The cholesterol transfer function of steroidogenic acute regulatory protein (StAR) is uniquely integrated into adrenal cells, with mRNA translation and protein kinase A (PKA) phosphorylation occurring at the mitochondrial outer membrane (OMM). The StAR C-terminal cholesterol-binding domain (CBD) initiates mitochondrial intermembrane contacts to rapidly direct cholesterol to Cyp11a1 in the inner membrane (IMM). The conserved StAR N-terminal regulatory domain (NTD) includes a leader sequence targeting the CBD to OMM complexes that initiate cholesterol transfer. Here, we show how the NTD functions to enhance CBD activity delivers more efficiently from StAR mRNA in adrenal cells, and then how two factors hormonally restrain this process. NTD processing at two conserved sequence sites is selectively affected by StAR PKA phosphorylation. The CBD functions as a receptor to stimulate the OMM/IMM contacts that mediate transfer. The NTD controls the transit time that integrates extramitochondrial StAR effects on cholesterol homeostasis with other mitochondrial functions, including ATP generation, inter-organelle fusion, and the major permeability transition pore in partnership with other OMM proteins. PKA also rapidly induces two additional StAR modulators: salt-inducible kinase 1 (SIK1) and Znf36l1/Tis11b. Induced SIK1 attenuates the activity of CRTC2, a key mediator of StAR transcription and splicing, but only as cAMP levels decline. TIS11b inhibits translation and directs the endonuclease-mediated removal of the 3.5-kb StAR mRNA. Removal of either of these functions individually enhances cAMP-mediated induction of StAR. High-resolution fluorescence in situ hybridization (HR-FISH) of StAR RNA reveals asymmetric transcription at the gene locus and slow RNA splicing that delays mRNA formation, potentially to synchronize with cholesterol import. Adrenal cells may retain slow transcription to integrate with intermembrane NTD activation. HR-FISH resolves individual 3.5-kb StAR

76 FR 69713 - Application To Export Electric Energy; BP Energy Company

Science.gov (United States)

2011-11-09

... DEPARTMENT OF ENERGY [OE Docket No. EA-314-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... electric energy from the United States to Mexico as a power marketer for a five-year term using existing...

Data-driven HR how to use analytics and metrics to drive performance

CERN Document Server

Marr, Bernard

2018-01-01

Traditionally seen as a purely people function unconcerned with numbers, HR is now uniquely placed to use company data to drive performance, both of the people in the organization and the organization as a whole. Data-driven HR is a practical guide which enables HR practitioners to leverage the value of the vast amount of data available at their fingertips. Covering how to identify the most useful sources of data, how to collect information in a transparent way that is in line with data protection requirements and how to turn this data into tangible insights, this book marks a turning point for the HR profession. Covering all the key elements of HR including recruitment, employee engagement, performance management, wellbeing and training, Data-driven HR examines the ways data can contribute to organizational success by, among other things, optimizing processes, driving performance and improving HR decision making. Packed with case studies and real-life examples, this is essential reading for all HR profession...

Expression of the Transcription Factor E4BP4 in Human Basophils

DEFF Research Database (Denmark)

Jensen, Bettina Margrethe; Gohr, Maria; Poulsen, Lars Kærgaard

2014-01-01

Rationale The cytokine IL-3 plays an important role for human basophil development, function and survival. IL-3 is also reported to induce the expression of the transcription factor E4BP4, but it is not known whether E4BP4 is expressed in basophils and influences basophil responsiveness. The aim...... by Alcian blue. RNA was extracted (0.005-0.02 µg RNA from 0.5 - 1 x 106 cells), and the corresponding cDNA analyzed by real-time PCR where E4BP4 expression was calculated as 2-(CT(E4BP4) - CT(β-actin)). E4BP4 protein expression was visualized in basophil lysates (107 cells/ml) by Western blot followed...... the transcription factor E4BP4 which might have an impact on basophil histamine release....

Nuclear Enterprises portable dose rate meter type PDR4 and external probes types BP1/1, BP8 and GP9

International Nuclear Information System (INIS)

Burgess, P.H.; Iles, W.J.

1979-08-01

The performance characteristics of Nuclear Enterprises Portable Dose Rate Meter Type PDR4 are evaluated under the headings: general description, facilities and controls, radiation characteristics, electrical characteristics, environmental characteristics, mechanical characteristics, the manual, summary of performance, and conclusions. Results of an investigation of the radiation characteristics of the external probes Type BP1/1, Type BP8, and Type GP9 are also detailed. (U.K.)

Managing (Sales)People towards Performance: HR Strategy, Leadership & Teamwork

NARCIS (Netherlands)

H.M.S. Dietz (Bart)

2009-01-01

textabstractManaging people towards performance is one of the most critical priorities for managers in practice. This dissertation focuses on this important issue and explores how HR Strategy, Leaders, and Teams, impact performance. It addresses respectively how HR as a system of coherent

Intensive Versus Standard Blood Pressure Control in SPRINT-Eligible Participants of ACCORD-BP.

Science.gov (United States)

Buckley, Leo F; Dixon, Dave L; Wohlford, George F; Wijesinghe, Dayanjan S; Baker, William L; Van Tassell, Benjamin W

2017-12-01

We sought to determine the effect of intensive blood pressure (BP) control on cardiovascular outcomes in participants with type 2 diabetes mellitus (T2DM) and additional risk factors for cardiovascular disease (CVD). This study was a post hoc, multivariate, subgroup analysis of ACCORD-BP (Action to Control Cardiovascular Risk in Diabetes Blood Pressure) participants. Participants were eligible for the analysis if they were in the standard glucose control arm of ACCORD-BP and also had the additional CVD risk factors required for SPRINT (Systolic Blood Pressure Intervention Trial) eligibility. We used a Cox proportional hazards regression model to compare the effect of intensive versus standard BP control on CVD outcomes. The "SPRINT-eligible" ACCORD-BP participants were pooled with SPRINT participants to determine whether the effects of intensive BP control interacted with T2DM. The mean baseline Framingham 10-year CVD risk scores were 14.5% and 14.8%, respectively, in the intensive and standard BP control groups. The mean achieved systolic BP values were 120 and 134 mmHg in the intensive and standard BP control groups ( P control reduced the composite of CVD death, nonfatal myocardial infarction (MI), nonfatal stroke, any revascularization, and heart failure (hazard ratio 0.79; 95% CI 0.65-0.96; P = 0.02). Intensive BP control also reduced CVD death, nonfatal MI, and nonfatal stroke (hazard ratio 0.69; 95% CI 0.51-0.93; P = 0.01). Treatment-related adverse events occurred more frequently in participants receiving intensive BP control (4.1% vs. 2.1%; P = 0.003). The effect of intensive BP control on CVD outcomes did not differ between patients with and without T2DM ( P > 0.62). Intensive BP control reduced CVD outcomes in a cohort of participants with T2DM and additional CVD risk factors. © 2017 by the American Diabetes Association.

The Factors of Forming the National HR-Management Model

Directory of Open Access Journals (Sweden)

Elena P. Kostenko

2017-12-01

Full Text Available There are some factors considered in this article, which influence the forming of national HR-management model. The group-forming criterion is the nature of factors, that determine the system of HR-management as a system of corporate culture values, norms and rules of organizational behavior, ways of realization some important managing functions and dominating approaches to make decisions. This article shows that the plurality of combinations in different factors leads to forming the unique HR-management model. The geoclimatic factor influences the principles of the labor organization (orientation primarily on individual or collective forms of labor, attitude to the management experience of other countries, attitude to resources, etc., the distribution of labor resources, the level of labor mobility, and the psychosocial type of employee. Models of man's labor behavior are constituted In the process of historical development. Attention is focused on the formation of a national HR-model, such as the conducted socio-economic policy, the characteristics of the institutional environment, economic goals and priorities of the country's development, the level of development and the nature of the national productive forces and economic structures. Much attention was paid to the analysis of the historically formed value system and labor traditions, which influence the approaches to HR-management. As far as religion influences the model of person’s inclusion in labor, motives of labor behavior, management culture of a certain employee, preferred payment etc., we examined how the main traditional religions (Christianity, Islam, Judaism, Buddhism, Confucianism, Hinduism influence the HR-management system in different countries.

Post glacial mass movements in Western Norway with special emphasis on the 2000 - 2200 BP and 2800 - 3200 BP periods - final report

International Nuclear Information System (INIS)

Boee, Reidulv; Lepland, Aivo; Blikra, Lars Harald; Longva, Oddvar; Soenstegaard, Eivind

2002-01-01

The Ormen Lange Gas Field was discovered in the Norwegian Sea outside the Moere og Romsdal in 1997. The development of this field which is located in the area of the Storegga Slide, requires safety assessment. The project aims to collect and compile data on slides, avalanches and gravitational faults that may have resulted from large earthquakes or tsunamis in the north west of Western Norway. A major task in the present project has been to investigate the spatial extent and interpret the origin of a postulated mass movement event ca. 2000 years ago and to evaluate its causes, climate variations, a tsunami (possibly caused by an earthquake affecting the offshore area), and earthquake only affecting parts of Western Norway or a combination of an earthquake and a tsunami. Several other mass movements, including the Storegga Slide tsunami deposits and pre-Storegga Slide slide and debris flow deposits have been studied both in the fjord and the lake sediments. Five of the 16 investigated fjords (Dalsfjorden, Foerdefjorden, Syvdsfjorden, Voldafjorden, Oerstadfjorden) provide evidence for a 2000 - 2200 years BP (calendar years before present, i.e. 1950) event. Previous investigations show no indication of a large shelf edge slide in the Storegga area, that may have created a tsunami at that time, nor are any mass movement deposits found on land or in the investigated lakes. This suggests that the 2000 - 2200 BP debris flows and turbidites were most likely related to one or more earthquakes on land or close to the coast and not an offshore mega slide generated tsunami. The Storegga Slide (8200 BP) tsunami deposits are observed in cores over most of the investigated area, both in the deep fjords and in lakes. Striking similarity between major slide and debris flow deposits at the 2000 - 2200 BP and ca. 11000 - 11700 BP stratigraphic levels suggest a common triggering mechanism, probably earthquakes with epicentres in the Sunnfjord Sunnmoere region. A period of debris flows

Gear Fault Diagnosis Based on BP Neural Network

Science.gov (United States)

Huang, Yongsheng; Huang, Ruoshi

2018-03-01

Gear transmission is more complex, widely used in machinery fields, which form of fault has some nonlinear characteristics. This paper uses BP neural network to train the gear of four typical failure modes, and achieves satisfactory results. Tested by using test data, test results have an agreement with the actual results. The results show that the BP neural network can effectively solve the complex state of gear fault in the gear fault diagnosis.

[Clinical significance of NS1-BP expression in esophageal squamous cell carcinoma].

Science.gov (United States)

Ren, K; Qian, D; Wang, Y W; Pang, Q S; Zhang, W C; Yuan, Z Y; Wang, P

2018-01-23

Objective: To investigate the clinical significance of NS1-BP expression in patients with esophageal squamous cell carcinoma (ESCC), and to study the roles of NS1-BP in proliferation and apoptosis of ESCC cells. Methods: A total of 98 tumor tissues and 30 adjacent normal tissues from 98 ESCC patients were used as study group and control group, and these samples were collected in Sun Yat-Sen University Cancer Center between 2002 and 2008. In addition, 46 ESCC tissues which were collected in Cancer Institute and Hospital of Tianjin Medical University were used as validation group. Expression of mucosal NS1-BP was detected by immunohistochemistry. Kaplan-Meier curve and log-rank test were used to analyze the survival rate. Multivariate Cox proportional hazard model was used to analyze the prognostic factors. Furthermore, NS1-BP was over expressed or knocked down in ESCC cells by transient transfection. Protein levels of c-Myc were detected by western blot. Cell viability and apoptosis was analyzed by MTT assay and flow cytometry. Results: Among all of tested samples, NS1-BP were down-regulated in 9 out of 30 non-tumorous normal esophageal tissues (30.0%) and 85 out of 144 ESCC tissues (59.0%), respectively, showing a statistically significant difference ( P =0.012). In the study group, three-year disease-free survival rate of NS1-BP high expression group (53.2%) was significantly higher than that of NS1-BP low expression group (27.6%; P =0.009). In the validation group, the three-year disease-free survival rates were 57.8% and 25.5% in NS1-BP high and low levels groups, respectively, showing a similar results ( P =0.016). Importantly, multivariate analyses showed that low expression of NS1-BP was an independent predictor for chemoradiotherapy sensitivity and shorter disease-free survival time in ESCC patients( P <0.05 for all). Furthermore, overexpressed NS1-BP in TE-1 cells repressed c-Myc expression, inhibited cell proliferation and promoted apoptosis. In contrast

Neutron Star Science with the NuSTAR

Energy Technology Data Exchange (ETDEWEB)

Vogel, J. K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2015-10-16

The Nuclear Spectroscopic Telescope Array (NuSTAR), launched in June 2012, helped scientists obtain for the first time a sensitive high-­energy X-­ray map of the sky with extraordinary resolution. This pioneering telescope has aided in the understanding of how stars explode and neutron stars are born. LLNL is a founding member of the NuSTAR project, with key personnel on its optics and science team. We used NuSTAR to observe and analyze the observations of different neutron star classes identified in the last decade that are still poorly understood. These studies not only help to comprehend newly discovered astrophysical phenomena and emission processes for members of the neutron star family, but also expand the utility of such observations for addressing broader questions in astrophysics and other physics disciplines. For example, neutron stars provide an excellent laboratory to study exotic and extreme phenomena, such as the equation of state of the densest matter known, the behavior of matter in extreme magnetic fields, and the effects of general relativity. At the same time, knowing their accurate populations has profound implications for understanding the life cycle of massive stars, star collapse, and overall galactic evolution.

Relations between age, metallicity and kinematics of F-G stars of the Galactic disk

International Nuclear Information System (INIS)

Shevelev, Yu.G.; Marsakov, V.A.; Suchkov, A.A.

1989-01-01

The data for ∼ 5500 F-G stars are used to study their kinematics, metal abindance and HR diagram in terms of uvby photometry. The age-metallicity, velocity-metallicity, and age-velocity relations are derived. An estimate for the age of the galactic disk is obtained. The following is shown: 1) At[Fe/H] -0.1, turn out to be kinematically younger than these G dwarfs. The same paradox is revealed by G and K giants

A new BP Fourier algorithm and its application in English teaching evaluation

Science.gov (United States)

Pei, Xuehui; Pei, Guixin

2017-08-01

BP neural network algorithm has wide adaptability and accuracy when used in complicated system evaluation, but its calculation defects such as slow convergence have limited its practical application. The paper tries to speed up the calculation convergence of BP neural network algorithm with Fourier basis functions and presents a new BP Fourier algorithm for complicated system evaluation. First, shortages and working principle of BP algorithm are analyzed for subsequent targeted improvement; Second, the presented BP Fourier algorithm adopts Fourier basis functions to simplify calculation structure, designs new calculation transfer function between input and output layers, and conducts theoretical analysis to prove the efficiency of the presented algorithm; Finally, the presented algorithm is used in evaluating university English teaching and the application results shows that the presented BP Fourier algorithm has better performance in calculation efficiency and evaluation accuracy and can be used in evaluating complicated system practically.

InterProScan Result: BP117067 [KAIKOcDNA[Archive

Lifescience Database Archive (English)

Full Text Available BP117067 BP117067_1_ORF2 D483359C05197373 PFAM PF00067 p450 6e-05 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...

Influence of a stellar wind on the evolution of a star of 30 M/sub sun/

International Nuclear Information System (INIS)

Stothers, R.; Chin, C.

1980-01-01

A coarse grid of theoretical evolutionary tracks has been computed for a star of 30 M/sub sun/, in an attempt to delineate the role of mass loss in the star's evolution during core helium burning. For all of the tracks, Cox-Stewart opacities have been adopted, and the free parameters have included the rate of mass loss, criterion for convection, and initial chemical composition. With the use of the Schwarzschild criterion, the star suffers little mass loss during core helium burning and remains almost to the end, a blue supergiant, well separated from main-sequence stars on the H-R diagram. With the use of the Ledoux criterion, the same consequences are obtained only in the case of a relatively low initial hydrogen or initial metals abundance. Otherwise, the star evolves, first, into a red supergiant, whereupon rapid mass loss must be assumed to take place, if the observed paucity of very bright red supergiants is to be accounted for. The stellar remnant then consists of little more than the original helium core, and may appear, for a time, bluer than equally luminous main-sequence stars, provided that the the initial hydrogen and metals abundances are normal. Thus, a wide variety of possible evolutionary tracks can be obtained for an initial mass of 30 M/sub sun/ with reasonable choices of the free parameters

O stars and Wolf-Rayet stars

International Nuclear Information System (INIS)

Conti, P.S.; Underhill, A.B.; Jordan, S.; Thomas, R.

1988-01-01

Basic information is given about O and Wolf-Rayet stars indicating how these stars are defined and what their chief observable properties are. Part 2 of the volume discussed four related themes pertaining to the hottest and most luminous stars. Presented are: an observational overview of the spectroscopic classification and extrinsic properties of O and Wolf-Rayet stars; the intrinsic parameters of luminosity, effective temperature, mass, and composition of the stars, and a discussion of their viability; stellar wind properties; and the related issues concerning the efforts of stellar radiation and wind on the immediate interstellar environment are presented

O stars and Wolf-Rayet stars

Science.gov (United States)

Conti, Peter S.; Underhill, Anne B.; Jordan, Stuart (Editor); Thomas, Richard (Editor)

1988-01-01

Basic information is given about O and Wolf-Rayet stars indicating how these stars are defined and what their chief observable properties are. Part 2 of the volume discussed four related themes pertaining to the hottest and most luminous stars. Presented are: an observational overview of the spectroscopic classification and extrinsic properties of O and Wolf-Rayet stars; the intrinsic parameters of luminosity, effective temperature, mass, and composition of the stars, and a discussion of their viability; stellar wind properties; and the related issues concerning the efforts of stellar radiation and wind on the immediate interstellar environment are presented.

InterProScan Result: BP124291 [KAIKOcDNA[Archive

Lifescience Database Archive (English)

Full Text Available BP124291 BP124291_5_ORF1 92B626ADD33C8436 PFAM PF00067 p450 1.8e-09 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...

InterProScan Result: BP123442 [KAIKOcDNA[Archive

Lifescience Database Archive (English)

Full Text Available BP123442 BP123442_1_ORF1 331440C6CA592A17 PRINTS PR00385 P450 6.3e-05 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...

TopBP1 associates with NBS1 and is involved in homologous recombination repair

International Nuclear Information System (INIS)

Morishima, Ken-ichi; Sakamoto, Shuichi; Kobayashi, Junya; Izumi, Hideki; Suda, Tetsuji; Matsumoto, Yoshiyuki; Tauchi, Hiroshi; Ide, Hiroshi; Komatsu, Kenshi; Matsuura, Shinya

2007-01-01

TopBP1 is involved in DNA replication and DNA damage checkpoint. Recent studies have demonstrated that TopBP1 is a direct positive effecter of ATR. However, it is not known how TopBP1 recognizes damaged DNA. Here, we show that TopBP1 formed nuclear foci after exposure to ionizing radiation, but such TopBP1 foci were abolished in Nijmegen breakage syndrome cells. We also show that TopBP1 physically associated with NBS1 in vivo. These results suggested that NBS1 might regulate TopBP1 recruitment to the sites of DNA damage. TopBP1-depleted cells showed hypersensitivity to Mitomycin C and ionizing radiation, an increased frequency of sister-chromatid exchange level, and a reduced frequency of DNA double-strand break induced homologous recombination repair. Together, these results suggested that TopBP1 might be a mediator of DNA damage signaling from NBS1 to ATR and promote homologous recombination repair

The human element of right-sizing. BP experiences

International Nuclear Information System (INIS)

Hollis, J.W.

1994-01-01

BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning

The human element of right-sizing. BP experiences

Energy Technology Data Exchange (ETDEWEB)

Hollis, J W [BP Norge (Norway)

1994-12-31

BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning

A robust star identification algorithm with star shortlisting

Science.gov (United States)

Mehta, Deval Samirbhai; Chen, Shoushun; Low, Kay Soon

2018-05-01

A star tracker provides the most accurate attitude solution in terms of arc seconds compared to the other existing attitude sensors. When no prior attitude information is available, it operates in "Lost-In-Space (LIS)" mode. Star pattern recognition, also known as star identification algorithm, forms the most crucial part of a star tracker in the LIS mode. Recognition reliability and speed are the two most important parameters of a star pattern recognition technique. In this paper, a novel star identification algorithm with star ID shortlisting is proposed. Firstly, the star IDs are shortlisted based on worst-case patch mismatch, and later stars are identified in the image by an initial match confirmed with a running sequential angular match technique. The proposed idea is tested on 16,200 simulated star images having magnitude uncertainty, noise stars, positional deviation, and varying size of the field of view. The proposed idea is also benchmarked with the state-of-the-art star pattern recognition techniques. Finally, the real-time performance of the proposed technique is tested on the 3104 real star images captured by a star tracker SST-20S currently mounted on a satellite. The proposed technique can achieve an identification accuracy of 98% and takes only 8.2 ms for identification on real images. Simulation and real-time results depict that the proposed technique is highly robust and achieves a high speed of identification suitable for actual space applications.

Star-Branched Polymers (Star Polymers)

KAUST Repository

Hirao, Akira

2015-09-01

The synthesis of well-defined regular and asymmetric mixed arm (hereinafter miktoarm) star-branched polymers by the living anionic polymerization is reviewed in this chapter. In particular, much attention is being devoted to the synthetic development of miktoarm star polymers since 2000. At the present time, the almost all types of multiarmed and multicomponent miktoarm star polymers have become feasible by using recently developed iterative strategy. For example, the following well-defined stars have been successfully synthesized: 3-arm ABC, 4-arm ABCD, 5-arm ABCDE, 6-arm ABCDEF, 7-arm ABCDEFG, 6-arm ABC, 9-arm ABC, 12-arm ABC, 13-arm ABCD, 9-arm AB, 17-arm AB, 33-arm AB, 7-arm ABC, 15-arm ABCD, and 31-arm ABCDE miktoarm star polymers, most of which are quite new and difficult to synthesize by the end of the 1990s. Several new specialty functional star polymers composed of vinyl polymer segments and rigid rodlike poly(acetylene) arms, helical polypeptide, or helical poly(hexyl isocyanate) arms are introduced.

884 Cal.BP and all that

International Nuclear Information System (INIS)

Switsur, Roy

1986-01-01

A history of the development of the technique of radiocarbon dating highlights the two problems with this method. The first is calibration; the radiocarbon calendar is not linear. However two independent experiments to provide high precision measurements in tree rings have resulted in a high precision calibration curve. The second is how to denote radiocarbon ages and calibrated dates, as this depends on how the dendrochronology time scale used in the calibration is transferred to the actual calendar. If the zero of the dendroscale is transferred from the origin of the Christian calendar to AD 1950, radiocarbon ages are designated CAL BP (BP = before present). There is an alternative method which results in CAL AD and CAL BC. A suggestion for a standard notation is made to avoid the confusion of two systems. (U.K.)

Outsourcing HR Services: The Role of Human Resource Intermediaries

Science.gov (United States)

Kock, Henrik; Wallo, Andreas; Nilsson, Barbro; Hoglund, Cecilia

2012-01-01

Purpose: In this article, the area of interest is an emerging type of organisation called human resource intermediaries (HRIs), which focus on delivering human resource (HR) services to public sector organisations and private companies. The purpose of this article is, thus, to explore HRIs as deliverers of HR services. More specifically, the…

African American Accounting Majors and the 150-hr Requirement

Science.gov (United States)

Booker, Quinton; Hill, Cecil L.; Wright, Carl

2010-01-01

The study provides information on African American accounting majors' views regarding 150-hr issues. The authors collected data from 152 students at two schools. Students at one school supported the requirement while those at the other school did not. However, students believed that the 150-hr requirement enhances the quality of certified public…

BP teatas harvast edusammust / Hendrik Vosman

Index Scriptorium Estoniae

Vosman, Hendrik

2010-01-01

Naftakompanii BP teatas, et suudab Mehhiko lahest päevas kinni püüda sinna lekkinud 10 000 barrelit naftat. Tegu on ajutise lahendusega, lõplikult peaks naftavoo peatama merepõhja puuritavad nn. asenduskaevud

STELLAR CORONAE, SOLAR FLARES: A DETAILED COMPARISON OF {sigma} GEM, HR 1099, AND THE SUN IN HIGH-RESOLUTION X-RAYS

Energy Technology Data Exchange (ETDEWEB)

Huenemoerder, David P. [Massachusetts Institute of Technology, Kavli Institute for Astrophysics and Space Research, 70 Vassar St., Cambridge, MA 02139 (United States); Phillips, Kenneth J. H. [Visiting Scientist, Space Research Center, Polish Academy of Sciences, 51-622, Kopernika 11, Wroclaw (Poland); Sylwester, Janusz; Sylwester, Barbara, E-mail: dph@space.mit.edu, E-mail: kennethjhphillips@yahoo.com, E-mail: js@cbk.pan.wroc.pl, E-mail: bs@cbk.pan.wroc.pl [Space Research Center, Polish Academy of Sciences, 51-622, Kopernika 11, Wroclaw (Poland)

2013-05-10

The Chandra High Energy Transmission Grating Spectrometer (HETG) spectra of the coronally active binary stars {sigma} Gem and HR 1099 are among the highest fluence observations for such systems taken at high spectral resolution in X-rays with this instrument. This allows us to compare their properties in detail to solar flare spectra obtained with the Russian CORONAS-F spacecraft's RESIK instrument at similar resolution in an overlapping bandpass. Here we emphasize the detailed comparisons of the 3.3-6.1 A region (including emission from highly ionized S, Si, Ar, and K) from solar flare spectra to the corresponding {sigma} Gem and HR 1099 spectra. We also model the larger wavelength range of the HETG, from 1.7 to 25 A - having emission lines from Fe, Ca, Ar, Si, Al, Mg, Ne, O, and N-to determine coronal temperatures and abundances. {sigma} Gem is a single-lined coronally active long-period binary which has a very hot corona. HR 1099 is a similar, but shorter period, double-lined system. With very deep HETG exposures we can even study emission from some of the weaker species, such as K, Na, and Al, which are important since they have the lowest first ionization potentials, a parameter well known to be correlated with elemental fractionation in the solar corona. The solar flare temperatures reach Almost-Equal-To 20 MK, comparable to the {sigma} Gem and HR 1099 coronae. During the Chandra exposures, {sigma} Gem was slowly decaying from a flare and its spectrum is well characterized by a collisional ionization equilibrium plasma with a broad temperature distribution ranging from 2 to 60 MK, peaking near 25 MK, but with substantial emission from 50 MK plasma. We have detected K XVIII and Na XI emission which allow us to set limits on their abundances. HR 1099 was also quite variable in X-rays, also in a flare state, but had no detectable K XVIII. These measurements provide new comparisons of solar and stellar coronal abundances, especially at the lowest first

Characterization of a cancer cell line that expresses a splicing variant form of 53BP1: Separation of checkpoint and repair functions in 53BP1

International Nuclear Information System (INIS)

Iwabuchi, Kuniyoshi; Matsui, Tadashi; Hashimoto, Mitsumasa; Matsumoto, Yoshihisa; Kurihara, Takayuki; Date, Takayasu

2008-01-01

53BP1 plays important roles in checkpoint signaling and repair for DNA double-strand breaks. We found that a colon cancer cell line, SW48, expressed a splicing variant form of 53BP1, which lacks the residues corresponding to exons 10 and 11. Activation of ATM and phosphorylation of ATM and ATR targets occurred in SW48 cells in response to X-irradiation, and these X-ray-induced responses were not enhanced by expression of full-length 53BP1 in SW48 cells, indicating that this splicing variant fully activates the major checkpoint signaling in SW48 cells. In contrast, the expression of full-length 53BP1 in SW48 cells promoted the repair of X-ray-induced DNA damage, evidenced by faster disappearance of X-ray-induced γ-H2AX foci, a marker for DNA damage, and less residual chromosomal aberrations after X-irradiation. We conclude that the two major roles of 53BP1, the checkpoint signaling and repair for DNA damage, can be functionally separated

IGF2BP3 Modulates the Interaction of Invasion-Associated Transcripts with RISC

Directory of Open Access Journals (Sweden)

Hanane Ennajdaoui

2016-05-01

Full Text Available Insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3 expression correlates with malignancy, but its role(s in pathogenesis remains enigmatic. We interrogated the IGF2BP3-RNA interaction network in pancreatic ductal adenocarcinoma (PDAC cells. Using a combination of genome-wide approaches, we have identified 164 direct mRNA targets of IGF2BP3. These transcripts encode proteins enriched for functions such as cell migration, proliferation, and adhesion. Loss of IGF2BP3 reduced PDAC cell invasiveness and remodeled focal adhesion junctions. Individual nucleotide resolution crosslinking immunoprecipitation (iCLIP revealed significant overlap of IGF2BP3 and microRNA (miRNA binding sites. IGF2BP3 promotes association of the RNA-induced silencing complex (RISC with specific transcripts. Our results show that IGF2BP3 influences a malignancy-associated RNA regulon by modulating miRNA-mRNA interactions.

IGF2BP3 Modulates the Interaction of Invasion-Associated Transcripts with RISC.

Science.gov (United States)

Ennajdaoui, Hanane; Howard, Jonathan M; Sterne-Weiler, Timothy; Jahanbani, Fereshteh; Coyne, Doyle J; Uren, Philip J; Dargyte, Marija; Katzman, Sol; Draper, Jolene M; Wallace, Andrew; Cazarez, Oscar; Burns, Suzanne C; Qiao, Mei; Hinck, Lindsay; Smith, Andrew D; Toloue, Masoud M; Blencowe, Benjamin J; Penalva, Luiz O F; Sanford, Jeremy R

2016-05-31

Insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3) expression correlates with malignancy, but its role(s) in pathogenesis remains enigmatic. We interrogated the IGF2BP3-RNA interaction network in pancreatic ductal adenocarcinoma (PDAC) cells. Using a combination of genome-wide approaches, we have identified 164 direct mRNA targets of IGF2BP3. These transcripts encode proteins enriched for functions such as cell migration, proliferation, and adhesion. Loss of IGF2BP3 reduced PDAC cell invasiveness and remodeled focal adhesion junctions. Individual nucleotide resolution crosslinking immunoprecipitation (iCLIP) revealed significant overlap of IGF2BP3 and microRNA (miRNA) binding sites. IGF2BP3 promotes association of the RNA-induced silencing complex (RISC) with specific transcripts. Our results show that IGF2BP3 influences a malignancy-associated RNA regulon by modulating miRNA-mRNA interactions. Copyright © 2016 The Author(s). Published by Elsevier Inc. All rights reserved.

Nuclear planetology: understanding habitable planets as Galactic bulge stellar remnants (black dwarfs) in a Hertzsprung-Russell (HR) diagram

Science.gov (United States)

Roller, Goetz

2016-04-01

The Hertzsprung-Russell (HR) diagram is one of the most important diagrams in astronomy. In a HR diagram, the luminosity of stars and/or stellar remnants (white dwarf stars, WD's), relative to the luminosity of the sun, is plotted versus their surface temperatures (Teff). The Earth shows a striking similarity in size (radius ≈ 6.370 km) and Teff of its outer core surface (Teff ≈ 3800 K at the core-mantle-boundary) with old WD's (radius ≈ 6.300 km) like WD0346+246 (Teff ≈ 3820 K after ≈ 12.7 Ga [1]), which plot in the HR diagram close to the low-mass extension of the stellar population or main sequence. In the light of nuclear planetology [2], Earth-like planets are regarded as old, down-cooled and differentiated black dwarfs (Fe-C BLD's) after massive decompression, the most important nuclear reactions involved being 56Fe(γ,α)52Cr (etc.), possibly responsible for extreme terrestrial glaciations events ("snowball" Earth), together with (γ,n), (γ,p) and fusion reactions like 12C(α,γ)16O. The latter reaction might have caused oxidation of the planet from inside out. Nuclear planetology is a new research field, tightly constrained by a coupled 187Re-232Th-238U systematics. By means of nuclear/quantum physics and taking the theory of relativity into account, it aims at understanding the thermal and chemical evolution of Fe-C BLD's after gravitational contraction (e.g. Mercury) or Fermi-pressure controlled collapse (e.g. Earth) events after massive decompression, leading possibly to an r-process event, towards the end of their cooling period [2]. So far and based upon 187Re-232Th-238U nuclear geochronometry, the Fe-C BLD hypothesis can successfully explain the global terrestrial MORB 232Th/238U signature [3]. Thus, it may help to elucidate the DM (depleted mantle), EMI (enriched mantle 1), EMII (enriched mantle 2) or HIMU (high U/Pb) reservoirs, and the 187Os/188Os isotopic dichotomy in Archean magmatic rocks and sediments [4]. Here I present a conceptual

BP Canada Energy Company : climate change action plan update 1999-2000

International Nuclear Information System (INIS)

2001-10-01

An aggressive, world-wide target for a 10 per cent reduction of greenhouse gas emissions was set by BP p.l.c. and BP Canada Energy Company has supported this endeavour. Six major areas have been identified as offering potential solutions to the problem of climate change: the control of greenhouse gases, the conservation of energy, the introduction of new technologies, the promotion of flexible market instruments, the participation in the policy process, and an investment in research. This document reviewed the efforts expanded to date in those areas. It was noted that a deliberate shift was made by BP leadership from oil to natural gas production, releasing much less carbon dioxide in the atmosphere when burned. A brief overview of the operations of BP Canada Energy Company was provided in chapter 1, followed by the philosophy concerning greenhouse gases in chapter 2. In chapter 3, the topic of BP's global emissions trading system was discussed. The current and projected greenhouse gas emissions were looked at in chapter 4, while chapter 5 dealt with setting global targets, with specific emphasis on Canadian targets. In chapter 6 , the emphasis was placed on BP's emission reduction initiatives. In chapter 7, the question of raising awareness was examined. 7 tabs., 7 figs

Statistical investigation of flare stars. III. Flare stars in the general galactic star field

International Nuclear Information System (INIS)

Mirzoyan, L.V.; Ambaryan, V.V.; Garibdzhanyan, A.T.; Mirzoyan, A.L.

1989-01-01

Some questions relating to the existence of a large number of flare stars in the general star field of the Galaxy are discussed. It is shown that only a small proportion of them can be found by photographic observations, and the fraction of field flare stars among such stars found in the regions of star clusters and associations does not exceed 10%. The ratio of the numbers of flare stars of the foreground and the background for a particular system depends on its distance, reaching zero at a distance of about 500 pc. The spatial density of flare stars in the Pleiades is at least two orders of magnitude greater than in the general galactic field. A lower limit for the number of flare stars in the Galaxy is estimated at 4.2 ·10 9 , and the number of nonflare red dwarfs at 2.1·10 10 . There are grounds for believing that they were all formed in star clusters and associations

Neutron star/red giant encounters in globular clusters

International Nuclear Information System (INIS)

Bailyn, C.D.

1988-01-01

The author presents a simple expression for the amount by which xsub(crit) is diminished as a star evolves xsub(crit) Rsub(crit)/R*, where Rsub(crit) is the maximum distance of closest approach between two stars for which the tidal energy is sufficient to bind the system, and R* is the radius of the star on which tides are being raised. Also it is concluded that tidal capture of giants by neutron stars resulting in binary systems is unlikely in globular clusters. However, collisions between neutron stars and red giants, or an alternative process involving tidal capture of a main-sequence star into an initially detached binary system, may result either in rapidly rotating neutron stars or in white dwarf/neutron star binaries. (author)

Cuff inflation during ambulatory blood pressure monitoring and heart rate

Directory of Open Access Journals (Sweden)

Mia Skov-Madsen

2008-11-01

Full Text Available Mia Skov-Madsen, My Svensson, Jeppe Hagstrup ChristensenDepartment of Nephrology, Aarhus University Hospital, Aalborg, DenmarkIntroduction: Twenty four-hour ambulatory blood pressure monitoring is a clinically validated procedure in evaluation of blood pressure (BP. We hypothesised that the discomfort during cuff inflation would increase the heart rate (HR measured with 24-h ambulatory BP monitoring compared to a following HR measurement with a 24-h Holter monitor.Methods: The study population (n = 56 were recruited from the outpatient’s clinic at the Department of Nephrology, Aalborg Hospital, Aarhus University Hospital at Aalborg, Denmark. All the patients had chronic kidney disease (CKD. We compared HR measured with a 24-h Holter monitor with a following HR measured by a 24-h ambulatory BP monitoring.Results: We found a highly significant correlation between the HR measured with the Holter monitor and HR measured with 24-h ambulatory blood pressure monitoring (r = 0.77, p < 0.001. Using the Bland-Altman plot, the mean difference in HR was only 0.5 beat/min during 24 hours with acceptable limits of agreement for both high and low HR levels. Dividing the patients into groups according to betablocker treatment, body mass index, age, sex, angiotensin-converting enzyme inhibitor treatment, statins treatment, diuretic treatment, or calcium channel blocker treatment revealed similar results as described above.Conclusion: The results indicate that the discomfort induced by cuff inflation during 24-h ambulatory BP monitoring does not increase HR. Thus, 24-h ambulatory BP monitoring may be a reliable measurement of the BP among people with CKD.Keywords: ambulatory blood pressure monitoring, Holter monitoring, heart rate, chronic kidney disease, hypertension

Preliminary Geological Findings on the BP-1 Simulant

Science.gov (United States)

Stoeser, D. B.; Rickman, D. L.; Wilson, S.

2010-01-01

A waste material from an aggregate producing quarry has been used to make an inexpensive lunar simulant called BP-1. The feedstock is the Black Point lava flow in northern Arizona. Although this is part of the San Francisco volcanic field, which is also the source of the JSC-1 series feedstock, BP-1 and JSC-1 are distinct. Chemically, the Black Point flow is an amygdaloidal nepheline-bearing basalt. The amygdules are filled with secondary minerals containing opaline silica, calcium carbonate, and ferric iron minerals. X-ray diffraction (XRD) detected approximately 3% quartz, which is in line with tests done by the Kennedy Space Center Industrial Hygiene Office. Users of this material should use appropriate protective equipment. XRD also showed the presence of significant halite and some bassanite. Both are interpreted to be evaporative residues due to recycling of wash water at the quarry. The size distribution of BP-1 may be superior to some other simulants for some applications.

Symbiotic stars

International Nuclear Information System (INIS)

Boyarchuk, A.A.

1975-01-01

There are some arguments that the symbiotic stars are binary, where one component is a red giant and the other component is a small hot star which is exciting a nebula. The symbiotic stars belong to the old disc population. Probably, symbiotic stars are just such an evolutionary stage for double stars as planetary nebulae for single stars. (Auth.)

Quark core stars, quark stars and strange stars

International Nuclear Information System (INIS)

Grassi, F.

1988-01-01

A recent one flavor quark matter equation of state is generalized to several flavors. It is shown that quarks undergo a first order phase transition. In addition, this equation of state depends on just one parameter in the two flavor case, two parameters in the three flavor case, and these parameters are constrained by phenomenology. This equation of state is then applied to the hadron-quark transition in neutron stars and the determination of quark star stability, the investigation of strange matter stability and possible strange star existence. 43 refs., 6 figs

Enabling quaternion derivatives: the generalized HR calculus

Science.gov (United States)

Xu, Dongpo; Jahanchahi, Cyrus; Took, Clive C.; Mandic, Danilo P.

2015-01-01

Quaternion derivatives exist only for a very restricted class of analytic (regular) functions; however, in many applications, functions of interest are real-valued and hence not analytic, a typical case being the standard real mean square error objective function. The recent HR calculus is a step forward and provides a way to calculate derivatives and gradients of both analytic and non-analytic functions of quaternion variables; however, the HR calculus can become cumbersome in complex optimization problems due to the lack of rigorous product and chain rules, a consequence of the non-commutativity of quaternion algebra. To address this issue, we introduce the generalized HR (GHR) derivatives which employ quaternion rotations in a general orthogonal system and provide the left- and right-hand versions of the quaternion derivative of general functions. The GHR calculus also solves the long-standing problems of product and chain rules, mean-value theorem and Taylor's theorem in the quaternion field. At the core of the proposed GHR calculus is quaternion rotation, which makes it possible to extend the principle to other functional calculi in non-commutative settings. Examples in statistical learning theory and adaptive signal processing support the analysis. PMID:26361555

Conformational Dynamics of apo-GlnBP Revealed by Experimental and Computational Analysis

KAUST Repository

Feng, Yitao

2016-10-13

The glutamine binding protein (GlnBP) binds l-glutamine and cooperates with its cognate transporters during glutamine uptake. Crystal structure analysis has revealed an open and a closed conformation for apo- and holo-GlnBP, respectively. However, the detailed conformational dynamics have remained unclear. Herein, we combined NMR spectroscopy, MD simulations, and single-molecule FRET techniques to decipher the conformational dynamics of apo-GlnBP. The NMR residual dipolar couplings of apo-GlnBP were in good agreement with a MD-derived structure ensemble consisting of four metastable states. The open and closed conformations are the two major states. This four-state model was further validated by smFRET experiments and suggests the conformational selection mechanism in ligand recognition of GlnBP. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim

Fault Diagnosis of Power System Based on Improved Genetic Optimized BP-NN

Directory of Open Access Journals (Sweden)

Yuan Pu

2015-01-01

Full Text Available BP neural network (Back-Propagation Neural Network, BP-NN is one of the most widely neural network models and is applied to fault diagnosis of power system currently. BP neural network has good self-learning and adaptive ability and generalization ability, but the operation process is easy to fall into local minima. Genetic algorithm has global optimization features, and crossover is the most important operation of the Genetic Algorithm. In this paper, we can modify the crossover of traditional Genetic Algorithm, using improved genetic algorithm optimized BP neural network training initial weights and thresholds, to avoid the problem of BP neural network fall into local minima. The results of analysis by an example, the method can efficiently diagnose network fault location, and improve fault-tolerance and grid fault diagnosis effect.

Conformational Dynamics of apo-GlnBP Revealed by Experimental and Computational Analysis

KAUST Repository

Feng, Yitao; Zhang, Lu; Wu, Shaowen; Liu, Zhijun; Gao, Xin; Zhang, Xu; Liu, Maili; Liu, Jianwei; Huang, Xuhui; Wang, Wenning

2016-01-01

The glutamine binding protein (GlnBP) binds l-glutamine and cooperates with its cognate transporters during glutamine uptake. Crystal structure analysis has revealed an open and a closed conformation for apo- and holo-GlnBP, respectively. However, the detailed conformational dynamics have remained unclear. Herein, we combined NMR spectroscopy, MD simulations, and single-molecule FRET techniques to decipher the conformational dynamics of apo-GlnBP. The NMR residual dipolar couplings of apo-GlnBP were in good agreement with a MD-derived structure ensemble consisting of four metastable states. The open and closed conformations are the two major states. This four-state model was further validated by smFRET experiments and suggests the conformational selection mechanism in ligand recognition of GlnBP. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim

Kinematic and spatial distributions of barium stars - are the barium stars and Am stars related?

International Nuclear Information System (INIS)

Hakkila, J.

1989-01-01

The possibility of an evolutionary link between Am stars and barium stars is considered, and an examination of previous data suggests that barium star precursors are main-sequence stars of intermediate mass, are most likely A and/or F dwarfs, and are intermediate-mass binaries with close to intermediate orbital separations. The possible role of mass transfer in the later development of Am systems is explored. Mass transfer and loss from systems with a range of masses and orbital separations may explain such statistical peculiarities of barium stars as the large dispersion in absolute magnitude, the large range of elemental abundances from star to star, and the small number of stars with large peculiar velocities. 93 refs

TopBP1-mediated DNA processing during mitosis.

Science.gov (United States)

Gallina, Irene; Christiansen, Signe Korbo; Pedersen, Rune Troelsgaard; Lisby, Michael; Oestergaard, Vibe H

2016-01-01

Maintenance of genome integrity is crucial to avoid cancer and other genetic diseases. Thus faced with DNA damage, cells mount a DNA damage response to avoid genome instability. The DNA damage response is partially inhibited during mitosis presumably to avoid erroneous processing of the segregating chromosomes. Yet our recent study shows that TopBP1-mediated DNA processing during mitosis is highly important to reduce transmission of DNA damage to daughter cells. (1) Here we provide an overview of the DNA damage response and DNA repair during mitosis. One role of TopBP1 during mitosis is to stimulate unscheduled DNA synthesis at underreplicated regions. We speculated that such genomic regions are likely to hold stalled replication forks or post-replicative gaps, which become the substrate for DNA synthesis upon entry into mitosis. Thus, we addressed whether the translesion pathways for fork restart or post-replicative gap filling are required for unscheduled DNA synthesis in mitosis. Using genetics in the avian DT40 cell line, we provide evidence that unscheduled DNA synthesis in mitosis does not require the translesion synthesis scaffold factor Rev1 or PCNA ubiquitylation at K164, which serve to recruit translesion polymerases to stalled forks. In line with this finding, translesion polymerase η foci do not colocalize with TopBP1 or FANCD2 in mitosis. Taken together, we conclude that TopBP1 promotes unscheduled DNA synthesis in mitosis independently of the examined translesion polymerases.

BP pääseb lekkest kuiva nahaga / Heiki Suurkask

Index Scriptorium Estoniae

Suurkask, Heiki, 1972-

2010-01-01

BP saab peagi valmis tagavara-naftapuuraugu, lekkinud puuraugule õnnestus peale valada betoonkiht. Autor märgib, et tegelikult ei saa USA võimud ühtegi edusammu naftalekke peatamisel selgelt oma nimele kirjutada ning ainsaks kaotajaks selles lekkes peale looduse ja kalurite paistab olevat ameti kaotav BP juht Tony Hatward

The Star Formation Scenario in the Galactic Range from Ophiuchus to Chamaeleon

Science.gov (United States)

Sartori, Marília J.

2000-07-01

two stellar populations is very similar. We estimated the age of the PMS stars using H-R diagrams constructed with photometric data, spectral type and HIPPARCOS parallaxes, when available. We also re-determined the age of the OB associations using the same method. The comparison of the ages of the two populations shows that they are also similar. Our conclusion is that the two stellar populations have a common global origin. The arrangement of stars and molecular clouds in this extended region and the average velocity of the stars in the opposite direction of the galactic rotation, agree with the expected behavior of the star formation in a nearby spiral arm. On the other hand, the star formation by impact of high velocity clouds on the galactic disk and the sequential star formation do not explain our results. We conclude that the extended complex we have studied probably belongs to a spiral arm close to the Sun.

200-BP-5 operable unit Technical Baseline report

International Nuclear Information System (INIS)

Jacques, I.D.; Kent, S.K.

1991-10-01

This report supports development of a remedial investigation/feasibility study work plan for the 200-BP-5 operable unit. The report summarizes baseline information for waste sites and unplanned release sites located in the 200-BP-5 operable unit. The sites were investigated by the Technical Baseline Section of the Environmental Engineering Group, Westinghouse Hanford Company (Westinghouse Hanford). The investigation consisted of review and evaluation of current and historical Hanford Site reports, drawings, and photographs, and was supplemented with recent inspections of the Hanford Site and employee interviews. No field investigations or sampling were conducted

Advertising as Insurance or Commitment? Evidence from the BP Oil Spill

OpenAIRE

Lint Barrage; Eric Chyn; Justine Hastings

2014-01-01

This paper explores how advertising impacts the consumer response to news about unobserved product quality. Specifically, we estimate how British Petroleum’s (BP) 2000-2008 “Beyond Petroleum” advertising campaign affected the impact of the 2010 BP oil spill. We find that BP station margins declined by 4.2 cents per gallon, and volumes declined by 3.6 percent after the spill. However, pre-spill advertising significantly dampened the price response in the short-run, and reduced the fraction of ...

An expert computer program for classifying stars on the MK spectral classification system

International Nuclear Information System (INIS)

Gray, R. O.; Corbally, C. J.

2014-01-01

This paper describes an expert computer program (MKCLASS) designed to classify stellar spectra on the MK Spectral Classification system in a way similar to humans—by direct comparison with the MK classification standards. Like an expert human classifier, the program first comes up with a rough spectral type, and then refines that spectral type by direct comparison with MK standards drawn from a standards library. A number of spectral peculiarities, including barium stars, Ap and Am stars, λ Bootis stars, carbon-rich giants, etc., can be detected and classified by the program. The program also evaluates the quality of the delivered spectral type. The program currently is capable of classifying spectra in the violet-green region in either the rectified or flux-calibrated format, although the accuracy of the flux calibration is not important. We report on tests of MKCLASS on spectra classified by human classifiers; those tests suggest that over the entire HR diagram, MKCLASS will classify in the temperature dimension with a precision of 0.6 spectral subclass, and in the luminosity dimension with a precision of about one half of a luminosity class. These results compare well with human classifiers.

An expert computer program for classifying stars on the MK spectral classification system

Energy Technology Data Exchange (ETDEWEB)

Gray, R. O. [Department of Physics and Astronomy, Appalachian State University, Boone, NC 26808 (United States); Corbally, C. J. [Vatican Observatory Research Group, Tucson, AZ 85721-0065 (United States)

2014-04-01

This paper describes an expert computer program (MKCLASS) designed to classify stellar spectra on the MK Spectral Classification system in a way similar to humans—by direct comparison with the MK classification standards. Like an expert human classifier, the program first comes up with a rough spectral type, and then refines that spectral type by direct comparison with MK standards drawn from a standards library. A number of spectral peculiarities, including barium stars, Ap and Am stars, λ Bootis stars, carbon-rich giants, etc., can be detected and classified by the program. The program also evaluates the quality of the delivered spectral type. The program currently is capable of classifying spectra in the violet-green region in either the rectified or flux-calibrated format, although the accuracy of the flux calibration is not important. We report on tests of MKCLASS on spectra classified by human classifiers; those tests suggest that over the entire HR diagram, MKCLASS will classify in the temperature dimension with a precision of 0.6 spectral subclass, and in the luminosity dimension with a precision of about one half of a luminosity class. These results compare well with human classifiers.

Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

International Nuclear Information System (INIS)

Kanginakudru, Sriramana; DeSmet, Marsha; Thomas, Yanique; Morgan, Iain M.; Androphy, Elliot J.

2015-01-01

The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication

Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

Energy Technology Data Exchange (ETDEWEB)

Kanginakudru, Sriramana, E-mail: skangina@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); DeSmet, Marsha, E-mail: mdesmet@iupui.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Thomas, Yanique, E-mail: ysthomas@umail.iu.edu [Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States); Morgan, Iain M., E-mail: immorgan@vcu.edu [VCU Philips Institute for Oral Health Research, Virginia Commonwealth University, Richmond, Virginia (United States); Androphy, Elliot J., E-mail: eandro@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States)

2015-04-15

The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication.

CROATIAN ADULT SPOKEN LANGUAGE CORPUS (HrAL

Directory of Open Access Journals (Sweden)

Jelena Kuvač Kraljević

2016-01-01

Full Text Available Interest in spoken-language corpora has increased over the past two decades leading to the development of new corpora and the discovery of new facets of spoken language. These types of corpora represent the most comprehensive data source about the language of ordinary speakers. Such corpora are based on spontaneous, unscripted speech defined by a variety of styles, registers and dialects. The aim of this paper is to present the Croatian Adult Spoken Language Corpus (HrAL, its structure and its possible applications in different linguistic subfields. HrAL was built by sampling spontaneous conversations among 617 speakers from all Croatian counties, and it comprises more than 250,000 tokens and more than 100,000 types. Data were collected during three time slots: from 2010 to 2012, from 2014 to 2015 and during 2016. HrAL is today available within TalkBank, a large database of spoken-language corpora covering different languages (https://talkbank.org, in the Conversational Analyses corpora within the subsection titled Conversational Banks. Data were transcribed, coded and segmented using the transcription format Codes for Human Analysis of Transcripts (CHAT and the Computerised Language Analysis (CLAN suite of programmes within the TalkBank toolkit. Speech streams were segmented into communication units (C-units based on syntactic criteria. Most transcripts were linked to their source audios. The TalkBank is public free, i.e. all data stored in it can be shared by the wider community in accordance with the basic rules of the TalkBank. HrAL provides information about spoken grammar and lexicon, discourse skills, error production and productivity in general. It may be useful for sociolinguistic research and studies of synchronic language changes in Croatian.

Interactions of the human MCM-BP protein with MCM complex components and Dbf4.

Directory of Open Access Journals (Sweden)

Tin Nguyen

Full Text Available MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.

Interactions of the human MCM-BP protein with MCM complex components and Dbf4.

Science.gov (United States)

Nguyen, Tin; Jagannathan, Madhav; Shire, Kathy; Frappier, Lori

2012-01-01

MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.

Value creation through HR shared services: towards a conceptual framework

NARCIS (Netherlands)

Meijerink, Jeroen Gerard; Bondarouk, Tatiana; Looise, Jan C.

2013-01-01

Purpose – The purpose of this paper is to derive a measure for the performance of human resource shared service providers (HR SSPs) and then to develop a theoretical framework that conceptualises their performance. Design/methodology/approach – This conceptual paper starts from the HR shared

Gauging the Galactic thick disk with RR Lyrae stars

Directory of Open Access Journals (Sweden)

Cruz G.

2012-02-01

Full Text Available In this contribution we present results from the QUEST RR Lyrae Survey of the thick disk. The survey spans ~480 sq. deg. at low latitude |b| < 30°, with multi-epoch VRI observations, obtained with the QUEST-I camera at the 1m Jürgen Stock Schmidt telescope located at the National Astronomical Observatory of Venezuela. This constitutes the first deep RR Lyrae survey of the Galactic thick disk conducted at low galactic latitudes, covering simultaneously a large range in radial (8stars having accurate distances (errors <7% and individual reddenings derived from each star’s color curve at minimum light. Moreover, the use of RR Lyrae stars as tracers ensures negligible contamination from the Galactic thin disk. We find a thick disk mean scale height hZ = 0.94 ± 0.11kpc and scale length hR = 3.2 ± 0.4kpc, derived from the vertical and radial mean density profiles of RR Lyrae stars. We also find evidence of thick disk flaring and results that may suggest the thick disk radial density profile shows signs of antitruncation. We discuss our findings in the context of recent thick disk formation models.

CERN HR receives award for on-line recruitment and communication

CERN Multimedia

Joannah Caborn Wengler

2012-01-01

In a survey of 21,000 European students, CERN ranked 15th, ahead of giants like Microsoft and Nestlé, for the quality of its on-line "talent communication", that is how it uses the Internet to attract job applicants. HR now boasts a new virtual award, certifying its on-line savvy.   The "virtual" award given to HR. How did you get your job at CERN? Via the CERN HR website, or Facebook, or Twitter? Or were you headhunted on LinkedIn? Particularly if you’re from the younger generation, chances are that you used some form of on-line recruitment. In this case you will have used one of the best recruitment tools in Europe, according to the 2012 OTaC (Online Talent Communication) study, carried out by a research institute named Potentialpark. It surveyed over 21,000 students, asking them to rate employers’ use of seven different channels of communication about jobs and careers, from HR websites and on-line application systems to the...

Bp'S Baku-Tbilisi-Ceyhan pipeline: the new corporate colonialism.

Science.gov (United States)

Marriott, James; Muttitt, Greg

2006-01-01

An international campaign was waged questioning the benefits of BP's Baku-Tbilisi-Ceyhan pipeline in an effort to avoid a "zone of sacrifice" there. This article is an offshoot of that effort and explains the contemporary struggle over the pipeline project. The authors describe the project's background and evaluate the actual and potential impacts of the project in which they consider eight areas. They also assess BP's capacity to confront resistance to the pipeline.

PLEIADES-HR IMAGE QUALITY COMMISSIONING

Directory of Open Access Journals (Sweden)

L. Lebègue

2012-07-01

Full Text Available PLEIADES is the highest resolution civilian earth observing system ever developed in Europe. This imagery program is conducted by the French National Space Agency, CNES. It operates since 2012 a first satellite PLEIADES-HR launched on 2011 December 17th, a second one should be launched by the end of the year. Each satellite is designed to provide optical 70 cm resolution coloured images to civilian and defence users. The Image Quality requirements were defined from users studies from the different spatial imaging applications, taking into account the trade-off between on-board technological complexity and ground processing capacity. The assessment of the image quality and the calibration operation have been performed by CNES Image Quality team during the 6 month commissioning phase that followed the satellite launch. These activities cover many topics gathered in two families : radiometric and geometric image quality. The new capabilities offered by PLEIADES-HR agility allowed to imagine new methods of image calibration and performance assessment. Starting from an overview of the satellite characteristics, this paper presents all the calibration operations that were conducted during the commissioning phase and also gives the main results for every image quality performance.

Composite Spectra Paper 1: HR 6902

Indian Academy of Sciences (India)

tribpo

spectra; in many cases we have used the maximum width permitted by the optics of ... 10 mЕ, corresponding to 1 µm the plate, are the norm. ..... an inequality ..... on the spectra of HR 6902, we have thought it appropriate to weight the four ...

A Brightness-Referenced Star Identification Algorithm for APS Star Trackers

Science.gov (United States)

Zhang, Peng; Zhao, Qile; Liu, Jingnan; Liu, Ning

2014-01-01

Star trackers are currently the most accurate spacecraft attitude sensors. As a result, they are widely used in remote sensing satellites. Since traditional charge-coupled device (CCD)-based star trackers have a limited sensitivity range and dynamic range, the matching process for a star tracker is typically not very sensitive to star brightness. For active pixel sensor (APS) star trackers, the intensity of an imaged star is valuable information that can be used in star identification process. In this paper an improved brightness referenced star identification algorithm is presented. This algorithm utilizes the k-vector search theory and adds imaged stars' intensities to narrow the search scope and therefore increase the efficiency of the matching process. Based on different imaging conditions (slew, bright bodies, etc.) the developed matching algorithm operates in one of two identification modes: a three-star mode, and a four-star mode. If the reference bright stars (the stars brighter than three magnitude) show up, the algorithm runs the three-star mode and efficiency is further improved. The proposed method was compared with other two distinctive methods the pyramid and geometric voting methods. All three methods were tested with simulation data and actual in orbit data from the APS star tracker of ZY-3. Using a catalog composed of 1500 stars, the results show that without false stars the efficiency of this new method is 4∼5 times that of the pyramid method and 35∼37 times that of the geometric method. PMID:25299950

Why a well-designed HR shared service provider fails to create end-user value?

NARCIS (Netherlands)

Meijerink, Jeroen Gerard; Bondarouk, Tatiana; Looise, Jan C.

2011-01-01

Human resource shared services centres (HR SSCs) are foreseen as improving HR service delivery for their end-users: employees, line managers and decentralized HR professionals. Although the concept expects the benefits of HR SSCs to come from centralizing knowledge and decentralizing the control

Correlation of expression of BP1, a homeobox gene, with estrogen receptor status in breast cancer

International Nuclear Information System (INIS)

Fu, Sidney W; Poola, Indira; Stephan, Dietrich A; Berg, Patricia E; Schwartz, Arnold; Stevenson, Holly; Pinzone, Joseph J; Davenport, Gregory J; Orenstein, Jan M; Gutierrez, Peter; Simmens, Samuel J; Abraham, Jessy

2003-01-01

BP1 is a novel homeobox gene cloned in our laboratory. Our previous studies in leukemia demonstrated that BP1 has oncogenic properties, including as a modulator of cell survival. Here BP1 expression was examined in breast cancer, and the relationship between BP1 expression and clinicopathological data was determined. Total RNA was isolated from cell lines, tumors, and matched normal adjacent tissue or tissue from autopsy. Reverse transcription polymerase chain reaction was performed to evaluate BP1 expression. Statistical analysis was accomplished with SAS. Analysis of 46 invasive ductal breast tumors demonstrated BP1 expression in 80% of them, compared with a lack of expression in six normal breast tissues and low-level expression in one normal breast tissue. Remarkably, 100% of tumors that were negative for the estrogen receptor (ER) were BP1-positive, whereas 73% of ER-positive tumors expressed BP1 (P = 0.03). BP1 expression was also associated with race: 89% of the tumors of African American women were BP1-positive, whereas 57% of those from Caucasian women expressed BP1 (P = 0.04). However, there was no significant difference in BP1 expression between grades I, II, and III tumors. Interestingly, BP1 mRNA expression was correlated with the ability of malignant cell lines to cause breast cancer in mice. Because BP1 is expressed abnormally in breast tumors, it could provide a useful target for therapy, particularly in patients with ER-negative tumors. The frequent expression of BP1 in all tumor grades suggests that activation of BP1 is an early event

Water ingestion decreases cardiac workload time-dependent in healthy adults with no effect of gender.

Science.gov (United States)

Monnard, Cathriona Rosemary; Grasser, Erik Konrad

2017-08-11

Ingestion of water entails a variety of cardiovascular responses. However, the precise effect remains elusive. We aimed to determine in healthy adults the effect of water on cardiac workload and to investigate potential gender differences. We pooled data from two controlled studies where blood pressure (BP) and heart rate (HR) were continuously recorded before and after the ingestion of 355 mL of tap water. Additionally, we calculated double product by multiplying systolic BP with HR and evaluated spectral parameters referring to vagal tone. All parameters were investigated for potential differences based on gender. In response to water, HR, systolic BP, and double product decreased significantly during the first 30 min. However, these effects were attenuated for HR and double product and even abolished for systolic BP over the subsequent 30 min. Over the entire post-drink period (60 min), decreases in HR and double product (all P fashion, cardiac workload and that these responses appear not to be influenced by gender.

Asteroseismic modelling of the solar-like star β Hydri

Science.gov (United States)

Doğan, G.; Brandão, I. M.; Bedding, T. R.; Christensen-Dalsgaard, J.; Cunha, M. S.; Kjeldsen, H.

2010-07-01

We present the results of modelling the subgiant star β Hydri using seismic observational constraints. We have computed several grids of stellar evolutionary tracks using the Aarhus STellar Evolution Code (ASTEC, Christensen-Dalsgaard in Astrophys. Space Sci. 316:13, 2008a), with and without helium diffusion and settling. For those models on each track that are located at the observationally determined position of β Hydri in the Hertzsprung-Russell (HR) diagram, we have calculated the oscillation frequencies using the Aarhus adiabatic pulsation package (ADIPLS, Christensen-Dalsgaard in Astrophys. Space Sci. 316:113, 2008b). Applying the near-surface corrections to the calculated frequencies using the empirical law presented by Kjeldsen et al. (Astrophys. J. 683:L175, 2008), we have compared the corrected model frequencies with the observed frequencies of the star. We show that after correcting the frequencies for the near-surface effects, we have a fairly good fit for both l=0 and l=2 frequencies. We also have good agreement between the observed and calculated l=1 mode frequencies, although there is room for improvement in order to fit all the observed mixed modes simultaneously.

Comparisons between observational color-magnitude diagrams and synthetic cluster diagrams for young star clusters in the Magellanic Clouds

International Nuclear Information System (INIS)

Recker, S.A.; Brunish, W.M.; Mathews, G.J.

1984-01-01

Young star clusters ( 8 yr) in the Magellanic Clouds (MC) can be used to test the current status of the theory of stellar evolution as applied to intermediate and massive stars. The color-magnitude diagram of many young clusters in the MC shows large numbers of stars in both the main sequence and post main sequence evolutionary phases. Using a grid of stellar evolution models, synthetic cluster H-R diagrams are constructed and compared to observed color-magnitude diagrams to determine the age, age spread, and composition for any given cluster. In addition, for those cases where the data is of high quality, detailed comparisons between theory and observation can provide a diagnostic of the accuracy of the stellar evolution models. Initial indications of these comparisons suggest that the theoretical models should be altered to include: a larger value for the mixing length parameter, a larger rate of mass loss during the asymptotic giant branch phase, and possibly convective overshoot during the core burning phases. (Auth.)

200-BP-5 operable unit treatability test report

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-04-01

The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites.

200-BP-5 operable unit treatability test report

International Nuclear Information System (INIS)

1996-04-01

The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites

Validation of calcaneus trabecular microstructure measurements by HR-pQCT.

Science.gov (United States)

Metcalf, Louis M; Dall'Ara, Enrico; Paggiosi, Margaret A; Rochester, John R; Vilayphiou, Nicolas; Kemp, Graham J; McCloskey, Eugene V

2018-01-01

Assessment of calcaneus microstructure using high-resolution peripheral quantitative computed tomography (HR-pQCT) might be used to improve fracture risk predictions or to assess responses to pharmacological and physical interventions. To develop a standard clinical protocol for the calcaneus, we validated calcaneus trabecular microstructure measured by HR-pQCT against 'gold-standard' micro-CT measurements. Ten human cadaveric feet were scanned in situ using HR-pQCT (isotropic 82μm voxel size) at 100, 150 and 200ms integration times, and at 100ms integration time following removal of the calcaneus from the foot (ex vivo). Dissected portions of these bones were scanned using micro-computed tomography (micro-CT) at an isotropic 17.4μm voxel size. HR-pQCT images were rigidly registered to those obtained with micro-CT and divided into multiple 5mm sided cubes to evaluate and compare morphometric parameters between the modalities. Standard HR-pQCT measurements (derived bone volume fraction (BV/TV d ); trabecular number, Tb.N; derived trabecular thickness, Tb.Th d ; derived trabecular spacing, Tb.Sp d ) and corresponding micro-CT voxel-based measurements (BV/TV, Tb.N, Tb.Th, Tb.Sp) were compared. A total of 108 regions of interest were analysed across the 10 specimens. At all integration times HR-pQCT BV/TV d was strongly correlated with micro-CT BV/TV (r 2 =0.95-0.98, RMSE=1%), but BV/TV d was systematically lower than that measured by micro-CT (mean bias=5%). In contrast, HR-pQCT systematically overestimated Tb.N at all integration times; of the in situ scans, 200ms yielded the lowest mean bias and the strongest correlation with micro-CT (r 2 =0.61, RMSE=0.15mm -1 ). Regional analysis revealed greater accuracy for Tb.N in the superior regions of the calcaneus at all integration times in situ (mean bias=0.44-0.85mm -1 ; r 2 =0.70-0.88, pmicrostructure, particularly in the superior region of the calcaneus, can be assessed by HR-pQCT. The highest integration time

STELLAR DIAMETERS AND TEMPERATURES. II. MAIN-SEQUENCE K- AND M-STARS

Energy Technology Data Exchange (ETDEWEB)

Boyajian, Tabetha S.; McAlister, Harold A.; Jones, Jeremy; White, Russel; Henry, Todd; Gies, Douglas; Jao, Wei-Chun; Parks, J. Robert [Center for High Angular Resolution Astronomy and Department of Physics and Astronomy, Georgia State University, P.O. Box 4106, Atlanta, GA 30302-4106 (United States); Von Braun, Kaspar; Kane, Stephen R.; Ciardi, David [NASA Exoplanet Science Institute, California Institute of Technology, MC 100-22, Pasadena, CA 91125 (United States); Van Belle, Gerard [Lowell Observatory, Flagstaff, AZ 86001 (United States); Ten Brummelaar, Theo A.; Schaefer, Gail; Sturmann, Laszlo; Sturmann, Judit [The CHARA Array, Mount Wilson Observatory, Mount Wilson, CA 91023 (United States); Muirhead, Philip S. [Department of Astronomy, California Institute of Technology, 1200 East California Boulevard, MC 249-17, Pasadena, CA 91125 (United States); Lopez-Morales, Mercedes [Institut de Ciencies de L' Espai (CSIC-IEEC), E-08193 Bellaterra (Spain); Ridgway, Stephen [National Optical Astronomy Observatory, P.O. Box 26732, Tucson, AZ 85726-6732 (United States); Rojas-Ayala, Barbara [Department of Astrophysics, Division of Physical Sciences, American Museum of Natural History, Central Park West at 79th Street, New York, NY 10024 (United States); and others

2012-10-01

suggest that the models over account for the effects that the stellar metallicity may have on the astrophysical properties of an object. By comparing the interferometrically measured radii for the single star population to those of eclipsing binaries, we find that for a given mass, single and binary star radii are indistinguishable. However, we also find that for a given radius, the literature temperatures for binary stars are systematically lower compared to our interferometrically derived temperatures of single stars by {approx}200 to 300 K. The nature of this offset is dependent on the validation of binary star temperatures, where bringing all measurements to a uniform and correctly calibrated temperature scale is needed to identify any influence stellar activity may have on the physical properties of a star. Lastly, we present an empirically determined H-R diagram using fundamental properties presented here in combination with those in Boyajian et al. for a total of 74 nearby, main-sequence, A- to M-type stars, and define regions of habitability for the potential existence of sub-stellar mass companions in each system.

Study on MPGA-BP of Gravity Dam Deformation Prediction

Directory of Open Access Journals (Sweden)

Xiaoyu Wang

2017-01-01

Full Text Available Displacement is an important physical quantity of hydraulic structures deformation monitoring, and its prediction accuracy is the premise of ensuring the safe operation. Most existing metaheuristic methods have three problems: (1 falling into local minimum easily, (2 slowing convergence, and (3 the initial value’s sensitivity. Resolving these three problems and improving the prediction accuracy necessitate the application of genetic algorithm-based backpropagation (GA-BP neural network and multiple population genetic algorithm (MPGA. A hybrid multiple population genetic algorithm backpropagation (MPGA-BP neural network algorithm is put forward to optimize deformation prediction from periodic monitoring surveys of hydraulic structures. This hybrid model is employed for analyzing the displacement of a gravity dam in China. The results show the proposed model is superior to an ordinary BP neural network and statistical regression model in the aspect of global search, convergence speed, and prediction accuracy.

RanBP3 influences interactions between CRM1 and its nuclear protein export substrates

OpenAIRE

Englmeier, Ludwig; Fornerod, Maarten; Bischoff, F. Ralf; Petosa, Carlo; Mattaj, Iain W.; Kutay, Ulrike

2001-01-01

We investigated the role of RanBP3, a nuclear member of the Ran-binding protein 1 family, in CRM1-mediated protein export in higher eukaryotes. RanBP3 interacts directly with CRM1 and also forms a trimeric complex with CRM1 and RanGTP. However, RanBP3 does not bind to CRM1 like an export substrate. Instead, it can stabilize CRM1–export substrate interaction. Nuclear RanBP3 stimulates CRM1-dependent protein export in permeabilized cells. These data indicate that RanBP3 functions by a novel mec...

BP Investment Exceeds $4 Bln in china

Institute of Scientific and Technical Information of China (English)

Wang Ping

2008-01-01

@@ British Petroleum (BP) recently signed a series of agreements with China including those in clean energy and wind power generation, during British Prime Minister Gordon Brown's visit to China in mid-January.

Design and application of star map simulation system for star sensors

Science.gov (United States)

Wu, Feng; Shen, Weimin; Zhu, Xifang; Chen, Yuheng; Xu, Qinquan

2013-12-01

Modern star sensors are powerful to measure attitude automatically which assure a perfect performance of spacecrafts. They achieve very accurate attitudes by applying algorithms to process star maps obtained by the star camera mounted on them. Therefore, star maps play an important role in designing star cameras and developing procession algorithms. Furthermore, star maps supply significant supports to exam the performance of star sensors completely before their launch. However, it is not always convenient to supply abundant star maps by taking pictures of the sky. Thus, star map simulation with the aid of computer attracts a lot of interests by virtue of its low price and good convenience. A method to simulate star maps by programming and extending the function of the optical design program ZEMAX is proposed. The star map simulation system is established. Firstly, based on analyzing the working procedures of star sensors to measure attitudes and the basic method to design optical system by ZEMAX, the principle of simulating star sensor imaging is given out in detail. The theory about adding false stars and noises, and outputting maps is discussed and the corresponding approaches are proposed. Then, by external programming, the star map simulation program is designed and produced. Its user interference and operation are introduced. Applications of star map simulation method in evaluating optical system, star image extraction algorithm and star identification algorithm, and calibrating system errors are presented completely. It was proved that the proposed simulation method provides magnificent supports to the study on star sensors, and improves the performance of star sensors efficiently.

Hemodynamic response during aneurysm clipping surgery among experienced neurosurgeons.

Science.gov (United States)

Bunevicius, Adomas; Bilskiene, Diana; Macas, Andrius; Tamasauskas, Arimantas

2016-02-01

Neurosurgery is a challenging field associated with high levels of mental stress. The goal of this study was to investigate the hemodynamic response of experienced neurosurgeons during aneurysm clipping surgery and to evaluate whether neurosurgeons' hemodynamic responses are associated with patients' clinical statuses. Four vascular neurosurgeons (all male; mean age 51 ± 10 years; post-residency experience ≥7 years) were studied during 42 aneurysm clipping procedures. Blood pressure (BP) and heart rate (HR) were assessed at rest and during seven phases of surgery: before the skin incision, after craniotomy, after dural opening, after aneurysm neck dissection, after aneurysm clipping, after dural closure and after skin closure. HR and BP were significantly greater during surgery relative to the rest situation (p ≤ 0.03). There was a statistically significant increase in neurosurgeons' HR (F [6, 41] = 10.88, p neurosurgeon experience, the difference in BP as a function of aneurysm rupture was not significant (p > 0.08). Aneurysm location, intraoperative aneurysm rupture, admission WFNS score, admission Glasgow Coma Scale scores and Fisher grade were not associated with neurosurgeons' intraoperative HR and BP (all p > 0.07). Aneurysm clipping surgery is associated with significant hemodynamic system activation among experienced neurosurgeons. The greatest HR and BP were after aneurysm neck dissection and clipping. Aneurysm location and patient clinical status were not associated with intraoperative changes of neurosurgeons' HR and BP.

Regular Generalized Star Star closed sets in Bitopological Spaces

OpenAIRE

K. Kannan; D. Narasimhan; K. Chandrasekhara Rao; R. Ravikumar

2011-01-01

The aim of this paper is to introduce the concepts of τ1τ2-regular generalized star star closed sets , τ1τ2-regular generalized star star open sets and study their basic properties in bitopological spaces.

ENHANCED STAR FORMATION OF LESS MASSIVE GALAXIES IN A PROTOCLUSTER AT z = 2.5

Energy Technology Data Exchange (ETDEWEB)

Hayashi, Masao; Kodama, Tadayuki [Optical and Infrared Astronomy Division, National Astronomical Observatory, Mitaka, Tokyo 181-8588 (Japan); Tanaka, Ichi; Koyama, Yusei [Subaru Telescope, National Astronomical Observatory of Japan, 650 North A’ohoku Place, Hilo, HI 96720 (United States); Shimakawa, Rhythm; Suzuki, Tomoko L.; Yamamoto, Moegi [Department of Astronomical Science, SOKENDAI (The Graduate University for Advanced Studies), Mitaka, Tokyo 181-8588 (Japan); Tadaki, Ken-ichi, E-mail: masao.hayashi@nao.ac.jp [Max-Planck-Institut für Extraterrestrische Physik, Giessenbachstrasse, D-85748 Garching (Germany)

2016-08-01

We investigate a correlation between star formation rate (SFR) and stellar mass for H α emission-line galaxies (HAEs) in one of the richest protoclusters ever known at z∼2.5, the USS 1558-003 protocluster. This study is based on a 9.7 hr narrowband imaging data with MOIRCS on the Subaru telescope. We are able to construct a sample in combination with additional H -band data taken with WFC3 on the Hubble Space Telescope , of 100 HAEs reaching the dust-corrected SFRs down to 3 M {sub ⊙} yr{sup −1} and the stellar masses down to 10{sup 8.0} M {sub ⊙}. We find that while the star-forming galaxies with ≳10{sup 9.3} M {sub ⊙} are located on the universal SFR-mass main sequence (MS) irrespective of the environment, less massive star-forming galaxies with ≲10{sup 9.3} M {sub ⊙} show a significant upward scatter from the MS in this protocluster. This suggests that some less massive galaxies are in a starburst phase, although we do not know yet if this is due to environmental effects.

Massive stars evolution with mass-loss. 20-100 M(sun) models

Energy Technology Data Exchange (ETDEWEB)

Chiosi, C; Sreenivasan, S R [Calgary Univ., Alberta (Canada). Dept. of Physics; Nasi, E [Padua Univ. (Italy). Istituto di Astronomia

1978-02-01

The evolution of stars with initial masses 20, 30, 40, 60, 80, 100 M(sun) and Population I chemical composition (X = 0.700, Z = 0.02) is calculated, taking into account mass-loss due to stellar winds, from the main sequence up to the early stages of central He-burning. This study incorporates mass-loss rates predicted by the theory of Castor et al. (1975) for the early type phases and a novel way of treating mass-loss rates due to acoustic energy flux driven winds in the later stages analogous to the work of Fusi-Pecci and Renzini (1975a). The results are presented in terms of evolutionary tracks, isochrones, loci of constant mass-loss rates and loci of constant mass in the HR diagram. The effects of mass-loss on the internal structure of the models as well as on the occurrence of semiconvection are also investigated. A detailed comparison of the theoretical predictions and observational results is made and possible implications for O, Of, Wolf-Rayet stars and red supergiants are brought out.

Association of Autoantibodies to BP180 with Disease Activity in Greek Patients with Bullous Pemphigoid

Directory of Open Access Journals (Sweden)

Aikaterini Patsatsi

2012-01-01

Full Text Available 39 bullous pemphigoid (BP patients were studied to assess the clinical significance of anti-BP180 and anti-BP230 circulating autoantibodies of BP and correlate their titers with the clinical scores of the BP Disease Area Index (BPDAI and the Autoimmune Bullous Skin Disorder Intensity Score (ABSIS as well as with the intensity of pruritus measured by the BPDAI pruritus component. All parameters were evaluated by the time of diagnosis (baseline, month 3, and month 6. Titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with BPDAI component for the intensity of pruritus (, at baseline. At month 3, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . At month 6, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . There was no statistically significant correlation between titers of anti-BP230 autoantibodies and the BPDAI, ABSIS, and BPDAI component for the intensity of pruritus at the same time points.

Sleep-time BP: prognostic marker of type 2 diabetes and therapeutic target for prevention.

Science.gov (United States)

Hermida, Ramón C; Ayala, Diana E; Mojón, Artemio; Fernández, José R

2016-02-01

We investigated the prognostic value of clinic and ambulatory BP (ABP) to predict new-onset diabetes and whether risk reduction is related to the progressive decrease of clinic BP or awake or asleep ABP. We prospectively evaluated 2,656 individuals without diabetes, 1,292 men and 1,364 women, 50.6 ± 14.3 years of age, with baseline BP ranging from normotension to hypertension according to ABP criteria. At baseline and annually (more frequently if hypertension treatment was adjusted based on ABP) thereafter, ABP and physical activity (wrist actigraphy) were simultaneously monitored for 48 h to accurately derive the awake and asleep BP means. During a 5.9-year median follow-up, 190 participants developed type 2 diabetes. The asleep systolic ABP mean was the most significant predictor of new-onset diabetes in a Cox proportional-hazard model adjusted for age, waist circumference, glucose, chronic kidney disease (CKD) and hypertension treatment. Daytime clinic BP and awake or 48 h ABP mean had no predictive value when corrected by the asleep ABP mean. Analyses of BP changes during follow-up revealed a 30% reduction in the risk of new-onset diabetes per 1-SD decrease in asleep systolic ABP mean, independent of changes in clinic BP or awake or 48 h ABP means. Sleep-time BP is a highly significant independent prognostic marker for new-onset diabetes. Alteration in sleep-time BP regulation seems to precede, rather than follow, the development of new-onset diabetes. Most important, lowering asleep BP, a novel therapeutic target requiring ABP evaluation, could be a significant method for reducing new-onset diabetes risk.

Overexpressed CacyBP/SIP leads to the suppression of growth in renal cell carcinoma

International Nuclear Information System (INIS)

Sun, Shiren; Ning, Xiaoxuan; Liu, Jie; Liu, Lili; Chen, Yu; Han, Shuang; Zhang, Yanqi; Liang, Jie; Wu, Kaichun; Fan, Daiming

2007-01-01

Calcyclin-binding protein/Siah-1-interacting protein (CacyBP/SIP), a target protein of S100, has been identified as a component of a novel ubiquitinylation complex leading to β-catenin degradation, which was found to be related to the malignant phenotypes of gastric cancer. However, the roles of CacyBP/SIP in renal cell carcinoma still remain unclear. In the present study, we had analyzed the expression of the CacyBP/SIP protein in human renal cancer cells and clinical tissue samples. The possible roles of CacyBP/SIP in regulating the malignant phenotype of renal cancer cells were also investigated. The results demonstrated that the expression of CacyBP/SIP was markedly down-regulated in renal cell carcinoma tissues and cell lines. Ectopic overexpression of CacyBP/SIP in A498 cells inhibited the proliferation of this cell and delayed cell cycle progression significantly, which might be related to the down-regulation of Cyclin D1 through reducing β-catenin protein. CacyBP/SIP also suppressed colony formation in soft agar and its tumorigenicity in nude mice. Taken together, our work showed that CacyBP/SIP, as a novel down-regulated gene in renal cell carcinoma, suppressed proliferation and tumorigenesis of renal cancer cells

G3BP1, G3BP2 and CAPRIN1 are required for translation of interferon stimulated mRNAs and are targeted by a dengue virus non-coding RNA.

Science.gov (United States)

Bidet, Katell; Dadlani, Dhivya; Garcia-Blanco, Mariano A

2014-07-01

Viral RNA-host protein interactions are critical for replication of flaviviruses, a genus of positive-strand RNA viruses comprising major vector-borne human pathogens including dengue viruses (DENV). We examined three conserved host RNA-binding proteins (RBPs) G3BP1, G3BP2 and CAPRIN1 in dengue virus (DENV-2) infection and found them to be novel regulators of the interferon (IFN) response against DENV-2. The three RBPs were required for the accumulation of the protein products of several interferon stimulated genes (ISGs), and for efficient translation of PKR and IFITM2 mRNAs. This identifies G3BP1, G3BP2 and CAPRIN1 as novel regulators of the antiviral state. Their antiviral activity was antagonized by the abundant DENV-2 non-coding subgenomic flaviviral RNA (sfRNA), which bound to G3BP1, G3BP2 and CAPRIN1, inhibited their activity and lead to profound inhibition of ISG mRNA translation. This work describes a new and unexpected level of regulation for interferon stimulated gene expression and presents the first mechanism of action for an sfRNA as a molecular sponge of anti-viral effectors in human cells.

BP Oil Company's approach to risk management

International Nuclear Information System (INIS)

Fryman, C.E.

1996-01-01

The oil and chemical industries face major challenges in deciding how to handle the numerous recommendations coming from various audits, reviews and studies conducted in the functional areas of personnel health and safety, loss prevention, and environmental protection. And, the number of recommendations continues to grow with time, as regulations and normal business requirements are met. BP Oil has developed a methodology for risk ranking the events leading to specific recommendations and then determining the cost-effectiveness of the recommendations in reducing the risk. The author completed successful pilot tests of this methodology at two of BP Oil's petroleum refineries, examining the recommendations from process hazards analyses and studies completed over the past few years. The methodology has since been implemented throughout their petroleum refining, distribution, transportation, and retail business streams

Prediction of BP Reactivity to Talking Using Hybrid Soft Computing Approaches

Directory of Open Access Journals (Sweden)

Gurmanik Kaur

2014-01-01

Full Text Available High blood pressure (BP is associated with an increased risk of cardiovascular diseases. Therefore, optimal precision in measurement of BP is appropriate in clinical and research studies. In this work, anthropometric characteristics including age, height, weight, body mass index (BMI, and arm circumference (AC were used as independent predictor variables for the prediction of BP reactivity to talking. Principal component analysis (PCA was fused with artificial neural network (ANN, adaptive neurofuzzy inference system (ANFIS, and least square-support vector machine (LS-SVM model to remove the multicollinearity effect among anthropometric predictor variables. The statistical tests in terms of coefficient of determination (R2, root mean square error (RMSE, and mean absolute percentage error (MAPE revealed that PCA based LS-SVM (PCA-LS-SVM model produced a more efficient prediction of BP reactivity as compared to other models. This assessment presents the importance and advantages posed by PCA fused prediction models for prediction of biological variables.

Prediction of BP reactivity to talking using hybrid soft computing approaches.

Science.gov (United States)

Kaur, Gurmanik; Arora, Ajat Shatru; Jain, Vijender Kumar

2014-01-01

High blood pressure (BP) is associated with an increased risk of cardiovascular diseases. Therefore, optimal precision in measurement of BP is appropriate in clinical and research studies. In this work, anthropometric characteristics including age, height, weight, body mass index (BMI), and arm circumference (AC) were used as independent predictor variables for the prediction of BP reactivity to talking. Principal component analysis (PCA) was fused with artificial neural network (ANN), adaptive neurofuzzy inference system (ANFIS), and least square-support vector machine (LS-SVM) model to remove the multicollinearity effect among anthropometric predictor variables. The statistical tests in terms of coefficient of determination (R (2)), root mean square error (RMSE), and mean absolute percentage error (MAPE) revealed that PCA based LS-SVM (PCA-LS-SVM) model produced a more efficient prediction of BP reactivity as compared to other models. This assessment presents the importance and advantages posed by PCA fused prediction models for prediction of biological variables.

Comments on H.R. 2480

International Nuclear Information System (INIS)

Rezendes, V.S.

1990-10-01

GAO testified on H.R. 2480, the Uranium Enrichment Reorganization Act, which would restructure DOE's uranium enrichment program as a government corporation. Specifically, this legislation would allow the corporation to set prices to maximize long-term returns; establish a fund to meet future decontamination, decommissioning, and remedial action costs associated with past uranium enrichment activities. and require the government to pay its share of the costs to clean up mining waste generated under past government contracts. GAO believes that H.R. 2480 takes needed steps toward establishing clear objectives for the enrichment program and would allow the new corporation to better operate as a business entity. The bill would also resolve several long-term issues that seriously challenge the program's future, including the need to pay billions of dollars in environmental and decommissioning costs at a time when competition is expected to increase. However, GAO believes that the bill could be strengthened by including a specific cost recovery provision. Because DOE projects that the corporation's future earnings could be substantial, GAO suggests that Congress require the repayment of $3 billion, rather than rely solely on unspecified dividends and/or uncertain future stock sales that may not materialize unless problems related to licensing uncertainties, increased competition, and billions of dollars in liabilities are adequately resolved

Burn out or fade away? On the X-ray and magnetic death of intermediate mass stars

Energy Technology Data Exchange (ETDEWEB)

Drake, Jeremy J.; Kashyap, Vinay; Günther, H. Moritz; Wright, Nicholas J. [Smithsonian Astrophysical Observatory, MS-3, 60 Garden Street, Cambridge, MA 02138 (United States); Braithwaite, Jonathan, E-mail: jdrake@cfa.harvard.edu [Argelander Institut für Astronomie, Auf dem Hügel 71, D-53121 Bonn (Germany)

2014-05-10

The nature of the mechanisms apparently driving X-rays from intermediate mass stars lacking strong convection zones or massive winds remains poorly understood, and the possible role of hidden, lower mass close companions is still unclear. A 20 ks Chandra HRC-I observation of HR 4796A, an 8 Myr old main sequence A0 star devoid of close stellar companions, has been used to search for a signature or remnant of magnetic activity from the Herbig Ae phase. X-rays were not detected and the X-ray luminosity upper limit was L{sub X} ≤ 1.3 × 10{sup 27} erg s{sup –1}. The result is discussed in the context of various scenarios for generating magnetic activity, including rotational shear and subsurface convection. A dynamo driven by natal differential rotation is unlikely to produce observable X rays, chiefly because of the difficulty in getting the dissipated energy up to the surface of the star. A subsurface convection layer produced by the ionization of helium could host a dynamo that should be effective throughout the main sequence but can only produce X-ray luminosities of the order 10{sup 25} erg s{sup –1}. This luminosity lies only moderately below the current detection limit for Vega. Our study supports the idea that X-ray production in Herbig Ae/Be stars is linked largely to the accretion process rather than the properties of the underlying star, and that early A stars generally decline in X-ray luminosity at least 100,000 fold in only a few million years.

Divergent homologs of the predicted small RNA BpCand697 in Burkholderia spp.

Science.gov (United States)

Damiri, Nadzirah; Mohd-Padil, Hirzahida; Firdaus-Raih, Mohd

2015-09-01

The small RNA (sRNA) gene candidate, BpCand697 was previously reported to be unique to Burkholderia spp. and is encoded at 3' non-coding region of a putative AraC family transcription regulator gene. This study demonstrates the conservation of BpCand697 sequence across 32 Burkholderia spp. including B. pseudomallei, B. mallei, B. thailandensis and Burkholderia sp. by integrating both sequence homology and secondary structural analyses of BpCand697 within the dataset. The divergent sequence of BpCand697 was also used as a discriminatory power in clustering the dataset according to the potential virulence of Burkholderia spp., showing that B. thailandensis was clearly secluded from the virulent cluster of B. pseudomallei and B. mallei. Finally, the differential co-transcript expression of BpCand697 and its flanking gene, bpsl2391 was detected in Burkholderia pseudomallei D286 after grown under two different culture conditions using nutrient-rich and minimal media. It is hypothesized that the differential expression of BpCand697-bpsl2391 co-transcript between the two standard prepared media might correlate with nutrient availability in the culture media, suggesting that the physical co-localization of BpCand697 in B. pseudomallei D286 might be directly or indirectly involved with the transcript regulation of bpsl2391 under the selected in vitro culture conditions.

I-Love relations for incompressible stars and realistic stars

Science.gov (United States)

Chan, T. K.; Chan, AtMa P. O.; Leung, P. T.

2015-02-01

In spite of the diversity in the equations of state of nuclear matter, the recently discovered I-Love-Q relations [Yagi and Yunes, Science 341, 365 (2013), 10.1126/science.1236462], which relate the moment of inertia, tidal Love number (deformability), and the spin-induced quadrupole moment of compact stars, hold for various kinds of realistic neutron stars and quark stars. While the physical origin of such universality is still a current issue, the observation that the I-Love-Q relations of incompressible stars can well approximate those of realistic compact stars hints at a new direction to approach the problem. In this paper, by establishing recursive post-Minkowskian expansion for the moment of inertia and the tidal deformability of incompressible stars, we analytically derive the I-Love relation for incompressible stars and show that the so-obtained formula can be used to accurately predict the behavior of realistic compact stars from the Newtonian limit to the maximum mass limit.

veteran athletes exercise at higher maximum heart rates than

African Journals Online (AJOL)

HR responses in different sporting disciplines." All tests were performed in the ... blood pressure (BP) and HR were measured from the right arm while the subjects were in a supine and standing position. Diastolic BP (DBP) was defined as the ...

PM : Cabinet likely to choose TNK-BP

Index Scriptorium Estoniae

2005-01-01

Tõenäoliselt saab Mazeikiu Nafta aktsiate ostjaks Suurbritannia-Vene ettevõte TNK-BP. Endiselt soovib ka Leedu Jukose osa naftakompaniist osta, kuid selleks raha laenamine võib mõjutada riigi majandust ja üleminekut eurole

Lamin A/C-dependent interaction with 53BP1 promotes cellular responses to DNA damage

DEFF Research Database (Denmark)

Gibbs-Seymour, Ian; Markiewicz, Ewa; Bekker-Jensen, Simon

2015-01-01

Lamins A/C have been implicated in DNA damage response pathways. We show that the DNA repair protein 53BP1 is a lamin A/C binding protein. In undamaged human dermal fibroblasts (HDF), 53BP1 is a nucleoskeleton protein. 53BP1 binds to lamins A/C via its Tudor domain, and this is abrogated by DNA...... damage. Lamins A/C regulate 53BP1 levels and consequently lamin A/C-null HDF display a 53BP1 null-like phenotype. Our data favour a model in which lamins A/C maintain a nucleoplasmic pool of 53BP1 in order to facilitate its rapid recruitment to sites of DNA damage and could explain why an absence...

Nocturnal Hypertension and Altered Night-Day BP Profile and Atherosclerosis in Renal Transplant Patients.

Science.gov (United States)

Mallamaci, Francesca; Tripepi, Rocco; Leonardis, Daniela; Mafrica, Angela; Versace, Maria Carmela; Provenzano, Fabio; Tripepi, Giovanni; Zoccali, Carmine

2016-10-01

The clinical relevance of ambulatory blood pressure monitoring (ABPM) for risk stratification in renal transplant patients still remains poorly defined. We investigated the association between clinic and ABPM with an established biomarker of atherosclerosis (intima-media thickness [IMT] by echo-color Doppler) in a large, inclusive survey (n = 172) in renal transplant patients at a single institution. Forty-two patients (24%) were classified as hypertensive by ABPM criteria and 29 (17%) by clinic blood pressure (BP) criteria. Average daytime and nighttime BP was 126 ± 12/78 ± 9 mm Hg and 123 ± 13/74 ± 10 mm Hg, respectively. Forty-five patients (26%) were classified as hypertensive by the daytime criterion (>135/85 mm Hg) and a much higher proportion (n = 119, 69%) by the nighttime criterion (>120/70 mm Hg). Sixty-two patients (36%) had a night-day ratio of 1 or greater, indicating clear-cut nondipping. The average nighttime systolic BP (r = 0.24, P = 0.001) and the night-day systolic BP ratio (r = 0.23, P = 0.002) were directly related to IMT, and these associations were much more robust than the 24-hour systolic BP-IMT relationship (r = 0.16, P = 0.04). Average daytime BP and clinic B were unrelated to IMT. In a multiple regression analysis adjusting for confounders, the night-day systolic BP ratio maintained an independent association with IMT (β = 0.14, P = 0.04). In renal transplant patients, the prevalence of nocturnal hypertension by far exceeds the prevalence of hypertension as assessed by clinic, daytime, and 24-hour ABPM. Nighttime systolic BP and the night-day ratio but no other BP metrics are independently associated with IMT. Blood pressure during nighttime may provide unique information for the assessment of cardiovascular risk attributable to BP burden in renal transplant patients.

Search for OB stars running away from young star clusters. II. The NGC 6357 star-forming region

Science.gov (United States)

Gvaramadze, V. V.; Kniazev, A. Y.; Kroupa, P.; Oh, S.

2011-11-01

Dynamical few-body encounters in the dense cores of young massive star clusters are responsible for the loss of a significant fraction of their massive stellar content. Some of the escaping (runaway) stars move through the ambient medium supersonically and can be revealed via detection of their bow shocks (visible in the infrared, optical or radio). In this paper, which is the second of a series of papers devoted to the search for OB stars running away from young ( ≲ several Myr) Galactic clusters and OB associations, we present the results of the search for bow shocks around the star-forming region NGC 6357. Using the archival data of the Midcourse Space Experiment (MSX) satellite and the Spitzer Space Telescope, and the preliminary data release of the Wide-Field Infrared Survey Explorer (WISE), we discovered seven bow shocks, whose geometry is consistent with the possibility that they are generated by stars expelled from the young (~1-2 Myr) star clusters, Pismis 24 and AH03 J1725-34.4, associated with NGC 6357. Two of the seven bow shocks are driven by the already known OB stars, HD 319881 and [N78] 34. Follow-up spectroscopy of three other bow-shock-producing stars showed that they are massive (O-type) stars as well, while the 2MASS photometry of the remaining two stars suggests that they could be B0 V stars, provided that both are located at the same distance as NGC 6357. Detection of numerous massive stars ejected from the very young clusters is consistent with the theoretical expectation that star clusters can effectively lose massive stars at the very beginning of their dynamical evolution (long before the second mechanism for production of runaway stars, based on a supernova explosion in a massive tight binary system, begins to operate) and lends strong support to the idea that probably all field OB stars have been dynamically ejected from their birth clusters. A by-product of our search for bow shocks around NGC 6357 is the detection of three circular

Do All O Stars Form in Star Clusters?

Science.gov (United States)

Weidner, C.; Gvaramadze, V. V.; Kroupa, P.; Pflamm-Altenburg, J.

The question whether or not massive stars can form in isolation or only in star clusters is of great importance for the theory of (massive) star formation as well as for the stellar initial mass function of whole galaxies (IGIMF-theory). While a seemingly easy question it is rather difficult to answer. Several physical processes (e.g. star-loss due to stellar dynamics or gas expulsion) and observational limitations (e.g. dust obscuration of young clusters, resolution) pose severe challenges to answer this question. In this contribution we will present the current arguments in favour and against the idea that all O stars form in clusters.

Esprit HR mattress cover in pressure ulcer prevention.

Science.gov (United States)

Khoulowa, J

Modern mattresses provide soft dense foam, which permits the redistribution of pressure on the patient over a wider area - away from bony prominences where pressure ulcers usually occur. The material used in producing multistretch covers for the new mattresses had a tendency to delaminate as a result of a combination of heat, moisture and inappropriate cleansing techniques causing the water barriers to fall. In partnership with York Health NHS Trust and the material manufacturer, STM Healthcare produced a mattress cover (Esprit HR) which was able to withstand higher pressure from heat and moisture and greatly extended the life expectancy of the Esprit HR mattress.

Giant CP stars

International Nuclear Information System (INIS)

Loden, L.O.; Sundman, A.

1989-01-01

This study is part of an investigation of the possibility of using chemically peculiar (CP) stars to map local galactic structure. Correct luminosities of these stars are therefore crucial. CP stars are generally regarded as main-sequence or near-main-sequence objects. However, some CP stars have been classified as giants. A selection of stars, classified in literature as CP giants, are compared to normal stars in the same effective temperature interval and to ordinary 'non giant' CP stars. There is no clear confirmation of a higher luminosity for 'CP giants', than for CP stars in general. In addition, CP characteristics seem to be individual properties not repeated in a component star or other cluster members. (author). 50 refs., 5 tabs., 3 figs

G3BP1, G3BP2 and CAPRIN1 are required for translation of interferon stimulated mRNAs and are targeted by a dengue virus non-coding RNA.

Directory of Open Access Journals (Sweden)

Katell Bidet

2014-07-01

Full Text Available Viral RNA-host protein interactions are critical for replication of flaviviruses, a genus of positive-strand RNA viruses comprising major vector-borne human pathogens including dengue viruses (DENV. We examined three conserved host RNA-binding proteins (RBPs G3BP1, G3BP2 and CAPRIN1 in dengue virus (DENV-2 infection and found them to be novel regulators of the interferon (IFN response against DENV-2. The three RBPs were required for the accumulation of the protein products of several interferon stimulated genes (ISGs, and for efficient translation of PKR and IFITM2 mRNAs. This identifies G3BP1, G3BP2 and CAPRIN1 as novel regulators of the antiviral state. Their antiviral activity was antagonized by the abundant DENV-2 non-coding subgenomic flaviviral RNA (sfRNA, which bound to G3BP1, G3BP2 and CAPRIN1, inhibited their activity and lead to profound inhibition of ISG mRNA translation. This work describes a new and unexpected level of regulation for interferon stimulated gene expression and presents the first mechanism of action for an sfRNA as a molecular sponge of anti-viral effectors in human cells.

Non-Contact Heart Rate and Blood Pressure Estimations from Video Analysis and Machine Learning Modelling Applied to Food Sensory Responses: A Case Study for Chocolate.

Science.gov (United States)

Gonzalez Viejo, Claudia; Fuentes, Sigfredo; Torrico, Damir D; Dunshea, Frank R

2018-06-03

Traditional methods to assess heart rate (HR) and blood pressure (BP) are intrusive and can affect results in sensory analysis of food as participants are aware of the sensors. This paper aims to validate a non-contact method to measure HR using the photoplethysmography (PPG) technique and to develop models to predict the real HR and BP based on raw video analysis (RVA) with an example application in chocolate consumption using machine learning (ML). The RVA used a computer vision algorithm based on luminosity changes on the different RGB color channels using three face-regions (forehead and both cheeks). To validate the proposed method and ML models, a home oscillometric monitor and a finger sensor were used. Results showed high correlations with the G color channel (R² = 0.83). Two ML models were developed using three face-regions: (i) Model 1 to predict HR and BP using the RVA outputs with R = 0.85 and (ii) Model 2 based on time-series prediction with HR, magnitude and luminosity from RVA inputs to HR values every second with R = 0.97. An application for the sensory analysis of chocolate showed significant correlations between changes in HR and BP with chocolate hardness and purchase intention.

PLEIADES-HR INNOVATIVE TECHNIQUES FOR RADIOMETRIC IMAGE QUALITY COMMISSIONING

Directory of Open Access Journals (Sweden)

G. Blanchet

2012-07-01

Full Text Available The first Pleiades-HR satellite, part of a constellation of two, has been launched on December 17, 2011. This satellite produces high resolution optical images. In order to achieve good image quality, Pleiades-HR should first undergo an important 6 month commissioning phase period. This phase consists in calibrating and assessing the radiometric and geometric image quality to offer the best images to end users. This new satellite has benefited from technology improvements in various fields which make it stand out from other Earth observation satellites. In particular, its best-in-class agility performance enables new calibration and assessment techniques. This paper is dedicated to presenting these innovative techniques that have been tested for the first time for the Pleiades- HR radiometric commissioning. Radiometric activities concern compression, absolute calibration, detector normalization, and refocusing operations, MTF (Modulation Transfer Function assessment, signal-to-noise ratio (SNR estimation, and tuning of the ground processing parameters. The radiometric performances of each activity are summarized in this paper.

Bursting star formation and the overabundance of Wolf-Rayet stars

International Nuclear Information System (INIS)

Bodigfee, G.; Deloore, C.

1985-01-01

The ratio of the number of WR-stars to their OB progenitors appears to be significantly higher in some extragalactic systems than in our Galaxy. This overabundance of Wolf-Rayet-stars can be explained as a consequence of a recent burst of star formation. It is suggested that this burst is the manifestation of a long period nonlinear oscillation in the star formation process, produced by positive feedback effects between young stars and the interstellar medium. Star burst galaxies with large numbers of WR-stars must generate gamma fluxes but due to the distance, all of them are beyond the reach of present-day detectors, except probably 30 Dor

Properties of the stars of early generations in the scale covariant cosmology

International Nuclear Information System (INIS)

Maeder, A.

1978-01-01

We examine here some consequences of cosmological propositions which accept that further invariances exist in the theory of gravitation. Several astrophysical tests have already been performed, with the noticeable and worrying results that astrophysics only supports scale invariance if matter creation still occurs in the Universe. Within this cosmological framework, stars being very different from the present ones would have existed in the past with higher rate of nuclear transformation and higher luminosity per unit of mass. The basic properties of these stars at an early epoch (t = 1/5 t 0 ) are examined with numerical models: the zero-age sequence, the central conditions in stars, the various critical stellar masses, the mass- and gravity-luminosity relation, the paths in the HR diagram, the changes of lifetimes, the evolution in the log Tsub(c) vs log rhosub(c) diagram. Useful expressions are also given for deriving by scaling the above properties at epochs other than the one considered in numerical applications. A major change occurs for the problem of the helium synthesis. In the scale covariant cosmology, the big-bang He-synthesis seems to be only of very marginal importance and the essential of the present He-content of the Universe could be accounted by stellar processes at the early generations of stars. This has for consequence that the ratio ΔY/ΔZ of Helium to the metals synthetized during the history of the Galaxy would be much larger than as predicted by standard cosmology. (orig.) [de

Bisphosphonate Drug Holiday and Fracture Risk: A Population-Based Cohort Study.

Science.gov (United States)

Adams, Annette L; Adams, John L; Raebel, Marsha A; Tang, Beth T; Kuntz, Jennifer L; Vijayadeva, Vinutha; McGlynn, Elizabeth A; Gozansky, Wendolyn S

2018-03-12

Holidays from bisphosphonates (BPs) may help to prevent rare adverse events like atypical femoral fractures, but may be appropriate only if risk of osteoporosis-related fractures does not increase. Our objective was to compare the incidence of osteoporosis-related fractures among women who had a bisphosphonate (BP) holiday to those who continued use BPs. This retrospective cohort study, conducted within 4 Kaiser Permanente integrated health system regions, included 39,502 women aged ≥45 years with ≥3 years exposure to BP. Participants with a BP holiday (≥12 months with no use) were compared to persistent (use with ≥50% adherence) and non-persistent (use with holiday (n = 11,497), non-persistent user (n = 10,882), and persistent user groups (n = 17,123) were observed for 156,657 person-years. A total of 5,199 osteoporosis-related fractures (including 1,515 hip fractures and 2,147 vertebral fractures) were observed. Compared to the persistent use group, there was a slight difference in overall osteoporosis-related fracture risk (HR 0.92, 95% CI 0.84-0.99)and no difference in hip fracture risk (HR 0.95, 95% CI 0.83-1.10) for the BP holiday group. A slight reduction in risk of vertebral fracture was observed (HR 0.83, 95% CI 0.74-0.95). Compared to the non-persistent user group, the BP holiday group was at decreased risk for osteoporosis-related fractures (HR 0.71, 95% CI 0.65-0.79), vertebral fractures (HR 0.68, 95% CI 0.59-0.78), and hip fractures (HR 0.59; 95% CI 0.50-0.70). Women who undertake a BP holiday from BP of ≥12 months duration for any reason after ≥3 years of BP use do not appear to be at greater risk of osteoporosis-related fragility fracture, hip, or vertebral fractures compared to ongoing BP users. In our cohort, BP holiday remains a viable strategy for balancing the benefits and potential harms associated with long-term BP use. This article is protected by copyright. All rights reserved. This article is protected by copyright

TRIGGERED STAR FORMATION SURROUNDING WOLF-RAYET STAR HD 211853

Energy Technology Data Exchange (ETDEWEB)

Liu Tie; Wu Yuefang; Zhang Huawei [Department of Astronomy, Peking University, 100871 Beijing (China); Qin Shengli, E-mail: liutiepku@gmail.com [I. Physikalisches Institut, Universitaet zu Koeln, Zuelpicher Str. 77, 50937 Koeln (Germany)

2012-05-20

The environment surrounding Wolf-Rayet (W-R) star HD 211853 is studied in molecular, infrared, as well as radio, and H I emission. The molecular ring consists of well-separated cores, which have a volume density of 10{sup 3} cm{sup -3} and kinematic temperature {approx}20 K. Most of the cores are under gravitational collapse due to external pressure from the surrounding ionized gas. From the spectral energy distribution modeling toward the young stellar objects, the sequential star formation is revealed on a large scale in space spreading from the W-R star to the molecular ring. A small-scale sequential star formation is revealed toward core 'A', which harbors a very young star cluster. Triggered star formations are thus suggested. The presence of the photodissociation region, the fragmentation of the molecular ring, the collapse of the cores, and the large-scale sequential star formation indicate that the 'collect and collapse' process functions in this region. The star-forming activities in core 'A' seem to be affected by the 'radiation-driven implosion' process.

TRIGGERED STAR FORMATION SURROUNDING WOLF-RAYET STAR HD 211853

International Nuclear Information System (INIS)

Liu Tie; Wu Yuefang; Zhang Huawei; Qin Shengli

2012-01-01

The environment surrounding Wolf-Rayet (W-R) star HD 211853 is studied in molecular, infrared, as well as radio, and H I emission. The molecular ring consists of well-separated cores, which have a volume density of 10 3 cm –3 and kinematic temperature ∼20 K. Most of the cores are under gravitational collapse due to external pressure from the surrounding ionized gas. From the spectral energy distribution modeling toward the young stellar objects, the sequential star formation is revealed on a large scale in space spreading from the W-R star to the molecular ring. A small-scale sequential star formation is revealed toward core 'A', which harbors a very young star cluster. Triggered star formations are thus suggested. The presence of the photodissociation region, the fragmentation of the molecular ring, the collapse of the cores, and the large-scale sequential star formation indicate that the 'collect and collapse' process functions in this region. The star-forming activities in core 'A' seem to be affected by the 'radiation-driven implosion' process.

A nonlinear filtering algorithm for denoising HR(S)TEM micrographs

International Nuclear Information System (INIS)

Du, Hongchu

2015-01-01

Noise reduction of micrographs is often an essential task in high resolution (scanning) transmission electron microscopy (HR(S)TEM) either for a higher visual quality or for a more accurate quantification. Since HR(S)TEM studies are often aimed at resolving periodic atomistic columns and their non-periodic deviation at defects, it is important to develop a noise reduction algorithm that can simultaneously handle both periodic and non-periodic features properly. In this work, a nonlinear filtering algorithm is developed based on widely used techniques of low-pass filter and Wiener filter, which can efficiently reduce noise without noticeable artifacts even in HR(S)TEM micrographs with contrast of variation of background and defects. The developed nonlinear filtering algorithm is particularly suitable for quantitative electron microscopy, and is also of great interest for beam sensitive samples, in situ analyses, and atomic resolution EFTEM. - Highlights: • A nonlinear filtering algorithm for denoising HR(S)TEM images is developed. • It can simultaneously handle both periodic and non-periodic features properly. • It is particularly suitable for quantitative electron microscopy. • It is of great interest for beam sensitive samples, in situ analyses, and atomic resolution EFTEM

Marine04 marine radiocarbon age calibration, 0-26 cal kyr BP

NARCIS (Netherlands)

Hughen, Konrad A.; Baillie, Mike G.L.; Bard, Edouard; Beck, J. Warren; Bertrand, Chanda J.H.; Blackwell, Paul G.; Buck, Caitlin E.; Burr, George S.; Cutler, Kirsten B.; Damon, Paul E.; Edwards, Richard L.; Fairbanks, Richard G.; Friedrich, Michael; Guilderson, Thomas P.; Kromer, Bernd; McCormac, Gerry; Manning, Sturt; Bronk Ramsey, Christopher; Reimer, Paula J.; Reimer, Ron W.; Remmele, Sabine; Southon, John R.; Stuiver, Minze; Talamo, Sahra; Taylor, F.W.; Plicht, Johannes van der; Weyhenmeyer, Constanze E.

2004-01-01

New radiocarbon calibration curves, IntCal04 and Marine04, have been constructed and internationally ratified to replace the terrestrial and marine components of IntCal98. The new calibration data sets extend an additional 2000 yr, from 0–26 cal kyr BP (Before Present, 0 cal BP = AD 1950), and

PALFA Discovers Neutron Stars on a Collision Course

Science.gov (United States)

Kohler, Susanna

2018-03-01

Got any plans in 46 million years? If not, you should keep an eye out for PSR J1946+2052 around that time this upcoming merger of two neutron stars promises to be an exciting show!Survey SuccessAverage profile for PSR J1946+2052 at 1.43 GHz from a 2 hr observation from the Arecibo Observatory. [Stovall et al. 2018]It seems like we just wrote about the dearth of known double-neutron-star systems, and about how new surveys are doing their best to find more of these compact binaries. Observing these systems improves our knowledge of how pairs of evolved stars behave before they eventually spiral in, merge, and emit gravitational waves that detectors like the Laser Interferometer Gravitational-wave Observatory might observe.Todays study, led by Kevin Stovall (National Radio Astronomy Observatory), goes to show that these surveys are doing a great job so far! Yet another double-neutron-star binary, PSR J1946+2052, has now been discovered as part of the Arecibo L-Band Feed Array pulsar (PALFA) survey. This one is especially unique due to the incredible speed with which these neutron stars orbit each other and their correspondingly (relatively!) short timescale for merger.An Extreme ExampleThe PALFA survey, conducted with the enormous 305-meter radio dish at Arecibo, has thus far resulted in the discovery of 180 pulsars including two double-neutron-star systems. The most recent discovery by Stovall and collaborators brings that number up to three, for a grand total of 16 binary-neutron-star systems (confirmed and unconfirmed) known to date.The 305-m Arecibo Radio Telescope, built into the landscape at Arecibo, Puerto Rico. [NOAO/AURA/NSF/H. Schweiker/WIYN]The newest binary in this collection, PSR J1946+2052, exhibits a pulsar with a 17-millisecond spin period thatwhips around its compact companion at a terrifying rate: the binary period is just 1.88 hours. Follow-up observations with the Jansky Very Large Array and other telescopes allowed the team to identify the binarys

Heavy Metal Stars

Science.gov (United States)

2001-08-01

the interstellar medium and was present in the cloud of dust and gas from which the Solar System and hence our Earth was formed. More information The research described in this Press Release is reported in a scientific article ("Discovery of three Lead stars" by S. Van Eck, S. Goriely, A. Jorissen and B. Plez) that appears in the August 23, 2001 issue of the science journal "Nature". Notes [1]: The team consists of Sophie Van Eck , Stéphane Goriely , Alain Jorissen (all Institut d'Astronomie et d'Astrophysique de l'Université Libre de Bruxelles, Belgium) and Bertrand Plez (Groupe de Recherche en Astronomie et Astrophysique en Languedoc, Université de Montpellier II - GRAAL), France). Sophie Van Eck was an ESO fellow (1999-2000). [2] The "atomic mass" of a chemical element is the total mass of the positively charged protons and neutral neutrons in the atomic nucleus. The "atomic number" of a chemical element is equal to the number of protons in the nucleus. Different isotopes of a chemical element all have the same number of protons in the nuclei, but a different number of neutrons. For the principal (most abundant) isotopes of the elements mentioned in this text, the "atomic mass" (expressed in "atomic mass units" (amu)) is approximately: Hydrogen : 1 atomic mass unit (with 1 proton in the nucleus); Helium : 4 atomic mass units (2 protons + 2 neutrons); Lithium : 7 atomic mass units (3 protons + 4 neutrons); Carbon : 12 atomic mass units (6 protons + 6 neutrons); Oxygen : 16 atomic mass units (8 protons + 8 neutrons); Iron : 56 atomic mass units (26 protons + 30 neutrons); Zirconium : 90 atomic mass units (40 protons + 50 neutrons); Barium : 138 atomic mass units (56 protons + 82 neutrons); Tungsten : 184 atomic mass units (74 protons + 110 neutrons); Lead : 208 atomic mass units (82 protons + 126 neutrons); Bismuth : 209 atomic mass units (83 protons + 126 neutrons) [3] "AGB" stands for "Asymptotic Giant Branch"; a location in the HR-diagramme (a plot of stellar

Bringing human resources to the table: utilization of an HR balanced scorecard at Mayo Clinic.

Science.gov (United States)

Fottler, Myron D; Erickson, Eric; Rivers, Patrick A

2006-01-01

Rather than viewing HR as a critical driver of organizational strategy and outcomes, most health care organizations see HR as a drain on the organization's bottom line. Only by aligning HR with the organizational strategy will HR leaders truly get a seat at the leadership table. HR professionals can overcome impediments and gain a seat at the table by learning the language of business and the ways in which organizational leaders use data to drive their decisions. This article shows how Mayo Clinic uses the popular Balanced Scorecard approach to align its measures of HR performance to the organization's strategic plan.

Star Polymers.

Science.gov (United States)

Ren, Jing M; McKenzie, Thomas G; Fu, Qiang; Wong, Edgar H H; Xu, Jiangtao; An, Zesheng; Shanmugam, Sivaprakash; Davis, Thomas P; Boyer, Cyrille; Qiao, Greg G

2016-06-22

Recent advances in controlled/living polymerization techniques and highly efficient coupling chemistries have enabled the facile synthesis of complex polymer architectures with controlled dimensions and functionality. As an example, star polymers consist of many linear polymers fused at a central point with a large number of chain end functionalities. Owing to this exclusive structure, star polymers exhibit some remarkable characteristics and properties unattainable by simple linear polymers. Hence, they constitute a unique class of technologically important nanomaterials that have been utilized or are currently under audition for many applications in life sciences and nanotechnologies. This article first provides a comprehensive summary of synthetic strategies towards star polymers, then reviews the latest developments in the synthesis and characterization methods of star macromolecules, and lastly outlines emerging applications and current commercial use of star-shaped polymers. The aim of this work is to promote star polymer research, generate new avenues of scientific investigation, and provide contemporary perspectives on chemical innovation that may expedite the commercialization of new star nanomaterials. We envision in the not-too-distant future star polymers will play an increasingly important role in materials science and nanotechnology in both academic and industrial settings.

Comparison between Pentacam HR and Orbscan II after hyperopic photorefractive keratectomy

Directory of Open Access Journals (Sweden)

Mahmoud Jabbarvand

2017-01-01

Conclusion: Pentacam HR and Orbscan II after PRK for hyperopia show reasonable agreement for determining A-BFS, P-BFS, A-TG3, and CCT, but not for A-CE, P-CE, A-TG5, or ACD. CCT measurements with Pentacam HR have reasonable agreement with US pachymetry.

An Inventory Controlled Supply Chain Model Based on Improved BP Neural Network

Directory of Open Access Journals (Sweden)

Wei He

2013-01-01

Full Text Available Inventory control is a key factor for reducing supply chain cost and increasing customer satisfaction. However, prediction of inventory level is a challenging task for managers. As one of the widely used techniques for inventory control, standard BP neural network has such problems as low convergence rate and poor prediction accuracy. Aiming at these problems, a new fast convergent BP neural network model for predicting inventory level is developed in this paper. By adding an error offset, this paper deduces the new chain propagation rule and the new weight formula. This paper also applies the improved BP neural network model to predict the inventory level of an automotive parts company. The results show that the improved algorithm not only significantly exceeds the standard algorithm but also outperforms some other improved BP algorithms both on convergence rate and prediction accuracy.

The prenyl-binding protein PrBP/δ: a chaperone participating in intracellular trafficking.

Science.gov (United States)

Zhang, Houbin; Constantine, Ryan; Frederick, Jeanne M; Baehr, Wolfgang

2012-12-15

Expressed ubiquitously, PrBP/δ functions as chaperone/co-factor in the transport of a subset of prenylated proteins. PrBP/δ features an immunoglobulin-like β-sandwich fold for lipid binding, and interacts with diverse partners. PrBP/δ binds both C-terminal C15 and C20 prenyl side chains of phototransduction polypeptides and small GTP-binding (G) proteins of the Ras superfamily. PrBP/δ also interacts with the small GTPases, ARL2 and ARL3, which act as release factors (GDFs) for prenylated cargo. Targeted deletion of the mouse Pde6d gene encoding PrBP/δ resulted in impeded trafficking to the outer segments of GRK1 and cone PDE6 which are predicted to be farnesylated and geranylgeranylated, respectively. Rod and cone transducin trafficking was largely unaffected. These trafficking defects produce progressive cone-rod dystrophy in the Pde6d(-/-) mouse. Copyright © 2012 Elsevier Ltd. All rights reserved.

[Segmentation of whole body bone SPECT image based on BP neural network].

Science.gov (United States)

Zhu, Chunmei; Tian, Lianfang; Chen, Ping; He, Yuanlie; Wang, Lifei; Ye, Guangchun; Mao, Zongyuan

2007-10-01

In this paper, BP neural network is used to segment whole body bone SPECT image so that the lesion area can be recognized automatically. For the uncertain characteristics of SPECT images, it is hard to achieve good segmentation result if only the BP neural network is employed. Therefore, the segmentation process is divided into three steps: first, the optimal gray threshold segmentation method is employed for preprocessing, then BP neural network is used to roughly identify the lesions, and finally template match method and symmetry-removing program are adopted to delete the wrongly recognized areas.

Wolf-Rayet stars

Energy Technology Data Exchange (ETDEWEB)

Sahade, J

1981-12-01

Aspects of the problems of the Wolf-Rayet stars related to their chemical composition, their evolutionary status, and their apparent dichotomy in two spectral sequences are discussed. Dogmas concerning WR stars are critically discussed, including the belief that WR stars lack hydrogen, that they are helium stars evolved from massive close binaries, and the existence of a second WR stage in which the star is a short-period single-lined binary. The relationship of WR stars with planetary nebulae is addressed, as is the membership of these stars in clusters and associations. The division of WR stars into WN and WC sequences is considered, questioning the reasonability of accounting for WR line formation in terms of abundance differences.

Modification of the Clinical Global Impressions (CGI) Scale for use in bipolar illness (BP): the CGI-BP.

Science.gov (United States)

Spearing, M K; Post, R M; Leverich, G S; Brandt, D; Nolen, W

1997-12-05

The Clinical Global Impressions Scale (CGI) was modified specifically for use in assessing global illness severity and change in patients with bipolar disorder. Criticisms of the original CGI were addressed by correcting inconsistencies in scaling, identifying time frames for comparison, clarifying definitions of illness severity and change, and separating out assessment of treatment side effects from illness improvement during treatment. A Detailed User's Guide was developed to train clinicians in the use of the new CGI-Bipolar Version (CGI-BP) for rating severity of manic and depressive episodes and the degree of change from the immediately preceding phase and from the worst phase of illness. The revised scale and manual provide a focused set of instructions to facilitate the reliability of these ratings of mania, depression, and overall bipolar illness during treatment of an acute episode or in longer-term illness prophylaxis. Interrater reliability of the scale was demonstrated in preliminary analyses. Thus, the modified CGI-BP is anticipated to be more useful than the original CGI in studies of bipolar disorder.

StarDOM: From STAR format to XML

International Nuclear Information System (INIS)

Linge, Jens P.; Nilges, Michael; Ehrlich, Lutz

1999-01-01

StarDOM is a software package for the representation of STAR files as document object models and the conversion of STAR files into XML. This allows interactive navigation by using the Document Object Model representation of the data as well as easy access by XML query languages. As an example application, the entire BioMagResBank has been transformed into XML format. Using an XML query language, statistical queries on the collected NMR data sets can be constructed with very little effort. The BioMagResBank/XML data and the software can be obtained at http://www.nmr.embl-heidelberg.de/nmr/StarDOM/

STARS no star on Kauai

International Nuclear Information System (INIS)

Jones, M.

1993-01-01

The island of Kuai, home to the Pacific Missile Range Facility, is preparing for the first of a series of Star Wars rocket launches expected to begin early this year. The Strategic Defense Initiative plans 40 launches of the Stategic Target System (STARS) over a 10-year period. The focus of the tests appears to be weapons and sensors designed to combat multiple-warhead ICBMs, which will be banned under the START II Treaty that was signed in January. The focus of this article is to express the dubious value of testing the STARS at a time when their application will not be an anticipated problem

Distribution of ABO and Rh-Hr blood group antigens, alleles and ...

African Journals Online (AJOL)

ABO and Rh-Hr blood group antigens represent a genetically stably determined trait with many-sided biological and clinical significance. The indigenous Ajarian population (105 subjects) was investigated for ABO Rh-Hr red cell blood group antigens. Using immunoserologic methods, seven blood group antigens (A, B, C, c, ...

Bursopentin (BP5 protects dendritic cells from lipopolysaccharide-induced oxidative stress for immunosuppression.

Directory of Open Access Journals (Sweden)

Tao Qin

Full Text Available Dendritic cells (DCs play a vital role in the regulation of immune-mediated inflammatory diseases. Thus, DCs have been regarded as a major target for the development of immunomodulators. However, oxidative stress could disturb inflammatory regulation in DCs. Here, we examined the effect of bursopentine (BP5, a novel pentapeptide isolated from chicken bursa of fabricius, on the protection of DCs against oxidative stress for immunosuppression. BP5 showed potent protective effects against the lipopolysaccharide (LPS-induced oxidative stress in DCs, including nitric oxide, reactive oxygen species and lipid peroxidation. Furthermore, BP5 elevated the level of cellular reductive status through increasing the reduced glutathione (GSH and the GSH/GSSG ratio. Concomitant with these, the activities of several antioxidative redox enzymes, including glutathione peroxidase (GPx, catalase (CAT and superoxide dismutase (SOD, were obviously enhanced. BP5 also suppressed submucosal DC maturation in the LPS-stimulated intestinal epithelial cells (ECs/DCs coculture system. Finally, we found that heme oxygenase 1 (HO-1 was remarkably upregulated by BP5 in the LPS-induced DCs, and played an important role in the suppression of oxidative stress and DC maturation. These results suggested that BP5 could protect the LPS-activated DCs against oxidative stress and have potential applications in DC-related inflammatory responses.

LBT observations of the HR8799 planetary system

Science.gov (United States)

Mesa, D.; Arcidiacono, C.; Claudi, R. U.; Desidera, S.; Esposito, S.; Gratton, R.; Masciadri, E.

2013-09-01

We present here observations of the HR8799 planetary system performed in H and Ks band exploiting the AO system at the Large Binocular Telescope and the PISCES camera. Thanks to the excellent performence of the instrument we were able to detect for the first time the inner known planet of the system (HR8799) in the H band. Precise photometric and astrometric measures have been taken for all the four planets. Further, exploiting ours and previous astrometric results, we were able to put some limits on the planetary orbits of the four planets. The analysis of the dinamical stability of the system seems to show lower planetary masses than the ones adopted until now.

Effects of cumulative trauma load on perceptions of health, blood pressure, and resting heart rate in urban African American youth.

Science.gov (United States)

Conner-Warren, Rhonda

2014-04-01

This study examined relationships between cumulative trauma (CT) and urban African American (AA) adolescents' blood pressure (BP), heart rate (HR), and perceptions of health. A correlational design using secondary data analysis studied effects of CT, health outcomes, and perceptions of health. Participants were 175 urban AA youth (11-16 years) who completed structured surveys and physiological measures of HR and BP before and after exercise. AA youth were experiencing high levels of CT. Negative correlations were obtained between AA females' perceptions of their health and systolic BP with levels of trauma. No gender differences were found in HR or BP. AA females with high CT may perceive themselves as less healthy and can be at risk for health problems. © 2014, Wiley Periodicals, Inc.

阴道滴虫与宫颈HR-HPV感染及宫颈癌发生的相关性%Association about Trichomonas, HR-HPV Infection and Cervical Carcinoma

Institute of Scientific and Technical Information of China (English)

李旻; 郭会芹; 陈凤; 曹箭; 李中林; 张询; 潘秦镜

2007-01-01

目的 探讨阴道滴虫是否能增加高危人乳头瘤病毒(HR-HPV)感染和宫颈癌发生的危险.方法 对受检者进行液基细胞学检查和HR-HPV DNA检测,并在细胞学诊断中记录是否存在滴虫.对所有细胞学诊断非典型鳞状细胞(ASC)及以上病变、HR-HPV DNA阳性病例和部分细胞学阴性及HR-HPV DNA阴性病例进行阴道镜检查及活检.分别比较滴虫在HR-HPV DNA阳性组和阴性组、细胞学及组织学各级诊断中的存在率.结果 在13 024例受检者中有1 687例(12.95%)涂片中有滴虫.滴虫存在率在HR-HPV DNA阳性组与阴性组中无显著统计学差异(P＞0.05),在细胞学阴性病例组显著高于鳞状上皮内病变组(P＜0.05),在组织学阴性病例组显著高于在≥CIN2病例组(P＜0.05).结论 滴虫的存在不增加HR-HPV感染率,也不增加宫颈癌发生的危险.

Acute effect of ivabradine on heart rate and myocardial oxygen consumption in dogs with asymptomatic mitral valve degeneration.

Science.gov (United States)

Pirintr, Prapawadee; Limprasutr, Vudhiporn; Saengklub, Nakkawee; Pavinadol, Parnpradub; Yapao, Napat; Limvanicharat, Natthakarn; Kuecharoen, Hathaisiri; Kijtawornrat, Anusak

2018-05-14

Degenerative mitral valve disease (DMVD) is a common cardiac disease in geriatric dogs characterized by the degeneration of the mitral valve, leading to decreased cardiac output and activation of the sympathetic and renin-angiotensin-aldosterone system. This disease results in an increased resting heart rate (HR) and myocardial oxygen consumption (MVO 2 ). A recent publication demonstrated that dogs with asymptomatic DMVD had a significantly higher HR and systemic blood pressure (BP) than age-matched control dogs. This higher HR will eventually contribute to increased MVO 2 . This study aimed to determine the effects of a single oral dose of ivabradine on the HR, MVO 2 as assessed by the rate-pressure product, and BP in dogs with asymptomatic DMVD. Seven beagles with naturally occurring DMVD were instrumented by the Holter recorder and an oscillometric device to measure electrocardiogram and BP for 24 and 12 h, respectively. Each dog was randomly subjected to receive either placebo or ivabradine (0.5, 1.0 and 2.0 mg/kg). The results revealed that oral administration of ivabradine significantly decreased the HR and rate-pressure product in a dose-dependent manner without adverse effects. The highest dose of 2.0 mg/kg significantly reduced systolic and mean BP. Therefore, the findings imply that a single oral ivabradine administration at a dose of 1.0 mg/kg is suitable for dogs with asymptomatic DMVD to reduce the HR and MVO 2 without marked effects on BP. This may potentially make ivabradine promising for management of an elevated HR in DMVD dogs.

Star-forming galaxy models: Blending star formation into TREESPH

Science.gov (United States)

Mihos, J. Christopher; Hernquist, Lars

1994-01-01

We have incorporated star-formation algorithms into a hybrid N-body/smoothed particle hydrodynamics code (TREESPH) in order to describe the star forming properties of disk galaxies over timescales of a few billion years. The models employ a Schmidt law of index n approximately 1.5 to calculate star-formation rates, and explicitly include the energy and metallicity feedback into the Interstellar Medium (ISM). Modeling the newly formed stellar population is achieved through the use of hybrid SPH/young star particles which gradually convert from gaseous to collisionless particles, avoiding the computational difficulties involved in creating new particles. The models are shown to reproduce well the star-forming properties of disk galaxies, such as the morphology, rate of star formation, and evolution of the global star-formation rate and disk gas content. As an example of the technique, we model an encounter between a disk galaxy and a small companion which gives rise to a ring galaxy reminiscent of the Cartwheel (AM 0035-35). The primary galaxy in this encounter experiences two phases of star forming activity: an initial period during the expansion of the ring, and a delayed phase as shocked material in the ring falls back into the central regions.

HR practices for enhancing sustainable employability : implementation, use, and outcomes

OpenAIRE

Ybema, Jan Fekke; van Vuuren, Tinka; van Dam, Karen

2017-01-01

With the aging of the workforce, organizations need to maintain or improve the sustainable employability of their workforce throughout their working life. This raises the question which HR practices increase workers’ sustainable employability at work. The aim of this study is to investigate the extent to which organizations implement HR practices for enhancing sustainable employability in terms of workers’ health, motivation, and skills and knowledge from the employer’s perspective. In total,...

EMACSS: Evolve Me A Cluster of StarS

Science.gov (United States)

Alexander, Poul E. R.; Gieles, Mark

2012-03-01

The star cluster evolution code Evolve Me A Cluster of StarS (EMACSS) is a simple yet physically motivated computational model that describes the evolution of some fundamental properties of star clusters in static tidal fields. The prescription is based upon the flow of energy within the cluster, which is a constant fraction of the total energy per half-mass relaxation time. According to Henon's predictions, this flow is independent of the precise mechanisms for energy production within the core, and therefore does not require a complete description of the many-body interactions therein. Dynamical theory and analytic descriptions of escape mechanisms is used to construct a series of coupled differential equations expressing the time evolution of cluster mass and radius for a cluster of equal-mass stars. These equations are numerically solved using a fourth-order Runge-Kutta integration kernel; the results were benchmarked against a data base of direct N-body simulations. EMACSS is publicly available and reproduces the N-body results to within 10 per cent accuracy for the entire post-collapse evolution of star clusters.

BP erioperatsioon naftalekke peatamiseks nurjus / Jürgen Tamme

Index Scriptorium Estoniae

Tamme, Jürgen

2010-01-01

Naftakompanii BP katse peatada Mehhiko lahe naftaleke ebaõnnestus, nüüd püütakse reostust peatada uue toru paigaldamise abil. USA president Barack Obama avaldas taas rahulolematust naftakompaniiga. Kaart

Cardiovascular response during submaximal underwater treadmill exercise in stroke patients.

Science.gov (United States)

Yoo, Jeehyun; Lim, Kil-Byung; Lee, Hong-Jae; Kwon, Yong-Geol

2014-10-01

To evaluate the cardiovascular response during head-out water immersion, underwater treadmill gait, and land treadmill gait in stroke patients. Ten stroke patients were recruited for underwater and land treadmill gait sessions. Each session was 40 minutes long; 5 minutes for standing rest on land, 5 minutes for standing rest in water or on treadmill, 20 minutes for treadmill walking in water or on land, 5 minutes for standing rest in water or on treadmill, and 5 minutes for standing rest on land. Blood pressure (BP) and heart rate (HR) were measured during each session. In order to estimate the cardiovascular workload and myocardial oxygen demand, the rate pressure product (RPP) value was calculated by multiplying systolic BP (SBP) by HR. SBP, DBP, mean BP (mBP), and RPP decreased significantly after water immersion, but HR was unchanged. During underwater and land treadmill gait, SBP, mBP, DBP, RPP, and HR increased. However, the mean maximum increases in BP, HR and RPP of underwater treadmill walking were significantly lower than that of land treadmill walking. Stroke patients showed different cardiovascular responses during water immersion and underwater gait as opposed to standing and treadmill-walking on land. Water immersion and aquatic treadmill gait may reduce the workload of the cardiovascular system. This study suggested that underwater treadmill may be a safe and useful option for cardiovascular fitness and early ambulation in stroke rehabilitation.

EST Table: BP117517 [KAIKOcDNA[Archive

Lifescience Database Archive (English)

Full Text Available BP117517 ce--0464 10/09/28 63 %/173 aa ref|XP_002092422.1| GE14184 [Drosophila yakuba] gb|EDW92134.1| GE14...184 [Drosophila yakuba] 10/08/28 63 %/173 aa FBpp0259194|DyakGE14184-PA 10/08/28 35 %

Drosophila Longevity Assurance Conferred by Reduced Insulin Receptor Substrate Chico Partially Requires d4eBP.

Directory of Open Access Journals (Sweden)

Hua Bai

Full Text Available Mutations of the insulin/IGF signaling (IIS pathway extend Drosophila lifespan. Based on genetic epistasis analyses, this longevity assurance is attributed to downstream effects of the FOXO transcription factor. However, as reported FOXO accounts for only a portion of the observed longevity benefit, suggesting there are additional outputs of IIS to mediate aging. One candidate is target of rapamycin complex 1 (TORC1. Reduced TORC1 activity is reported to slow aging, whereas reduced IIS is reported to repress TORC1 activity. The eukaryotic translation initiation factor 4E binding protein (4E-BP is repressed by TORC1, and activated 4E-BP is reported to increase Drosophila lifespan. Here we use genetic epistasis analyses to test whether longevity assurance mutants of chico, the Drosophila insulin receptor substrate homolog, require Drosophila d4eBP to slow aging. In chico heterozygotes, which are robustly long-lived, d4eBP is required but not sufficient to slow aging. Remarkably, d4eBP is not required or sufficient for chico homozygotes to extend longevity. Likewise, chico heterozygote females partially require d4eBP to preserve age-dependent locomotion, and both chico genotypes require d4eBP to improve stress-resistance. Reproduction and most measures of growth affected by either chico genotype are always independent of d4eBP. In females, chico heterozygotes paradoxically produce more rather than less phosphorylated 4E-BP (p4E-BP. Altered IRS function within the IIS pathway of Drosophila appears to have partial, conditional capacity to regulate aging through an unconventional interaction with 4E-BP.

MCM-BP regulates unloading of the MCM2–7 helicase in late S phase

Science.gov (United States)

Nishiyama, Atsuya; Frappier, Lori; Méchali, Marcel

2011-01-01

Origins of DNA replication are licensed by recruiting MCM2–7 to assemble the prereplicative complex (pre-RC). How MCM2–7 is inactivated or removed from chromatin at the end of S phase is still unclear. Here, we show that MCM-BP can disassemble the MCM2–7 complex and might function as an unloader of MCM2–7 from chromatin. In Xenopus egg extracts, MCM-BP exists in a stable complex with MCM7, but is not associated with the MCM2–7 hexameric complex. MCM-BP accumulates in nuclei in late S phase, well after the loading of MCM2–7 onto chromatin. MCM-BP immunodepletion in Xenopus egg extracts inhibits replication-dependent MCM dissociation without affecting pre-RC formation and DNA replication. When excess MCM-BP is incubated with Xenopus egg extracts or immunopurified MCM2–7, it binds to MCM proteins and promotes disassembly of the MCM2–7 complex. Recombinant MCM-BP also releases MCM2–7 from isolated late-S-phase chromatin, but this activity is abolished when DNA replication is blocked. MCM-BP silencing in human cells also delays MCM dissociation in late S phase. We propose that MCM-BP plays a key role in the mechanism by which pre-RC is cleared from replicated DNA in vertebrate cells. PMID:21196493

Oxygen-dependent acetylation and dimerization of the corepressor CtBP2 in neural stem cells

International Nuclear Information System (INIS)

Karaca, Esra; Lewicki, Jakub; Hermanson, Ola

2015-01-01

The transcriptional corepressor CtBP2 is essential for proper development of the nervous system. The factor exerts its repression by interacting in complexes with chromatin-modifying factors such as histone deacetylases (HDAC) 1/2 and the histone demethylase LSD1/KDM1. Notably, the histone acetyl transferase p300 acetylates CtBP2 and this is an important regulatory event of the activity and subcellular localization of the protein. We recently demonstrated an essential role for CtBPs as sensors of microenvironmental oxygen levels influencing the differentiation potential of neural stem cells (NSCs), but it is not known whether oxygen levels influence the acetylation levels of CtBP factors. Here we show by using proximity ligation assay (PLA) that CtBP2 acetylation levels increased significantly in undifferentiated, proliferating NSCs under hypoxic conditions. CtBP2 interacted with the class III HDAC Sirt1 but this interaction was unaltered in hypoxic conditions, and treatment with the Sirt1 inhibitor Ex527 did not result in any significant change in total CtBP2 acetylation levels. Instead, we revealed a significant decrease in PLA signal representing CtBP2 dimerization in NSCs under hypoxic conditions, negatively correlating with the acetylation levels. Our results suggest that microenvironmental oxygen levels influence the dimerization and acetylation levels, and thereby the activity, of CtBP2 in proliferating NSCs

Oxygen-dependent acetylation and dimerization of the corepressor CtBP2 in neural stem cells

Energy Technology Data Exchange (ETDEWEB)

Karaca, Esra; Lewicki, Jakub; Hermanson, Ola, E-mail: Ola.Hermanson@ki.se

2015-03-01

The transcriptional corepressor CtBP2 is essential for proper development of the nervous system. The factor exerts its repression by interacting in complexes with chromatin-modifying factors such as histone deacetylases (HDAC) 1/2 and the histone demethylase LSD1/KDM1. Notably, the histone acetyl transferase p300 acetylates CtBP2 and this is an important regulatory event of the activity and subcellular localization of the protein. We recently demonstrated an essential role for CtBPs as sensors of microenvironmental oxygen levels influencing the differentiation potential of neural stem cells (NSCs), but it is not known whether oxygen levels influence the acetylation levels of CtBP factors. Here we show by using proximity ligation assay (PLA) that CtBP2 acetylation levels increased significantly in undifferentiated, proliferating NSCs under hypoxic conditions. CtBP2 interacted with the class III HDAC Sirt1 but this interaction was unaltered in hypoxic conditions, and treatment with the Sirt1 inhibitor Ex527 did not result in any significant change in total CtBP2 acetylation levels. Instead, we revealed a significant decrease in PLA signal representing CtBP2 dimerization in NSCs under hypoxic conditions, negatively correlating with the acetylation levels. Our results suggest that microenvironmental oxygen levels influence the dimerization and acetylation levels, and thereby the activity, of CtBP2 in proliferating NSCs.

A central role for R7bp in the regulation of itch sensation.

Science.gov (United States)

Pandey, Mritunjay; Zhang, Jian-Hua; Mishra, Santosh K; Adikaram, Poorni R; Harris, Benjamin; Kahler, John F; Loshakov, Anna; Sholevar, Roxanne; Genis, Allison; Kittock, Claire; Kabat, Juraj; Ganesan, Sundar; Neubig, Richard R; Hoon, Mark A; Simonds, William F