WorldWideScience

Sample records for bp fusion model

  1. BP fusion model for the detection of oil spills on the sea by remote sensing

    Science.gov (United States)

    Chen, Weiwei; An, Jubai; Zhang, Hande; Lin, Bin

    2003-06-01

    Oil spills are very serious marine pollution in many countries. In order to detect and identify the oil-spilled on the sea by remote sensor, scientists have to conduct a research work on the remote sensing image. As to the detection of oil spills on the sea, edge detection is an important technology in image processing. There are many algorithms of edge detection developed for image processing. These edge detection algorithms always have their own advantages and disadvantages in the image processing. Based on the primary requirements of edge detection of the oil spills" image on the sea, computation time and detection accuracy, we developed a fusion model. The model employed a BP neural net to fuse the detection results of simple operators. The reason we selected BP neural net as the fusion technology is that the relation between simple operators" result of edge gray level and the image"s true edge gray level is nonlinear, while BP neural net is good at solving the nonlinear identification problem. Therefore in this paper we trained a BP neural net by some oil spill images, then applied the BP fusion model on the edge detection of other oil spill images and obtained a good result. In this paper the detection result of some gradient operators and Laplacian operator are also compared with the result of BP fusion model to analysis the fusion effect. At last the paper pointed out that the fusion model has higher accuracy and higher speed in the processing oil spill image"s edge detection.

  2. Modeling and Prediction of Coal Ash Fusion Temperature based on BP Neural Network

    Directory of Open Access Journals (Sweden)

    Miao Suzhen

    2016-01-01

    Full Text Available Coal ash is the residual generated from combustion of coal. The ash fusion temperature (AFT of coal gives detail information on the suitability of a coal source for gasification procedures, and specifically to which extent ash agglomeration or clinkering is likely to occur within the gasifier. To investigate the contribution of oxides in coal ash to AFT, data of coal ash chemical compositions and Softening Temperature (ST in different regions of China were collected in this work and a BP neural network model was established by XD-APC PLATFORM. In the BP model, the inputs were the ash compositions and the output was the ST. In addition, the ash fusion temperature prediction model was obtained by industrial data and the model was generalized by different industrial data. Compared to empirical formulas, the BP neural network obtained better results. By different tests, the best result and the best configurations for the model were obtained: hidden layer nodes of the BP network was setted as three, the component contents (SiO2, Al2O3, Fe2O3, CaO, MgO were used as inputs and ST was used as output of the model.

  3. Effective Multifocus Image Fusion Based on HVS and BP Neural Network

    Directory of Open Access Journals (Sweden)

    Yong Yang

    2014-01-01

    Full Text Available The aim of multifocus image fusion is to fuse the images taken from the same scene with different focuses to obtain a resultant image with all objects in focus. In this paper, a novel multifocus image fusion method based on human visual system (HVS and back propagation (BP neural network is presented. Three features which reflect the clarity of a pixel are firstly extracted and used to train a BP neural network to determine which pixel is clearer. The clearer pixels are then used to construct the initial fused image. Thirdly, the focused regions are detected by measuring the similarity between the source images and the initial fused image followed by morphological opening and closing operations. Finally, the final fused image is obtained by a fusion rule for those focused regions. Experimental results show that the proposed method can provide better performance and outperform several existing popular fusion methods in terms of both objective and subjective evaluations.

  4. Probabilistic transport models for fusion

    International Nuclear Information System (INIS)

    Milligen, B.Ph. van; Carreras, B.A.; Lynch, V.E.; Sanchez, R.

    2005-01-01

    A generalization of diffusive (Fickian) transport is considered, in which particle motion is described by probability distributions. We design a simple model that includes a critical mechanism to switch between two transport channels, and show that it exhibits various interesting characteristics, suggesting that the ideas of probabilistic transport might provide a framework for the description of a range of unusual transport phenomena observed in fusion plasmas. The model produces power degradation and profile consistency, as well as a scaling of the confinement time with system size reminiscent of the gyro-Bohm/Bohm scalings observed in fusion plasmas, and rapid propagation of disturbances. In the present work we show how this model may also produce on-axis peaking of the profiles with off-axis fuelling. It is important to note that the fluid limit of a simple model like this, characterized by two transport channels, does not correspond to the usual (Fickian) transport models commonly used for modelling transport in fusion plasmas, and behaves in a fundamentally different way. (author)

  5. Modeling wormhole growth and wormhole networks in unconsolidated sand media using the BP CHOPS model

    Energy Technology Data Exchange (ETDEWEB)

    Vanderheyden, W.B. [BP America, Inc. Exploration and Production Technology Unconventional Oil Flagship (United States); Zhang, D. Z.; Jayaraman, B. [Los Alamos National Laboratory Theoretical Division Solid and Fluid Dynamics Group (United States)

    2011-07-01

    Cold Heavy Oil Production with Sand (CHOPS) is a recovery method used in unconsolidated sands to produce heavy oil. During the use of the CHOPS method, wormholes originating from production wells are generated. The aim of this paper is to present 2 modeling tools developed by BP in order to improve reservoir simulation of CHOPS operations with wormholes. The first tool developed is a CHOPS modeling framework representing wormhole networks through reservoir simulation and its wellbore model. The second one consists of the application of advanced fluid-structure interaction modeling into the simulation of wormhole and its network growth. Experiments were carried out and a qualitative agreement was achieved with the model. In addition the BP CHOPS model can predict probable oil production without calibration. This paper presented an improved model for reservoir simulation with wormholes but further work is required to predict wormhole shape in a more accurate manner.

  6. An Inventory Controlled Supply Chain Model Based on Improved BP Neural Network

    Directory of Open Access Journals (Sweden)

    Wei He

    2013-01-01

    Full Text Available Inventory control is a key factor for reducing supply chain cost and increasing customer satisfaction. However, prediction of inventory level is a challenging task for managers. As one of the widely used techniques for inventory control, standard BP neural network has such problems as low convergence rate and poor prediction accuracy. Aiming at these problems, a new fast convergent BP neural network model for predicting inventory level is developed in this paper. By adding an error offset, this paper deduces the new chain propagation rule and the new weight formula. This paper also applies the improved BP neural network model to predict the inventory level of an automotive parts company. The results show that the improved algorithm not only significantly exceeds the standard algorithm but also outperforms some other improved BP algorithms both on convergence rate and prediction accuracy.

  7. On Affine Fusion and the Phase Model

    Directory of Open Access Journals (Sweden)

    Mark A. Walton

    2012-11-01

    Full Text Available A brief review is given of the integrable realization of affine fusion discovered recently by Korff and Stroppel. They showed that the affine fusion of the su(n Wess-Zumino-Novikov-Witten (WZNW conformal field theories appears in a simple integrable system known as the phase model. The Yang-Baxter equation leads to the construction of commuting operators as Schur polynomials, with noncommuting hopping operators as arguments. The algebraic Bethe ansatz diagonalizes them, revealing a connection to the modular S matrix and fusion of the su(n WZNW model. The noncommutative Schur polynomials play roles similar to those of the primary field operators in the corresponding WZNW model. In particular, their 3-point functions are the su(n fusion multiplicities. We show here how the new phase model realization of affine fusion makes obvious the existence of threshold levels, and how it accommodates higher-genus fusion.

  8. Generomak: Fusion physics, engineering and costing model

    International Nuclear Information System (INIS)

    Delene, J.G.; Krakowski, R.A.; Sheffield, J.; Dory, R.A.

    1988-06-01

    A generic fusion physics, engineering and economics model (Generomak) was developed as a means of performing consistent analysis of the economic viability of alternative magnetic fusion reactors. The original Generomak model developed at Oak Ridge by Sheffield was expanded for the analyses of the Senior Committee on Environmental Safety and Economics of Magnetic Fusion Energy (ESECOM). This report describes the Generomak code as used by ESECOM. The input data used for each of the ten ESECOM fusion plants and the Generomak code output for each case is given. 14 refs., 3 figs., 17 tabs

  9. Modeling Cyber Situational Awareness Through Data Fusion

    Science.gov (United States)

    2013-03-01

    following table: Table 3.10: Example Vulnerable Hosts for Criticality Assessment Experiment Example Id OS Applications/Services Version 1 Mac OS X VLC ...linux.org/. [4] Blasch, E., I. Kadar, J. Salerno, M. Kokar, S. Das, G. Powell, D. Corkill, and E. Ruspini. “Issues and challenges of knowledge representation...Holsopple. “Issues and challenges in higher level fusion: Threat/impact assessment and intent modeling (a panel summary)”. Information Fusion (FUSION

  10. Fusion algebras of logarithmic minimal models

    International Nuclear Information System (INIS)

    Rasmussen, Joergen; Pearce, Paul A

    2007-01-01

    We present explicit conjectures for the chiral fusion algebras of the logarithmic minimal models LM(p,p') considering Virasoro representations with no enlarged or extended symmetry algebra. The generators of fusion are countably infinite in number but the ensuing fusion rules are quasi-rational in the sense that the fusion of a finite number of representations decomposes into a finite direct sum of representations. The fusion rules are commutative, associative and exhibit an sl(2) structure but require so-called Kac representations which are typically reducible yet indecomposable representations of rank 1. In particular, the identity of the fundamental fusion algebra p ≠ 1 is a reducible yet indecomposable Kac representation of rank 1. We make detailed comparisons of our fusion rules with the results of Gaberdiel and Kausch for p = 1 and with Eberle and Flohr for (p, p') = (2, 5) corresponding to the logarithmic Yang-Lee model. In the latter case, we confirm the appearance of indecomposable representations of rank 3. We also find that closure of a fundamental fusion algebra is achieved without the introduction of indecomposable representations of rank higher than 3. The conjectured fusion rules are supported, within our lattice approach, by extensive numerical studies of the associated integrable lattice models. Details of our lattice findings and numerical results will be presented elsewhere. The agreement of our fusion rules with the previous fusion rules lends considerable support for the identification of the logarithmic minimal models LM(p,p') with the augmented c p,p' (minimal) models defined algebraically

  11. Temperature prediction model of asphalt pavement in cold regions based on an improved BP neural network

    International Nuclear Information System (INIS)

    Xu, Bo; Dan, Han-Cheng; Li, Liang

    2017-01-01

    Highlights: • Pavement temperature prediction model is presented with improved BP neural network. • Dynamic and static methods are presented to predict pavement temperature. • Pavement temperature can be excellently predicted in next 3 h. - Abstract: Ice cover on pavement threatens traffic safety, and pavement temperature is the main factor used to determine whether the wet pavement is icy or not. In this paper, a temperature prediction model of the pavement in winter is established by introducing an improved Back Propagation (BP) neural network model. Before the application of the BP neural network model, many efforts were made to eliminate chaos and determine the regularity of temperature on the pavement surface (e.g., analyze the regularity of diurnal and monthly variations of pavement temperature). New dynamic and static prediction methods are presented by improving the algorithms to intelligently overcome the prediction inaccuracy at the change point of daily temperature. Furthermore, some scenarios have been compared for different dates and road sections to verify the reliability of the prediction model. According to the analysis results, the daily pavement temperatures can be accurately predicted for the next 3 h from the time of prediction by combining the dynamic and static prediction methods. The presented method in this paper can provide technical references for temperature prediction of the pavement and the development of an early-warning system for icy pavements in cold regions.

  12. Research on the Prediction Model of CPU Utilization Based on ARIMA-BP Neural Network

    Directory of Open Access Journals (Sweden)

    Wang Jina

    2016-01-01

    Full Text Available The dynamic deployment technology of the virtual machine is one of the current cloud computing research focuses. The traditional methods mainly work after the degradation of the service performance that usually lag. To solve the problem a new prediction model based on the CPU utilization is constructed in this paper. A reference offered by the new prediction model of the CPU utilization is provided to the VM dynamic deployment process which will speed to finish the deployment process before the degradation of the service performance. By this method it not only ensure the quality of services but also improve the server performance and resource utilization. The new prediction method of the CPU utilization based on the ARIMA-BP neural network mainly include four parts: preprocess the collected data, build the predictive model of ARIMA-BP neural network, modify the nonlinear residuals of the time series by the BP prediction algorithm and obtain the prediction results by analyzing the above data comprehensively.

  13. Comparison of Spatiotemporal Fusion Models: A Review

    Directory of Open Access Journals (Sweden)

    Bin Chen

    2015-02-01

    Full Text Available Simultaneously capturing spatial and temporal dynamics is always a challenge for the remote sensing community. Spatiotemporal fusion has gained wide interest in various applications for its superiority in integrating both fine spatial resolution and frequent temporal coverage. Though many advances have been made in spatiotemporal fusion model development and applications in the past decade, a unified comparison among existing fusion models is still limited. In this research, we classify the models into three categories: transformation-based, reconstruction-based, and learning-based models. The objective of this study is to (i compare four fusion models (STARFM, ESTARFM, ISTAFM, and SPSTFM under a one Landsat-MODIS (L-M pair prediction mode and two L-M pair prediction mode using time-series datasets from the Coleambally irrigation area and Poyang Lake wetland; (ii quantitatively assess prediction accuracy considering spatiotemporal comparability, landscape heterogeneity, and model parameter selection; and (iii discuss the advantages and disadvantages of the three categories of spatiotemporal fusion models.

  14. Topological matter, integrable models and fusion rings

    International Nuclear Information System (INIS)

    Nemeschansky, D.; Warner, N.P.

    1992-01-01

    We show how topological G k /G k models can be embedded into the topological matter models that are obtained by perturbing the twisted N = 2 supersymmetric, hermitian symmetric, coset models. In particular, this leads to an embedding of the fusion ring of G as a sub-ring of the perturbed, chiral primary ring. The perturbation of the twisted N = 2 model that leads to the fusion ring is also shown to lead to an integrable N = 2 supersymmetric field theory when the untwisted N = 2 superconformal field theory is perturbed by the same operator and its hermitian conjugate. (orig.)

  15. Application of BP Neural Network Algorithm in Traditional Hydrological Model for Flood Forecasting

    Directory of Open Access Journals (Sweden)

    Jianjin Wang

    2017-01-01

    Full Text Available Flooding contributes to tremendous hazards every year; more accurate forecasting may significantly mitigate the damages and loss caused by flood disasters. Current hydrological models are either purely knowledge-based or data-driven. A combination of data-driven method (artificial neural networks in this paper and knowledge-based method (traditional hydrological model may booster simulation accuracy. In this study, we proposed a new back-propagation (BP neural network algorithm and applied it in the semi-distributed Xinanjiang (XAJ model. The improved hydrological model is capable of updating the flow forecasting error without losing the leading time. The proposed method was tested in a real case study for both single period corrections and real-time corrections. The results reveal that the proposed method could significantly increase the accuracy of flood forecasting and indicate that the global correction effect is superior to the second-order autoregressive correction method in real-time correction.

  16. Evaluation of Water Resource Security Based on an MIV-BP Model in a Karst Area

    Directory of Open Access Journals (Sweden)

    Liying Liu

    2018-06-01

    Full Text Available Evaluation of water resource security deserves particular attention in water resource planning and management. A typical karst area in Guizhou Province, China, was used as the research area in this paper. First, based on data from Guizhou Province for the past 10 years, the mean impact value–back propagation (MIV-BP model was used to analyze the factors influencing water resource security in the karst area. Second, 18 indices involving five aspects, water environment subsystem, social subsystem, economic subsystem, ecological subsystem, and human subsystem, were selected to establish an evaluation index of water resource security. Finally, a BP artificial neural network model was constructed to evaluate the water resource security of Guizhou Province from 2005 to 2014. The results show that water resource security in Guizhou, which was at a moderate warning level from 2005 to 2009 and a critical safety level from 2010 to 2014, has generally improved. Groundwater supply ratio, industrial water utilization rate, water use efficiency, per capita grain production, and water yield modulus were the obstacles to water resource security. Driving factors were comprehensive utilization rate of industrial solid waste, qualifying rate of industrial wastewater, above moderate rocky desertification area ratio, water requirement per unit gross domestic product (GDP, and degree of development and utilization of groundwater. Our results provide useful suggestions on the management of water resource security in Guizhou Province and a valuable reference for water resource research.

  17. Modelling irradiation effects in fusion materials

    DEFF Research Database (Denmark)

    Victoria, M.; Dudarev, S.; Boutard, J.L.

    2007-01-01

    We review the current status of the European fusion materials modelling programme. We describe recent findings and outline potential areas for future development. Large-scale density functional theory (DFT) calculations reveal the structure of the point defects in α-Fe, and highlight the crucial...

  18. D-FNN Based Modeling and BP Neural Network Decoupling Control of PVC Stripping Process

    Directory of Open Access Journals (Sweden)

    Shu-zhi Gao

    2014-01-01

    Full Text Available PVC stripping process is a kind of complicated industrial process with characteristics of highly nonlinear and time varying. Aiming at the problem of establishing the accurate mathematics model due to the multivariable coupling and big time delay, the dynamic fuzzy neural network (D-FNN is adopted to establish the PVC stripping process model based on the actual process operation datum. Then, the PVC stripping process is decoupled by the distributed neural network decoupling module to obtain two single-input-single-output (SISO subsystems (slurry flow to top tower temperature and steam flow to bottom tower temperature. Finally, the PID controller based on BP neural networks is used to control the decoupled PVC stripper system. Simulation results show the effectiveness of the proposed integrated intelligent control method.

  19. Construction of Fluid - solid Coupling Model with Improved Richards - BP & Its Engineering Application

    Science.gov (United States)

    Xie, Chengyu; Jia, Nan; Shi, Dongping; Lu, Hao

    2017-10-01

    In order to study the slurry diffusion law during grouting, Richards unsaturated-saturated model was introduced, the definition of the grouting model is clear, the Richards model control equation was established, And the BP neural network was introduced, the improved fluid-solid coupling model was constructed, Through the use of saturated - unsaturated seepage flow model, As well as the overflow boundary iterative solution of the mixed boundary conditions, the free surface is calculated. Engineering practice for an example, with the aid of multi - field coupling analysis software, the diffusion law of slurry was simulated numerically. The results show that the slurry diffusion rule is affected by grouting material, initial pressure and other factors. When the slurry starts, it flows in the cracks along the upper side of the grouting hole, when the pressure gradient is reduced to the critical pressure, that is, to the lower side of the flow, when the slurry diffusion stability, and ultimately its shape like an 8. The slurry is spread evenly from the overall point of view, from the grouting mouth toward the surrounding evenly spread, it gradually reaches saturation by non-saturation, and it is not a purely saturated flow, when the slurry spread and reach a saturated state, the diffusion time is the engineering grouting time.

  20. Realization of BP neural network modeling based on NOXof CFB boiler in DCS

    Science.gov (United States)

    Bai, Jianyun; Zhu, Zhujun; Wang, Qi; Ying, Jiang

    2018-02-01

    In the CFB boiler installed with SNCR denitrification system, the mass concentration of NO X is difficult to be predicted by the conventional mathematical model, and the step response mathematical model, obtained by using the step disturbance test of ammonia injection,is inaccurate. this paper presents two kinds of BP neural network model, according to the relationship between the generated mass concentration of NO X and the load, the ratio of air to coal without using the SNCR system, as well as the relationship between the tested mass concentration of NO X and the load, the ratio of air to coal and the amount of ammonia using the SNCR system. then itrealized the on-line prediction of the mass concentration of NO X and the remaining mass concentration of NO X after reductionreaction in DCS system. the practical results show that the average error per hour between generation and the prediction of the amount of NO X mass concentration is within 10 mg/Nm3,the reducing reaction of measured and predicted hourly average error is within 2 mg/Nm3, all in error range, which provides a more accurate model for solvingthe problem on NO X automatic control of SNCR system.

  1. Modeling decisions information fusion and aggregation operators

    CERN Document Server

    Torra, Vicenc

    2007-01-01

    Information fusion techniques and aggregation operators produce the most comprehensive, specific datum about an entity using data supplied from different sources, thus enabling us to reduce noise, increase accuracy, summarize and extract information, and make decisions. These techniques are applied in fields such as economics, biology and education, while in computer science they are particularly used in fields such as knowledge-based systems, robotics, and data mining. This book covers the underlying science and application issues related to aggregation operators, focusing on tools used in practical applications that involve numerical information. Starting with detailed introductions to information fusion and integration, measurement and probability theory, fuzzy sets, and functional equations, the authors then cover the following topics in detail: synthesis of judgements, fuzzy measures, weighted means and fuzzy integrals, indices and evaluation methods, model selection, and parameter extraction. The method...

  2. Model-based satellite image fusion

    DEFF Research Database (Denmark)

    Aanæs, Henrik; Sveinsson, J. R.; Nielsen, Allan Aasbjerg

    2008-01-01

    A method is proposed for pixel-level satellite image fusion derived directly from a model of the imaging sensor. By design, the proposed method is spectrally consistent. It is argued that the proposed method needs regularization, as is the case for any method for this problem. A framework for pixel...... neighborhood regularization is presented. This framework enables the formulation of the regularization in a way that corresponds well with our prior assumptions of the image data. The proposed method is validated and compared with other approaches on several data sets. Lastly, the intensity......-hue-saturation method is revisited in order to gain additional insight of what implications the spectral consistency has for an image fusion method....

  3. Heavy ion fusion reactions: comparison among different models

    Energy Technology Data Exchange (ETDEWEB)

    Canto, L F; Carlson, B V; Hussein, M S

    1988-03-01

    A comparison among different ion fusion models is presented. In particular, the multistep aspects of the recently proposed Dinucleus Doorway Model are made explicit and the model is confronted with other compound nucleus limitation models. It is suggested that the latter models provide effective one-step descriptions of heavy ion fusion.

  4. Multi-model ensemble hydrological simulation using a BP Neural Network for the upper Yalongjiang River Basin, China

    Science.gov (United States)

    Li, Zhanjie; Yu, Jingshan; Xu, Xinyi; Sun, Wenchao; Pang, Bo; Yue, Jiajia

    2018-06-01

    Hydrological models are important and effective tools for detecting complex hydrological processes. Different models have different strengths when capturing the various aspects of hydrological processes. Relying on a single model usually leads to simulation uncertainties. Ensemble approaches, based on multi-model hydrological simulations, can improve application performance over single models. In this study, the upper Yalongjiang River Basin was selected for a case study. Three commonly used hydrological models (SWAT, VIC, and BTOPMC) were selected and used for independent simulations with the same input and initial values. Then, the BP neural network method was employed to combine the results from the three models. The results show that the accuracy of BP ensemble simulation is better than that of the single models.

  5. Three-dimensional model for fusion processes

    International Nuclear Information System (INIS)

    Olson, A.P.

    1984-01-01

    Active galactic nuclei (AGN) emit unusual spectra of radiation which is interpreted to signify extreme distance, extreme power, or both. The status of AGNs was recently reviewed by Balick and Heckman. It seems that the greatest conceptual difficulty with understanding AGNs is how to form a coherent phenomenological model of their properties. What drives the galactic engine. What and where are the mass-flows of fuel to this engine. Are there more than one engine. Do the engines have any symmetry properties. Is observed radiation isotropically emitted from the source. If it is polarized, what causes the polarization. Why is there a roughly spherical cloud of ionized gas about the center of our own galaxy, the Milky Way. The purpose of this paper is to discuss a new model, based on fusion processes which are not axisymmetric, uniform, isotropic, or even time-invariant. Then, the relationship to these questions will be developed. A unified model of fusion processes applicable to many astronomical phenomena will be proposed and discussed

  6. Predictions on the Development Dimensions of Provincial Tourism Discipline Based on the Artificial Neural Network BP Model

    Science.gov (United States)

    Yang, Yang; Hu, Jun; Lv, Yingchun; Zhang, Mu

    2013-01-01

    As the tourism industry has gradually become the strategic mainstay industry of the national economy, the scope of the tourism discipline has developed rigorously. This paper makes a predictive study on the development of the scope of Guangdong provincial tourism discipline based on the artificial neural network BP model in order to find out how…

  7. Modelling irradiation effects in fusion materials

    International Nuclear Information System (INIS)

    Victoria, M.; Dudarev, S.; Boutard, J.L.; Diegele, E.; Laesser, R.; Almazouzi, A.; Caturla, M.J.; Fu, C.C.; Kaellne, J.; Malerba, L.; Nordlund, K.; Perlado, M.; Rieth, M.; Samaras, M.; Schaeublin, R.; Singh, B.N.; Willaime, F.

    2007-01-01

    We review the current status of the European fusion materials modelling programme. We describe recent findings and outline potential areas for future development. Large-scale density functional theory (DFT) calculations reveal the structure of the point defects in α-Fe, and highlight the crucial part played by magnetism. The calculations give accurate migration energies of point defects and the strength of their interaction with He atoms. Kinetic models based on DFT results reproduce the stages of radiation damage recovery in iron, and stages of He-desorption from pre-implanted iron. Experiments aimed at validating the models will be carried out in the future using a multi-beam ion irradiation facility chosen for its versatility and rapid feedback

  8. Modelling irradiation effects in fusion materials

    Energy Technology Data Exchange (ETDEWEB)

    Victoria, M. [Instituto de Fusion Nuclear, Universidad Politecnica de Madrid, c/Jose Gutierrez Abascal 2, 28006 Madrid (Spain); Dudarev, S. [EURATOM/UKAEA Fusion Association, Culham Science Centre, Oxfordshire OX14 3DB, UK and Department of Physics, Imperial College, Exhibition Road, London SW7 2AZ (United Kingdom); Boutard, J.L. [EFDA-CSU Garching, Boltzmannstrasse 2, D-85748 Garching (Germany)], E-mail: jean-louis.boutard@tech.efda.org; Diegele, E.; Laesser, R. [EFDA-CSU Garching, Boltzmannstrasse 2, D-85748 Garching (Germany); Almazouzi, A. [Structural Materials Expert Group, Nuclear Materials Science Institute, SCK-CEN, Boeretang 200, B-2400 Mol (Belgium); Caturla, M.J. [Departamento de Fisica Aplicada, Universidad de Alicante, 03690 San Vicente de Raspeig (Spain); Fu, C.C. [Service de Metallurgie Physique, CEA/Saclay, F-91191 Gif sur Yvette Cedex (France); Kaellne, J. [Department of Engineering Sciences, Uppsala University, Box 534, S-751 21 Uppsala (Sweden); Malerba, L. [Structural Materials Expert Group, Nuclear Materials Science Institute, SCK-CEN, Boeretang 200, B-2400 Mol (Belgium); Nordlund, K. [Association EURATOM-Tekes, Accelerator Laboratory, P.O. Box 43, 00014 University of Helsinki (Finland); Perlado, M. [Instituto de Fusion Nuclear, Universidad Politecnica de Madrid, c/Jose Gutierrez Abascal 2, 28006 Madrid (Spain); Rieth, M. [Forschungszentrum Karlsruhe, Institut fuer Materialforschung I, P.O. Box 3640, D-76021 Karlsruhe (Germany); Samaras, M. [Paul Scherrer Institute, Nuclear Energy and Safety Department, CH-5232 Villigen PSI (Switzerland); Schaeublin, R. [Ecole Polytechnique Federale de Lausanne (EPFL), Centre de Recherches en Physique des Plasmas, Association Euratom-Confederation Suisse, CH-5232 Villigen PSI (Switzerland); Singh, B.N. [Department of Materials Research, Risoe National Laboratory, DK-4000 Roskilde (Denmark); Willaime, F. [Service de Metallurgie Physique, CEA/Saclay, F-91191 Gif sur Yvette Cedex (France)

    2007-10-15

    We review the current status of the European fusion materials modelling programme. We describe recent findings and outline potential areas for future development. Large-scale density functional theory (DFT) calculations reveal the structure of the point defects in {alpha}-Fe, and highlight the crucial part played by magnetism. The calculations give accurate migration energies of point defects and the strength of their interaction with He atoms. Kinetic models based on DFT results reproduce the stages of radiation damage recovery in iron, and stages of He-desorption from pre-implanted iron. Experiments aimed at validating the models will be carried out in the future using a multi-beam ion irradiation facility chosen for its versatility and rapid feedback.

  9. Mechanisms of cold fusion: comprehensive explanations by the Nattoh model

    International Nuclear Information System (INIS)

    Matsumoto, Takaaki

    1995-01-01

    The phenomena of cold fusion seem to be very complicated; inconsistent data between the production rates of heat, neutrons, tritiums and heliums. Our thoughts need to drastically change in order to appropriately understand the mechanisms of cold fusion. Here, a review is described for the Nattoh model, that has been developed extensively to provide comprehensive explanations for the mechanisms of cold fusion. Important experimental findings that prove the model are described. Furthermore several subjects including impacts on other fields are also discussed. (author)

  10. Neural Network Based Models for Fusion Applications

    Science.gov (United States)

    Meneghini, Orso; Tema Biwole, Arsene; Luda, Teobaldo; Zywicki, Bailey; Rea, Cristina; Smith, Sterling; Snyder, Phil; Belli, Emily; Staebler, Gary; Canty, Jeff

    2017-10-01

    Whole device modeling, engineering design, experimental planning and control applications demand models that are simultaneously physically accurate and fast. This poster reports on the ongoing effort towards the development and validation of a series of models that leverage neural-­network (NN) multidimensional regression techniques to accelerate some of the most mission critical first principle models for the fusion community, such as: the EPED workflow for prediction of the H-Mode and Super H-Mode pedestal structure the TGLF and NEO models for the prediction of the turbulent and neoclassical particle, energy and momentum fluxes; and the NEO model for the drift-kinetic solution of the bootstrap current. We also applied NNs on DIII-D experimental data for disruption prediction and quantifying the effect of RMPs on the pedestal and ELMs. All of these projects were supported by the infrastructure provided by the OMFIT integrated modeling framework. Work supported by US DOE under DE-SC0012656, DE-FG02-95ER54309, DE-FC02-04ER54698.

  11. Review for 'Nattoh' model and experimental findings during cold fusion

    International Nuclear Information System (INIS)

    Matsumoto, Takaaki

    1993-01-01

    A review is described for the Nattoh model that provides the framework of the mechanisms of cold fusion. The model classifies the reactions into two categories: fundamental and associated reactions. The former involves the new 'hydrogen-catalyzed' fusion reaction and the chain-reactions of hydrogens. And extremely exciting physics are involved in the latter. Furthermore experimental findings are described. (author)

  12. Fusion

    CERN Document Server

    Mahaffey, James A

    2012-01-01

    As energy problems of the world grow, work toward fusion power continues at a greater pace than ever before. The topic of fusion is one that is often met with the most recognition and interest in the nuclear power arena. Written in clear and jargon-free prose, Fusion explores the big bang of creation to the blackout death of worn-out stars. A brief history of fusion research, beginning with the first tentative theories in the early 20th century, is also discussed, as well as the race for fusion power. This brand-new, full-color resource examines the various programs currently being funded or p

  13. Modeling of mechanical properties of as-cast Mg-Li-Al alloys based on PSO-BP algorithm

    Directory of Open Access Journals (Sweden)

    Li Ming

    2012-05-01

    Full Text Available Artificial neural networks have been widely used to predict the mechanical properties of alloys in material research. This study aims to investigate the implicit relationship between the compositions and mechanical properties of as-cast Mg-Li-Al alloys. Based on the experimental collection of the tensile strength and the elongation of representative Mg-Li-Al alloys, a momentum back-propagation (BP neural network with a single hidden layer was established. Particle swarm optimization (PSO was applied to optimize the BP model. In the neural network, the input variables were the contents of Mg, Li and Al, and the output variables were the tensile strength and the elongation. The results show that the proposed PSO-BP model can describe the quantitative relationship between the Mg-Li-Al alloy’s composition and its mechanical properties. It is possible that the mechanical properties to be predicted without experiment by inputting the alloy composition into the trained network model. The prediction of the influence of Al addition on the mechanical properties of as-cast Mg-Li-Al alloys is consistent with the related research results.

  14. The fusion rate in the transmission resonance model

    International Nuclear Information System (INIS)

    Jaendel, M.

    1992-01-01

    Resonant transmission of deuterons through a chain of target deuterons in a metal matrix has been suggested as an explanation for the cold fusion phenomena. In this paper the fusion rate in such transmission resonance models is estimated, and the basic physical constraints are discussed. The dominating contribution to the fusion yield is found to come from metastable states. The fusion rate is well described by the Wentzel-Kramer-Brillouin approximation and appears to be much too small to explain the experimental anomalies

  15. A short-term load forecasting model of natural gas based on optimized genetic algorithm and improved BP neural network

    International Nuclear Information System (INIS)

    Yu, Feng; Xu, Xiaozhong

    2014-01-01

    Highlights: • A detailed data processing will make more accurate results prediction. • Taking a full account of more load factors to improve the prediction precision. • Improved BP network obtains higher learning convergence. • Genetic algorithm optimized by chaotic cat map enhances the global search ability. • The combined GA–BP model improved by modified additional momentum factor is superior to others. - Abstract: This paper proposes an appropriate combinational approach which is based on improved BP neural network for short-term gas load forecasting, and the network is optimized by the real-coded genetic algorithm. Firstly, several kinds of modifications are carried out on the standard neural network to accelerate the convergence speed of network, including improved additional momentum factor, improved self-adaptive learning rate and improved momentum and self-adaptive learning rate. Then, it is available to use the global search capability of optimized genetic algorithm to determine the initial weights and thresholds of BP neural network to avoid being trapped in local minima. The ability of GA is enhanced by cat chaotic mapping. In light of the characteristic of natural gas load for Shanghai, a series of data preprocessing methods are adopted and more comprehensive load factors are taken into account to improve the prediction accuracy. Such improvements facilitate forecasting efficiency and exert maximum performance of the model. As a result, the integration model improved by modified additional momentum factor gets more ideal solutions for short-term gas load forecasting, through analyses and comparisons of the above several different combinational algorithms

  16. The fusion of heavy ions in an interaction potential model

    International Nuclear Information System (INIS)

    Zipper, W.

    1980-01-01

    The paper contains the problems connected with fusion processes in heavy ions collision. Results of experimental fusion data for reactions: 9 Be + 12 C, 6 Li + 28 Si, 9 Be + 28 Si, 12 C + 28 Si, 12 C + 16 O and 16 O + 16 O are presented. Comparison of measured fusion cross sections with predictions of the fusion potential model have been made. The validity of this model for both light systems, like 9 Be + 12 C and heavy systems, like 35 Cl + 62 Ni, have been discussed. In conclusion, it should be stated that fusion cross sections could be correctly predicted by the potential model with a potential describing the elastic scattering data. (author)

  17. Process models and model-data fusion in dendroecology

    Directory of Open Access Journals (Sweden)

    Joel eGuiot

    2014-08-01

    Full Text Available Dendrochronology (i.e. the study of annually dated tree-ring time series has proved to be a powerful technique to understand tree-growth. This paper intends to show the interest of using ecophysiological modeling not only to understand and predict tree-growth (dendroecology but also to reconstruct past climates (dendroclimatology. Process models have been used for several decades in dendroclimatology, but it is only recently that methods of model-data fusion have led to significant progress in modeling tree-growth as a function of climate and in reconstructing past climates. These model-data fusion (MDF methods, mainly based on the Bayesian paradigm, have been shown to be powerful for both model calibration and model inversion. After a rapid survey of tree-growth modeling, we illustrate MDF with examples based on series of Southern France Aleppo pines and Central France oaks. These examples show that if plants experienced CO2 fertilization, this would have a significant effect on tree-growth which in turn would bias the climate reconstructions. This bias could be extended to other environmental non-climatic factors directly or indirectly affecting annual ring formation and not taken into account in classical empirical models, which supports the use of more complex process-based models. Finally, we conclude by showing the interest of the data assimilation methods applied in climatology to produce climate re-analyses.

  18. Realistic modeling of chamber transport for heavy-ion fusion

    International Nuclear Information System (INIS)

    Sharp, W.M.; Grote, D.P.; Callahan, D.A.; Tabak, M.; Henestroza, E.; Yu, S.S.; Peterson, P.F.; Welch, D.R.; Rose, D.V.

    2003-01-01

    Transport of intense heavy-ion beams to an inertial-fusion target after final focus is simulated here using a realistic computer model. It is found that passing the beam through a rarefied plasma layer before it enters the fusion chamber can largely neutralize the beam space charge and lead to a usable focal spot for a range of ion species and input conditions

  19. Sensor Fusion and Model Verification for a Mobile Robot

    DEFF Research Database (Denmark)

    Bisgaard, Morten; Vinther, Dennis; Østergaard, Kasper Zinck

    2005-01-01

    This paper presents the results of modeling, sensor fusion and model verification for a four-wheel driven, four-wheel steered mobile robot moving in outdoor terrain. The model derived for the robot describes the actuator and wheel dynamics and the vehicle kinematics, and includes friction terms...

  20. BP volume reduction equipment

    International Nuclear Information System (INIS)

    Kitamura, Yoshinori; Muroo, Yoji; Hamanaka, Isao

    2003-01-01

    A new type of burnable poison (BP) volume reduction system is currently being developed. Many BP rods, a subcomponent of spent fuel assemblies are discharged from nuclear power reactors. This new system reduces the overall volume of BP rods. The main system consists of BP rod cutting equipment, equipment for the recovery of BP cut pieces, and special transport equipment for the cut rods. The equipment is all operated by hydraulic press cylinders in water to reduce operator exposure to radioactivity. (author)

  1. Fusion safety codes International modeling with MELCOR and ATHENA- INTRA

    CERN Document Server

    Marshall, T; Topilski, L; Merrill, B

    2002-01-01

    For a number of years, the world fusion safety community has been involved in benchmarking their safety analyses codes against experiment data to support regulatory approval of a next step fusion device. This paper discusses the benchmarking of two prominent fusion safety thermal-hydraulic computer codes. The MELCOR code was developed in the US for fission severe accident safety analyses and has been modified for fusion safety analyses. The ATHENA code is a multifluid version of the US-developed RELAP5 code that is also widely used for fusion safety analyses. The ENEA Fusion Division uses ATHENA in conjunction with the INTRA code for its safety analyses. The INTRA code was developed in Germany and predicts containment building pressures, temperatures and fluid flow. ENEA employs the French-developed ISAS system to couple ATHENA and INTRA. This paper provides a brief introduction of the MELCOR and ATHENA-INTRA codes and presents their modeling results for the following breaches of a water cooling line into the...

  2. Analysis and forecast of railway coal transportation volume based on BP neural network combined forecasting model

    Science.gov (United States)

    Xu, Yongbin; Xie, Haihong; Wu, Liuyi

    2018-05-01

    The share of coal transportation in the total railway freight volume is about 50%. As is widely acknowledged, coal industry is vulnerable to the economic situation and national policies. Coal transportation volume fluctuates significantly under the new economic normal. Grasp the overall development trend of railway coal transportation market, have important reference and guidance significance to the railway and coal industry decision-making. By analyzing the economic indicators and policy implications, this paper expounds the trend of the coal transportation volume, and further combines the economic indicators with the high correlation with the coal transportation volume with the traditional traffic prediction model to establish a combined forecasting model based on the back propagation neural network. The error of the prediction results is tested, which proves that the method has higher accuracy and has practical application.

  3. Features Extraction of Flotation Froth Images and BP Neural Network Soft-Sensor Model of Concentrate Grade Optimized by Shuffled Cuckoo Searching Algorithm

    Directory of Open Access Journals (Sweden)

    Jie-sheng Wang

    2014-01-01

    Full Text Available For meeting the forecasting target of key technology indicators in the flotation process, a BP neural network soft-sensor model based on features extraction of flotation froth images and optimized by shuffled cuckoo search algorithm is proposed. Based on the digital image processing technique, the color features in HSI color space, the visual features based on the gray level cooccurrence matrix, and the shape characteristics based on the geometric theory of flotation froth images are extracted, respectively, as the input variables of the proposed soft-sensor model. Then the isometric mapping method is used to reduce the input dimension, the network size, and learning time of BP neural network. Finally, a shuffled cuckoo search algorithm is adopted to optimize the BP neural network soft-sensor model. Simulation results show that the model has better generalization results and prediction accuracy.

  4. Vehicle logo recognition using multi-level fusion model

    Science.gov (United States)

    Ming, Wei; Xiao, Jianli

    2018-04-01

    Vehicle logo recognition plays an important role in manufacturer identification and vehicle recognition. This paper proposes a new vehicle logo recognition algorithm. It has a hierarchical framework, which consists of two fusion levels. At the first level, a feature fusion model is employed to map the original features to a higher dimension feature space. In this space, the vehicle logos become more recognizable. At the second level, a weighted voting strategy is proposed to promote the accuracy and the robustness of the recognition results. To evaluate the performance of the proposed algorithm, extensive experiments are performed, which demonstrate that the proposed algorithm can achieve high recognition accuracy and work robustly.

  5. Mathematical modelling and linear stability analysis of laser fusion cutting

    International Nuclear Information System (INIS)

    Hermanns, Torsten; Schulz, Wolfgang; Vossen, Georg; Thombansen, Ulrich

    2016-01-01

    A model for laser fusion cutting is presented and investigated by linear stability analysis in order to study the tendency for dynamic behavior and subsequent ripple formation. The result is a so called stability function that describes the correlation of the setting values of the process and the process’ amount of dynamic behavior.

  6. Mathematical modelling and linear stability analysis of laser fusion cutting

    Energy Technology Data Exchange (ETDEWEB)

    Hermanns, Torsten; Schulz, Wolfgang [RWTH Aachen University, Chair for Nonlinear Dynamics, Steinbachstr. 15, 52047 Aachen (Germany); Vossen, Georg [Niederrhein University of Applied Sciences, Chair for Applied Mathematics and Numerical Simulations, Reinarzstr.. 49, 47805 Krefeld (Germany); Thombansen, Ulrich [RWTH Aachen University, Chair for Laser Technology, Steinbachstr. 15, 52047 Aachen (Germany)

    2016-06-08

    A model for laser fusion cutting is presented and investigated by linear stability analysis in order to study the tendency for dynamic behavior and subsequent ripple formation. The result is a so called stability function that describes the correlation of the setting values of the process and the process’ amount of dynamic behavior.

  7. Evaluation of different freshwater forcing scenarios for the 8.2 ka BP event in a coupled climate model

    Energy Technology Data Exchange (ETDEWEB)

    Wiersma, A.P.; Renssen, H. [Vrije Universiteit Amsterdam, Faculty of Earth and Life Sciences, Amsterdam (Netherlands); Goosse, H.; Fichefet, T. [Universite Catholique de Louvain, Institut d' Astronomie et de Geophysique George Lemaitre, Louvain-la-Neuve (Belgium)

    2006-12-15

    To improve our understanding of the mechanism causing the 8.2 ka BP event, we investigated the response of ocean circulation in the ECBilt-CLIO-VECODE (Version 3) model to various freshwater fluxes into the Labrador Sea. Starting from an early Holocene climate state we released freshwater pulses varying in volume and duration based on published estimates. In addition we tested the effect of a baseline flow (0.172 Sv) in the Labrador Sea to account for the background-melting of the Laurentide ice-sheet on the early Holocene climate and on the response of the overturning circulation. Our results imply that the amount of freshwater released is the decisive factor in the response of the ocean, while the release duration only plays a minor role, at least when considering the short release durations (1, 2 and 5 years) of the applied freshwater pulses. Furthermore, the experiments with a baseline flow produce a more realistic early Holocene climate state without Labrador Sea Water formation. Meltwater pulses introduced into this climate state produce a prolonged weakening of the overturning circulation compared to an early Holocene climate without baseline flow, and therefore less freshwater is needed to produce an event of similar duration. (orig.)

  8. Applications of computer modeling to fusion research

    International Nuclear Information System (INIS)

    Dawson, J.M.

    1989-01-01

    Progress achieved during this report period is presented on the following topics: Development and application of gyrokinetic particle codes to tokamak transport, development of techniques to take advantage of parallel computers; model dynamo and bootstrap current drive; and in general maintain our broad-based program in basic plasma physics and computer modeling

  9. Drosophila Cancer Models Identify Functional Differences between Ret Fusions.

    Science.gov (United States)

    Levinson, Sarah; Cagan, Ross L

    2016-09-13

    We generated and compared Drosophila models of RET fusions CCDC6-RET and NCOA4-RET. Both RET fusions directed cells to migrate, delaminate, and undergo EMT, and both resulted in lethality when broadly expressed. In all phenotypes examined, NCOA4-RET was more severe than CCDC6-RET, mirroring their effects on patients. A functional screen against the Drosophila kinome and a library of cancer drugs found that CCDC6-RET and NCOA4-RET acted through different signaling networks and displayed distinct drug sensitivities. Combining data from the kinome and drug screens identified the WEE1 inhibitor AZD1775 plus the multi-kinase inhibitor sorafenib as a synergistic drug combination that is specific for NCOA4-RET. Our work emphasizes the importance of identifying and tailoring a patient's treatment to their specific RET fusion isoform and identifies a multi-targeted therapy that may prove effective against tumors containing the NCOA4-RET fusion. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

  10. ADAS: Atomic data, modelling and analysis for fusion

    International Nuclear Information System (INIS)

    Summers, H. P.; O'Mullane, M. G.; Whiteford, A. D.; Badnell, N. R.; Loch, S. D.

    2007-01-01

    The Atomic Data and Analysis Structure, ADAS, comprises extensive fundamental and derived atomic data collections, interactive codes for the manipulation and generation of collisional-radiative data and models, off-line codes for large scale fundamental atomic data production and codes for diagnostic analysis in the fusion and astrophysical environments. ADAS data are organized according to precise specifications, tuned to application and are assigned to numbered ADAS data formats. Some of these formats contain very large quantities of data and some have achieved wide-scale adoption in the fusion community.The paper focuses on recent extensions of ADAS designed to orient ADAS to the needs of ITER. The issue of heavy atomic species, expected to be present as ITER wall and divertor materials, dopants or control species, will be addressed with a view to the economized handling of the emission and ionisation state data needed for diagnostic spectral analysis. Charge exchange and beam emission spectroscopic capabilities and developments in ADAS will be reviewed from an ITER perspective and in the context of a shared analysis between fusion laboratories. Finally an overview and summary of current large scale fundamental data production in the framework of the ADAS project will be given and its intended availability in both fusion and astrophysics noted

  11. A comprehensive alpha-heating model for inertial confinement fusion

    Science.gov (United States)

    Christopherson, A. R.; Betti, R.; Bose, A.; Howard, J.; Woo, K. M.; Campbell, E. M.; Sanz, J.; Spears, B. K.

    2018-01-01

    A comprehensive model is developed to study alpha-heating in inertially confined plasmas. It describes the time evolution of a central low-density hot spot confined by a compressible shell, heated by fusion alphas, and cooled by radiation and thermal losses. The model includes the deceleration, stagnation, and burn phases of inertial confinement fusion implosions, and is valid for sub-ignited targets with ≤10 × amplification of the fusion yield from alpha-heating. The results of radiation-hydrodynamic simulations are used to derive realistic initial conditions and dimensionless parameters for the model. It is found that most of the alpha energy (˜90%) produced before bang time is deposited within the hot spot mass, while a small fraction (˜10%) drives mass ablation off the inner shell surface and its energy is recycled back into the hot spot. Of the bremsstrahlung radiation emission, ˜40% is deposited in the hot spot, ˜40% is recycled back in the hot spot by ablation off the shell, and ˜20% leaves the hot spot. We show here that the hot spot, shocked shell, and outer shell trajectories from this analytical model are in good agreement with simulations. A detailed discussion of the effect of alpha-heating on the hydrodynamics is also presented.

  12. Modeling, analysis and experiments for fusion nuclear technology

    International Nuclear Information System (INIS)

    Abdou, M.A.; Hadid, A.H.; Raffray, A.R.; Tillack, M.S.; Iizuka, T.

    1988-01-01

    Selected issues in the development of fusion nuclear technology (FNT) have been studied. These relate to (1) near-term experiments, modeling, and analysis for several key FNT issues, and (2) FNT testing in future fusion facilities. A key concern for solid breeder blankets is to reduce the number of candidate materials and configurations for advanced experiments to emphasize those with the highest potential. Based on technical analysis, recommendations have been developed for reducing the size of the test matrix and for focusing the testing program on important areas of emphasis. The characteristics of an advanced liquid metal MHD experiment have also been studied. This facility is required in addition to existing facilities in order to address critical uncertainties in MHD fluid flow and heat transfer. In addition to experiments, successful development of FNT will require models for interpreting experimental data, for planning experiments, and for use as a design tool for fusion components. Modeling of liquid metal fluid flows is a particular area of need in which substantial progress is expected, and initial efforts are reported here. Preliminary results on the modeling of tritium transport and inventory in solid breeders are also summarized. Finally, the thermo-mechanical behavior of liquid-metal-cooled limiters is analyzed and the parameter space for feasible designs is explored. Because of the renewed strong interest in a fusion engineering facility, a critical review and analysis of the important FNT testing requirements have been performed. Several areas have been emphasized due to their strong impact on the design and cost of the test facility. These include (1) the length of the plasma burn and the mode of operation (pulsed vs. steady-state), and (2) the need for a tritium-producing blanket and its impact on the availability of the device. (orig.)

  13. Heat transfer models for fusion blanket first walls

    International Nuclear Information System (INIS)

    Fillo, J.A.

    1977-01-01

    In the development of magnetically confined fusion reactors, the ability to cool the first wall, i.e., the first material surface interfacing the plasma, appears to be a critical factor involved in establishing the wall load limit. In order to understand the thermal behavior of the first wall time-dependent, one-dimensional heat conduction models are reviewed with differing modes of heat extraction and cooling

  14. Sensor Fusion Based Model for Collision Free Mobile Robot Navigation

    Science.gov (United States)

    Almasri, Marwah; Elleithy, Khaled; Alajlan, Abrar

    2015-01-01

    Autonomous mobile robots have become a very popular and interesting topic in the last decade. Each of them are equipped with various types of sensors such as GPS, camera, infrared and ultrasonic sensors. These sensors are used to observe the surrounding environment. However, these sensors sometimes fail and have inaccurate readings. Therefore, the integration of sensor fusion will help to solve this dilemma and enhance the overall performance. This paper presents a collision free mobile robot navigation based on the fuzzy logic fusion model. Eight distance sensors and a range finder camera are used for the collision avoidance approach where three ground sensors are used for the line or path following approach. The fuzzy system is composed of nine inputs which are the eight distance sensors and the camera, two outputs which are the left and right velocities of the mobile robot’s wheels, and 24 fuzzy rules for the robot’s movement. Webots Pro simulator is used for modeling the environment and the robot. The proposed methodology, which includes the collision avoidance based on fuzzy logic fusion model and line following robot, has been implemented and tested through simulation and real time experiments. Various scenarios have been presented with static and dynamic obstacles using one robot and two robots while avoiding obstacles in different shapes and sizes. PMID:26712766

  15. Sensor Fusion Based Model for Collision Free Mobile Robot Navigation

    Directory of Open Access Journals (Sweden)

    Marwah Almasri

    2015-12-01

    Full Text Available Autonomous mobile robots have become a very popular and interesting topic in the last decade. Each of them are equipped with various types of sensors such as GPS, camera, infrared and ultrasonic sensors. These sensors are used to observe the surrounding environment. However, these sensors sometimes fail and have inaccurate readings. Therefore, the integration of sensor fusion will help to solve this dilemma and enhance the overall performance. This paper presents a collision free mobile robot navigation based on the fuzzy logic fusion model. Eight distance sensors and a range finder camera are used for the collision avoidance approach where three ground sensors are used for the line or path following approach. The fuzzy system is composed of nine inputs which are the eight distance sensors and the camera, two outputs which are the left and right velocities of the mobile robot’s wheels, and 24 fuzzy rules for the robot’s movement. Webots Pro simulator is used for modeling the environment and the robot. The proposed methodology, which includes the collision avoidance based on fuzzy logic fusion model and line following robot, has been implemented and tested through simulation and real time experiments. Various scenarios have been presented with static and dynamic obstacles using one robot and two robots while avoiding obstacles in different shapes and sizes.

  16. Android Application Model of "Suami Siaga Plus" as an Innovation in Birth Preparedness and Complication Readiness (BP/CR) Intervention.

    Science.gov (United States)

    Santoso, Hanna Yuanita Dana; Supriyana, Supriyana; Bahiyatun, Bahiyatun; Widyawati, Melyana Nurul; Fatmasari, Diyah; Sudiyono, Sudiyono; Widyastari, Dyah Anantalia; Sinaga, Doni Marisi

    2017-03-01

    Objective: WHO recommends Mobile health , a practice of medicine and public health supported by mobile devices, to improve community health status and change people's behavior for the health purposes. The present study sought to examine the effectiveness of the android application program of Suami Siaga Plus in increasing husband's scores in birth preparedness and complication readiness (BP/CR) intervention. Materials and methods: It was a randomized controlled trial with pretest-posttest design. A total of 38 couples of husbands and pregnant women from three health centers at three sub districts in Semarang was selected by proportional systematic random sampling technique and equally distributed into control and intervention group. A questionnaire related to BP/CR published by JHPIEGO was employed in data collection. Statistical analysis was performed to obtain the frequency distribution and percentage of the variables, and also to assess the mean difference of BP/CR score of husbands. Results: Husbands' knowledge of key danger signs and five standard elements in BP/CR practices in both intervention and control group increased after counseling. Moreover, the proportion of husbands who understand the key danger signs during pregnancy was higher among those who were exposed by Suami Siaga Plus application delivered via mobile phone. Counseling only increased husbands' score from 61.5 to 62.6 (2%), whilst the combination of counseling and the application boosted 20% of husbands' score from 60.4 to 72.9 (p-value 0.000). Conclusion: A combination of counseling and Suami Siaga Plus application significantly improves husbands and wives' score on BP/CR compared to those who received counseling only. The data suggests the application would be able to suppress the three delays, which in turn can reduce the maternal mortality rate. The study results could be important information for the Department of Health and health professionals to use android application program , in

  17. Effective World Modeling: Multisensor Data Fusion Methodology for Automated Driving.

    Science.gov (United States)

    Elfring, Jos; Appeldoorn, Rein; van den Dries, Sjoerd; Kwakkernaat, Maurice

    2016-10-11

    The number of perception sensors on automated vehicles increases due to the increasing number of advanced driver assistance system functions and their increasing complexity. Furthermore, fail-safe systems require redundancy, thereby increasing the number of sensors even further. A one-size-fits-all multisensor data fusion architecture is not realistic due to the enormous diversity in vehicles, sensors and applications. As an alternative, this work presents a methodology that can be used to effectively come up with an implementation to build a consistent model of a vehicle's surroundings. The methodology is accompanied by a software architecture. This combination minimizes the effort required to update the multisensor data fusion system whenever sensors or applications are added or replaced. A series of real-world experiments involving different sensors and algorithms demonstrates the methodology and the software architecture.

  18. Effective World Modeling: Multisensor Data Fusion Methodology for Automated Driving

    Directory of Open Access Journals (Sweden)

    Jos Elfring

    2016-10-01

    Full Text Available The number of perception sensors on automated vehicles increases due to the increasing number of advanced driver assistance system functions and their increasing complexity. Furthermore, fail-safe systems require redundancy, thereby increasing the number of sensors even further. A one-size-fits-all multisensor data fusion architecture is not realistic due to the enormous diversity in vehicles, sensors and applications. As an alternative, this work presents a methodology that can be used to effectively come up with an implementation to build a consistent model of a vehicle’s surroundings. The methodology is accompanied by a software architecture. This combination minimizes the effort required to update the multisensor data fusion system whenever sensors or applications are added or replaced. A series of real-world experiments involving different sensors and algorithms demonstrates the methodology and the software architecture.

  19. BP's emissions trading system

    International Nuclear Information System (INIS)

    Victor, David G.; House, Joshua C.

    2006-01-01

    Between 1998 and 2001, BP reduced its emissions of greenhouse gases by more than 10%. BP's success in cutting emissions is often equated with its use of an apparently market-based emissions trading program. However no independent study has ever examined the rules and operation of BP's system and the incentives acting on managers to reduce emissions. We use interviews with key managers and with traders in several critical business units to explore the bound of BP's success with emissions trading. No money actually changed hands when permits were traded, and the main effect of the program was to create awareness of money-saving emission controls rather than strong price incentives. We show that the trading system did not operate like a 'textbook' cap and trade scheme. Rather, the BP system operated much like a 'safety valve' trading system, where managers let the market function until the cost of doing so surpassed what the company was willing to tolerate

  20. Fusion of intraoperative force sensoring, surface reconstruction and biomechanical modeling

    Science.gov (United States)

    Röhl, S.; Bodenstedt, S.; Küderle, C.; Suwelack, S.; Kenngott, H.; Müller-Stich, B. P.; Dillmann, R.; Speidel, S.

    2012-02-01

    Minimally invasive surgery is medically complex and can heavily benefit from computer assistance. One way to help the surgeon is to integrate preoperative planning data into the surgical workflow. This information can be represented as a customized preoperative model of the surgical site. To use it intraoperatively, it has to be updated during the intervention due to the constantly changing environment. Hence, intraoperative sensor data has to be acquired and registered with the preoperative model. Haptic information which could complement the visual sensor data is still not established. In addition, biomechanical modeling of the surgical site can help in reflecting the changes which cannot be captured by intraoperative sensors. We present a setting where a force sensor is integrated into a laparoscopic instrument. In a test scenario using a silicone liver phantom, we register the measured forces with a reconstructed surface model from stereo endoscopic images and a finite element model. The endoscope, the instrument and the liver phantom are tracked with a Polaris optical tracking system. By fusing this information, we can transfer the deformation onto the finite element model. The purpose of this setting is to demonstrate the principles needed and the methods developed for intraoperative sensor data fusion. One emphasis lies on the calibration of the force sensor with the instrument and first experiments with soft tissue. We also present our solution and first results concerning the integration of the force sensor as well as accuracy to the fusion of force measurements, surface reconstruction and biomechanical modeling.

  1. Modeling and experiments on tritium permeation in fusion reactor blankets

    Science.gov (United States)

    Holland, D. F.; Longhurst, G. R.

    The determination of tritium loss from helium-cooled fusion breeding blankets are discussed. The issues are: (1) applicability of present models to permeation at low tritium pressures; (2) effectiveness of oxide layers in reducing permeation; (3) effectiveness of hydrogen addition as a means to lower tritium permeation; and (4) effectiveness of conversion to tritiated water and subsequent trapping to reduce permeation. Theoretical models applicable to these issues are discussed, and results of experiments in two areas are presented; permeation of mixtures of hydrogen isotopes and conversion to tritiated water.

  2. Modeling and experiments on tritium permeation in fusion reactor blankets

    International Nuclear Information System (INIS)

    Holland, D.F.; Longhurst, G.R.

    1985-01-01

    Issues are discussed that are critical in determining tritium loss from helium-cooled fusion breeding blankets. These issues are: (a) applicability of present models to permeation at low tritium pressures, (b) effectiveness of oxide layers in reducing permeation, (c) effectiveness of hydrogen addition as a means to lower tritium permeation, and (d) effectiveness of conversion to tritiated water and subsequent trapping as a means to reduce permeation. The paper discusses theoretical models applicable to these issues, and presents results of experiments in two areas: permeation of mixtures of hydrogen isotopes and conversion to tritiated water

  3. Vector boson fusion in the inert doublet model

    Science.gov (United States)

    Dutta, Bhaskar; Palacio, Guillermo; Restrepo, Diego; Ruiz-Álvarez, José D.

    2018-03-01

    In this paper we probe the inert Higgs doublet model at the LHC using vector boson fusion (VBF) search strategy. We optimize the selection cuts and investigate the parameter space of the model and we show that the VBF search has a better reach when compared with the monojet searches. We also investigate the Drell-Yan type cuts and show that they can be important for smaller charged Higgs masses. We determine the 3 σ reach for the parameter space using these optimized cuts for a luminosity of 3000 fb-1 .

  4. [Research progress of multi-model medical image fusion and recognition].

    Science.gov (United States)

    Zhou, Tao; Lu, Huiling; Chen, Zhiqiang; Ma, Jingxian

    2013-10-01

    Medical image fusion and recognition has a wide range of applications, such as focal location, cancer staging and treatment effect assessment. Multi-model medical image fusion and recognition are analyzed and summarized in this paper. Firstly, the question of multi-model medical image fusion and recognition is discussed, and its advantage and key steps are discussed. Secondly, three fusion strategies are reviewed from the point of algorithm, and four fusion recognition structures are discussed. Thirdly, difficulties, challenges and possible future research direction are discussed.

  5. A semi-analytic model of magnetized liner inertial fusion

    Energy Technology Data Exchange (ETDEWEB)

    McBride, Ryan D.; Slutz, Stephen A. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States)

    2015-05-15

    Presented is a semi-analytic model of magnetized liner inertial fusion (MagLIF). This model accounts for several key aspects of MagLIF, including: (1) preheat of the fuel (optionally via laser absorption); (2) pulsed-power-driven liner implosion; (3) liner compressibility with an analytic equation of state, artificial viscosity, internal magnetic pressure, and ohmic heating; (4) adiabatic compression and heating of the fuel; (5) radiative losses and fuel opacity; (6) magnetic flux compression with Nernst thermoelectric losses; (7) magnetized electron and ion thermal conduction losses; (8) end losses; (9) enhanced losses due to prescribed dopant concentrations and contaminant mix; (10) deuterium-deuterium and deuterium-tritium primary fusion reactions for arbitrary deuterium to tritium fuel ratios; and (11) magnetized α-particle fuel heating. We show that this simplified model, with its transparent and accessible physics, can be used to reproduce the general 1D behavior presented throughout the original MagLIF paper [S. A. Slutz et al., Phys. Plasmas 17, 056303 (2010)]. We also discuss some important physics insights gained as a result of developing this model, such as the dependence of radiative loss rates on the radial fraction of the fuel that is preheated.

  6. Applying the elastic model for various nucleus-nucleus fusion

    International Nuclear Information System (INIS)

    HASSAN, G.S.; RAGAB, H.S.; SEDDEEK, M.K.

    2000-01-01

    The Elastic Model of two free parameters m,d given by Scalia has been used for wider energy regions to fit the available experimental data for potential barriers and cross sections. In order to generalize Scalia's formula in both sub- and above-barrier regions, we calculated m, d for pairs rather than those given by Scalia and compared the calculated cross sections with the experimental data. This makes a generalization of the Elastic Model in describing fusion process. On the other hand, Scalia's range of interacting systems was 24 ≤ A ≤194 where A is the compound nucleus mass number. Our extension of that model includes an example of the pairs of A larger than his final limit aiming to make it as a general formula for any type of reactants: light, intermediate or heavy systems. A significant point is the comparison of Elastic Model calculations with the well known methods studying complete fusion and compound nucleus formation, namely with the resultants of using Proximity potential with either Sharp or Smooth cut-off approximations

  7. Association of a Chromosomal Rearrangement Event with Mouse Posterior Polymorphous Corneal Dystrophy and Alterations in Csrp2bp, Dzank1, and Ovol2 Gene Expression.

    Directory of Open Access Journals (Sweden)

    Anna L Shen

    Full Text Available We have previously described a mouse model of human posterior polymorphous corneal dystrophy (PPCD and localized the causative mutation to a 6.2 Mbp region of chromosome 2, termed Ppcd1. We now show that the gene rearrangement linked to mouse Ppcd1 is a 3.9 Mbp chromosomal inversion flanked by 81 Kbp and 542 bp deletions. This recombination event leads to deletion of Csrp2bp Exons 8 through 11, Dzank1 Exons 20 and 21, and the pseudogene Znf133. In addition, we identified translocation of novel downstream sequences to positions adjacent to Csrp2bp Exon 7 and Dzank1 Exon 20. Twelve novel fusion transcripts involving Csrp2bp or Dzank1 linked to downstream sequences have been identified. Eight are expressed at detectable levels in PPCD1 but not wildtype eyes. Upregulation of two Csrp2bp fusion transcripts, as well as upregulation of the adjacent gene, Ovol2, was observed. Absence of the PPCD1 phenotype in animals haploinsufficient for Csrp2bp or both Csrp2bp and Dzank1 rules out haploinsufficiency of these genes as a cause of mouse PPCD1. Complementation experiments confirm that PPCD1 embryonic lethality is due to disruption of Csrp2bp expression. The ocular expression pattern of Csrp2bp is consistent with a role for this protein in corneal development and pathogenesis of PPCD1.

  8. FDG goes BP

    International Nuclear Information System (INIS)

    Chan, J.G.

    2000-01-01

    Full text: A monograph for Fluorodeoxyglucose F-18 Injection (FDG) was first released in Supplement 1 of the United States Pharmacopoeia 1990 (USP 90) on 1 November 1989 to become effective on 1 January 1990. As this was the only monograph available until recently it served as the applicable standard to be followed. The Therapeutic Goods Act states that the British Pharmacopoeia (BP) is the precedent to be followed in Australia and implies that if a monograph exists for a finished product then this needs to be applied to achieve a certain standard of quality. If the monograph does not exist in the BP then other pharmacopoeia monographs can be sourced starting with the European Pharmacopoeia (Ph Eur) then the USP. A monograph for FDG first appeared in the Ph Eur in a 1999 Supplement (effective 1 January 1999 and now included in the Ph Eur 2000) and then in the BP 1999 (effective 1 December 1999). The Commonwealth Government Gazette (Notice 48, 1/12/99) published that the BP 99 was adopted on the 1st December 1999. Since then manufacturers have been required to comply with the monograph for FDG in the BP 99. This presentation looks at the content of the BP 99 monograph and compares it with that in the USP. Copyright (2000) The Australian and New Zealand Society of Nuclear Medicine Inc

  9. Constraining statistical-model parameters using fusion and spallation reactions

    Directory of Open Access Journals (Sweden)

    Charity Robert J.

    2011-10-01

    Full Text Available The de-excitation of compound nuclei has been successfully described for several decades by means of statistical models. However, such models involve a large number of free parameters and ingredients that are often underconstrained by experimental data. We show how the degeneracy of the model ingredients can be partially lifted by studying different entrance channels for de-excitation, which populate different regions of the parameter space of the compound nucleus. Fusion reactions, in particular, play an important role in this strategy because they fix three out of four of the compound-nucleus parameters (mass, charge and total excitation energy. The present work focuses on fission and intermediate-mass-fragment emission cross sections. We prove how equivalent parameter sets for fusion-fission reactions can be resolved using another entrance channel, namely spallation reactions. Intermediate-mass-fragment emission can be constrained in a similar way. An interpretation of the best-fit IMF barriers in terms of the Wigner energies of the nascent fragments is discussed.

  10. Modeling Xenon Purification Systems in a Laser Inertial Fusion Engine

    Science.gov (United States)

    Hopkins, Ann; Gentile, Charles

    2011-10-01

    A Laser Inertial Fusion Engine (LIFE) is a proposed method to employ fusion energy to produce electricity for consumers. However, before it can be built and used as such, each aspect of a LIFE power plant must first be meticulously planned. We are in the process of developing and perfecting models for an exhaust processing and fuel recovery system. Such a system is especially essential because it must be able to recapture and purify expensive materials involved in the reaction so they may be reused. One such material is xenon, which is to be used as an intervention gas in the target chamber. Using Aspen HYSYS, we have modeled several subsystems for exhaust processing, including a subsystem for xenon recovery and purification. After removing hydrogen isotopes using lithium bubblers, we propose to use cryogenic distillation to purify the xenon from remaining contaminants. Aspen HYSYS allows us to analyze predicted flow rates, temperatures, pressures, and compositions within almost all areas of the xenon purification system. Through use of Aspen models, we hope to establish that we can use xenon in LIFE efficiently and in a practical manner.

  11. Atomic Data and Modelling for Fusion: the ADAS Project

    International Nuclear Information System (INIS)

    Summers, H. P.; O'Mullane, M. G.

    2011-01-01

    The paper is an update on the Atomic Data and Analysis Structure, ADAS, since ICAM-DATA06 and a forward look to its evolution in the next five years. ADAS is an international project supporting principally magnetic confinement fusion research. It has participant laboratories throughout the world, including ITER and all its partner countries. In parallel with ADAS, the ADAS-EU Project provides enhanced support for fusion research at Associated Laboratories and Universities in Europe and ITER. OPEN-ADAS, sponsored jointly by the ADAS Project and IAEA, is the mechanism for open access to principal ADAS atomic data classes and facilitating software for their use. EXTENDED-ADAS comprises a variety of special, integrated application software, beyond the purely atomic bounds of ADAS, tuned closely to specific diagnostic analyses and plasma models.The current scientific content and scope of these various ADAS and ADAS related activities are briefly reviewed. These span a number of themes including heavy element spectroscopy and models, charge exchange spectroscopy, beam emission spectroscopy and special features which provide a broad baseline of atomic modelling and support. Emphasis will be placed on 'lifting the fundamental data baseline'--a principal ADAS task for the next few years. This will include discussion of ADAS and ADAS-EU coordinated and shared activities and some of the methods being exploited.

  12. BP-ANN for fitting the temperature-germination model and its application in predicting sowing time and region for Bermudagrass.

    Directory of Open Access Journals (Sweden)

    Erxu Pi

    Full Text Available Temperature is one of the most significant environmental factors that affects germination of grass seeds. Reliable prediction of the optimal temperature for seed germination is crucial for determining the suitable regions and favorable sowing timing for turf grass cultivation. In this study, a back-propagation-artificial-neural-network-aided dual quintic equation (BP-ANN-QE model was developed to improve the prediction of the optimal temperature for seed germination. This BP-ANN-QE model was used to determine optimal sowing times and suitable regions for three Cynodon dactylon cultivars (C. dactylon, 'Savannah' and 'Princess VII'. Prediction of the optimal temperature for these seeds was based on comprehensive germination tests using 36 day/night (high/low temperature regimes (both ranging from 5/5 to 40/40°C with 5°C increments. Seed germination data from these temperature regimes were used to construct temperature-germination correlation models for estimating germination percentage with confidence intervals. Our tests revealed that the optimal high/low temperature regimes required for all the three bermudagrass cultivars are 30/5, 30/10, 35/5, 35/10, 35/15, 35/20, 40/15 and 40/20°C; constant temperatures ranging from 5 to 40°C inhibited the germination of all three cultivars. While comparing different simulating methods, including DQEM, Bisquare ANN-QE, and BP-ANN-QE in establishing temperature based germination percentage rules, we found that the R(2 values of germination prediction function could be significantly improved from about 0.6940-0.8177 (DQEM approach to 0.9439-0.9813 (BP-ANN-QE. These results indicated that our BP-ANN-QE model has better performance than the rests of the compared models. Furthermore, data of the national temperature grids generated from monthly-average temperature for 25 years were fit into these functions and we were able to map the germination percentage of these C. dactylon cultivars in the national scale

  13. Statistical modeling for visualization evaluation through data fusion.

    Science.gov (United States)

    Chen, Xiaoyu; Jin, Ran

    2017-11-01

    There is a high demand of data visualization providing insights to users in various applications. However, a consistent, online visualization evaluation method to quantify mental workload or user preference is lacking, which leads to an inefficient visualization and user interface design process. Recently, the advancement of interactive and sensing technologies makes the electroencephalogram (EEG) signals, eye movements as well as visualization logs available in user-centered evaluation. This paper proposes a data fusion model and the application procedure for quantitative and online visualization evaluation. 15 participants joined the study based on three different visualization designs. The results provide a regularized regression model which can accurately predict the user's evaluation of task complexity, and indicate the significance of all three types of sensing data sets for visualization evaluation. This model can be widely applied to data visualization evaluation, and other user-centered designs evaluation and data analysis in human factors and ergonomics. Copyright © 2016 Elsevier Ltd. All rights reserved.

  14. An induction Linac driven heavy-ion fusion systems model

    International Nuclear Information System (INIS)

    Zuckerman, D.S.; Driemeyer, D.E.; Waganer, L.M.; Dudziak, D.J.

    1988-01-01

    A computerized systems model of a heavy-ion fusion (HIF) reactor power plant is presented. The model can be used to analyze the behavior and projected costs of a commercial power plant using an induction linear accelerator (Linac) as a driver. Each major component of the model (targets, reactor cavity, Linac, beam transport, power flow, balance of plant, and costing) is discussed. Various target, reactor cavity, Linac, and beam transport schemes are examined and compared. The preferred operating regime for such a power plant is also examined. The results show that HIF power plants can compete with other advanced energy concepts at the 1000-MW (electric) power level [cost of electricity (COE) -- 50 mill/kW . h] provided that the cost savings predicted for Linacs using higher charge-state ions (+3) can be realized

  15. Computer modeling and simulation in inertial confinement fusion

    International Nuclear Information System (INIS)

    McCrory, R.L.; Verdon, C.P.

    1989-03-01

    The complex hydrodynamic and transport processes associated with the implosion of an inertial confinement fusion (ICF) pellet place considerable demands on numerical simulation programs. Processes associated with implosion can usually be described using relatively simple models, but their complex interplay requires that programs model most of the relevant physical phenomena accurately. Most hydrodynamic codes used in ICF incorporate a one-fluid, two-temperature model. Electrons and ions are assumed to flow as one fluid (no charge separation). Due to the relatively weak coupling between the ions and electrons, each species is treated separately in terms of its temperature. In this paper we describe some of the major components associated with an ICF hydrodynamics simulation code. To serve as an example we draw heavily on a two-dimensional Lagrangian hydrodynamic code (ORCHID) written at the University of Rochester's Laboratory for Laser Energetics. 46 refs., 19 figs., 1 tab

  16. Application of the JDL data fusion process model for cyber security

    Science.gov (United States)

    Giacobe, Nicklaus A.

    2010-04-01

    A number of cyber security technologies have proposed the use of data fusion to enhance the defensive capabilities of the network and aid in the development of situational awareness for the security analyst. While there have been advances in fusion technologies and the application of fusion in intrusion detection systems (IDSs), in particular, additional progress can be made by gaining a better understanding of a variety of data fusion processes and applying them to the cyber security application domain. This research explores the underlying processes identified in the Joint Directors of Laboratories (JDL) data fusion process model and further describes them in a cyber security context.

  17. State and Local Intelligence Fusion Centers: An Evaluative Approach in Modeling a State Fusion Center

    National Research Council Canada - National Science Library

    Forsyth, William A

    2005-01-01

    .... Effective terrorism prevention, however, requires information and intelligence fusion as a cooperative process at all levels of government so that the flow of intelligence can be managed to support...

  18. Fault diagnosis model for power transformers based on information fusion

    Science.gov (United States)

    Dong, Ming; Yan, Zhang; Yang, Li; Judd, Martin D.

    2005-07-01

    Methods used to assess the insulation status of power transformers before they deteriorate to a critical state include dissolved gas analysis (DGA), partial discharge (PD) detection and transfer function techniques, etc. All of these approaches require experience in order to correctly interpret the observations. Artificial intelligence (AI) is increasingly used to improve interpretation of the individual datasets. However, a satisfactory diagnosis may not be obtained if only one technique is used. For example, the exact location of PD cannot be predicted if only DGA is performed. However, using diverse methods may result in different diagnosis solutions, a problem that is addressed in this paper through the introduction of a fuzzy information infusion model. An inference scheme is proposed that yields consistent conclusions and manages the inherent uncertainty in the various methods. With the aid of information fusion, a framework is established that allows different diagnostic tools to be combined in a systematic way. The application of information fusion technique for insulation diagnostics of transformers is proved promising by means of examples.

  19. Model based population PK-PD analysis of furosemide for BP lowering effect: A comparative study in primary and secondary hypertension.

    Science.gov (United States)

    Shukla, Mahendra; Ibrahim, Moustafa M A; Jain, Moon; Jaiswal, Swati; Sharma, Abhisheak; Hanif, Kashif; Lal, Jawahar

    2017-11-15

    Though numerous reports have demonstrated multiple mechanisms by which furosemide can exert its anti-hypertensive response. However, lack of studies describing PK-PD relationship for furosemide featuring its anti-hypertensive property has limited its usage as a blood pressure (BP) lowering agent. Serum concentrations and mean arterial BP were monitored following 40 and 80mgkg -1 multiple oral dose of furosemide in spontaneously hypertensive rats (SHR) and DOCA-salt induced hypertensive (DOCA-salt) rats. A simultaneous population PK-PD relationship using E max model with effect compartment was developed to compare the anti-hypertensive efficacy of furosemide in these rat models. A two-compartment PK model with Weibull-type absorption and first-order elimination best described the serum concentration-time profile of furosemide. In the present study, post dose serum concentrations of furosemide were found to be lower than the EC 50 . The EC 50 predicted in DOCA-salt rats was found to be lower (4.5-fold), whereas the tolerance development was higher than that in SHR model. The PK-PD parameter estimates, particularly lower values of EC 50 , K e and Q in DOCA-salt rats as compared to SHR, pinpointed the higher BP lowering efficacy of furosemide in volume overload induced hypertensive conditions. Insignificantly altered serum creatinine and electrolyte levels indicated a favorable side effect profile of furosemide. In conclusion, the final PK-PD model described the data well and provides detailed insights into the use of furosemide as an anti-hypertensive agent. Copyright © 2017. Published by Elsevier B.V.

  20. Improving Agent Based Models and Validation through Data Fusion.

    Science.gov (United States)

    Laskowski, Marek; Demianyk, Bryan C P; Friesen, Marcia R; McLeod, Robert D; Mukhi, Shamir N

    2011-01-01

    This work is contextualized in research in modeling and simulation of infection spread within a community or population, with the objective to provide a public health and policy tool in assessing the dynamics of infection spread and the qualitative impacts of public health interventions. This work uses the integration of real data sources into an Agent Based Model (ABM) to simulate respiratory infection spread within a small municipality. Novelty is derived in that the data sources are not necessarily obvious within ABM infection spread models. The ABM is a spatial-temporal model inclusive of behavioral and interaction patterns between individual agents on a real topography. The agent behaviours (movements and interactions) are fed by census / demographic data, integrated with real data from a telecommunication service provider (cellular records) and person-person contact data obtained via a custom 3G Smartphone application that logs Bluetooth connectivity between devices. Each source provides data of varying type and granularity, thereby enhancing the robustness of the model. The work demonstrates opportunities in data mining and fusion that can be used by policy and decision makers. The data become real-world inputs into individual SIR disease spread models and variants, thereby building credible and non-intrusive models to qualitatively simulate and assess public health interventions at the population level.

  1. A method based on IHS cylindrical transform model for quality assessment of image fusion

    Science.gov (United States)

    Zhu, Xiaokun; Jia, Yonghong

    2005-10-01

    Image fusion technique has been widely applied to remote sensing image analysis and processing, and methods for quality assessment of image fusion in remote sensing have also become the research issues at home and abroad. Traditional assessment methods combine calculation of quantitative indexes and visual interpretation to compare fused images quantificationally and qualitatively. However, in the existing assessment methods, there are two defects: on one hand, most imdexes lack the theoretic support to compare different fusion methods. On the hand, there is not a uniform preference for most of the quantitative assessment indexes when they are applied to estimate the fusion effects. That is, the spatial resolution and spectral feature could not be analyzed synchronously by these indexes and there is not a general method to unify the spatial and spectral feature assessment. So in this paper, on the basis of the approximate general model of four traditional fusion methods, including Intensity Hue Saturation(IHS) triangle transform fusion, High Pass Filter(HPF) fusion, Principal Component Analysis(PCA) fusion, Wavelet Transform(WT) fusion, a correlation coefficient assessment method based on IHS cylindrical transform is proposed. By experiments, this method can not only get the evaluation results of spatial and spectral features on the basis of uniform preference, but also can acquire the comparison between fusion image sources and fused images, and acquire differences among fusion methods. Compared with the traditional assessment methods, the new methods is more intuitionistic, and in accord with subjective estimation.

  2. Numerical modelling of electromagnetic loads on fusion device structures

    International Nuclear Information System (INIS)

    Bettini, Paolo; Palumbo, Maurizio Furno; Specogna, Ruben

    2014-01-01

    In magnetic confinement fusion devices, during abnormal operations (disruptions) the plasma begins to move rapidly towards the vessel wall in a vertical displacement event (VDE), producing plasma current asymmetries, vessel eddy currents and open field line halo currents, each of which can exert potentially damaging forces upon the vessel and in-vessel components. This paper presents a methodology to estimate electromagnetic loads, on three-dimensional conductive structures surrounding the plasma, which arise from the interaction of halo-currents associated to VDEs with a magnetic field of the order of some Tesla needed for plasma confinement. Lorentz forces, calculated by complementary formulations, are used as constraining loads in a linear static structural analysis carried out on a detailed model of the mechanical structures of a representative machine

  3. Numerical modelling of electromagnetic loads on fusion device structures

    Science.gov (United States)

    Bettini, Paolo; Furno Palumbo, Maurizio; Specogna, Ruben

    2014-03-01

    In magnetic confinement fusion devices, during abnormal operations (disruptions) the plasma begins to move rapidly towards the vessel wall in a vertical displacement event (VDE), producing plasma current asymmetries, vessel eddy currents and open field line halo currents, each of which can exert potentially damaging forces upon the vessel and in-vessel components. This paper presents a methodology to estimate electromagnetic loads, on three-dimensional conductive structures surrounding the plasma, which arise from the interaction of halo-currents associated to VDEs with a magnetic field of the order of some Tesla needed for plasma confinement. Lorentz forces, calculated by complementary formulations, are used as constraining loads in a linear static structural analysis carried out on a detailed model of the mechanical structures of a representative machine.

  4. Studies of breakeven prices and electricity supply potentials of nuclear fusion by a long-term world energy and environment model

    International Nuclear Information System (INIS)

    Tokimatsu, K.; Asaoka, Y.; Okano, K.; Yoshida, T.; Hiwatari, R.; Konishi, S.; Nishio, S.; Fujino, J.; Ogawa, Y.; Yamaji, K.

    2002-01-01

    In response to social demand, this paper investigates the breakeven price (BP) and potential electricity supply of nuclear fusion energy in the 21st century by means of a world energy and environment model. We set the following objectives in this paper: (i) to reveal the economics of the introduction conditions of nuclear fusion; (ii) to know when tokamak-type nuclear fusion reactors are expected to be introduced cost-effectively into future energy systems; (iii) to estimate the share in 2100 of electricity produced by the presently designed reactors that could be economically selected in the year. The model can give in detail the energy and environment technologies and price-induced energy saving, and can illustrate optimal energy supply structures by minimizing the costs of total discounted energy systems at a discount rate of 5%. The following parameters of nuclear fusion were considered: cost of electricity (COE) in the nuclear fusion introduction year, annual COE reduction rates, regional introduction year, and regional nuclear fusion capacity projection. The investigations are carried out for three nuclear fusion projections one of which includes tritium breeding constraints, four future CO 2 concentration constraints, and technological assumptions on fossil fuels, nuclear fission, CO 2 sequestration, and anonymous innovative technologies. It is concluded that: (1) the BPs are from 65 to 125 mill kW -1 h -1 depending on the introduction year of nuclear fusion under the 550 ppmv CO 2 concentration constraints; those of a business-as-usual (BAU) case are from 51 to 68 mill kW -1 h -1 . Uncertainties resulting from the CO 2 concentration constraints and the technological options influenced the BPs by plus/minus some 10-30 mill kW -1 h -1 , (2) tokamak-type nuclear fusion reactors (as presently designed, with a COE range around 70-130 mill kW -1 h -1 ) would be favourably introduced into energy systems after 2060 based on the economic criteria under the 450 and

  5. Studies of breakeven prices and electricity supply potentials of nuclear fusion by a long-term world energy and environment model

    Science.gov (United States)

    Tokimatsu, K.; Asaoka, Y.; Konishi, S.; Fujino, J.; Ogawa, Y.; Okano, K.; Nishio, S.; Yoshida, T.; Hiwatari, R.; Yamaji, K.

    2002-11-01

    In response to social demand, this paper investigates the breakeven price (BP) and potential electricity supply of nuclear fusion energy in the 21st century by means of a world energy and environment model. We set the following objectives in this paper: (i) to reveal the economics of the introduction conditions of nuclear fusion; (ii) to know when tokamak-type nuclear fusion reactors are expected to be introduced cost-effectively into future energy systems; (iii) to estimate the share in 2100 of electricity produced by the presently designed reactors that could be economically selected in the year. The model can give in detail the energy and environment technologies and price-induced energy saving, and can illustrate optimal energy supply structures by minimizing the costs of total discounted energy systems at a discount rate of 5%. The following parameters of nuclear fusion were considered: cost of electricity (COE) in the nuclear fusion introduction year, annual COE reduction rates, regional introduction year, and regional nuclear fusion capacity projection. The investigations are carried out for three nuclear fusion projections one of which includes tritium breeding constraints, four future CO2 concentration constraints, and technological assumptions on fossil fuels, nuclear fission, CO2 sequestration, and anonymous innovative technologies. It is concluded that: (1) the BPs are from 65 to 125 mill kW-1 h-1 depending on the introduction year of nuclear fusion under the 550 ppmv CO2 concentration constraints; those of a business-as-usual (BAU) case are from 51 to 68 mill kW-1h-1. Uncertainties resulting from the CO2 concentration constraints and the technological options influenced the BPs by plus/minus some 10 30 mill kW-1h-1, (2) tokamak-type nuclear fusion reactors (as presently designed, with a COE range around 70 130 mill kW-1h-1) would be favourably introduced into energy systems after 2060 based on the economic criteria under the 450 and 550 ppmv CO2

  6. a Comparative Analysis of Spatiotemporal Data Fusion Models for Landsat and Modis Data

    Science.gov (United States)

    Hazaymeh, K.; Almagbile, A.

    2018-04-01

    In this study, three documented spatiotemporal data fusion models were applied to Landsat-7 and MODIS surface reflectance, and NDVI. The algorithms included the spatial and temporal adaptive reflectance fusion model (STARFM), sparse representation based on a spatiotemporal reflectance fusion model (SPSTFM), and spatiotemporal image-fusion model (STI-FM). The objectives of this study were to (i) compare the performance of these three fusion models using a one Landsat-MODIS spectral reflectance image pairs using time-series datasets from the Coleambally irrigation area in Australia, and (ii) quantitatively evaluate the accuracy of the synthetic images generated from each fusion model using statistical measurements. Results showed that the three fusion models predicted the synthetic Landsat-7 image with adequate agreements. The STI-FM produced more accurate reconstructions of both Landsat-7 spectral bands and NDVI. Furthermore, it produced surface reflectance images having the highest correlation with the actual Landsat-7 images. This study indicated that STI-FM would be more suitable for spatiotemporal data fusion applications such as vegetation monitoring, drought monitoring, and evapotranspiration.

  7. A generative model for probabilistic label fusion of multimodal data

    DEFF Research Database (Denmark)

    Iglesias, Juan Eugenio; Sabuncu, Mert Rory; Van Leemput, Koen

    2012-01-01

    The maturity of registration methods, in combination with the increasing processing power of computers, has made multi-atlas segmentation methods practical. The problem of merging the deformed label maps from the atlases is known as label fusion. Even though label fusion has been well studied for...

  8. Canonical form of an elastoplastic model of nuclear fusion

    International Nuclear Information System (INIS)

    Mikhajlova, T.I.; Mikhajlov, I.N.; Do Dang, G.

    1997-01-01

    Starting from equations of motion describing the fusion process in symmetrical nuclear systems of low angular momenta we reconstruct the collective Lagrangian and dissipation Rayleigh functions. This opens new perspectives in studying the dynamical effects in the heavy nuclei collisions. In particular, it provides a basis for a quantal description of the fusion process and accompanying its effects

  9. Effect of phospholipid metabolites on model membrane fusion

    Energy Technology Data Exchange (ETDEWEB)

    Shragin, A.S.; Vasilenko, I.A.; Selishcheva, A.A.; Shvets, V.I.

    1985-01-01

    /sup 31/P-NMR spectroscopy and formation of fluorescent complexes between Tb/sup 3 +/ and dipicolinic acid were used to monitor liposome fusion and the effects of phospholipases C and D on the process. Phospholipase C was found highly efficient in initiating liposomal fusion, regardless of the phospholipid composition of the bilayer membranes. However, phospholipase D promoted liposomal fusion only in cases in which the membranes contained high concentrations of phospholipids incapable of forming bilayer membranes, such as phosphatidylethanolamine and cardiolipin. The mechanism of action of both enzymes in promoting liposomal fusion was ascribed to the generation of a metastable state in the membranes as a result of enzymatic formation of lipophilic metabolites 1,2-diacylglycerol and phosphatidic acid. The perturbation, or fluidity, of the liposomal membranes favored fusion on contact. 21 references, 4 figures.

  10. Efficient modeling for pulsed activation in inertial fusion energy reactors

    International Nuclear Information System (INIS)

    Sanz, J.; Yuste, P.; Reyes, S.; Latkowski, J.F.

    2000-01-01

    First structural wall material (FSW) materials in inertial fusion energy (IFE) power reactors will be irradiated under typical repetition rates of 1-10 Hz, for an operation time as long as the total reactor lifetime. The main objective of the present work is to determine whether a continuous-pulsed (CP) approach can be an efficient method in modeling the pulsed activation process for operating conditions of FSW materials. The accuracy and practicability of this method was investigated both analytically and (for reaction/decay chains of two and three nuclides) by computational simulation. It was found that CP modeling is an accurate and practical method for calculating the neutron-activation of FSW materials. Its use is recommended instead of the equivalent steady-state method or the exact pulsed modeling. Moreover, the applicability of this method to components of an IFE power plant subject to repetition rates lower than those of the FSW is still being studied. The analytical investigation was performed for 0.05 Hz, which could be typical for the coolant. Conclusions seem to be similar to those obtained for the FSW. However, further future work is needed for a final answer

  11. Danish heathland manipulation experiment data in Model-Data-Fusion

    Science.gov (United States)

    Thum, Tea; Peylin, Philippe; Ibrom, Andreas; Van Der Linden, Leon; Beier, Claus; Bacour, Cédric; Santaren, Diego; Ciais, Philippe

    2013-04-01

    In ecosystem manipulation experiments (EMEs) the ecosystem is artificially exposed to different environmental conditions that aim to simulate circumstances in future climate. At Danish EME site Brandbjerg the responses of a heathland to drought, warming and increased atmospheric CO2 concentration are studied. The warming manipulation is realized by passive nighttime warming. The measurements include control plots as well as replicates for each three treatment separately and in combination. The Brandbjerg heathland ecosystem is dominated by heather and wavy hairgrass. These experiments provide excellent data for validation and development of ecosystem models. In this work we used a generic vegetation model ORCHIDEE with Model-Data-Fusion (MDF) approach. ORCHIDEE model is a process-based model that describes the exchanges of carbon, water and energy between the atmosphere and the vegetation. It can be run at different spatial scales from global to site level. Different vegetation types are described in ORCHIDEE as plant functional types. In MDF we are using observations from the site to optimize the model parameters. This enables us to assess the modelling errors and the performance of the model for different manipulation treatments. This insight will inform us whether the different processes are adequately modelled or if the model is missing some important processes. We used a genetic algorithm in the MDF. The data available from the site included measurements of aboveground biomass, heterotrophic soil respiration and total ecosystem respiration from years 2006-2008. The biomass was measured six times doing this period. The respiration measurements were done with manual chamber measurements. For the soil respiration we used results from an empirical model that has been developed for the site. This enabled us to have more data for the MDF. Before the MDF we performed a sensitivity analysis of the model parameters to different data streams. Fifteen most influential

  12. Fusion rings and fusion ideals

    DEFF Research Database (Denmark)

    Andersen, Troels Bak

    by the so-called fusion ideals. The fusion rings of Wess-Zumino-Witten models have been widely studied and are well understood in terms of precise combinatorial descriptions and explicit generating sets of the fusion ideals. They also appear in another, more general, setting via tilting modules for quantum......This dissertation investigates fusion rings, which are Grothendieck groups of rigid, monoidal, semisimple, abelian categories. Special interest is in rational fusion rings, i.e., fusion rings which admit a finite basis, for as commutative rings they may be presented as quotients of polynomial rings...

  13. Model Fusion Tool - the Open Environmental Modelling Platform Concept

    Science.gov (United States)

    Kessler, H.; Giles, J. R.

    2010-12-01

    The vision of an Open Environmental Modelling Platform - seamlessly linking geoscience data, concepts and models to aid decision making in times of environmental change. Governments and their executive agencies across the world are facing increasing pressure to make decisions about the management of resources in light of population growth and environmental change. In the UK for example, groundwater is becoming a scarce resource for large parts of its most densely populated areas. At the same time river and groundwater flooding resulting from high rainfall events are increasing in scale and frequency and sea level rise is threatening the defences of coastal cities. There is also a need for affordable housing, improved transport infrastructure and waste disposal as well as sources of renewable energy and sustainable food production. These challenges can only be resolved if solutions are based on sound scientific evidence. Although we have knowledge and understanding of many individual processes in the natural sciences it is clear that a single science discipline is unable to answer the questions and their inter-relationships. Modern science increasingly employs computer models to simulate the natural, economic and human system. Management and planning requires scenario modelling, forecasts and ‘predictions’. Although the outputs are often impressive in terms of apparent accuracy and visualisation, they are inherently not suited to simulate the response to feedbacks from other models of the earth system, such as the impact of human actions. Geological Survey Organisations (GSO) are increasingly employing advances in Information Technology to visualise and improve their understanding of geological systems. Instead of 2 dimensional paper maps and reports many GSOs now produce 3 dimensional geological framework models and groundwater flow models as their standard output. Additionally the British Geological Survey have developed standard routines to link geological

  14. Proceedings of the third specialists' workshop on modeling tritium behaviour in ceramic fusion blankets

    International Nuclear Information System (INIS)

    Werle, H.

    1991-08-01

    The third specialists' workshop on modeling tritium behaviour in ceramic fusion blankets, hosted by Kernforschungszentrum Karlsruhe, was held June 10-11, 1991. The workshop was coordinated through the IEA Annex II implementing agreement on 'Radiation damage in fusion materials'. (orig./WL)

  15. Modeling Small-Amplitude Perturbations in Inertial Confinement Fusion Pellets

    Science.gov (United States)

    Zalesak, Steven; Metzler, N.; Velikovich, A. L.; Gardner, J. H.; Manheimer, W.

    2005-10-01

    Recent advances in inertial confinement fusion (ICF) technology serve to ensure that imploding laser-driven ICF pellets will spend a significantly larger portion of their time in what is regarded as the ``linear'' portion of their perturbation evolution, i.e., in the presence of small-amplitude but nonetheless evolving perturbations. Since the evolution of these linear perturbations collectively form the initial conditions for the subsequent nonlinear evolution of the pellet, which in turn determines the energy yield of the pellet, the accurate numerical modeling of these small-amplitude perturbations has taken on an increased importance. This modeling is difficult despite the expected linear evolution of the perturbations themselves, because these perturbations are embedded in a highly nonlinear, strongly-shocked, and highly complex flow field which in and of itself stresses numerical computation capabilities, and whose simulation often employs numerical techniques which were not designed with the proper treatment of small-amplitude perturbations in mind. In this paper we will review some of the techniques that we have recently found to be of use toward this end.

  16. A system dynamics model for tritium cycle of pulsed fusion reactor

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Zuolong; Nie, Baojie [Key Laboratory of Neutronics and Radiation Safety, Institute of Nuclear Energy Safety Technology, Chinese Academy of Sciences, Hefei, Anhui, 230031 (China); University of Science and Technology of China, Hefei, Anhui, 230027 (China); Chen, Dehong, E-mail: dehong.chen@fds.org.cn [Key Laboratory of Neutronics and Radiation Safety, Institute of Nuclear Energy Safety Technology, Chinese Academy of Sciences, Hefei, Anhui, 230031 (China)

    2017-05-15

    As great challenges and uncertainty exist in achieving steady plasma burning, pulsed plasma burning may be a potential scenario for fusion engineering test reactor, even for fusion DEMOnstration reactor. In order to analyze dynamic tritium inventory and tritium self-sufficiency for pulsed fusion systems, a system dynamics model of tritium cycle was developed on the basis of earlier version of Tritium Analysis program for fusion System (TAS). The model was verified with TRIMO, which was developed by KIT in Germany. Tritium self-sufficiency and dynamic tritium inventory assessment were performed for a typical fusion engineering test reactor. The verification results show that the system dynamics model can be used for tritium cycle analysis of pulsed fusion reactor with sufficient reliability. The assessment results of tritium self-sufficiency indicate that the fusion reactor might only need several hundred gram tritium to startup if achieved high efficient tritium handling ability (Referred ITER: 1 h). And the initial tritium startup inventory in pulsed fusion reactor is determined by the combined influence of pulse length, burn availability, and tritium recycle time. Meanwhile, tritium self-sufficiency can be achieved under the defined condition.

  17. A system dynamics model for tritium cycle of pulsed fusion reactor

    International Nuclear Information System (INIS)

    Zhu, Zuolong; Nie, Baojie; Chen, Dehong

    2017-01-01

    As great challenges and uncertainty exist in achieving steady plasma burning, pulsed plasma burning may be a potential scenario for fusion engineering test reactor, even for fusion DEMOnstration reactor. In order to analyze dynamic tritium inventory and tritium self-sufficiency for pulsed fusion systems, a system dynamics model of tritium cycle was developed on the basis of earlier version of Tritium Analysis program for fusion System (TAS). The model was verified with TRIMO, which was developed by KIT in Germany. Tritium self-sufficiency and dynamic tritium inventory assessment were performed for a typical fusion engineering test reactor. The verification results show that the system dynamics model can be used for tritium cycle analysis of pulsed fusion reactor with sufficient reliability. The assessment results of tritium self-sufficiency indicate that the fusion reactor might only need several hundred gram tritium to startup if achieved high efficient tritium handling ability (Referred ITER: 1 h). And the initial tritium startup inventory in pulsed fusion reactor is determined by the combined influence of pulse length, burn availability, and tritium recycle time. Meanwhile, tritium self-sufficiency can be achieved under the defined condition.

  18. Contribution to the numerical modeling of inertial confinement fusion

    International Nuclear Information System (INIS)

    Maire, P.H.

    2011-02-01

    This work was realized by writing the CHIC code, which is a software for designing and restoring experience in the field of inertial confinement fusion. The theoretical model describing the implosion of a laser target is a system of partial differential equations in the center of which is the Euler equations written in Lagrangian formalism, coupled with diffusion equations modeling the nonlinear transport of energy by electrons and photons. After a brief review of the physical context, we describe two novel methods which constitute the backbone of the CHIC code. These are 2 high-order finite volume schemes respectively dedicated to solving the equations of Lagrangian hydrodynamics and the anisotropic diffusion equations on bi-dimensional unstructured grids. The first scheme, called EUCCLHYD (Explicit Unstructured Lagrangian Hydrodynamics), solves the equations of gas dynamics on a moving mesh that moves at the speed of light. It is obtained from a general formalism based on the concept of sub-cell forces. In this context, the numerical fluxes are expressed in terms of the sub-cell force and the nodal velocity. Their determination is based on 3 basic principles: geometric compatibility between the movement of nodes and the volume change of mesh (geometric conservation law), compatibility with the second law of thermodynamics and conservation of total energy and momentum. The high-order extension is performed using a method based on solving a generalized Riemann problem in the acoustic approximation. The second scheme, called CCLAD (Cell-Centered Lagrangian Diffusion), solves the anisotropic heat equation. The corresponding discretization relies on a discrete variational formulation based on the sub-cell that allows to build a multipoint approximation of heat flux. This high-order discretization makes possible the resolution of the equations of anisotropic diffusion with satisfactory accuracy on highly distorted Lagrangian meshes. (author)

  19. A liquid-drop model for the heavy-ion fusion below the Coulomb barrier

    International Nuclear Information System (INIS)

    Aguiar, Carlos Eduardo Magalhaes de.

    1988-03-01

    The enhancement of sub-barrier fusion observed in heavy ion collisions is studied in a liquid-drop model. It is shown that shape degrees of freedom related to neck formation play an important role in the fusion process, and increase the low energy fusion rates. The model predictions are in a quite satisfactory agreement with the experimental data, and major discrepancies seem to be found only for those systems where specific nuclear structure effects should also be considered. (author). 83 refs, 54 figs

  20. Modelling third harmonic ion cyclotron acceleration of deuterium beams for JET fusion product studies experiments

    DEFF Research Database (Denmark)

    Schneider, M.; Johnson, T.; Dumont, R.

    2016-01-01

    Recent JET experiments have been dedicated to the studies of fusion reactions between deuterium (D) and Helium-3 (3He) ions using neutral beam injection (NBI) in synergy with third harmonic ion cyclotron radio-frequency heating (ICRH) of the beam. This scenario generates a fast ion deuterium tail...... enhancing DD and D3He fusion reactions. Modelling and measuring the fast deuterium tail accurately is essential for quantifying the fusion products. This paper presents the modelling of the D distribution function resulting from the NBI+ICRF heating scheme, reinforced by a comparison with dedicated JET fast...

  1. Study of fusion mechanism of halo nuclear 11Be+208Pb by applying QMD model

    International Nuclear Information System (INIS)

    Wang Ning; Li Zhuxia

    2001-01-01

    The authors have studied the fusion reaction for 11 Be + 208 Pb near barrier by applying QMD model, and find that in t he fusion reaction induced by halo nuclei there simultaneously exist two mechanisms competing with each other. On one hand, 11 Be is a weakly bound nuclear system and is easily broke up caused by the interaction with target, when it approaches to target, so the fusion cross section is suppressed. On the other hand, several neutrons of 11 Be transfer into 208 Pb and interact with 208 Pb to cause the local radius of 208 Pb increase and result in an enhancement of fusion cross section. The fusion cross sections calculated show an enhancement near barrier, and the calculated results agree with the experimental data reasonably well

  2. Nuclear fusion as new energy option in a global single-regional energy system model

    International Nuclear Information System (INIS)

    Eherer, C.; Baumann, M.; Dueweke, J.; Hamacher, T.

    2005-01-01

    Is there a window of opportunity for fusion on the electricity market under 'business as usual' conditions, and if not, how do the boundary conditions have to look like to open such a window? This question is addressed within a subtask of the Socio-Economic Research on Fusion (SERF) programme of the European Commission. The most advanced energy-modelling framework, the TIMES model generator developed by the Energy Technology System Analysis Project group of the IEA (ETSAP) has been used to implement a global single-regional partial equilibrium energy model. Within the current activities the potential role of fusion power in various future energy scenarios is studied. The final energy demand projections of the baseline of the investigations are based on IIASA-WEC Scenario B. Under the quite conservative baseline assumptions fusion only enters the model solution with 35 GW in 2100 and it can be observed that coal technologies dominate electricity production in 2100. Scenario variations show that the role of fusion power is strongly affected by the availability of GEN IV fission breeding technologies as energy option and by CO 2 emission caps. The former appear to be a major competitor of fusion power while the latter open a window of opportunity for fusion power on the electricity market. An interesting outcome is furthermore that the possible share of fusion electricity is more sensitive to the potential of primary resources like coal, gas and uranium, than to the share of solar and wind power in the system. This indicates that both kinds of technologies, renewables and fusion power, can coexist in future energy systems in case of CO 2 emission policies and/or resource scarcity scenarios. It is shown that Endogenous Technological Learning (ETL), a more consistent description of technological progress than mere time series, has an impact on the model results. (author)

  3. Present status on atomic and molecular data relevant to fusion plasma diagnostics and modeling

    International Nuclear Information System (INIS)

    Tawara, H.

    1997-01-01

    This issue is the collection of the paper presented status on atomic and molecular data relevant to fusion plasma diagnostics and modeling. The 10 of the presented papers are indexed individually. (J.P.N.)

  4. Label fusion based brain MR image segmentation via a latent selective model

    Science.gov (United States)

    Liu, Gang; Guo, Xiantang; Zhu, Kai; Liao, Hengxu

    2018-04-01

    Multi-atlas segmentation is an effective approach and increasingly popular for automatically labeling objects of interest in medical images. Recently, segmentation methods based on generative models and patch-based techniques have become the two principal branches of label fusion. However, these generative models and patch-based techniques are only loosely related, and the requirement for higher accuracy, faster segmentation, and robustness is always a great challenge. In this paper, we propose novel algorithm that combines the two branches using global weighted fusion strategy based on a patch latent selective model to perform segmentation of specific anatomical structures for human brain magnetic resonance (MR) images. In establishing this probabilistic model of label fusion between the target patch and patch dictionary, we explored the Kronecker delta function in the label prior, which is more suitable than other models, and designed a latent selective model as a membership prior to determine from which training patch the intensity and label of the target patch are generated at each spatial location. Because the image background is an equally important factor for segmentation, it is analyzed in label fusion procedure and we regard it as an isolated label to keep the same privilege between the background and the regions of interest. During label fusion with the global weighted fusion scheme, we use Bayesian inference and expectation maximization algorithm to estimate the labels of the target scan to produce the segmentation map. Experimental results indicate that the proposed algorithm is more accurate and robust than the other segmentation methods.

  5. Fusion neutronics

    CERN Document Server

    Wu, Yican

    2017-01-01

    This book provides a systematic and comprehensive introduction to fusion neutronics, covering all key topics from the fundamental theories and methodologies, as well as a wide range of fusion system designs and experiments. It is the first-ever book focusing on the subject of fusion neutronics research. Compared with other nuclear devices such as fission reactors and accelerators, fusion systems are normally characterized by their complex geometry and nuclear physics, which entail new challenges for neutronics such as complicated modeling, deep penetration, low simulation efficiency, multi-physics coupling, etc. The book focuses on the neutronics characteristics of fusion systems and introduces a series of theories and methodologies that were developed to address the challenges of fusion neutronics, and which have since been widely applied all over the world. Further, it introduces readers to neutronics design’s unique principles and procedures, experimental methodologies and technologies for fusion systems...

  6. Stem cells regenerative properties on new rat spinal fusion model

    Czech Academy of Sciences Publication Activity Database

    Klíma, K.; Vaněček, Václav; Kohout, A.; Jiroušek, Ondřej; Foltán, R.; Štulík, J.; Machoň, V.; Pavlíková, G.; Jendelová, Pavla; Syková, Eva; Šedý, Jiří

    2015-01-01

    Roč. 64, č. 1 (2015), s. 119-128 ISSN 0862-8408 R&D Projects: GA MZd(CZ) NT13477; GA ČR(CZ) GAP304/10/0320 Institutional support: RVO:67985823 ; RVO:68378297 ; RVO:68378041 Keywords : mesenchymal stem cells * bone graft substitute * spinal fusion Subject RIV: FH - Neurology Impact factor: 1.643, year: 2015

  7. A prediction method based on wavelet transform and multiple models fusion for chaotic time series

    International Nuclear Information System (INIS)

    Zhongda, Tian; Shujiang, Li; Yanhong, Wang; Yi, Sha

    2017-01-01

    In order to improve the prediction accuracy of chaotic time series, a prediction method based on wavelet transform and multiple models fusion is proposed. The chaotic time series is decomposed and reconstructed by wavelet transform, and approximate components and detail components are obtained. According to different characteristics of each component, least squares support vector machine (LSSVM) is used as predictive model for approximation components. At the same time, an improved free search algorithm is utilized for predictive model parameters optimization. Auto regressive integrated moving average model (ARIMA) is used as predictive model for detail components. The multiple prediction model predictive values are fusion by Gauss–Markov algorithm, the error variance of predicted results after fusion is less than the single model, the prediction accuracy is improved. The simulation results are compared through two typical chaotic time series include Lorenz time series and Mackey–Glass time series. The simulation results show that the prediction method in this paper has a better prediction.

  8. Putting atomic diffusion theory of magnetic ApBp stars to the test: evaluation of the predictions of time-dependent diffusion models

    Science.gov (United States)

    Kochukhov, O.; Ryabchikova, T. A.

    2018-02-01

    A series of recent theoretical atomic diffusion studies has address the challenging problem of predicting inhomogeneous vertical and horizontal chemical element distributions in the atmospheres of magnetic ApBp stars. Here we critically assess the most sophisticated of such diffusion models - based on a time-dependent treatment of the atomic diffusion in a magnetized stellar atmosphere - by direct comparison with observations as well by testing the widely used surface mapping tools with the spectral line profiles predicted by this theory. We show that the mean abundances of Fe and Cr are grossly underestimated by the time-dependent theoretical diffusion model, with discrepancies reaching a factor of 1000 for Cr. We also demonstrate that Doppler imaging inversion codes, based either on modelling of individual metal lines or line-averaged profiles simulated according to theoretical three-dimensional abundance distribution, are able to reconstruct correct horizontal chemical spot maps despite ignoring the vertical abundance variation. These numerical experiments justify a direct comparison of the empirical two-dimensional Doppler maps with theoretical diffusion calculations. This comparison is generally unfavourable for the current diffusion theory, as very few chemical elements are observed to form overabundance rings in the horizontal field regions as predicted by the theory and there are numerous examples of element accumulations in the vicinity of radial field zones, which cannot be explained by diffusion calculations.

  9. A label field fusion bayesian model and its penalized maximum rand estimator for image segmentation.

    Science.gov (United States)

    Mignotte, Max

    2010-06-01

    This paper presents a novel segmentation approach based on a Markov random field (MRF) fusion model which aims at combining several segmentation results associated with simpler clustering models in order to achieve a more reliable and accurate segmentation result. The proposed fusion model is derived from the recently introduced probabilistic Rand measure for comparing one segmentation result to one or more manual segmentations of the same image. This non-parametric measure allows us to easily derive an appealing fusion model of label fields, easily expressed as a Gibbs distribution, or as a nonstationary MRF model defined on a complete graph. Concretely, this Gibbs energy model encodes the set of binary constraints, in terms of pairs of pixel labels, provided by each segmentation results to be fused. Combined with a prior distribution, this energy-based Gibbs model also allows for definition of an interesting penalized maximum probabilistic rand estimator with which the fusion of simple, quickly estimated, segmentation results appears as an interesting alternative to complex segmentation models existing in the literature. This fusion framework has been successfully applied on the Berkeley image database. The experiments reported in this paper demonstrate that the proposed method is efficient in terms of visual evaluation and quantitative performance measures and performs well compared to the best existing state-of-the-art segmentation methods recently proposed in the literature.

  10. Analysis of membrane fusion as a two-state sequential process: evaluation of the stalk model.

    Science.gov (United States)

    Weinreb, Gabriel; Lentz, Barry R

    2007-06-01

    We propose a model that accounts for the time courses of PEG-induced fusion of membrane vesicles of varying lipid compositions and sizes. The model assumes that fusion proceeds from an initial, aggregated vesicle state ((A) membrane contact) through two sequential intermediate states (I(1) and I(2)) and then on to a fusion pore state (FP). Using this model, we interpreted data on the fusion of seven different vesicle systems. We found that the initial aggregated state involved no lipid or content mixing but did produce leakage. The final state (FP) was not leaky. Lipid mixing normally dominated the first intermediate state (I(1)), but content mixing signal was also observed in this state for most systems. The second intermediate state (I(2)) exhibited both lipid and content mixing signals and leakage, and was sometimes the only leaky state. In some systems, the first and second intermediates were indistinguishable and converted directly to the FP state. Having also tested a parallel, two-intermediate model subject to different assumptions about the nature of the intermediates, we conclude that a sequential, two-intermediate model is the simplest model sufficient to describe PEG-mediated fusion in all vesicle systems studied. We conclude as well that a fusion intermediate "state" should not be thought of as a fixed structure (e.g., "stalk" or "transmembrane contact") of uniform properties. Rather, a fusion "state" describes an ensemble of similar structures that can have different mechanical properties. Thus, a "state" can have varying probabilities of having a given functional property such as content mixing, lipid mixing, or leakage. Our data show that the content mixing signal may occur through two processes, one correlated and one not correlated with leakage. Finally, we consider the implications of our results in terms of the "modified stalk" hypothesis for the mechanism of lipid pore formation. We conclude that our results not only support this hypothesis but

  11. Image fusion in craniofacial virtual reality modeling based on CT and 3dMD photogrammetry.

    Science.gov (United States)

    Xin, Pengfei; Yu, Hongbo; Cheng, Huanchong; Shen, Shunyao; Shen, Steve G F

    2013-09-01

    The aim of this study was to demonstrate the feasibility of building a craniofacial virtual reality model by image fusion of 3-dimensional (3D) CT models and 3 dMD stereophotogrammetric facial surface. A CT scan and stereophotography were performed. The 3D CT models were reconstructed by Materialise Mimics software, and the stereophotogrammetric facial surface was reconstructed by 3 dMD patient software. All 3D CT models were exported as Stereo Lithography file format, and the 3 dMD model was exported as Virtual Reality Modeling Language file format. Image registration and fusion were performed in Mimics software. Genetic algorithm was used for precise image fusion alignment with minimum error. The 3D CT models and the 3 dMD stereophotogrammetric facial surface were finally merged into a single file and displayed using Deep Exploration software. Errors between the CT soft tissue model and 3 dMD facial surface were also analyzed. Virtual model based on CT-3 dMD image fusion clearly showed the photorealistic face and bone structures. Image registration errors in virtual face are mainly located in bilateral cheeks and eyeballs, and the errors are more than 1.5 mm. However, the image fusion of whole point cloud sets of CT and 3 dMD is acceptable with a minimum error that is less than 1 mm. The ease of use and high reliability of CT-3 dMD image fusion allows the 3D virtual head to be an accurate, realistic, and widespread tool, and has a great benefit to virtual face model.

  12. Multimodality Tumor Delineation and Predictive Modelling via Fuzzy-Fusion Deformable Models and Biological Potential Functions

    Science.gov (United States)

    Wasserman, Richard Marc

    The radiation therapy treatment planning (RTTP) process may be subdivided into three planning stages: gross tumor delineation, clinical target delineation, and modality dependent target definition. The research presented will focus on the first two planning tasks. A gross tumor target delineation methodology is proposed which focuses on the integration of MRI, CT, and PET imaging data towards the generation of a mathematically optimal tumor boundary. The solution to this problem is formulated within a framework integrating concepts from the fields of deformable modelling, region growing, fuzzy logic, and data fusion. The resulting fuzzy fusion algorithm can integrate both edge and region information from multiple medical modalities to delineate optimal regions of pathological tissue content. The subclinical boundaries of an infiltrating neoplasm cannot be determined explicitly via traditional imaging methods and are often defined to extend a fixed distance from the gross tumor boundary. In order to improve the clinical target definition process an estimation technique is proposed via which tumor growth may be modelled and subclinical growth predicted. An in vivo, macroscopic primary brain tumor growth model is presented, which may be fit to each patient undergoing treatment, allowing for the prediction of future growth and consequently the ability to estimate subclinical local invasion. Additionally, the patient specific in vivo tumor model will be of significant utility in multiple diagnostic clinical applications.

  13. Developing models for simulation of pinched-beam dynamics in heavy ion fusion. Revision 1

    International Nuclear Information System (INIS)

    Boyd, J.K.; Mark, J.W.K.; Sharp, W.M.; Yu, S.S.

    1984-01-01

    For heavy-ion fusion energy applications, Mark and Yu have derived hydrodynamic models for numerical simulation of energetic pinched-beams including self-pinches and external-current pinches. These pinched-beams are applicable to beam propagation in fusion chambers and to the US High Temperature Experiment. The closure of the Mark-Yu model is obtained with adiabatic assumptions mathematically analogous to those of Chew, Goldberger, and Low for MHD. Features of this hydrodynamic beam model are compared with a kinetic treatment

  14. Semi empirical model for astrophysical nuclear fusion reactions of 1≤Z≤15

    International Nuclear Information System (INIS)

    Manjunatha, H.C.; Seenappa, L.; Sridhar, K.N.

    2017-01-01

    The fusion reaction is one of the most important reactions in the stellar evolution. Due to the complicated reaction mechanism of fusion, there is great uncertainty in the reaction rate which limits our understanding of various stellar objects. Low z elements are formed through many fusion reactions such as "4He+"1"2C→"1"6O, "1"2C+"1"2C→"2"0Ne+"4He, "1"2C+"1"2C→"2"3Na, "1"2C+"1"2C→"2"3Mg, "1"6O+"1"6O→"2"8Si+"4He, "1"2C+"1H→"1"3N and "1"3C+"4He→"1"6O. A detail study is required on Coulomb and nuclear interaction in formation of low Z elements in stars through fusion reactions. For astrophysics, the important energy range extends from 1 MeV to 3 MeV in the center of mass frame, which is only partially covered by experiments. In the present work, we have studied the basic fusion parameters such as barrier heights (V_B), positions (R_B), curvature of the inverted parabola (ħω_1) for fusion barrier, cross section and compound nucleus formation probability (P_C_N) and fusion process in the low Z element (1≤Z≤15) formation process. For each isotope, we have studied all possible projectile-target combinations. We have also studied the astrophysical S(E) factor for these reactions. Based on this study, we have formulated the semi empirical relations for barrier heights (V_B), positions (R_B), curvature of the inverted parabola and hence for the fusion cross section and astrophysical S(E) factor. The values produced by the present model compared with the experiments and data available in the literature. (author)

  15. Role of cytoskeleton in regulating fusion of nucleoli: a study using the activated mouse oocyte model.

    Science.gov (United States)

    Lian, Hua-Yu; Jiao, Guang-Zhong; Wang, Hui-Li; Tan, Xiu-Wen; Wang, Tian-Yang; Zheng, Liang-Liang; Kong, Qiao-Qiao; Tan, Jing-He

    2014-09-01

    Although fusion of nucleoli was observed during pronuclear development of zygotes and the behavior of nucleoli in pronuclei has been suggested as an indicator of embryonic developmental potential, the mechanism for nucleolar fusion is unclear. Although both cytoskeleton and the nucleolus are important cellular entities, there are no special reports on the relationship between the two. Role of cytoskeleton in regulating fusion of nucleoli was studied using the activated mouse oocyte model. Mouse oocytes were cultured for 6 h in activating medium (Ca²⁺-free CZB medium containing 10 mM SrCl₂) supplemented with or without inhibitors for cytoskeleton or protein synthesis before pronuclear formation, nucleolar fusion, and the activity of maturation-promoting factor (MPF) were examined. Whereas treatment with microfilament inhibitor cytochalasin D or B or intermediate filament inhibitor acrylamide suppressed nucleolar fusion efficiently, treatment with microtubule inhibitor demecolcine or nocodazole or protein synthesis inhibitor cycloheximide had no effect. The cytochalasin D- or acrylamide-sensitive temporal window coincided well with the reported temporal window for nucleolar fusion in activated oocytes. Whereas a continuous incubation with demecolcine prevented pronuclear formation, pronuclei formed normally when demecolcine was excluded during the first hour of activation treatment when the MPF activity dropped dramatically. The results suggest that 1) microfilaments and intermediate filaments but not microtubules support nucleolar fusion, 2) proteins required for nucleolar fusion including microfilaments and intermediate filaments are not de novo synthesized, and 3) microtubule disruption prevents pronuclear formation by activating MPF. © 2014 by the Society for the Study of Reproduction, Inc.

  16. Leaf area index uncertainty estimates for model-data fusion applications

    Science.gov (United States)

    Andrew D. Richardson; D. Bryan Dail; D.Y. Hollinger

    2011-01-01

    Estimates of data uncertainties are required to integrate different observational data streams as model constraints using model-data fusion. We describe an approach with which random and systematic uncertainties in optical measurements of leaf area index [LAI] can be quantified. We use data from a measurement campaign at the spruce-dominated Howland Forest AmeriFlux...

  17. Modeling hydrodynamic instabilities of double ablation fronts in inertial confinement fusion

    International Nuclear Information System (INIS)

    Yanez, C.; Sanz, J.; Olazabal-Loume, M.; Ibanez, L. F.

    2013-01-01

    A linear Rayleigh-Taylor instability theory of double ablation (DA) fronts is developed for direct-drive inertial confinement fusion. Two approaches are discussed: an analytical discontinuity model for the radiation dominated regime of very steep DA front structure, and a numerical self-consistent model that covers more general hydrodynamic profiles behaviours. Dispersion relation results are compared to 2D simulations. (authors)

  18. Based on BP Neural Network Stock Prediction

    Science.gov (United States)

    Liu, Xiangwei; Ma, Xin

    2012-01-01

    The stock market has a high profit and high risk features, on the stock market analysis and prediction research has been paid attention to by people. Stock price trend is a complex nonlinear function, so the price has certain predictability. This article mainly with improved BP neural network (BPNN) to set up the stock market prediction model, and…

  19. A hybrid model for coupling kinetic corrections of fusion reactivity to hydrodynamic implosion simulations

    Science.gov (United States)

    Tang, Xian-Zhu; McDevitt, C. J.; Guo, Zehua; Berk, H. L.

    2014-03-01

    Inertial confinement fusion requires an imploded target in which a central hot spot is surrounded by a cold and dense pusher. The hot spot/pusher interface can take complicated shape in three dimensions due to hydrodynamic mix. It is also a transition region where the Knudsen and inverse Knudsen layer effect can significantly modify the fusion reactivity in comparison with the commonly used value evaluated with background Maxwellians. Here, we describe a hybrid model that couples the kinetic correction of fusion reactivity to global hydrodynamic implosion simulations. The key ingredient is a non-perturbative treatment of the tail ions in the interface region where the Gamow ion Knudsen number approaches or surpasses order unity. The accuracy of the coupling scheme is controlled by the precise criteria for matching the non-perturbative kinetic model to perturbative solutions in both configuration space and velocity space.

  20. A Novel DBN Feature Fusion Model for Cross-Corpus Speech Emotion Recognition

    Directory of Open Access Journals (Sweden)

    Zou Cairong

    2016-01-01

    Full Text Available The feature fusion from separate source is the current technical difficulties of cross-corpus speech emotion recognition. The purpose of this paper is to, based on Deep Belief Nets (DBN in Deep Learning, use the emotional information hiding in speech spectrum diagram (spectrogram as image features and then implement feature fusion with the traditional emotion features. First, based on the spectrogram analysis by STB/Itti model, the new spectrogram features are extracted from the color, the brightness, and the orientation, respectively; then using two alternative DBN models they fuse the traditional and the spectrogram features, which increase the scale of the feature subset and the characterization ability of emotion. Through the experiment on ABC database and Chinese corpora, the new feature subset compared with traditional speech emotion features, the recognition result on cross-corpus, distinctly advances by 8.8%. The method proposed provides a new idea for feature fusion of emotion recognition.

  1. The effects of local insulin application to lumbar spinal fusions in a rat model.

    Science.gov (United States)

    Koerner, John D; Yalamanchili, Praveen; Munoz, William; Uko, Linda; Chaudhary, Saad B; Lin, Sheldon S; Vives, Michael J

    2013-01-01

    The rates of pseudoarthrosis after a single-level spinal fusion have been reported up to 35%, and the agents that increase the rate of fusion have an important role in decreasing pseudoarthrosis after spinal fusion. Previous studies have analyzed the effects of local insulin application to an autograft in a rat segmental defect model. Defects treated with a time-released insulin implant had significantly more new bone formation and greater quality of bone compared with controls based on histology and histomorphometry. A time-released insulin implant may have similar effects when applied in a lumbar spinal fusion model. This study analyzes the effects of a local time-released insulin implant applied to the fusion bed in a rat posterolateral lumbar spinal fusion model. Our hypothesis was twofold: first, a time-released insulin implant applied to the autograft bed in a rat posterolateral lumbar fusion will increase the rate of successful fusion and second, will alter the local environment of the fusion site by increasing the levels of local growth factors. Animal model (Institutional Animal Care and Use Committee approved) using 40 adult male Sprague-Dawley rats. Forty skeletally mature Sprague-Dawley rats weighing approximately 500 g each underwent posterolateral intertransverse lumbar fusions with iliac crest autograft from L4 to L5 using a Wiltse-type approach. After exposure of the transverse processes and high-speed burr decortication, a Linplant (Linshin Canada, Inc., ON, Canada) consisting of 95% microrecrystalized palmitic acid and 5% bovine insulin (experimental group) or a sham implant consisting of only palmitic acid (control group) was implanted on the fusion bed with iliac crest autograft. As per the manufacturer, the Linplant has a release rate of 2 U/day for a minimum of 40 days. The transverse processes and autograft beds of 10 animals from the experimental and 10 from the control group were harvested at Day 4 and analyzed for growth factors. The

  2. On the treatment of plane fusion front in lumped parameter thermal models with convection

    International Nuclear Information System (INIS)

    Le Tellier, R.; Skrzypek, E.; Saas, L.

    2017-01-01

    Highlights: • Solid phase approximations for a two-phase Stefan fusion problem with convection are analyzed. • A reference solution combines integral conservation eqs and a FE solution of the 1D heat equation. • Numerical results are presented for a transient in light water reactor severe accident analysis. • The models performances are highlighted on fusion transients in terms of Biot and Stefan numbers. - Abstract: Within the framework of lumped parameter models for integral codes, this paper focuses on the modeling of a two-phase Stefan fusion problem with natural convection in the liquid phase. In particular, this specific Stefan problem is of interest when studying corium pool behavior in the framework of light water reactor severe accident analysis. The objective of this research is to analyze the applicability of different approximations related to the modeling of the solid phase in terms of boundary heat flux closure relations. Three different approximations are considered: a quadratic profile based model, a model where a parameter controls the power partitioning at the interface and the steady state conduction assumption. These models are compared with an accurate front-tracking solution of this plane fusion front problem. This “reference” is obtained by combining the same integral conservation equations as the approximate models with a mesh-based solution of the 1D heat equation. Numerical results are discussed for a typical configuration of interest for corium pool analysis. Different fusion transients (constructed from nondimensionalization considerations in terms of Biot and Stefan numbers) are used in order to highlight the potential and limitations of the different approximations.

  3. Lumbar subtotal corpectomy non-fusion model produced using a novel prosthesis.

    Science.gov (United States)

    Liu, Jiantao; Zhang, Feng; Gao, Zhengchao; Li, Yuhuan; Niu, Binbin; He, Xijing

    2017-11-01

    In this study, we aimed to design a movable artificial lumbar complex (MALC) prosthesis for non-fusion reconstruction after lumbar subtotal corpectomy and to establish an in vitro anterolateral lumbar corpectomy non-fusion model for evaluating the biomechanical stability, preservation of segment movements and influence on adjacent inter-vertebral movements of this prosthesis. Imaging was performed on a total of 26 fresh goat lumbar spine specimens to determine which of the specimens did not meet the requirements (free of deformity and fractures); the residual specimens were randomly divided into an intact group, a fusion group and a non-fusion group. Bone mineral density (BMD) was tested and compared among the three groups. Biomechanical testing was conducted to obtain the range of motion (ROM) in flexion-extension, lateral bending at L2-3, L3-4 and L4-5 and axial rotation at L2-5 in the three groups. Two specimens were excluded due to vertebral fractures. BMD showed no statistical significance among three groups (P > 0.05). The stability of the prosthesis did not differ significantly during flexion, extension, and lateral bending at L2-3, L3-4, and L4-5 and axial torsion at L2-5 between the intact group and the non-fusion group (P > 0.05). Segment movements of the specimens in the non-fusion group revealed significantly decreased L2-3 ROM and significantly increased L3-4 and L4-5 ROM in flexion and lateral bending compared with the fusion group (P inter-vertebral spaces. However, additional studies, including in vivo animal experiments as well as biocompatibility and biomechanical tests of human body specimens are needed.

  4. Multispecies exclusion process with fusion and fission of rods: A model inspired by intraflagellar transport

    Science.gov (United States)

    Patra, Swayamshree; Chowdhury, Debashish

    2018-01-01

    We introduce a multispecies exclusion model where length-conserving probabilistic fusion and fission of the hard rods are allowed. Although all rods enter the system with the same initial length ℓ =1 , their length can keep changing, because of fusion and fission, as they move in a step-by-step manner towards the exit. Two neighboring hard rods of lengths ℓ1 and ℓ2 can fuse into a single rod of longer length ℓ =ℓ1+ℓ2 provided ℓ ≤N . Similarly, length-conserving fission of a rod of length ℓ'≤N results in two shorter daughter rods. Based on the extremum current hypothesis, we plot the phase diagram of the model under open boundary conditions utilizing the results derived for the same model under periodic boundary condition using mean-field approximation. The density profile and the flux profile of rods are in excellent agreement with computer simulations. Although the fusion and fission of the rods are motivated by similar phenomena observed in intraflagellar transport (IFT) in eukaryotic flagella, this exclusion model is too simple to account for the quantitative experimental data for any specific organism. Nevertheless, the concepts of "flux profile" and "transition zone" that emerge from the interplay of fusion and fission in this model are likely to have important implications for IFT and for other similar transport phenomena in long cell protrusions.

  5. BP180 dysfunction triggers spontaneous skin inflammation in mice.

    Science.gov (United States)

    Zhang, Yang; Hwang, Bin-Jin; Liu, Zhen; Li, Ning; Lough, Kendall; Williams, Scott E; Chen, Jinbo; Burette, Susan W; Diaz, Luis A; Su, Maureen A; Xiao, Shengxiang; Liu, Zhi

    2018-06-04

    BP180, also known as collagen XVII, is a hemidesmosomal component and plays a key role in maintaining skin dermal/epidermal adhesion. Dysfunction of BP180, either through genetic mutations in junctional epidermolysis bullosa (JEB) or autoantibody insult in bullous pemphigoid (BP), leads to subepidermal blistering accompanied by skin inflammation. However, whether BP180 is involved in skin inflammation remains unknown. To address this question, we generated a BP180-dysfunctional mouse strain and found that mice lacking functional BP180 (termed Δ NC16A ) developed spontaneous skin inflammatory disease, characterized by severe itch, defective skin barrier, infiltrating immune cells, elevated serum IgE levels, and increased expression of thymic stromal lymphopoietin (TSLP). Severe itch is independent of adaptive immunity and histamine, but dependent on increased expression of TSLP by keratinocytes. In addition, a high TSLP expression is detected in BP patients. Our data provide direct evidence showing that BP180 regulates skin inflammation independently of adaptive immunity, and BP180 dysfunction leads to a TSLP-mediated itch. The newly developed mouse strain could be a model for elucidation of disease mechanisms and development of novel therapeutic strategies for skin inflammation and BP180-related skin conditions.

  6. Disentangling unisensory from fusion effects in the attentional modulation of McGurk effects: a Bayesian modeling study suggests that fusion is attention-dependent

    DEFF Research Database (Denmark)

    Schwartz, Jean-Luc; Tiiippana, Kaisa; Andersen, Tobias

    2010-01-01

    The McGurk effect has been shown to be modulated by attention. However, it remains unclear whether attentional effects are due to changes in unisensory processing or in the fusion mechanism. In this paper, we used published experimental data showing that distraction of visual attention weakens th...... Selection criterion. Our findings suggest that distraction of visual attention affects fusion by decreasing the weight of the visual input.......The McGurk effect has been shown to be modulated by attention. However, it remains unclear whether attentional effects are due to changes in unisensory processing or in the fusion mechanism. In this paper, we used published experimental data showing that distraction of visual attention weakens...... the McGurk effect, to fit either the Fuzzy Logical Model of Perception (FLMP) in which the fusion mechanism is fixed, or a variant of it in which the fusion mechanism could be varied depending on attention. The latter model was associated with a larger likelihood when assessed with a Bayesian Model...

  7. Analyzer-based imaging of spinal fusion in an animal model

    International Nuclear Information System (INIS)

    Kelly, M E; Beavis, R C; Allen, L A; Fiorella, David; Schueltke, E; Juurlink, B H; Chapman, L D; Zhong, Z

    2008-01-01

    Analyzer-based imaging (ABI) utilizes synchrotron radiation sources to create collimated monochromatic x-rays. In addition to x-ray absorption, this technique uses refraction and scatter rejection to create images. ABI provides dramatically improved contrast over standard imaging techniques. Twenty-one adult male Wistar rats were divided into four experimental groups to undergo the following interventions: (1) non-injured control, (2) decortication alone, (3) decortication with iliac crest bone grafting and (4) decortication with iliac crest bone grafting and interspinous wiring. Surgical procedures were performed at the L5-6 level. Animals were killed at 2, 4 and 6 weeks after the intervention and the spine muscle blocks were excised. Specimens were assessed for the presence of fusion by (1) manual testing, (2) conventional absorption radiography and (3) ABI. ABI showed no evidence of bone fusion in groups 1 and 2 and showed solid or possibly solid fusion in subjects from groups 3 and 4 at 6 weeks. Metal artifacts were not present in any of the ABI images. Conventional absorption radiographs did not provide diagnostic quality imaging of either the graft material or fusion masses in any of the specimens in any of the groups. Synchrotron-based ABI represents a novel imaging technique which can be used to assess spinal fusion in a small animal model. ABI produces superior image quality when compared to conventional radiographs

  8. Analyzer-based imaging of spinal fusion in an animal model

    Science.gov (United States)

    Kelly, M. E.; Beavis, R. C.; Fiorella, David; Schültke, E.; Allen, L. A.; Juurlink, B. H.; Zhong, Z.; Chapman, L. D.

    2008-05-01

    Analyzer-based imaging (ABI) utilizes synchrotron radiation sources to create collimated monochromatic x-rays. In addition to x-ray absorption, this technique uses refraction and scatter rejection to create images. ABI provides dramatically improved contrast over standard imaging techniques. Twenty-one adult male Wistar rats were divided into four experimental groups to undergo the following interventions: (1) non-injured control, (2) decortication alone, (3) decortication with iliac crest bone grafting and (4) decortication with iliac crest bone grafting and interspinous wiring. Surgical procedures were performed at the L5-6 level. Animals were killed at 2, 4 and 6 weeks after the intervention and the spine muscle blocks were excised. Specimens were assessed for the presence of fusion by (1) manual testing, (2) conventional absorption radiography and (3) ABI. ABI showed no evidence of bone fusion in groups 1 and 2 and showed solid or possibly solid fusion in subjects from groups 3 and 4 at 6 weeks. Metal artifacts were not present in any of the ABI images. Conventional absorption radiographs did not provide diagnostic quality imaging of either the graft material or fusion masses in any of the specimens in any of the groups. Synchrotron-based ABI represents a novel imaging technique which can be used to assess spinal fusion in a small animal model. ABI produces superior image quality when compared to conventional radiographs.

  9. The Fusion Model of Intelligent Transportation Systems Based on the Urban Traffic Ontology

    Science.gov (United States)

    Yang, Wang-Dong; Wang, Tao

    On these issues unified representation of urban transport information using urban transport ontology, it defines the statute and the algebraic operations of semantic fusion in ontology level in order to achieve the fusion of urban traffic information in the semantic completeness and consistency. Thus this paper takes advantage of the semantic completeness of the ontology to build urban traffic ontology model with which we resolve the problems as ontology mergence and equivalence verification in semantic fusion of traffic information integration. Information integration in urban transport can increase the function of semantic fusion, and reduce the amount of data integration of urban traffic information as well enhance the efficiency and integrity of traffic information query for the help, through the practical application of intelligent traffic information integration platform of Changde city, the paper has practically proved that the semantic fusion based on ontology increases the effect and efficiency of the urban traffic information integration, reduces the storage quantity, and improve query efficiency and information completeness.

  10. Liquid-drop model description of heavy ion fusion at sub-barrier energies

    Energy Technology Data Exchange (ETDEWEB)

    Aguiar, C E; Barbosa, V C; Canto, L F; Donangelo, R

    1987-10-05

    The enhancement of the heavy ion fusion cross section at sub-barrier energies is studied in the liquid-drop model approach. The shape of the system is described by two spheres smoothly connected by a neck, and the kinetic and potential energies are calculated within this parametrization. Underbarrier fusion cross sections for symmetric projectile-target combinations are calculated in the WKB approximation and a comparison with the available data is made. The agreement is quite satisfactory, except for those systems in which the reaction is strongly affected by the details of the nuclear structure of the collision partners.

  11. Effect of TheraCyte-encapsulated parathyroid cells on lumbar fusion in a rat model

    OpenAIRE

    Chen, Sung-Hsiung; Huang, Shun-Chen; Lui, Chun-Chung; Lin, Tzu-Ping; Chou, Fong-Fu; Ko, Jih-Yang

    2012-01-01

    Introduction Implantation of TheraCyte 4 × 106 live parathyroid cells can increase the bone marrow density of the spine of ovariectomized rats. There has been no published study examining the effect of such implantation on spinal fusion outcomes. The purpose of this study was to examine the effect of TheraCyte-encapsulated parathyroid cells on posterolateral lumbar fusions in a rat model. Materials and methods Forty Sprague-Dawley rats underwent single-level, intertransverse process spinal fu...

  12. Short-Term Forecasting of Taiwanese Earthquakes Using a Universal Model of Fusion-Fission Processes

    NARCIS (Netherlands)

    Cheong, S.A.; Tan, T.L.; Chen, C.-C.; Chang, W.-L.; Liu, Z.; Chew, L.Y.; Sloot, P.M.A.; Johnson, N.F.

    2014-01-01

    Predicting how large an earthquake can be, where and when it will strike remains an elusive goal in spite of the ever-increasing volume of data collected by earth scientists. In this paper, we introduce a universal model of fusion-fission processes that can be used to predict earthquakes starting

  13. Beyond Knut Holt's fusion model, balancing market pull and technology push

    NARCIS (Netherlands)

    Nagel, A.P.

    2003-01-01

    Should a firm rely on market pull or on technology push? Some scholars have extreme opinions on this and firms do switch emphasis on push and pull over time. Knut Holt, the first president of ISPIM, presented his so-called Fusion Model in the early 1970s to shed light onto this debate. This paper

  14. The mechanical consequence of failure of ossified union in attempted posterior spinal fusion. A canine model.

    Science.gov (United States)

    Stonecipher, T K; Vanderby, R; Sciammarella, C A; Lei, S S; Fisk, J R

    1983-01-01

    The mechanical behavior of pseudarthrosis in posterior spinal fusion was investigated. A canine model was developed in which an incompletely ossified posterior fusion mass was consistently produced. The spines were excised, and the motion segments were mechanically tested using a specially developed loading apparatus. Tests were performed to evaluate stiffness of the segments to loading with compression, torsion, and anterioposterior and lateral bending shear stiffness. Changes in other modes of loading were less consistent. The motion characteristics of the pseudarthrosis could not be predicted from the extent of the osseous defect noted on roentgenograms. These findings correlate clinically with the progression of curvature seen with pseudarthrosis in scoliosis surgery and the unpredictable results of pseudarthrosis in posterior fusion performed in treatment of degenerative disc disease.

  15. System model for analysis of the mirror fusion-fission reactor

    International Nuclear Information System (INIS)

    Bender, D.J.; Carlson, G.A.

    1977-01-01

    This report describes a system model for the mirror fusion-fission reactor. In this model we include a reactor description as well as analyses of capital cost and blanket fuel management. In addition, we provide an economic analysis evaluating the cost of producing the two hybrid products, fissile fuel and electricity. We also furnish the results of a limited parametric analysis of the modeled reactor, illustrating the technological and economic implications of varying some important reactor design parameters

  16. Does PEEK/HA Enhance Bone Formation Compared With PEEK in a Sheep Cervical Fusion Model?

    Science.gov (United States)

    Walsh, William R; Pelletier, Matthew H; Bertollo, Nicky; Christou, Chris; Tan, Chris

    2016-11-01

    Polyetheretherketone (PEEK) has a wide range of clinical applications but does not directly bond to bone. Bulk incorporation of osteoconductive materials including hydroxyapatite (HA) into the PEEK matrix is a potential solution to address the formation of a fibrous tissue layer between PEEK and bone and has not been tested. Using in vivo ovine animal models, we asked: (1) Does PEEK-HA improve cortical and cancellous bone ongrowth compared with PEEK? (2) Does PEEK-HA improve bone ongrowth and fusion outcome in a more challenging functional ovine cervical fusion model? The in vivo responses of PEEK-HA Enhanced and PEEK-OPTIMA ® Natural were evaluated for bone ongrowth in the form of dowels implanted in the cancellous and cortical bone of adult sheep and examined at 4 and 12 weeks as well as interbody cervical fusion at 6, 12, and 26 weeks. The bone-implant interface was evaluated with radiographic and histologic endpoints for a qualitative assessment of direct bone contact of an intervening fibrous tissue later. Gamma-irradiated cortical allograft cages were evaluated as well. Incorporating HA into the PEEK matrix resulted in more direct bone apposition as opposed to the fibrous tissue interface with PEEK alone in the bone ongrowth as well as interbody cervical fusions. No adverse reactions were found at the implant-bone interface for either material. Radiography and histology revealed resorption and fracture of the allograft devices in vivo. Incorporating HA into PEEK provides a more favorable environment than PEEK alone for bone ongrowth. Cervical fusion was improved with PEEK-HA compared with PEEK alone as well as allograft bone interbody devices. Improving the bone-implant interface with a PEEK device by incorporating HA may improve interbody fusion results and requires further clinical studies.

  17. Integrating models with data in ecology and palaeoecology: advances towards a model-data fusion approach.

    Science.gov (United States)

    Peng, Changhui; Guiot, Joel; Wu, Haibin; Jiang, Hong; Luo, Yiqi

    2011-05-01

    It is increasingly being recognized that global ecological research requires novel methods and strategies in which to combine process-based ecological models and data in cohesive, systematic ways. Model-data fusion (MDF) is an emerging area of research in ecology and palaeoecology. It provides a new quantitative approach that offers a high level of empirical constraint over model predictions based on observations using inverse modelling and data assimilation (DA) techniques. Increasing demands to integrate model and data methods in the past decade has led to MDF utilization in palaeoecology, ecology and earth system sciences. This paper reviews key features and principles of MDF and highlights different approaches with regards to DA. After providing a critical evaluation of the numerous benefits of MDF and its current applications in palaeoecology (i.e., palaeoclimatic reconstruction, palaeovegetation and palaeocarbon storage) and ecology (i.e. parameter and uncertainty estimation, model error identification, remote sensing and ecological forecasting), the paper discusses method limitations, current challenges and future research direction. In the ongoing data-rich era of today's world, MDF could become an important diagnostic and prognostic tool in which to improve our understanding of ecological processes while testing ecological theory and hypotheses and forecasting changes in ecosystem structure, function and services. © 2011 Blackwell Publishing Ltd/CNRS.

  18. Research on Degeneration Model of Neural Network for Deep Groove Ball Bearing Based on Feature Fusion

    Directory of Open Access Journals (Sweden)

    Lijun Zhang

    2018-02-01

    Full Text Available Aiming at the pitting fault of deep groove ball bearing during service, this paper uses the vibration signal of five different states of deep groove ball bearing and extracts the relevant features, then uses a neural network to model the degradation for identifying and classifying the fault type. By comparing the effects of training samples with different capacities through performance indexes such as the accuracy and convergence speed, it is proven that an increase in the sample size can improve the performance of the model. Based on the polynomial fitting principle and Pearson correlation coefficient, fusion features based on the skewness index are proposed, and the performance improvement of the model after incorporating the fusion features is also validated. A comparison of the performance of the support vector machine (SVM model and the neural network model on this dataset is given. The research shows that neural networks have more potential for complex and high-volume datasets.

  19. Summary of human social, cultural, behavioral (HSCB) modeling for information fusion panel discussion

    Science.gov (United States)

    Blasch, Erik; Salerno, John; Kadar, Ivan; Yang, Shanchieh J.; Fenstermacher, Laurie; Endsley, Mica; Grewe, Lynne

    2013-05-01

    During the SPIE 2012 conference, panelists convened to discuss "Real world issues and challenges in Human Social/Cultural/Behavioral modeling with Applications to Information Fusion." Each panelist presented their current trends and issues. The panel had agreement on advanced situation modeling, working with users for situation awareness and sense-making, and HSCB context modeling in focusing research activities. Each panelist added different perspectives based on the domain of interest such as physical, cyber, and social attacks from which estimates and projections can be forecasted. Also, additional techniques were addressed such as interest graphs, network modeling, and variable length Markov Models. This paper summarizes the panelists discussions to highlight the common themes and the related contrasting approaches to the domains in which HSCB applies to information fusion applications.

  20. A system dynamics model for stock and flow of tritium in fusion power plant

    Energy Technology Data Exchange (ETDEWEB)

    Kasada, Ryuta, E-mail: r-kasada@iae.kyoto-u.ac.jp [Institute of Advanced Energy, Kyoto University, Gokasho, Uji, Kyoto 611-0011 (Japan); Kwon, Saerom [Institute of Advanced Energy, Kyoto University, Gokasho, Uji, Kyoto 611-0011 (Japan); Japan Atomic Energy Agency, Tokai-mura, Naka-gun, Ibaraki-ken 319-1195 (Japan); Konishi, Satoshi [Institute of Advanced Energy, Kyoto University, Gokasho, Uji, Kyoto 611-0011 (Japan); Sakamoto, Yoshiteru; Yamanishi, Toshihiko; Tobita, Kenji [Japan Atomic Energy Agency, Rokkasho-mura, Kamikita-gun, Aomori-ken 039-3212 (Japan)

    2015-10-15

    Highlights: • System dynamics model of tritium fuel cycle was developed for analyzing stock and flow of tritium in fusion power plants. • Sensitivity of tritium build-up to breeding ratio parameters has been assessed to two plant concepts having 3 GW and 1.5 GW fusion power. • D-D start-up absolutely without initial loading of tritium is possible for both of the 3 GW and 1.5 GW fusion power plant concepts. • Excess stock of tritium is generated by the steady state operation with the value of tritium breeding ratio over unity. - Abstract: In order to analyze self-efficiency of tritium fuel cycle (TFC) and share the systems thinking of TFC among researchers and engineers in the vast area of fusion reactor technology, we develop a system dynamics (SD) TFC model using a commercial software STELLA. The SD-TFC model is illustrated as a pipe diagram which consists of tritium stocks, such as plasma, fuel clean up, isotope separation, fueling with storage and blanket, and pipes connecting among them. By using this model, we survey a possibility of D-D start-up without initial loading of tritium on two kinds of fusion plant having different plasma parameters. The D-D start-up scenario can reduce the necessity of initial loading of tritium through the production in plasma by D-D reaction and in breeding blanket by D-D neutron. The model is also used for considering operation scenario to avoid excess stock of tritium which must be produced at tritium breeding ratio over unity.

  1. Graph-based Data Modeling and Analysis for Data Fusion in Remote Sensing

    Science.gov (United States)

    Fan, Lei

    ., fusion of multi-source data can in principal produce more detailed information than each single source. On the other hand, besides the abundant spectral information contained in HSI data, features such as texture and shape may be employed to represent data points from a spatial perspective. Furthermore, feature fusion also includes the strategy of removing redundant and noisy features in the dataset. One of the major problems in machine learning and pattern recognition is to develop appropriate representations for complex nonlinear data. In HSI processing, a particular data point is usually described as a vector with coordinates corresponding to the intensities measured in the spectral bands. This vector representation permits the application of linear and nonlinear transformations with linear algebra to find an alternative representation of the data. More generally, HSI is multi-dimensional in nature and the vector representation may lose the contextual correlations. Tensor representation provides a more sophisticated modeling technique and a higher-order generalization to linear subspace analysis. In graph theory, data points can be generalized as nodes with connectivities measured from the proximity of a local neighborhood. The graph-based framework efficiently characterizes the relationships among the data and allows for convenient mathematical manipulation in many applications, such as data clustering, feature extraction, feature selection and data alignment. In this thesis, graph-based approaches applied in the field of multi-source feature and data fusion in remote sensing area are explored. We will mainly investigate the fusion of spatial, spectral and LiDAR information with linear and multilinear algebra under graph-based framework for data clustering and classification problems.

  2. Modeling space charge in beams for heavy-ion fusion

    International Nuclear Information System (INIS)

    Sharp, W.M.

    1995-01-01

    A new analytic model is presented which accurately estimates the radially averaged axial component of the space-charge field of an axisymmetric heavy-ion beam in a cylindrical beam pipe. The model recovers details of the field near the beam ends that are overlooked by simpler models, and the results compare well to exact solutions of Poisson's equation. Field values are shown for several simple beam profiles and are compared with values obtained from simpler models

  3. Effect of TheraCyte-encapsulated parathyroid cells on lumbar fusion in a rat model.

    Science.gov (United States)

    Chen, Sung-Hsiung; Huang, Shun-Chen; Lui, Chun-Chung; Lin, Tzu-Ping; Chou, Fong-Fu; Ko, Jih-Yang

    2012-09-01

    Implantation of TheraCyte 4 × 10(6) live parathyroid cells can increase the bone marrow density of the spine of ovariectomized rats. There has been no published study examining the effect of such implantation on spinal fusion outcomes. The purpose of this study was to examine the effect of TheraCyte-encapsulated parathyroid cells on posterolateral lumbar fusions in a rat model. Forty Sprague-Dawley rats underwent single-level, intertransverse process spinal fusions using iliac crest autograft. The rats were randomly assigned to two groups: Group 1 rats received sham operations on their necks (control; N = 20); Group 2 rats were implanted with TheraCyte-encapsulated 4 × 10(6) live parathyroid cells into the subcutis of their necks (TheraCyte; N = 20). Six weeks after surgery the rats were killed. Fusion was assessed by inspection, manual palpation, radiography, and histology. Blood was drawn to measure the serum levels of calcium, phosphorus, and intact parathyroid hormone (iPTH). Based on manual palpation, the control group had a fusion rate of 33 % (6/18) and the TheraCyte group had a fusion rate of 72 % (13/18) (P = 0.044). Histology confirmed the manual palpation results. Serum iPTH levels were significantly higher in the TheraCyte group compared with the control group (P TheraCyte-encapsulated 4 × 10(6) live parathyroid cells than in control rats without significant change in serum calcium or phosphorus concentrations. As with any animal study, the results may not extrapolate to a higher species. Further studies are needed to determine if these effects are clinically significant.

  4. Integrable anyon chains: From fusion rules to face models to effective field theories

    International Nuclear Information System (INIS)

    Finch, Peter E.; Flohr, Michael; Frahm, Holger

    2014-01-01

    Starting from the fusion rules for the algebra SO(5) 2 we construct one-dimensional lattice models of interacting anyons with commuting transfer matrices of ‘interactions round the face’ (IRF) type. The conserved topological charges of the anyon chain are recovered from the transfer matrices in the limit of large spectral parameter. The properties of the models in the thermodynamic limit and the low energy excitations are studied using Bethe ansatz methods. Two of the anyon models are critical at zero temperature. From the analysis of the finite size spectrum we find that they are effectively described by rational conformal field theories invariant under extensions of the Virasoro algebra, namely WB 2 and WD 5 , respectively. The latter contains primaries with half and quarter spin. The modular partition function and fusion rules are derived and found to be consistent with the results for the lattice model

  5. Android Application Model of “Suami Siaga Plus” as an Innovation in Birth Preparedness and Complication Readiness (BP/CR Intervention

    Directory of Open Access Journals (Sweden)

    Hanna Yuanita Dana Santoso

    2017-08-01

    Full Text Available Objective: WHO recommends Mobile health, a practice of medicine and public health supported by mobile devices, to improve community health status and change people's behavior for the health purposes. The present study sought to examine the effectiveness of the android application program of Suami Siaga Plus in increasing husband’s scores in birth preparedness and complication readiness (BP/CR intervention.Materials and methods: It was a randomized controlled trial with pretest-posttest design. A total of 38 couples of husbands and pregnant women from three health centers at three sub districts in Semarang was selected by proportional systematic random sampling technique and equally distributed into control and intervention group. A questionnaire related to BP/CR published by JHPIEGO was employed in data collection. Statistical analysis was performed to obtain the frequency distribution and percentage of the variables, and also to assess the mean difference of BP/CR score of husbands.Results: Husbands’ knowledge of key danger signs and five standard elements in BP/CR practices in both intervention and control group increased after counseling. Moreover, the proportion of husbands who understand the key danger signs during pregnancy was higher among those who were exposed by Suami Siaga Plus application delivered via mobile phone. Counseling only increased husbands’ score from 61.5 to 62.6 (2%, whilst the combination of counseling and the application boosted 20% of husbands’ score from 60.4 to 72.9 (p-value 0.000.Conclusion: A combination of counseling and Suami Siaga Plus application significantly improves husbands and wives’ score on BP/CR compared to those who received counseling only. The data suggests the application would be able to suppress the three delays, which in turn can reduce the maternal mortality rate. The study results could be important information for the Department of Health and health professionals to use android

  6. Feature Fusion Based Audio-Visual Speaker Identification Using Hidden Markov Model under Different Lighting Variations

    Directory of Open Access Journals (Sweden)

    Md. Rabiul Islam

    2014-01-01

    Full Text Available The aim of the paper is to propose a feature fusion based Audio-Visual Speaker Identification (AVSI system with varied conditions of illumination environments. Among the different fusion strategies, feature level fusion has been used for the proposed AVSI system where Hidden Markov Model (HMM is used for learning and classification. Since the feature set contains richer information about the raw biometric data than any other levels, integration at feature level is expected to provide better authentication results. In this paper, both Mel Frequency Cepstral Coefficients (MFCCs and Linear Prediction Cepstral Coefficients (LPCCs are combined to get the audio feature vectors and Active Shape Model (ASM based appearance and shape facial features are concatenated to take the visual feature vectors. These combined audio and visual features are used for the feature-fusion. To reduce the dimension of the audio and visual feature vectors, Principal Component Analysis (PCA method is used. The VALID audio-visual database is used to measure the performance of the proposed system where four different illumination levels of lighting conditions are considered. Experimental results focus on the significance of the proposed audio-visual speaker identification system with various combinations of audio and visual features.

  7. Computer Aided Multi-Data Fusion Dismount Modeling

    Science.gov (United States)

    2012-03-22

    dependent on a particular environmental condition. They are costly, cumbersome, and involve dedicated software practices and particular knowledge to operate...allow manipulation of 2D matrices, like Microsoft Excel or Libre Office. The second alternative is to modify an already created model (MEM). The model... software . Therefore, with the described computer aided multi-data dismount model the researcher will be able to attach signatures to any desired

  8. Numerical modelling of laser rapid prototyping by fusion wire deposit

    OpenAIRE

    Arbaoui , Larbi; Masse , J.E.; Barrallier , Laurent; Mocellin , Katia

    2010-01-01

    International audience; A finite element model has been developed to simulate an innovative laser rapid prototyping process. Several numerical developments have been implemented in order to simulate the main steps of the rapid prototyping process: injection, heating, phase change and deposit. The numerical model also takes into account different phenomena: surface tension in the liquid state, asborptivity and plasma effects during materiallaser interaction. The threedimensional model is based...

  9. Particle simulation models and their application to controlled fusion

    International Nuclear Information System (INIS)

    Okuda, H.

    1977-01-01

    Plasma simulation models using particles are described which have been developed for studying the microscopic behavior of a confined plasma in a magnetic field. The first model is developed to investigate the anomalous diffusion of particles and energy due to low-frequency electrostatic microinstabilities in cylindrical and toroidal systems. The model makes use of the combination of eigenfunction expansion in one direction and the multipole expansion on a two-dimensional spatial grid for solving the Maxwell equations and for pushing particles. The second model is developed to study the neutral beam injection heating of a tokamak plasma taking into account the spatial variation of plasma parameters and the finite ion beam banana orbit. The self-consistent electric and magnetic fields are totally ignored in this model and the Fokker-Planck collisions on the beam ions due to background ions and electrons are built in through the Monte Carlo method

  10. A Feature Fusion Based Forecasting Model for Financial Time Series

    Science.gov (United States)

    Guo, Zhiqiang; Wang, Huaiqing; Liu, Quan; Yang, Jie

    2014-01-01

    Predicting the stock market has become an increasingly interesting research area for both researchers and investors, and many prediction models have been proposed. In these models, feature selection techniques are used to pre-process the raw data and remove noise. In this paper, a prediction model is constructed to forecast stock market behavior with the aid of independent component analysis, canonical correlation analysis, and a support vector machine. First, two types of features are extracted from the historical closing prices and 39 technical variables obtained by independent component analysis. Second, a canonical correlation analysis method is utilized to combine the two types of features and extract intrinsic features to improve the performance of the prediction model. Finally, a support vector machine is applied to forecast the next day's closing price. The proposed model is applied to the Shanghai stock market index and the Dow Jones index, and experimental results show that the proposed model performs better in the area of prediction than other two similar models. PMID:24971455

  11. Systems Modeling For The Laser Fusion-Fission Energy (LIFE) Power Plant

    International Nuclear Information System (INIS)

    Meier, W.R.; Abbott, R.; Beach, R.; Blink, J.; Caird, J.; Erlandson, A.; Farmer, J.; Halsey, W.; Ladran, T.; Latkowski, J.; MacIntyre, A.; Miles, R.; Storm, E.

    2008-01-01

    A systems model has been developed for the Laser Inertial Fusion-Fission Energy (LIFE) power plant. It combines cost-performance scaling models for the major subsystems of the plant including the laser, inertial fusion target factory, engine (i.e., the chamber including the fission and tritium breeding blankets), energy conversion systems and balance of plant. The LIFE plant model is being used to evaluate design trade-offs and to identify high-leverage R and D. At this point, we are focused more on doing self consistent design trades and optimization as opposed to trying to predict a cost of electricity with a high degree of certainty. Key results show the advantage of large scale (>1000 MWe) plants and the importance of minimizing the cost of diodes and balance of plant cost

  12. Peaceful fusion

    Energy Technology Data Exchange (ETDEWEB)

    Englert, Matthias [IANUS, TU Darmstadt (Germany)

    2014-07-01

    Like other intense neutron sources fusion reactors have in principle a potential to be used for military purposes. Although the use of fissile material is usually not considered when thinking of fusion reactors (except in fusion-fission hybrid concepts) quantitative estimates about the possible production potential of future commercial fusion reactor concepts show that significant amounts of weapon grade fissile materials could be produced even with very limited amounts of source materials. In this talk detailed burnup calculations with VESTA and MCMATH using an MCNP model of the PPCS-A will be presented. We compare different irradiation positions and the isotopic vectors of the plutonium bred in different blankets of the reactor wall with the liquid lead-lithium alloy replaced by uranium. The technical, regulatory and policy challenges to manage the proliferation risks of fusion power will be addressed as well. Some of these challenges would benefit if addressed at an early stage of the research and development process. Hence, research on fusion reactor safeguards should start as early as possible and accompany the current research on experimental fusion reactors.

  13. Studies on nuclear fusion energy potential based on a long-term world energy and environment model

    International Nuclear Information System (INIS)

    Tokimatsu, K.; Fujino, J.; Asaoka, Y.

    2001-01-01

    This study investigates introduction conditions and potential of nuclear fusion energy as energy supply and CO 2 mitigation technologies in the 21st century. Time horizon of the 21st century, 10 regionally allocated world energy/environment model (Linearized Dynamic New Earth 21) is used for this study. Following nuclear fusion technological data are taken into consideration: cost of electricity (COE) in nuclear fusion introduction year, annual COE reduction rates, regional introduction year, and maximum regional plant capacity constraints by maximum plant construction speed. We made simulation under a constraint of atmospheric CO 2 concentration of 550 parts per million by volume (ppmv) targeted at year 2100, assuming that sequestration technologies and unknown innovative technologies for CO 2 reduction are available. The results indicate that under the 550ppm scenario with nuclear fusion within maximum construction speed, 66mill/kWh is required for introducing nuclear fusion in 2050, 92 mill/kWh in 2060, and 106 mill/kWh in 2070. Therefore, tokamak type nuclear fusion reactors of present several reactor cost estimates are expected to be introduced between 2060 and 2070, and electricity generation fraction by nuclear fusion will go around 20% in 2100 if nuclear fusion energy growth is limited only by the maximum construction speed. CO 2 reduction by nuclear fusion introduced in 2050 from business-as-usual (BAU) scenario without nuclear fusion is about 20% of total reduction amount in 2100. In conclusion, nuclear fusion energy is revealed to be one of the candidates of energy supply technologies and CO 2 mitigation technologies. Cost competitiveness and removal of capacity constraint factors are desired for use of nuclear fusion energy in a large scale. (author)

  14. Geometric and Colour Data Fusion for Outdoor 3D Models

    Directory of Open Access Journals (Sweden)

    Ricardo Chacón

    2012-05-01

    Full Text Available This paper deals with the generation of accurate, dense and coloured 3D models of outdoor scenarios from scanners. This is a challenging research field in which several problems still remain unsolved. In particular, the process of 3D model creation in outdoor scenes may be inefficient if the scene is digitalized under unsuitable technical (specific scanner on-board camera and environmental (rain, dampness, changing illumination conditions. We address our research towards the integration of images and range data to produce photorealistic models. Our proposal is based on decoupling the colour integration and geometry reconstruction stages, making them independent and controlled processes. This issue is approached from two different viewpoints. On the one hand, given a complete model (geometry plus texture, we propose a method to modify the original texture provided by the scanner on-board camera with the colour information extracted from external images taken at given moments and under specific environmental conditions. On the other hand, we propose an algorithm to directly assign external images onto the complete geometric model, thus avoiding tedious on-line calibration processes. We present the work conducted on two large Roman archaeological sites dating from the first century A.D., namely, the Theatre of Segobriga and the Fori Porticus of Emerita Augusta, both in Spain. The results obtained demonstrate that our approach could be useful in the digitalization and 3D modelling fields.

  15. Computational Model of Secondary Palate Fusion and Disruption

    Science.gov (United States)

    Morphogenetic events are driven by cell-generated physical forces and complex cellular dynamics. To improve our capacity to predict developmental effects from cellular alterations, we built a multi-cellular agent-based model in CompuCell3D that recapitulates the cellular networks...

  16. Dose estimation models for environmental tritium released from fusion facilities

    International Nuclear Information System (INIS)

    Murata, Mikio

    1993-01-01

    Various mathematical models are being developed to predict the behavior of HT released to the natural environment and their consequent impact. This report outlines models and the major findings of HT field release studies in France and Canada. The models are constructed to incorporate the key processes thought to be responsible for the formation of atmospheric HTO from a release of HT. It has been established from the experiments that HT oxidized in surface soil is incorporated almost entirely into soil water as HTO. This tritium may be reemitted to the atmosphere in the form of HTO through exchange of soil and atmospheric moisture as well as through the bulk water mass flux from the soil the atmosphere due to evaporation and transpiration. The direct conversion of HT to HTO in air and direct uptake of HT by vegetation are expected to be negligible for the time and space scales of interest in considering short duration releases. HTO emitted to the atmosphere is can further exchange with soil and vegetation water. Validation of these models against experimental data is conducted to demonstrate their credibility. It may be concluded that further laboratory and field works are needed in order to develop a sufficiently good understanding of the dependence of the key processes on environmental factors (including diurnal cycling and seasonality) to allow the rates of the processes to be predicted from a knowledge of environmental conditions. (author)

  17. Semiparametric copula models for biometric score level fusion

    NARCIS (Netherlands)

    Susyanto, N.

    2016-01-01

    In biometric recognition, biometric samples (images of faces, fingerprints, voices, gaits, etc.) of people are compared and matchers (classifiers) indicate the level of similarity between any pair of samples by a score. If we model the joint distribution of all scores by a (semiparametric) Gaussian

  18. Assessing tropical rainforest growth traits: Data - Model fusion in the Congo basin and beyond

    Science.gov (United States)

    Pietsch, Stephan

    2017-04-01

    Virgin forest ecosystems resemble the key reference level for natural tree growth dynamics. The mosaic cycle concept describes such dynamics as local disequilibria driven by patch level succession cycles of breakdown, regeneration, juvenescence and old growth. These cycles, however, may involve different traits of light demanding and shade tolerant species assemblies. In this work a data model fusion concept will be introduced to assess the differences in growth dynamics of the mosaic cycle of the Western Congolian Lowland Rainforest ecosystem. Field data from 34 forest patches located in an ice age forest refuge, recently pinpointed to the ground and still devoid of direct human impact up to today - resemble the data base. A 3D error assessment procedure versus BGC model simulations for the 34 patches revealed two different growth dynamics, consistent with observed growth traits of pioneer and late succession species assemblies of the Western Congolian Lowland rainforest. An application of the same procedure to Central American Pacific rainforests confirms the strength of the 3D error field data model fusion concept to Central American Pacific rainforests confirms the strength of the 3D error field data model fusion concept to assess different growth traits of the mosaic cycle of natural forest dynamics.

  19. Nonlinearity of the forward-backward correlation function in the model with string fusion

    Science.gov (United States)

    Vechernin, Vladimir

    2017-12-01

    The behavior of the forward-backward correlation functions and the corresponding correlation coefficients between multiplicities and transverse momenta of particles produced in high energy hadronic interactions is analyzed by analytical and MC calculations in the models with and without string fusion. The string fusion is taking into account in simplified form by introducing the lattice in the transverse plane. The results obtained with two alternative definitions of the forward-backward correlation coefficient are compared. It is shown that the nonlinearity of correlation functions increases with the width of observation windows, leading at small string density to a strong dependence of correlation coefficient value on the definition. The results of the modeling enable qualitatively to explain the experimentally observed features in the behavior of the correlation functions between multiplicities and mean transverse momenta at small and large multiplicities.

  20. Organotypic three-dimensional culture model of mesenchymal and epithelial cells to examine tissue fusion events.

    Science.gov (United States)

    Tissue fusion during early mammalian development requires coordination of multiple cell types, the extracellular matrix, and complex signaling pathways. Fusion events during processes including heart development, neural tube closure, and palatal fusion are dependent on signaling ...

  1. A three-bar model for ratcheting of fusion reactor first wall

    International Nuclear Information System (INIS)

    Wolters, J.; Majumdar, S.

    1994-12-01

    First wall structures of fusion reactors are subjected to cyclic bending stresses caused by inhomogeneous temperature distribution during plasma burn cycles and by electromagnetically induced impact loads during plasma disruptions. Such a combination of loading can potentially lead to ratcheting or incremental accumulation of plastic strain with cycles. An elastic-plastic three-bar model is developed to investigate the ratcheting behavior of the first wall

  2. First wall thermal hydraulic models for fusion blankets

    International Nuclear Information System (INIS)

    Fillo, J.A.

    1980-01-01

    Subject to normal and off-normal reactor conditions, thermal hydraulic models of first walls, e.g., a thermal mass barrier, a tubular shield, and a radiating liner are reviewed. Under normal operation the plasma behaves as expected in a predicted way for transient and steady-state conditions. The most severe thermal loading on the first wall occurs when the plasma becomes unstable and dumps its energy on the wall in a very short period of time (milliseconds). Depending on the plasma dump time and area over which the energy is deposited may result in melting of the first wall surface, and if the temperature is high enough, vaporization

  3. A unified model of density limit in fusion plasmas

    Science.gov (United States)

    Zanca, P.; Sattin, F.; Escande, D. F.; Pucella, G.; Tudisco, O.

    2017-05-01

    In this work we identify by analytical and numerical means the conditions for the existence of a magnetic and thermal equilibrium of a cylindrical plasma, in the presence of Ohmic and/or additional power sources, heat conduction and radiation losses by light impurities. The boundary defining the solutions’ space having realistic temperature profile with small edge value takes mathematically the form of a density limit (DL). Compared to previous similar analyses the present work benefits from dealing with a more accurate set of equations. This refinement is elementary, but decisive, since it discloses a tenuous dependence of the DL on the thermal transport for configurations with an applied electric field. Thanks to this property, the DL scaling law is recovered almost identical for two largely different devices such as the ohmic tokamak and the reversed field pinch. In particular, they have in common a Greenwald scaling, linearly depending on the plasma current, quantitatively consistent with experimental results. In the tokamak case the DL dependence on any additional heating approximately follows a 0.5 power law, which is compatible with L-mode experiments. For a purely externally heated configuration, taken as a cylindrical approximation of the stellarator, the DL dependence on transport is found stronger. By adopting suitable transport models, DL takes on a Sudo-like form, in fair agreement with LHD experiments. Overall, the model provides a good zeroth-order quantitative description of the DL, applicable to widely different configurations.

  4. Music genre classification via likelihood fusion from multiple feature models

    Science.gov (United States)

    Shiu, Yu; Kuo, C.-C. J.

    2005-01-01

    Music genre provides an efficient way to index songs in a music database, and can be used as an effective means to retrieval music of a similar type, i.e. content-based music retrieval. A new two-stage scheme for music genre classification is proposed in this work. At the first stage, we examine a couple of different features, construct their corresponding parametric models (e.g. GMM and HMM) and compute their likelihood functions to yield soft classification results. In particular, the timbre, rhythm and temporal variation features are considered. Then, at the second stage, these soft classification results are integrated to result in a hard decision for final music genre classification. Experimental results are given to demonstrate the performance of the proposed scheme.

  5. Comparative study of cost models for tokamak DEMO fusion reactors

    International Nuclear Information System (INIS)

    Oishi, Tetsutarou; Yamazaki, Kozo; Arimoto, Hideki; Ban, Kanae; Kondo, Takuya; Tobita, Kenji; Goto, Takuya

    2012-01-01

    Cost evaluation analysis of the tokamak-type demonstration reactor DEMO using the PEC (physics-engineering-cost) system code is underway to establish a cost evaluation model for the DEMO reactor design. As a reference case, a DEMO reactor with reference to the SSTR (steady state tokamak reactor) was designed using PEC code. The calculated total capital cost was in the same order of that proposed previously in cost evaluation studies for the SSTR. Design parameter scanning analysis and multi regression analysis illustrated the effect of parameters on the total capital cost. The capital cost was predicted to be inside the range of several thousands of M$s in this study. (author)

  6. Comparison and analysis of 1D/2D/3D neutronics modeling for a fusion reactor

    International Nuclear Information System (INIS)

    Li, J.; Zeng, Q.; Chen, M.; Jiang, J.; Wu, Y.

    2007-01-01

    During the course of analyzing the characteristics for fusion reactors, the refined calculations are needed to confirm that the nuclear design requirements are met. Since the long computational time is consumed, the refined three-dimensional (3D) representation has been used primarily for establishing the baseline reference values, analyzing problems which cannot be reduced by symmetry considerations to lower dimensions, or where a high level of accuracy is desired locally. The two-dimensional (2D) or one-dimensional (1D) description leads itself readily to resolve many problems, such as the studies for the material fraction optimization, or for the blanket size optimization. The purpose of this paper is to find out the differences among different geometric descriptions, which can guide the way to approximate and simplify the computational model. The fusion power reactor named FDS-II was designed as an advanced fusion power reactor to demonstrate and validate the commercialization of fusion power by Institute of Plasma Physics, Chinese Academy of Science. In this contribution, the dual-cooled lithium lead (DLL) blanket of FDS-II was used as a reference for neutronics comparisons and analyses. The geometric descriptions include 1D concentric sphere model, 1D, 2D and 3D cylinder models. The home-developed multi-functional neutronics analysis code system VisualBUS, the Monte Carlo transport code MCNP and nuclear data library HENDL have been used for these analyses. The neutron wall loading distribution, tritium breeding ratio (TBR) and nuclear heat were calculated to evaluate the nuclear performance. The 3D calculation has been used as a comparison reference because it has the least errors in the treatment of geometry. It is suggested that the value of TBR calculated by the 1D approach should be greater than 1.3 to satisfy the practical need of tritium self-sufficiency. The distribution of nuclear heat based on the 2D and 3D models were similar since they all consider

  7. Concerning the modelling of systems in terms of Quantum Electrodynamics: the special case of 'Cold Fusion'

    International Nuclear Information System (INIS)

    Abyaneh, Morteza; Fleischmann, Martin; Del Giudice, Emilio; Vitiello, Giuseppe

    2006-01-01

    A question we are asked repeatedly is: 'what are the causes of the opposition to your belief in the reality of 'Cold Fusion?'. This question is normally asked in the context of the statement that Quantum Mechanics shows that this phenomenon is impossible (a view that we share). Our answer is always based on the statement 'but what about the modelling of such systems in terms of QED?' which is always met by the insistence that Quantum Mechanics shows that Cold Fusion is impossible. We conclude that scientists do not understand QED or, if they have some understanding of this subject, then this must be subject to some major misconceptions. This pointless dialogue (perhaps more correctly described as two monologues conducted in parallel) and the insistence on the primacy of Quantum Mechanics in the modelling of systems in the Natural Sciences is unfortunate because it obscures the outcome of the investigations in the more normal fields of the Natural Sciences (more normal than Cold Fusion). A brief outline of the work which has led to the formulation of the concept of coherence will therefore be given under the aegis of the revolutions in our understanding of the Natural Sciences which has taken place since the latter part of the 19. Century. The main illustration of the way we can demonstrate the applicability of these concepts will be based on the study of nucleation and phase growth. The development of micro-electrode substrates allows us to study the statistics of the formation of the first nucleus; it will be shown that these statistics are strictly in line with concepts developed from QED coherence. We conclude that QED coherence is not just a concept to be confined to sub-atomic physics, cosmology etc. but that it pervades the modelling of the whole of the Natural Sciences including that of 'Cold Fusion'. Some of the major steps which have taken place in the development of this subject area will be illustrated

  8. A DNA-based semantic fusion model for remote sensing data.

    Directory of Open Access Journals (Sweden)

    Heng Sun

    Full Text Available Semantic technology plays a key role in various domains, from conversation understanding to algorithm analysis. As the most efficient semantic tool, ontology can represent, process and manage the widespread knowledge. Nowadays, many researchers use ontology to collect and organize data's semantic information in order to maximize research productivity. In this paper, we firstly describe our work on the development of a remote sensing data ontology, with a primary focus on semantic fusion-driven research for big data. Our ontology is made up of 1,264 concepts and 2,030 semantic relationships. However, the growth of big data is straining the capacities of current semantic fusion and reasoning practices. Considering the massive parallelism of DNA strands, we propose a novel DNA-based semantic fusion model. In this model, a parallel strategy is developed to encode the semantic information in DNA for a large volume of remote sensing data. The semantic information is read in a parallel and bit-wise manner and an individual bit is converted to a base. By doing so, a considerable amount of conversion time can be saved, i.e., the cluster-based multi-processes program can reduce the conversion time from 81,536 seconds to 4,937 seconds for 4.34 GB source data files. Moreover, the size of result file recording DNA sequences is 54.51 GB for parallel C program compared with 57.89 GB for sequential Perl. This shows that our parallel method can also reduce the DNA synthesis cost. In addition, data types are encoded in our model, which is a basis for building type system in our future DNA computer. Finally, we describe theoretically an algorithm for DNA-based semantic fusion. This algorithm enables the process of integration of the knowledge from disparate remote sensing data sources into a consistent, accurate, and complete representation. This process depends solely on ligation reaction and screening operations instead of the ontology.

  9. A DNA-based semantic fusion model for remote sensing data.

    Science.gov (United States)

    Sun, Heng; Weng, Jian; Yu, Guangchuang; Massawe, Richard H

    2013-01-01

    Semantic technology plays a key role in various domains, from conversation understanding to algorithm analysis. As the most efficient semantic tool, ontology can represent, process and manage the widespread knowledge. Nowadays, many researchers use ontology to collect and organize data's semantic information in order to maximize research productivity. In this paper, we firstly describe our work on the development of a remote sensing data ontology, with a primary focus on semantic fusion-driven research for big data. Our ontology is made up of 1,264 concepts and 2,030 semantic relationships. However, the growth of big data is straining the capacities of current semantic fusion and reasoning practices. Considering the massive parallelism of DNA strands, we propose a novel DNA-based semantic fusion model. In this model, a parallel strategy is developed to encode the semantic information in DNA for a large volume of remote sensing data. The semantic information is read in a parallel and bit-wise manner and an individual bit is converted to a base. By doing so, a considerable amount of conversion time can be saved, i.e., the cluster-based multi-processes program can reduce the conversion time from 81,536 seconds to 4,937 seconds for 4.34 GB source data files. Moreover, the size of result file recording DNA sequences is 54.51 GB for parallel C program compared with 57.89 GB for sequential Perl. This shows that our parallel method can also reduce the DNA synthesis cost. In addition, data types are encoded in our model, which is a basis for building type system in our future DNA computer. Finally, we describe theoretically an algorithm for DNA-based semantic fusion. This algorithm enables the process of integration of the knowledge from disparate remote sensing data sources into a consistent, accurate, and complete representation. This process depends solely on ligation reaction and screening operations instead of the ontology.

  10. Hybrid modeling of plasma and applications to fusion and space physics

    International Nuclear Information System (INIS)

    Kazeminejad, F.

    1989-01-01

    Obtaining reasonable solutions to the nonlinear equations is crucial to the understanding of the behavior of plasmas. With the advent of high speed computers, computer modeling of plasmas has moved into the front row of the tools used in research of their nonlinear plasma dynamics. There are roughly speaking two types of plasma models, particle models and fluid models. Particle models try to emulate nature by following the motion of a large number of charged particles in their self consistent electromagnetic fields. Fluid models on the other hand use macroscopic fluid equations to model the plasma. MHD models are typical of this type. Particle models in general require larger memory for the computer due to the massive amount of data associated with the particles' kinematical variables. Particle models are generally limited to studying small regions of plasma for relatively short time intervals. Fluid models are better fit to handle large scales and long times; i.e., quite often the complete plasma involved in an experiment. The drawback of the fluid models however is that, they miss the physical phenomenon taking place at the microscale and these phenomenon can influence the properties of fluid. Another approach is to start with fluid models and incorporate more physics. Such models are referred to as hybrid models. In this thesis, two such models are discussed. They are then applied to two problems; the first is a simulation of the artificial comet generated by the AMPTE experiment; the second is the production of enhanced noise in fusion plasmas by injected energetic ions or by fusion reaction products. In both cases the models demonstrate qualitative agreement with the experimental observations

  11. Multi-sensor fusion with interacting multiple model filter for improved aircraft position accuracy.

    Science.gov (United States)

    Cho, Taehwan; Lee, Changho; Choi, Sangbang

    2013-03-27

    The International Civil Aviation Organization (ICAO) has decided to adopt Communications, Navigation, and Surveillance/Air Traffic Management (CNS/ATM) as the 21st century standard for navigation. Accordingly, ICAO members have provided an impetus to develop related technology and build sufficient infrastructure. For aviation surveillance with CNS/ATM, Ground-Based Augmentation System (GBAS), Automatic Dependent Surveillance-Broadcast (ADS-B), multilateration (MLAT) and wide-area multilateration (WAM) systems are being established. These sensors can track aircraft positions more accurately than existing radar and can compensate for the blind spots in aircraft surveillance. In this paper, we applied a novel sensor fusion method with Interacting Multiple Model (IMM) filter to GBAS, ADS-B, MLAT, and WAM data in order to improve the reliability of the aircraft position. Results of performance analysis show that the position accuracy is improved by the proposed sensor fusion method with the IMM filter.

  12. Multiscale modeling of radiation damage in Fe-based alloys in the fusion environment

    International Nuclear Information System (INIS)

    Wirth, B.D.; Odette, G.R.; Marian, J.; Ventelon, L.; Young-Vandersall, J.A.; Zepeda-Ruiz, L.A.

    2004-01-01

    Ferritic alloys represent a technologically important class of candidate materials for fusion first wall and blanket structures. A detailed understanding of the mechanisms of defect accumulation and microstructure evolution, and the corresponding effects on mechanical properties is required to predict their in-service structural performance limits. The physical processes involved in radiation damage, and its effects on mechanical properties, are inherently multiscale and hierarchical, spanning length and time scales from the atomic nucleus to meters and picosecond to decades. In this paper, we present a multiscale modeling methodology to describe radiation effects within the fusion energy environment. Selected results from atomic scale investigation are presented, focusing on (i) the mechanisms of self-interstitial dislocation loop formation with Burgers vector of a in iron relative to vanadium, (ii) helium transport and (iii) the interaction between helium and small self-interstitial clusters in iron, and (iv) dislocation-helium bubble interactions in fcc aluminum

  13. Progress in inertial fusion energy modelling at DENIM

    International Nuclear Information System (INIS)

    Velarde, G.; Cabellos, O.; Caturla, M.J.

    2005-01-01

    New results of the jet driven ignition target are presented, both with direct and indirect drive. This target is based on the conical guided target used in fast ignition, but use only one laser pulse. The ignition of the target is started by the impact of a jet produced in the guiding cone, instead of using charged particles generated by a other high power laser. We have shown that a laser or X-ray pulse could be used to produce a high velocity jet of several hundred of km/s by an accumulative effect, and we use these ideas to design this new kind of targets. In order to increase the efficiency of the process, we scan in the simulations different materials, cone profiles and laser intensities. ANALOP is a code developed to calculate opacities for hot plasmas, using analytical potentials including density and temperature effects. It has been recently updated to include the radiative transport into the rate equations by mean of the escape factors, and in parallel a line transport code which solve self-consistently the rate equation and radiative transfer equation in 1D planar geometry has been also developed. We have developed a comprehensive methodology to compute uncertainties on activation calculations. First we developed a sensitivity-uncertainty analysis method, providing the uncertainties of the different inventory responses functions due to the uncertainty of each of the reaction cross sections separately. Lately, we have developed and proved the excellent behaviour of a Monte Carlo-based methodology in assessing the synergetic/global effect of the complete set of cross-sections uncertainties on calculated radiological quantities. The methods have been applied to the activation analysis of the National Ignition Facility (NIF) and different IFE concepts (HYLIFE and Sombrero). Research on multiscale modelling of radiation damage in metals will be presented in comparison with 'ad hoc' experiments. Research on SiC composite is being pursued at macroscopic level

  14. Three-Dimensional Model Retrieval Using Dynamic Multi-Descriptor Fusion

    Institute of Scientific and Technical Information of China (English)

    Jau-Ling Shi; Chang-Hsing Lee; Yao-Wen Hou; Po-Ting Yeh

    2017-01-01

    In this paper, we propose a dynamic multi-descriptor fusion (DMDF) approach to improving the retrieval accuracy of 3-dimensional (3D) model retrieval systems. First, an independent retrieval list is generated by using each individual descriptor. Second, we propose an automatic relevant/irrelevant models selection (ARMS) approach to selecting the relevant and irrelevant 3D models automatically without any user interaction. A weighted distance, in which the weight associated with each individual descriptor is learnt by using the selected relevant and irrelevant models, is used to measure the similarity between two 3D models. Furthermore, a descriptor-dependent adaptive query point movement (AQPM) approach is employed to update every feature vector. This set of new feature vectors is used to index 3D models in the next search process. Four 3D model databases are used to compare the retrieval accuracy of our proposed DMDF approach with several descriptors as well as some well-known information fusion methods. Experimental results have shown that our proposed DMDF approach provides a promising retrieval result and always yields the best retrieval accuracy.

  15. A preliminary concept of stochastic model of the tritium cycle in a fusion reactor

    International Nuclear Information System (INIS)

    Taczanowski, S.

    1988-01-01

    A preliminary concept of stochastic model of the tritium circulation in a fusion reactor was elaborated in purpose of determining the necessary minimum and current tritium inventory in real circumstances. A random character of reactor operation was assumed what is especially valid in the starting phase being of particularly low reliability of the assembly. A system of differential equations with random initial conditions describing the tritium cycle was solved for both operation and break states of the reactor. The distribution of the moments and of the number of breaks in the reactor operation was discussed and the possibilities of further development of the present model are indicated. 5 refs., 2 figs. (author)

  16. Numerical models for the prediction of failure for multilayer fusion Al-alloy sheets

    International Nuclear Information System (INIS)

    Gorji, Maysam; Berisha, Bekim; Hora, Pavel; Timm, Jürgen

    2013-01-01

    Initiation and propagation of cracks in monolithic and multi-layer aluminum alloys, called “Fusion”, is investigated. 2D plane strain finite element simulations are performed to model deformation due to bending and to predict failure. For this purpose, fracture strains are measured based on microscopic pictures of Nakajima specimens. In addition to, micro-structure of materials is taken into account by introducing a random grain distribution over the sheet thickness as well as a random distribution of the measured yield curve. It is shown that the performed experiments and the introduced FE-Model are appropriate methods to highlight the advantages of the Fusion material, especially for bending processes

  17. Generalized information fusion and visualization using spatial voting and data modeling

    Science.gov (United States)

    Jaenisch, Holger M.; Handley, James W.

    2013-05-01

    We present a novel and innovative information fusion and visualization framework for multi-source intelligence (multiINT) data using Spatial Voting (SV) and Data Modeling. We describe how different sources of information can be converted into numerical form for further processing downstream, followed by a short description of how this information can be fused using the SV grid. As an illustrative example, we show the modeling of cyberspace as cyber layers for the purpose of tracking cyber personas. Finally we describe a path ahead for creating interactive agile networks through defender customized Cyber-cubes for network configuration and attack visualization.

  18. Detecting Weather Radar Clutter by Information Fusion With Satellite Images and Numerical Weather Prediction Model Output

    DEFF Research Database (Denmark)

    Bøvith, Thomas; Nielsen, Allan Aasbjerg; Hansen, Lars Kai

    2006-01-01

    A method for detecting clutter in weather radar images by information fusion is presented. Radar data, satellite images, and output from a numerical weather prediction model are combined and the radar echoes are classified using supervised classification. The presented method uses indirect...... information on precipitation in the atmosphere from Meteosat-8 multispectral images and near-surface temperature estimates from the DMI-HIRLAM-S05 numerical weather prediction model. Alternatively, an operational nowcasting product called 'Precipitating Clouds' based on Meteosat-8 input is used. A scale...

  19. A MULTI-RESOLUTION FUSION MODEL INCORPORATING COLOR AND ELEVATION FOR SEMANTIC SEGMENTATION

    Directory of Open Access Journals (Sweden)

    W. Zhang

    2017-05-01

    Full Text Available In recent years, the developments for Fully Convolutional Networks (FCN have led to great improvements for semantic segmentation in various applications including fused remote sensing data. There is, however, a lack of an in-depth study inside FCN models which would lead to an understanding of the contribution of individual layers to specific classes and their sensitivity to different types of input data. In this paper, we address this problem and propose a fusion model incorporating infrared imagery and Digital Surface Models (DSM for semantic segmentation. The goal is to utilize heterogeneous data more accurately and effectively in a single model instead of to assemble multiple models. First, the contribution and sensitivity of layers concerning the given classes are quantified by means of their recall in FCN. The contribution of different modalities on the pixel-wise prediction is then analyzed based on visualization. Finally, an optimized scheme for the fusion of layers with color and elevation information into a single FCN model is derived based on the analysis. Experiments are performed on the ISPRS Vaihingen 2D Semantic Labeling dataset. Comprehensive evaluations demonstrate the potential of the proposed approach.

  20. A unified modeling approach for physical experiment design and optimization in laser driven inertial confinement fusion

    Energy Technology Data Exchange (ETDEWEB)

    Li, Haiyan [Mechatronics Engineering School of Guangdong University of Technology, Guangzhou 510006 (China); Huang, Yunbao, E-mail: Huangyblhy@gmail.com [Mechatronics Engineering School of Guangdong University of Technology, Guangzhou 510006 (China); Jiang, Shaoen, E-mail: Jiangshn@vip.sina.com [Laser Fusion Research Center, China Academy of Engineering Physics, Mianyang 621900 (China); Jing, Longfei, E-mail: scmyking_2008@163.com [Laser Fusion Research Center, China Academy of Engineering Physics, Mianyang 621900 (China); Tianxuan, Huang; Ding, Yongkun [Laser Fusion Research Center, China Academy of Engineering Physics, Mianyang 621900 (China)

    2015-11-15

    Highlights: • A unified modeling approach for physical experiment design is presented. • Any laser facility can be flexibly defined and included with two scripts. • Complex targets and laser beams can be parametrically modeled for optimization. • Automatically mapping of laser beam energy facilitates targets shape optimization. - Abstract: Physical experiment design and optimization is very essential for laser driven inertial confinement fusion due to the high cost of each shot. However, only limited experiments with simple structure or shape on several laser facilities can be designed and evaluated in available codes, and targets are usually defined by programming, which may lead to it difficult for complex shape target design and optimization on arbitrary laser facilities. A unified modeling approach for physical experiment design and optimization on any laser facilities is presented in this paper. Its core idea includes: (1) any laser facility can be flexibly defined and included with two scripts, (2) complex shape targets and laser beams can be parametrically modeled based on features, (3) an automatically mapping scheme of laser beam energy onto discrete mesh elements of targets enable targets or laser beams be optimized without any additional interactive modeling or programming, and (4) significant computation algorithms are additionally presented to efficiently evaluate radiation symmetry on the target. Finally, examples are demonstrated to validate the significance of such unified modeling approach for physical experiments design and optimization in laser driven inertial confinement fusion.

  1. Analysis of laser remote fusion cutting based on a mathematical model

    Energy Technology Data Exchange (ETDEWEB)

    Matti, R. S. [Department of Engineering Sciences and Mathematics, Luleå University of Technology, S-971 87 Luleå (Sweden); Department of Mechanical Engineering, College of Engineering, University of Mosul, Mosul (Iraq); Ilar, T.; Kaplan, A. F. H. [Department of Engineering Sciences and Mathematics, Luleå University of Technology, S-971 87 Luleå (Sweden)

    2013-12-21

    Laser remote fusion cutting is analyzed by the aid of a semi-analytical mathematical model of the processing front. By local calculation of the energy balance between the absorbed laser beam and the heat losses, the three-dimensional vaporization front can be calculated. Based on an empirical model for the melt flow field, from a mass balance, the melt film and the melting front can be derived, however only in a simplified manner and for quasi-steady state conditions. Front waviness and multiple reflections are not modelled. The model enables to compare the similarities, differences, and limits between laser remote fusion cutting, laser remote ablation cutting, and even laser keyhole welding. In contrast to the upper part of the vaporization front, the major part only slightly varies with respect to heat flux, laser power density, absorptivity, and angle of front inclination. Statistical analysis shows that for high cutting speed, the domains of high laser power density contribute much more to the formation of the front than for low speed. The semi-analytical modelling approach offers flexibility to simplify part of the process physics while, for example, sophisticated modelling of the complex focused fibre-guided laser beam is taken into account to enable deeper analysis of the beam interaction. Mechanisms like recast layer generation, absorptivity at a wavy processing front, and melt film formation are studied too.

  2. Analysis of laser remote fusion cutting based on a mathematical model

    International Nuclear Information System (INIS)

    Matti, R. S.; Ilar, T.; Kaplan, A. F. H.

    2013-01-01

    Laser remote fusion cutting is analyzed by the aid of a semi-analytical mathematical model of the processing front. By local calculation of the energy balance between the absorbed laser beam and the heat losses, the three-dimensional vaporization front can be calculated. Based on an empirical model for the melt flow field, from a mass balance, the melt film and the melting front can be derived, however only in a simplified manner and for quasi-steady state conditions. Front waviness and multiple reflections are not modelled. The model enables to compare the similarities, differences, and limits between laser remote fusion cutting, laser remote ablation cutting, and even laser keyhole welding. In contrast to the upper part of the vaporization front, the major part only slightly varies with respect to heat flux, laser power density, absorptivity, and angle of front inclination. Statistical analysis shows that for high cutting speed, the domains of high laser power density contribute much more to the formation of the front than for low speed. The semi-analytical modelling approach offers flexibility to simplify part of the process physics while, for example, sophisticated modelling of the complex focused fibre-guided laser beam is taken into account to enable deeper analysis of the beam interaction. Mechanisms like recast layer generation, absorptivity at a wavy processing front, and melt film formation are studied too

  3. An object-oriented framework for magnetic-fusion modeling and analysis codes

    International Nuclear Information System (INIS)

    Cohen, R H; Yang, T Y Brian.

    1999-01-01

    The magnetic-fusion energy (MFE) program, like many other scientific and engineering activities, has a need to efficiently develop complex modeling codes which combine detailed models of components to make an integrated model of a device, as well as a rich supply of legacy code that could provide the component models. There is also growing recognition in many technical fields of the desirability of steerable software: computer programs whose functionality can be changed by the user as it is run. This project had as its goals the development of two key pieces of infrastructure that are needed to combine existing code modules, written mainly in Fortran, into flexible, steerable, object-oriented integrated modeling codes for magnetic- fusion applications. These two pieces are (1) a set of tools to facilitate the interfacing of Fortran code with a steerable object-oriented framework (which we have chosen to be based on PythonlW3, an object-oriented interpreted language), and (2) a skeleton for the integrated modeling code which defines the relationships between the modules. The first of these activities obviously has immediate applicability to a spectrum of projects; the second is more focussed on the MFE application, but may be of value as an example for other applications

  4. Model for fusion and cool compound nucleus formation based on the fragmentation theory

    International Nuclear Information System (INIS)

    Malhotra, N.; Aroumougame, R.; Saroha, D.R.; Gupta, R.K.

    1986-01-01

    Collective potential energy surfaces are calculated in both the adiabatic and sudden approximations by using the asymmetric two-center shell model in the Strutinsky method. It is shown that fusion of two colliding heavy ions occurs by their crossing over of the adiabatic interaction barrier. The adiabatic scattering potentials present two barriers, whereas no barrier is shown to occur in sudden scattering potentials. The first barrier is obtained just past the saddle shape but is too low, such that a deep inelastic process is expected. The other, inner, barrier is high enough to let the system fall into the fusion well, whose excitation energy then determines whether a cool compound nucleus is produced or the fusion-fission process occurs. For a given compound nucleus, the excitation energy is found to be small for only a few target-projectile combinations, which increase as their mass asymmetry increases. Such target-projectile combinations which refer to a cool compound nucleus can be identified by a simple calculation of the fragmentation potential based on the ground state binding energies with Coulomb and proximity effects calculated at a constant relative separation of the two nuclei. Our calculations are made for the composite systems with 102 < or =Z < or =114

  5. Model for fusion and cool compound nucleus formation based on the fragmentation theory

    International Nuclear Information System (INIS)

    Malhotra, N.; Aroumougame, R.; Saroha, D.R.; Gupta, R.K.

    1985-07-01

    The collective potential energy surfaces are calculated in both the adiabatic and sudden approximations by using the asymmetric two centre shell model in Strutinsky method. It is shown that fusion of two colliding heavy ions occur by their crossing over of the adiabatic interaction barrier. The adiabatic scattering potentials present two barriers whereas no barrier is shown to occur in sudden scattering potentials. The first barrier is obtained just past the saddle shape but is too low, such that a deep inelastic process is expected. The other, inner, barrier is high enough to let the system fall into the fusion well, whose excitation energy then determine whether a cool compound nucleus is produced or the fusion-fission process occurs. For a given compound nucleus, the excitation energy is found to be small for only a few target-projectile combinations, which increase as their mass asymmetry increases. Such target-projectile combinations which refer to a cool compound nucleus, can be identified by a simple calculation of the fragmentation potential based on the ground state binding energies with Couloumb and proximity effects calculated at a constant relative separation of the two nuclei. Our calculations are made for the composite systems with 102<=Z<=114. (author)

  6. Brain-computer interface with language model-electroencephalography fusion for locked-in syndrome.

    Science.gov (United States)

    Oken, Barry S; Orhan, Umut; Roark, Brian; Erdogmus, Deniz; Fowler, Andrew; Mooney, Aimee; Peters, Betts; Miller, Meghan; Fried-Oken, Melanie B

    2014-05-01

    Some noninvasive brain-computer interface (BCI) systems are currently available for locked-in syndrome (LIS) but none have incorporated a statistical language model during text generation. To begin to address the communication needs of individuals with LIS using a noninvasive BCI that involves rapid serial visual presentation (RSVP) of symbols and a unique classifier with electroencephalography (EEG) and language model fusion. The RSVP Keyboard was developed with several unique features. Individual letters are presented at 2.5 per second. Computer classification of letters as targets or nontargets based on EEG is performed using machine learning that incorporates a language model for letter prediction via Bayesian fusion enabling targets to be presented only 1 to 4 times. Nine participants with LIS and 9 healthy controls were enrolled. After screening, subjects first calibrated the system, and then completed a series of balanced word generation mastery tasks that were designed with 5 incremental levels of difficulty, which increased by selecting phrases for which the utility of the language model decreased naturally. Six participants with LIS and 9 controls completed the experiment. All LIS participants successfully mastered spelling at level 1 and one subject achieved level 5. Six of 9 control participants achieved level 5. Individuals who have incomplete LIS may benefit from an EEG-based BCI system, which relies on EEG classification and a statistical language model. Steps to further improve the system are discussed.

  7. Integrated process modeling for the laser inertial fusion energy (LIFE) generation system

    Science.gov (United States)

    Meier, W. R.; Anklam, T. M.; Erlandson, A. C.; Miles, R. R.; Simon, A. J.; Sawicki, R.; Storm, E.

    2010-08-01

    A concept for a new fusion-fission hybrid technology is being developed at Lawrence Livermore National Laboratory. The primary application of this technology is base-load electrical power generation. However, variants of the baseline technology can be used to "burn" spent nuclear fuel from light water reactors or to perform selective transmutation of problematic fission products. The use of a fusion driver allows very high burn-up of the fission fuel, limited only by the radiation resistance of the fuel form and system structures. As a part of this process, integrated process models have been developed to aid in concept definition. Several models have been developed. A cost scaling model allows quick assessment of design changes or technology improvements on cost of electricity. System design models are being used to better understand system interactions and to do design trade-off and optimization studies. Here we describe the different systems models and present systems analysis results. Different market entry strategies are discussed along with potential benefits to US energy security and nuclear waste disposal. Advanced technology options are evaluated and potential benefits from additional R&D targeted at the different options is quantified.

  8. Integrated process modeling for the laser inertial fusion Energy (LIFE) generation system

    International Nuclear Information System (INIS)

    Meier, W.R.; Anklam, T.M.; Erlandson, A.C.; Miles, R.R.; Simon, A.J.; Sawicki, R.; Storm, E.

    2010-01-01

    A concept for a new fusion-fission hybrid technology is being developed at Lawrence Livermore National Laboratory. The primary application of this technology is base-load electrical power generation. However, variants of the baseline technology can be used to 'burn' spent nuclear fuel from light water reactors or to perform selective transmutation of problematic fission products. The use of a fusion driver allows very high burn-up of the fission fuel, limited only by the radiation resistance of the fuel form and system structures. As a part of this process, integrated process models have been developed to aid in concept definition. Several models have been developed. A cost scaling model allows quick assessment of design changes or technology improvements on cost of electricity. System design models are being used to better understand system interactions and to do design trade-off and optimization studies. Here we describe the different systems models and present systems analysis results. Different market entry strategies are discussed along with potential benefits to US energy security and nuclear waste disposal. Advanced technology options are evaluated and potential benefits from additional R and D targeted at the different options is quantified.

  9. Integrated process modeling for the laser inertial fusion energy (LIFE) generation system

    International Nuclear Information System (INIS)

    Meier, W R; Anklam, T M; Erlandson, A C; Miles, R R; Simon, A J; Sawicki, R; Storm, E

    2010-01-01

    A concept for a new fusion-fission hybrid technology is being developed at Lawrence Livermore National Laboratory. The primary application of this technology is base-load electrical power generation. However, variants of the baseline technology can be used to 'burn' spent nuclear fuel from light water reactors or to perform selective transmutation of problematic fission products. The use of a fusion driver allows very high burn-up of the fission fuel, limited only by the radiation resistance of the fuel form and system structures. As a part of this process, integrated process models have been developed to aid in concept definition. Several models have been developed. A cost scaling model allows quick assessment of design changes or technology improvements on cost of electricity. System design models are being used to better understand system interactions and to do design trade-off and optimization studies. Here we describe the different systems models and present systems analysis results. Different market entry strategies are discussed along with potential benefits to US energy security and nuclear waste disposal. Advanced technology options are evaluated and potential benefits from additional R and D targeted at the different options is quantified.

  10. The Catchment Feature Model: A Device for Multimodal Fusion and a Bridge between Signal and Sense

    Science.gov (United States)

    Quek, Francis

    2004-12-01

    The catchment feature model addresses two questions in the field of multimodal interaction: how we bridge video and audio processing with the realities of human multimodal communication, and how information from the different modes may be fused. We argue from a detailed literature review that gestural research has clustered around manipulative and semaphoric use of the hands, motivate the catchment feature model psycholinguistic research, and present the model. In contrast to "whole gesture" recognition, the catchment feature model applies a feature decomposition approach that facilitates cross-modal fusion at the level of discourse planning and conceptualization. We present our experimental framework for catchment feature-based research, cite three concrete examples of catchment features, and propose new directions of multimodal research based on the model.

  11. The Catchment Feature Model: A Device for Multimodal Fusion and a Bridge between Signal and Sense

    Directory of Open Access Journals (Sweden)

    Francis Quek

    2004-09-01

    Full Text Available The catchment feature model addresses two questions in the field of multimodal interaction: how we bridge video and audio processing with the realities of human multimodal communication, and how information from the different modes may be fused. We argue from a detailed literature review that gestural research has clustered around manipulative and semaphoric use of the hands, motivate the catchment feature model psycholinguistic research, and present the model. In contrast to “whole gesture” recognition, the catchment feature model applies a feature decomposition approach that facilitates cross-modal fusion at the level of discourse planning and conceptualization. We present our experimental framework for catchment feature-based research, cite three concrete examples of catchment features, and propose new directions of multimodal research based on the model.

  12. Divertor modelling for conceptual studies of tokamak fusion reactor FDS-III

    International Nuclear Information System (INIS)

    Chen Yiping; Liu Songlin

    2010-01-01

    Divertor modelling for the conceptual studies of tokamak fusion reactor FDS-III was carried out by using the edge plasma code package B2.5-Eirene (SOLPS5.0). The modelling was performed by taking real MHD equilibrium and divertor geometry of the reactor into account. The profiles of plasma temperature, density and heat fluxes in the computational region and at the target plates have been obtained. The modelling results show that, with the fusion power P fu =2.6 GW and the edge density N edge =6.0x10 19 l/m 3 , the peak values of electron and ion heat fluxes at the outer target plate of divertor are respectively 93.92 MW/m 2 and 58.50 MW/m 2 . According to the modelling results it is suggested that some methods for reducing the heat fluxes at the target plates should be used in order to get acceptable level of power flux at the target plates for the divertor design of the reactor.

  13. Higgs production via weak boson fusion in the standard model and the MSSM

    International Nuclear Information System (INIS)

    Figy, Terrance; Palmer, Sophy

    2010-12-01

    Weak boson fusion is expected to be an important Higgs production channel at the LHC. Complete one-loop results for weak boson fusion in the Standard Model have been obtained by calculating the full virtual electroweak corrections and photon radiation and implementing these results into the public Monte Carlo program VBFNLO (which includes the NLO QCD corrections). Furthermore the dominant supersymmetric one-loop corrections to neutral Higgs production, in the general case where the MSSM includes complex phases, have been calculated. These results have been combined with all one-loop corrections of Standard Model type and with the propagator-type corrections from the Higgs sector of the MSSM up to the two-loop level. Within the Standard Model the electroweak corrections are found to be as important as the QCD corrections after the application of appropriate cuts. The corrections yield a shift in the cross section of order 5% for a Higgs of mass 100-200 GeV, confirming the result obtained previously in the literature. For the production of a light Higgs boson in the MSSM the Standard Model result is recovered in the decoupling limit, while the loop contributions from superpartners to the production of neutral MSSM Higgs bosons can give rise to corrections in excess of 10% away from the decoupling region. (orig.)

  14. rhBMP-2 (ACS and CRM formulations) overcomes pseudarthrosis in a New Zealand white rabbit posterolateral fusion model.

    Science.gov (United States)

    Lawrence, James P; Waked, Walid; Gillon, Thomas J; White, Andrew P; Spock, Christopher R; Biswas, Debdut; Rosenberger, Patricia; Troiano, Nancy; Albert, Todd J; Grauer, Jonathan N

    2007-05-15

    The study design consisted of a New Zealand white rabbit model of pseudarthrosis repair. Study groups consisting of no graft, autograft, or recombinant human bone morphogenetic protein-2 (rhBMP-2) with absorbable collagen sponge (ACS) or compression resistant matrix (CRM) were evaluated. To evaluate the relative efficacy of bone graft materials (autograft, ACS, and CRM). rhBMP-2 has been shown to have a 100% fusion rate in a primary rabbit fusion model, even in the presence of nicotine, which is known to inhibit fusion. Seventy-two New Zealand white rabbits underwent posterolateral lumbar fusion with iliac crest autograft. To establish pseudarthroses, nicotine was administered to all animals. At 5 weeks, the spines were explored and all pseudarthroses were redecorticated and implanted with no graft, autograft, rhBMP-2/ACS, or rhBMP-2/CRM. At 10 weeks, fusions were assessed by manual palpation and histology. Eight rabbits (11%) were lost to complications. At 5 weeks, 66 (97%) had pseudarthroses. At 10 weeks, attempted pseudarthrosis repairs were fused in 1 of 16 of no graft rabbits (6%), 5 of 17 autograft rabbits (29%), and 31 of 31 rhBMP-2 rabbits (with ACS or CRM) (100%). Histologic analysis demonstrated more mature bone formation in the rhBMP-2 groups. The 2 rhBMP-2 formulations led to significantly higher fusion rates and histologic bone formation than no graft and autograft controls in this pseudarthrosis repair model.

  15. BP-Mobil partnership. The common network takes place

    International Nuclear Information System (INIS)

    Anon.

    1997-01-01

    After the partnership between BP and Mobil was signed, the program of transformation of the petrol stations network started in November 1996 in the UK and concern 3300 stations in Europe and 800 stations in France. About 9100 stations will be transformed by the end of 1998. BP France is the operator for petroleum products (petrol, fuel, bitumens, LPG..) with a 70% share holding (30% for Mobil) while Mobil is the major shareholder (51%) for the lubricants and special products activities. The chemical, aviation nd maritime activities are not concerned. Thanks to the fusion of their down-file activities in Europe, the benefits of the partnership should reach 600 to 700 million of US Dollars each year. However the restructuring cost should reach 740 millions of US Dollars in two years, which doubles the initial estimation. Short paper. (J.S.)

  16. Probabilistic finite-size transport models for fusion: Anomalous transport and scaling laws

    International Nuclear Information System (INIS)

    Milligen, B.Ph. van; Sanchez, R.; Carreras, B.A.

    2004-01-01

    Transport in fusion plasmas in the low confinement mode is characterized by several remarkable properties: the anomalous scaling of transport with system size, stiff (or 'canonical') profiles, power degradation, and rapid transport phenomena. The present article explores the possibilities of constructing a unified transport model, based on the continuous-time random walk, in which all these phenomena are handled adequately. The resulting formalism appears to be sufficiently general to provide a sound starting point for the development of a full-blown plasma transport code, capable of incorporating the relevant microscopic transport mechanisms, and allowing predictions of confinement properties

  17. Simulations of mixing in Inertial Confinement Fusion with front tracking and sub-grid scale models

    Science.gov (United States)

    Rana, Verinder; Lim, Hyunkyung; Melvin, Jeremy; Cheng, Baolian; Glimm, James; Sharp, David

    2015-11-01

    We present two related results. The first discusses the Richtmyer-Meshkov (RMI) and Rayleigh-Taylor instabilities (RTI) and their evolution in Inertial Confinement Fusion simulations. We show the evolution of the RMI to the late time RTI under transport effects and tracking. The role of the sub-grid scales helps capture the interaction of turbulence with diffusive processes. The second assesses the effects of concentration on the physics model and examines the mixing properties in the low Reynolds number hot spot. We discuss the effect of concentration on the Schmidt number. The simulation results are produced using the University of Chicago code FLASH and Stony Brook University's front tracking algorithm.

  18. Long-term modelling of Carbon Capture and Storage, Nuclear Fusion, and large-scale District Heating

    DEFF Research Database (Denmark)

    Grohnheit, Poul Erik; Korsholm, Søren Bang; Lüthje, Mikael

    2011-01-01

    before 2050. The modelling tools developed by the International Energy Agency (IEA) Implementing Agreement ETSAP include both multi-regional global and long-term energy models till 2100, as well as national or regional models with shorter time horizons. Examples are the EFDA-TIMES model, focusing...... on nuclear fusion and the Pan European TIMES model, respectively. In the next decades CCS can be a driver for the development and expansion of large-scale district heating systems, which are currently widespread in Europe, Korea and China, and with large potentials in North America. If fusion will replace...... fossil fuel power plants with CCS in the second half of the century, the same infrastructure for heat distribution can be used which will support the penetration of both technologies. This paper will address the issue of infrastructure development and the use of CCS and fusion technologies using...

  19. Laser ablation under different electron heat conduction models in inertial confinement fusion

    Science.gov (United States)

    Li, Shuanggui; Ren, Guoli; Huo, Wen Yi

    2018-06-01

    In this paper, we study the influence of three different electron heat conduction models on the laser ablation of gold plane target. Different from previous studies, we concentrate on the plasma conditions, the conversion efficiency from laser into soft x rays and the scaling relation of mass ablation, which are relevant to hohlraum physics study in indirect drive inertial confinement fusion. We find that the simulated electron temperature in corona region is sensitive to the electron heat conduction models. For different electron heat conduction models, there are obvious differences in magnitude and spatial profile of electron temperature. For the flux limit model, the calculated conversion efficiency is sensitive to flux limiters. In the laser ablation of gold, most of the laser energies are converted into x rays. So the scaling relation of mass ablation rate is quite different from that of low Z materials.

  20. Tritium control in fusion reactor materials: A model for Tritium Extracting System

    Energy Technology Data Exchange (ETDEWEB)

    Zucchetti, Massimo [DENERG, Politecnico di Torino (Italy); Utili, Marco, E-mail: marco.utili@enea.it [ENEA UTIS – C.R. Brasimone, Bacino del Brasimone, Camugnano, BO (Italy); Nicolotti, Iuri [DENERG, Politecnico di Torino (Italy); Ying, Alice [University of California Los Angeles (UCLA), Los Angeles, CA (United States); Franza, Fabrizio [Karlsruhe Institute of Technology, Karlsruhe (Germany); Abdou, Mohamed [University of California Los Angeles (UCLA), Los Angeles, CA (United States)

    2015-10-15

    Highlights: • A modeling work has been performed to address these issues in view of its utilization for the TES (Tritium Extraction System), in the case of the HCPB TBM and for a Molecular sieve as adsorbent material. • A computational model has been setup and tested in this paper. • The results of experimental measurement of fundamental parameters such as mass transfer coefficients have been implemented in the model. • It turns out the capability to model the extraction process of gaseous tritium compounds and to estimate the breakthrough curves of the two main tritium gaseous species (H2 and HT). - Abstract: In fusion reactors, tritium is bred by lithium isotopes inside the blanket and then extracted. However, tritium can contaminate the reactor structures, and can be eventually released into the environment. Tritium in reactor components should therefore be kept under close control throughout the fusion reactor lifetime, bearing in mind the risk of accidents, the need for maintenance and the detritiation of dismantled reactor components before their re-use or disposal. A modeling work has been performed to address these issues in view of its utilization for the TES (Tritium Extraction System), in the case of the HCPB TBM and for a molecular sieve as adsorbent material. A computational model has been setup and tested. The results of experimental measurement of fundamental parameters such as mass transfer coefficients have been implemented in the model. It turns out the capability of the model to describe the extraction process of gaseous tritium compounds and to estimate the breakthrough curves of the two main tritium gaseous species (H2 and HT).

  1. Tritium control in fusion reactor materials: A model for Tritium Extracting System

    International Nuclear Information System (INIS)

    Zucchetti, Massimo; Utili, Marco; Nicolotti, Iuri; Ying, Alice; Franza, Fabrizio; Abdou, Mohamed

    2015-01-01

    Highlights: • A modeling work has been performed to address these issues in view of its utilization for the TES (Tritium Extraction System), in the case of the HCPB TBM and for a Molecular sieve as adsorbent material. • A computational model has been setup and tested in this paper. • The results of experimental measurement of fundamental parameters such as mass transfer coefficients have been implemented in the model. • It turns out the capability to model the extraction process of gaseous tritium compounds and to estimate the breakthrough curves of the two main tritium gaseous species (H2 and HT). - Abstract: In fusion reactors, tritium is bred by lithium isotopes inside the blanket and then extracted. However, tritium can contaminate the reactor structures, and can be eventually released into the environment. Tritium in reactor components should therefore be kept under close control throughout the fusion reactor lifetime, bearing in mind the risk of accidents, the need for maintenance and the detritiation of dismantled reactor components before their re-use or disposal. A modeling work has been performed to address these issues in view of its utilization for the TES (Tritium Extraction System), in the case of the HCPB TBM and for a molecular sieve as adsorbent material. A computational model has been setup and tested. The results of experimental measurement of fundamental parameters such as mass transfer coefficients have been implemented in the model. It turns out the capability of the model to describe the extraction process of gaseous tritium compounds and to estimate the breakthrough curves of the two main tritium gaseous species (H2 and HT).

  2. Multiscale musculoskeletal modelling, data–model fusion and electromyography-informed modelling

    Science.gov (United States)

    Zhang, J.; Heidlauf, T.; Sartori, M.; Besier, T.; Röhrle, O.; Lloyd, D.

    2016-01-01

    This paper proposes methods and technologies that advance the state of the art for modelling the musculoskeletal system across the spatial and temporal scales; and storing these using efficient ontologies and tools. We present population-based modelling as an efficient method to rapidly generate individual morphology from only a few measurements and to learn from the ever-increasing supply of imaging data available. We present multiscale methods for continuum muscle and bone models; and efficient mechanostatistical methods, both continuum and particle-based, to bridge the scales. Finally, we examine both the importance that muscles play in bone remodelling stimuli and the latest muscle force prediction methods that use electromyography-assisted modelling techniques to compute musculoskeletal forces that best reflect the underlying neuromuscular activity. Our proposal is that, in order to have a clinically relevant virtual physiological human, (i) bone and muscle mechanics must be considered together; (ii) models should be trained on population data to permit rapid generation and use underlying principal modes that describe both muscle patterns and morphology; and (iii) these tools need to be available in an open-source repository so that the scientific community may use, personalize and contribute to the database of models. PMID:27051510

  3. Stochastic modelling of fusion-product transport and thermalization with nuclear elastic scattering

    International Nuclear Information System (INIS)

    Deveaux, J.C.

    1983-01-01

    Monte Carlo methods are developed to model fusion-product (fp) transport and thermalization with both Rutherford scattering and nuclear elastic scattering (NES) in high-temperature (T/sub i/, T/sub e-/ > 50 keV), advanced-fuel (e.g. Cat-D, D- 3 He) plasmas. A discrete-event model is used to superimpose NES collisions on a Rutherford scattering model that contains the Spitzer coefficients of drag, velocity diffusion (VD), and pith-angle scattering (PAS). The effects of NES on fp transport and thermalization are investigated for advanced-fuel, Field-Reversed Mirror (FRM) plasmas that have a significant Hamiltonian-canonical angular momentum (H-Ptheta) space loss cone which scales with the characteristic size (S identical with R/sub HV//3p/sub i/) and applied vacuum magnetic field (B 0 )

  4. Data Fusion Modeling for an RT3102 and Dewetron System Application in Hybrid Vehicle Stability Testing

    Directory of Open Access Journals (Sweden)

    Zhibin Miao

    2015-08-01

    Full Text Available More and more hybrid electric vehicles are driven since they offer such advantages as energy savings and better active safety performance. Hybrid vehicles have two or more power driving systems and frequently switch working condition, so controlling stability is very important. In this work, a two-stage Kalman algorithm method is used to fuse data in hybrid vehicle stability testing. First, the RT3102 navigation system and Dewetron system are introduced. Second, a modeling of data fusion is proposed based on the Kalman filter. Then, this modeling is simulated and tested on a sample vehicle, using Carsim and Simulink software to test the results. The results showed the merits of this modeling.

  5. A preliminary model for estimating the first wall lifetime of a fusion reactor

    International Nuclear Information System (INIS)

    Daenner, W.

    1975-02-01

    The estimation of the first wall lifetime is a necessary basis for predicting the availability of a fusion power plant. In order to do this, an analytical model was prepared and programmed for the computer which calculates the temperature and stress load of the first wall from the principal design parameters and quotes them against the relevant material properties. Neither the analytical model nor the information about the material performance is yet complete so that the answers obtained from the program are very preliminary. This situation is underlined by the results of sample calculations performed for the CTRD blanket module cell. The results obtained for vanadium and vanadium alloys show a strong dependence of the lifetime on the irradiation creep and the ductility of these materials. Completion of this model is envisaged as soon as the missing information becomes available. (orig.) [de

  6. Multi-agent control system with information fusion based comfort model for smart buildings

    International Nuclear Information System (INIS)

    Wang, Zhu; Wang, Lingfeng; Dounis, Anastasios I.; Yang, Rui

    2012-01-01

    Highlights: ► Proposed a model to manage indoor energy and comfort for smart buildings. ► Developed a control system to maximize comfort with minimum energy consumption. ► Information fusion with ordered weighted averaging aggregation is used. ► Multi-agent technology and heuristic intelligent optimization are deployed in developing the control system. -- Abstract: From the perspective of system control, a smart and green building is a large-scale dynamic system with high complexity and a huge amount of information. Proper combination of the available information and effective control of the overall building system turns out to be a big challenge. In this study, we proposed a building indoor energy and comfort management model based on information fusion using ordered weighted averaging (OWA) aggregation. A multi-agent control system with heuristic intelligent optimization is developed to achieve a high level of comfort with the minimum power consumption. Case studies and simulation results are presented and discussed in this paper.

  7. Fusion Plasma Modelling Using Atomic and Molecular Data. Summary report of a Joint ICTP-IAEA Workshop

    International Nuclear Information System (INIS)

    Braams, B.J.

    2012-03-01

    The Joint ICTP-IAEA Workshop on Fusion Plasma Modelling using Atomic and Molecular Data was held from 23-27 January 2012 at Abdus Salam International Centre for Theoretical Physics in Trieste, Italy. Ten lecturers presented tutorials and reviews on topics in fusion plasma modelling and atomic, molecular and plasma-material interaction processes. There were 20 participants, generally early-career researchers in the area of A+M+PMI processes and also plasma modellers. The participants presented their work in short talks and a poster session. The proceedings of the workshop are summarized here. (author)

  8. Case Study: Organotypic human in vitro models of embryonic morphogenetic fusion

    Science.gov (United States)

    Morphogenetic fusion of tissues is a common event in embryonic development and disruption of fusion is associated with birth defects of the eye, heart, neural tube, phallus, palate, and other organ systems. Embryonic tissue fusion requires precise regulation of cell-cell and cell...

  9. Tissue identification with micro-magnetic resonance imaging in a caprine spinal fusion model

    NARCIS (Netherlands)

    Uffen, M.; Krijnen, M.; Hoogendoorn, R.; Strijkers, G.; Everts, V.; Wuisman, P.; Smit, T.

    2008-01-01

    Nonunion is a major complication of spinal interbody fusion. Currently X-ray and computed tomography (CT) are used for evaluating the spinal fusion process. However, both imaging modalities have limitations in judgment of the early stages of this fusion process, as they only visualize mineralized

  10. Assembly of human C-terminal binding protein (CtBP) into tetramers.

    Science.gov (United States)

    Bellesis, Andrew G; Jecrois, Anne M; Hayes, Janelle A; Schiffer, Celia A; Royer, William E

    2018-06-08

    C-terminal binding protein 1 (CtBP1) and CtBP2 are transcriptional coregulators that repress numerous cellular processes, such as apoptosis, by binding transcription factors and recruiting chromatin-remodeling enzymes to gene promoters. The NAD(H)-linked oligomerization of human CtBP is coupled to its co-transcriptional activity, which is implicated in cancer progression. However, the biologically relevant level of CtBP assembly has not been firmly established; nor has the stereochemical arrangement of the subunits above that of a dimer. Here, multi-angle light scattering (MALS) data established the NAD + - and NADH-dependent assembly of CtBP1 and CtBP2 into tetramers. An examination of subunit interactions within CtBP1 and CtBP2 crystal lattices revealed that both share a very similar tetrameric arrangement resulting from assembly of two dimeric pairs, with specific interactions probably being sensitive to NAD(H) binding. Creating a series of mutants of both CtBP1 and CtBP2, we tested the hypothesis that the crystallographically observed interdimer pairing stabilizes the solution tetramer. MALS data confirmed that these mutants disrupt both CtBP1 and CtBP2 tetramers, with the dimer generally remaining intact, providing the first stereochemical models for tetrameric assemblies of CtBP1 and CtBP2. The crystal structure of a subtle destabilizing mutant suggested that small structural perturbations of the hinge region linking the substrate- and NAD-binding domains are sufficient to weaken the CtBP1 tetramer. These results strongly suggest that the tetramer is important in CtBP function, and the series of CtBP mutants reported here can be used to investigate the physiological role of the tetramer. © 2018 Bellesis et al.

  11. Fusion energy

    International Nuclear Information System (INIS)

    Gross, R.A.

    1984-01-01

    This textbook covers the physics and technology upon which future fusion power reactors will be based. It reviews the history of fusion, reaction physics, plasma physics, heating, and confinement. Descriptions of commercial plants and design concepts are included. Topics covered include: fusion reactions and fuel resources; reaction rates; ignition, and confinement; basic plasma directory; Tokamak confinement physics; fusion technology; STARFIRE: A commercial Tokamak fusion power plant. MARS: A tandem-mirror fusion power plant; and other fusion reactor concepts

  12. Computational modeling of the axial-cylindrical inertial electrostatic confinement fusion neutron generator

    Science.gov (United States)

    Bromley, Blair Patrick

    2001-12-01

    The axial-cylindrical Inertial Electrostatic Confinement fusion neutron generator (IEC C-Device) is a high- voltage, low-pressure glow discharge device that produces neutrons from the deuterium-deuterium fusion reaction. Such a neutron source has potential applications for neutron activation analysis and capture therapies for cancer treatment. The IEC C-Device operating with deuterium fuel is modeled with the CHIMP computer code developed and written completely by the author to predict the fusion neutron generation rate and the plasma physics behavior using fundamental first principles. The CHIMP code is a time-dependent, spatially two-dimensional (r,z), particle-in-cell, Monte-Carlo-Collision (PIC-MCC) direct simulation model. The effects of secondary electron emission due to ion and electron impact on the metal electrodes and the glass walls and charge build-up on the glass wall are included. Either monatomic or molecular ions and electrons are modeled in a monatomic or molecular background neutral deuterium gas. CHIMP code predictions are compared against experimental results for the C-Device operating between 10 and 30 kV of anode voltage, between 10 and 40 mA of electrode current, and between 0.29 and 1.1 milliTorr of deuterium gas pressure. A calibration factor for the pressure accounts for the calibration of the ionization pressure gauge in the experiment, and an estimated pressure drop between the main chamber of the C-Device and the pressure gauge that is downstream of the exhaust port. Upgraded versions of the CHIMP code which have modifications to the algorithms for the boundary conditions, and which include charge exchange processes, and the contribution of fast neutrals to the neutron generation rate are also tested against several experimental data points. Although the CHIMP code gives predictions for the neutron generation rate that exhibit the same near-linear trends with current found in the experiment, it is apparent that at least five types of

  13. Characterization of a novel caudal vertebral interbody fusion in a rat tail model: An implication for future material and mechanical testing

    Directory of Open Access Journals (Sweden)

    Yu-Cheng Yeh

    2017-02-01

    Conclusion: The rat caudal disc interbody fusion model proved to be an efficient, repeatable and easily accessible model. Future research into adjuvant treatments like growth factor injection and alternative fusion materials under conditions of osteoporosis using this model would be worthwhile.

  14. Short-Term Forecasting of Taiwanese Earthquakes Using a Universal Model of Fusion-Fission Processes

    Science.gov (United States)

    Cheong, Siew Ann; Tan, Teck Liang; Chen, Chien-Chih; Chang, Wu-Lung; Liu, Zheng; Chew, Lock Yue; Sloot, Peter M. A.; Johnson, Neil F.

    2014-01-01

    Predicting how large an earthquake can be, where and when it will strike remains an elusive goal in spite of the ever-increasing volume of data collected by earth scientists. In this paper, we introduce a universal model of fusion-fission processes that can be used to predict earthquakes starting from catalog data. We show how the equilibrium dynamics of this model very naturally explains the Gutenberg-Richter law. Using the high-resolution earthquake catalog of Taiwan between Jan 1994 and Feb 2009, we illustrate how out-of-equilibrium spatio-temporal signatures in the time interval between earthquakes and the integrated energy released by earthquakes can be used to reliably determine the times, magnitudes, and locations of large earthquakes, as well as the maximum numbers of large aftershocks that would follow. PMID:24406467

  15. Application of a model to investigate the effective thermal conductivity of randomly packed fusion pebble beds

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xiaoliang; Zheng, Jie; Chen, Hongli, E-mail: hlchen1@ustc.edu.cn

    2016-05-15

    In our precious study, a prediction model, which calculates the effective thermal conductivity k{sub eff} of mono-sized pebble beds, has been developed and validated. Based on this model, here the effects of these influencing factors such as pebble size, thermal radiation, contact area, filling gas, gas flow, gas pressure, etc. on the k{sub eff} of randomly packed fusion pebble beds are studied and analyzed. The pebble beds investigated include Li{sub 4}SiO{sub 4}, Li{sub 2}ZrO{sub 3}, Li{sub 2}TiO{sub 3}, Li{sub 2}O, Be and BeO pebble beds. In the current study, many important and meaningful conclusions are derived and some of them are similar to the existing research results. Particularly, some critters that under which conditions the effect of some influencing factors can be neglected or should be considered are also presented.

  16. Advanced particle-in-cell simulation techniques for modeling the Lockheed Martin Compact Fusion Reactor

    Science.gov (United States)

    Welch, Dale; Font, Gabriel; Mitchell, Robert; Rose, David

    2017-10-01

    We report on particle-in-cell developments of the study of the Compact Fusion Reactor. Millisecond, two and three-dimensional simulations (cubic meter volume) of confinement and neutral beam heating of the magnetic confinement device requires accurate representation of the complex orbits, near perfect energy conservation, and significant computational power. In order to determine initial plasma fill and neutral beam heating, these simulations include ionization, elastic and charge exchange hydrogen reactions. To this end, we are pursuing fast electromagnetic kinetic modeling algorithms including a two implicit techniques and a hybrid quasi-neutral algorithm with kinetic ions. The kinetic modeling includes use of the Poisson-corrected direct implicit, magnetic implicit, as well as second-order cloud-in-cell techniques. The hybrid algorithm, ignoring electron inertial effects, is two orders of magnitude faster than kinetic but not as accurate with respect to confinement. The advantages and disadvantages of these techniques will be presented. Funded by Lockheed Martin.

  17. Airplane detection based on fusion framework by combining saliency model with Deep Convolutional Neural Networks

    Science.gov (United States)

    Dou, Hao; Sun, Xiao; Li, Bin; Deng, Qianqian; Yang, Xubo; Liu, Di; Tian, Jinwen

    2018-03-01

    Aircraft detection from very high resolution remote sensing images, has gained more increasing interest in recent years due to the successful civil and military applications. However, several problems still exist: 1) how to extract the high-level features of aircraft; 2) locating objects within such a large image is difficult and time consuming; 3) A common problem of multiple resolutions of satellite images still exists. In this paper, inspirited by biological visual mechanism, the fusion detection framework is proposed, which fusing the top-down visual mechanism (deep CNN model) and bottom-up visual mechanism (GBVS) to detect aircraft. Besides, we use multi-scale training method for deep CNN model to solve the problem of multiple resolutions. Experimental results demonstrate that our method can achieve a better detection result than the other methods.

  18. Studying Validity of Single-Fluid Model in Inertial Confinement Fusion

    International Nuclear Information System (INIS)

    Gu Jian-Fa; Fan Zheng-Feng; Dai Zhen-Sheng; Ye Wen-Hua; Pei Wen-Bing; Zhu Shao-Ping

    2014-01-01

    The validity of single-fluid model in inertial confinement fusion simulations is studied by comparing the results of the multi- and single-fluid models. The multi-fluid model includes the effects of collision and interpenetration between fluid species. By simulating the collision of fluid species, steady-state shock propagation into the thin DT gas and expansion of hohlraum Au wall heated by lasers, the results show that the validity of single-fluid model is strongly dependent on the ratio of the characteristic length of the simulated system to the particle mean free path. When the characteristic length L is one order larger than the mean free path λ, the single-fluid model's results are found to be in good agreement with the multi-fluid model's simulations, and the modeling of single-fluid remains valid. If the value of L/λ is lower than 10, the interpenetration between fluid species is significant, and the single-fluid simulations show some unphysical results; while the multi-fluid model can describe well the interpenetration and mix phenomena, and give more reasonable results. (physics of gases, plasmas, and electric discharges)

  19. Testing nonlocal models of electron thermal conduction for magnetic and inertial confinement fusion applications

    Science.gov (United States)

    Brodrick, J. P.; Kingham, R. J.; Marinak, M. M.; Patel, M. V.; Chankin, A. V.; Omotani, J. T.; Umansky, M. V.; Del Sorbo, D.; Dudson, B.; Parker, J. T.; Kerbel, G. D.; Sherlock, M.; Ridgers, C. P.

    2017-09-01

    Three models for nonlocal electron thermal transport are here compared against Vlasov-Fokker-Planck (VFP) codes to assess their accuracy in situations relevant to both inertial fusion hohlraums and tokamak scrape-off layers. The models tested are (i) a moment-based approach using an eigenvector integral closure (EIC) originally developed by Ji, Held, and Sovinec [Phys. Plasmas 16, 022312 (2009)]; (ii) the non-Fourier Landau-fluid (NFLF) model of Dimits, Joseph, and Umansky [Phys. Plasmas 21, 055907 (2014)]; and (iii) Schurtz, Nicolaï, and Busquet's [Phys. Plasmas 7, 4238 (2000)] multigroup diffusion model (SNB). We find that while the EIC and NFLF models accurately predict the damping rate of a small-amplitude temperature perturbation (within 10% at moderate collisionalities), they overestimate the peak heat flow by as much as 35% and do not predict preheat in the more relevant case where there is a large temperature difference. The SNB model, however, agrees better with VFP results for the latter problem if care is taken with the definition of the mean free path. Additionally, we present for the first time a comparison of the SNB model against a VFP code for a hohlraum-relevant problem with inhomogeneous ionisation and show that the model overestimates the heat flow in the helium gas-fill by a factor of ˜2 despite predicting the peak heat flux to within 16%.

  20. Prediction of Industrial Electric Energy Consumption in Anhui Province Based on GA-BP Neural Network

    Science.gov (United States)

    Zhang, Jiajing; Yin, Guodong; Ni, Youcong; Chen, Jinlan

    2018-01-01

    In order to improve the prediction accuracy of industrial electrical energy consumption, a prediction model of industrial electrical energy consumption was proposed based on genetic algorithm and neural network. The model use genetic algorithm to optimize the weights and thresholds of BP neural network, and the model is used to predict the energy consumption of industrial power in Anhui Province, to improve the prediction accuracy of industrial electric energy consumption in Anhui province. By comparing experiment of GA-BP prediction model and BP neural network model, the GA-BP model is more accurate with smaller number of neurons in the hidden layer.

  1. Knowledge fusion: Time series modeling followed by pattern recognition applied to unusual sections of background data

    International Nuclear Information System (INIS)

    Burr, T.; Doak, J.; Howell, J.A.; Martinez, D.; Strittmatter, R.

    1996-03-01

    This report describes work performed during FY 95 for the Knowledge Fusion Project, which by the Department of Energy, Office of Nonproliferation and National Security. The project team selected satellite sensor data as the one main example to which its analysis algorithms would be applied. The specific sensor-fusion problem has many generic features that make it a worthwhile problem to attempt to solve in a general way. The generic problem is to recognize events of interest from multiple time series in a possibly noisy background. By implementing a suite of time series modeling and forecasting methods and using well-chosen alarm criteria, we reduce the number of false alarms. We then further reduce the number of false alarms by analyzing all suspicious sections of data, as judged by the alarm criteria, with pattern recognition methods. This report describes the implementation and application of this two-step process for separating events from unusual background. As a fortunate by-product of this activity, it is possible to gain a better understanding of the natural background

  2. Knowledge fusion: Time series modeling followed by pattern recognition applied to unusual sections of background data

    Energy Technology Data Exchange (ETDEWEB)

    Burr, T.; Doak, J.; Howell, J.A.; Martinez, D.; Strittmatter, R.

    1996-03-01

    This report describes work performed during FY 95 for the Knowledge Fusion Project, which by the Department of Energy, Office of Nonproliferation and National Security. The project team selected satellite sensor data as the one main example to which its analysis algorithms would be applied. The specific sensor-fusion problem has many generic features that make it a worthwhile problem to attempt to solve in a general way. The generic problem is to recognize events of interest from multiple time series in a possibly noisy background. By implementing a suite of time series modeling and forecasting methods and using well-chosen alarm criteria, we reduce the number of false alarms. We then further reduce the number of false alarms by analyzing all suspicious sections of data, as judged by the alarm criteria, with pattern recognition methods. This report describes the implementation and application of this two-step process for separating events from unusual background. As a fortunate by-product of this activity, it is possible to gain a better understanding of the natural background.

  3. Statistical comparison of a hybrid approach with approximate and exact inference models for Fusion 2+

    Science.gov (United States)

    Lee, K. David; Wiesenfeld, Eric; Gelfand, Andrew

    2007-04-01

    One of the greatest challenges in modern combat is maintaining a high level of timely Situational Awareness (SA). In many situations, computational complexity and accuracy considerations make the development and deployment of real-time, high-level inference tools very difficult. An innovative hybrid framework that combines Bayesian inference, in the form of Bayesian Networks, and Possibility Theory, in the form of Fuzzy Logic systems, has recently been introduced to provide a rigorous framework for high-level inference. In previous research, the theoretical basis and benefits of the hybrid approach have been developed. However, lacking is a concrete experimental comparison of the hybrid framework with traditional fusion methods, to demonstrate and quantify this benefit. The goal of this research, therefore, is to provide a statistical analysis on the comparison of the accuracy and performance of hybrid network theory, with pure Bayesian and Fuzzy systems and an inexact Bayesian system approximated using Particle Filtering. To accomplish this task, domain specific models will be developed under these different theoretical approaches and then evaluated, via Monte Carlo Simulation, in comparison to situational ground truth to measure accuracy and fidelity. Following this, a rigorous statistical analysis of the performance results will be performed, to quantify the benefit of hybrid inference to other fusion tools.

  4. Knowledge fusion: An approach to time series model selection followed by pattern recognition

    International Nuclear Information System (INIS)

    Bleasdale, S.A.; Burr, T.L.; Scovel, J.C.; Strittmatter, R.B.

    1996-03-01

    This report describes work done during FY 95 that was sponsored by the Department of Energy, Office of Nonproliferation and National Security, Knowledge Fusion Project. The project team selected satellite sensor data to use as the one main example for the application of its analysis algorithms. The specific sensor-fusion problem has many generic features, which make it a worthwhile problem to attempt to solve in a general way. The generic problem is to recognize events of interest from multiple time series that define a possibly noisy background. By implementing a suite of time series modeling and forecasting methods and using well-chosen alarm criteria, we reduce the number of false alarms. We then further reduce the number of false alarms by analyzing all suspicious sections of data, as judged by the alarm criteria, with pattern recognition methods. An accompanying report (Ref 1) describes the implementation and application of this 2-step process for separating events from unusual background and applies a suite of forecasting methods followed by a suite of pattern recognition methods. This report goes into more detail about one of the forecasting methods and one of the pattern recognition methods and is applied to the same kind of satellite-sensor data that is described in Ref. 1

  5. Modelling of surface evolution of rough surface on divertor target in fusion devices

    International Nuclear Information System (INIS)

    Dai, Shuyu; Liu, Shengguang; Sun, Jizhong; Kirschner, A.; Kawamura, G.; Tskhakaya, D.; Ding, Rui; Luo, Guangnan; Wang, Dezhen

    2015-01-01

    Highlights: • We study the surface evolution of rough surface on divertor target in fusion devices. • The effects of gyration motion and E × B drift affect 3D angular distribution. • A larger magnetic field angle leads to a reduced net eroded areal density. • The rough surface evolution affects the physical sputtering yield. - Abstract: The 3D Monte-Carlo code SURO has been used to study the surface evolution of rough surface on the divertor target in fusion devices. The edge plasma at divertor region is modelled by the SDPIC code and used as input data for SURO. Coupled with SDPIC, SURO can perform more sophisticated simulations to calculate the local angle and surface evolution of rough surface. The simulation results show that the incident direction of magnetic field, gyration and E × B force has a significant impact on 3D angular distribution of background plasma and accordingly on the erosion of rough surface. The net eroded areal density of rough surface is studied by varying the magnetic field angle with surface normal. The evolution of the microscopic morphology of rough surface can lead to a significant change in the physical sputtering yield

  6. Evaluation of alternative model-data fusion approaches in water balance estimation across Australia

    Science.gov (United States)

    van Dijk, A. I. J. M.; Renzullo, L. J.

    2009-04-01

    Australia's national agencies are developing a continental modelling system to provide a range of water information services. It will include rolling water balance estimation to underpin national water accounts, water resources assessments that interpret current water resources availability and trends in a historical context, and water resources predictions coupled to climate and weather forecasting. The nation-wide coverage, currency, accuracy, and consistency required means that remote sensing will need to play an important role along with in-situ observations. Different approaches to blending models and observations can be considered. Integration of on-ground and remote sensing data into land surface models in atmospheric applications often involves state updating through model-data assimilation techniques. By comparison, retrospective water balance estimation and hydrological scenario modelling to date has mostly relied on static parameter fitting against observations and has made little use of earth observation. The model-data fusion approach most appropriate for a continental water balance estimation system will need to consider the trade-off between computational overhead and the accuracy gains achieved when using more sophisticated synthesis techniques and additional observations. This trade-off was investigated using a landscape hydrological model and satellite-based estimates of soil moisture and vegetation properties for aseveral gauged test catchments in southeast Australia.

  7. A neutron poison tritium breeding controller applied to a water cooled fusion reactor model

    International Nuclear Information System (INIS)

    Morgan, L.W.G.; Packer, L.W.

    2014-01-01

    Highlights: • The issue of a potentially producing a large tritium surplus inventory, within a solid breeder, is addressed. • A possible solution to this problem is presented in the form of a neutron poison based tritium production controller. • The tritium surplus inventory has been modelled by the FATI code for a simplified WCCB model and as a function of time. • It has been demonstrated that the tritium surplus inventory can be managed, which may impact on safety considerations. - Abstract: The generation of tritium in sufficient quantities is an absolute requirement for a next step fusion device such as DEMO due to the scarcity of tritium sources. Although the production of sufficient quantities of tritium will be one of the main challenges for DEMO, within an energy economy featuring several fusion power plants the active control of tritium production may be required in order to manage surplus tritium inventories at power plant sites. The primary reason for controlling the tritium inventory in such an economy would therefore be to minimise the risk and storage costs associated with large quantities of surplus tritium. In order to ensure that enough tritium will be produced in a reactor which contains a solid tritium breeder, over the reactor's lifetime, the tritium breeding rate at the beginning of its lifetime is relatively high and reduces over time. This causes a large surplus tritium inventory to build up until approximately halfway through the lifetime of the blanket, when the inventory begins to decrease. This surplus tritium inventory could exceed several tens of kilograms of tritium, impacting on possible safety and licensing conditions that may exist. This paper describes a possible solution to the surplus tritium inventory problem that involves neutron poison injection into the coolant, which is managed with a tritium breeding controller. A simple PID controller and is used to manage the injection of the neutron absorbing compounds into

  8. A neutron poison tritium breeding controller applied to a water cooled fusion reactor model

    Energy Technology Data Exchange (ETDEWEB)

    Morgan, L.W.G., E-mail: Lee.Morgan@CCFE.ac.uk; Packer, L.W.

    2014-10-15

    Highlights: • The issue of a potentially producing a large tritium surplus inventory, within a solid breeder, is addressed. • A possible solution to this problem is presented in the form of a neutron poison based tritium production controller. • The tritium surplus inventory has been modelled by the FATI code for a simplified WCCB model and as a function of time. • It has been demonstrated that the tritium surplus inventory can be managed, which may impact on safety considerations. - Abstract: The generation of tritium in sufficient quantities is an absolute requirement for a next step fusion device such as DEMO due to the scarcity of tritium sources. Although the production of sufficient quantities of tritium will be one of the main challenges for DEMO, within an energy economy featuring several fusion power plants the active control of tritium production may be required in order to manage surplus tritium inventories at power plant sites. The primary reason for controlling the tritium inventory in such an economy would therefore be to minimise the risk and storage costs associated with large quantities of surplus tritium. In order to ensure that enough tritium will be produced in a reactor which contains a solid tritium breeder, over the reactor's lifetime, the tritium breeding rate at the beginning of its lifetime is relatively high and reduces over time. This causes a large surplus tritium inventory to build up until approximately halfway through the lifetime of the blanket, when the inventory begins to decrease. This surplus tritium inventory could exceed several tens of kilograms of tritium, impacting on possible safety and licensing conditions that may exist. This paper describes a possible solution to the surplus tritium inventory problem that involves neutron poison injection into the coolant, which is managed with a tritium breeding controller. A simple PID controller and is used to manage the injection of the neutron absorbing compounds into

  9. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    Energy Technology Data Exchange (ETDEWEB)

    Kanginakudru, Sriramana, E-mail: skangina@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); DeSmet, Marsha, E-mail: mdesmet@iupui.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Thomas, Yanique, E-mail: ysthomas@umail.iu.edu [Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States); Morgan, Iain M., E-mail: immorgan@vcu.edu [VCU Philips Institute for Oral Health Research, Virginia Commonwealth University, Richmond, Virginia (United States); Androphy, Elliot J., E-mail: eandro@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States)

    2015-04-15

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication.

  10. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    International Nuclear Information System (INIS)

    Kanginakudru, Sriramana; DeSmet, Marsha; Thomas, Yanique; Morgan, Iain M.; Androphy, Elliot J.

    2015-01-01

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication

  11. Modelling of the edge of a fusion plasma towards ITER and experimental validation on JET

    International Nuclear Information System (INIS)

    Guillemaut, Christophe

    2013-01-01

    The conditions required for fusion can be obtained in tokamaks. In most of these machines, the plasma wall-interaction and the exhaust of heating power are handled in a cavity called divertor. However, the high heat flux involved and the limitations of the materials of the plasma facing components (PFC) are problematic. Many researches are done this field in the context of ITER which should demonstrate 500 MW of DT fusion power during ∼ 400 s. Such operations could bring the heat flux on the PFC too high to be handled. Its reduction to manageable levels relies on the divertor detachment involving the reduction of the particle and heat fluxes on the PFC. Unfortunately, this phenomenon is still difficult to model. The aim of this PhD is to use the modelling of JET experiments with EDGE2D-EIRENE to make some progress in the understanding of the detachment. The simulations reproduce the observed detachment in C and Be/W environments. The distribution of the radiation is well reproduced by the code for C but with some discrepancies in Be/W. The comparison between different sets of atomic physics processes shows that ion-molecule elastic collisions are responsible for the detachment seen in EDGE2D-EIRENE. This process provides good neutral confinement in the divertor and significant momentum losses at low temperature, when the plasma is recombining. Comparison between EDGE2D-EIRENE and SOLPS4.3 shows similar detachment trends but the importance of the ion-molecule elastic collisions is reduced in SOLPS4.3. Both codes suggest that any process capable of improving the neutral confinement in the divertor should help to improve the modelling of the detachment. (author) [fr

  12. BP report of the business year 1979

    Energy Technology Data Exchange (ETDEWEB)

    1980-01-01

    The paper presents a survey about the development of the energy- and petroleum market during the year 1979. A commentary of the German BP A.G. and its activities is given here: personnel- and management policy, exploration, supply, refining and distribution, investigation, and development. After a survey about the business situation of the German BP A.G. the detailed annual balance sheets of 1979 of the German BP and of the whole enterprise are given.

  13. The chicken embryo as an efficient model to test the function of muscle fusion genes in amniotes.

    Directory of Open Access Journals (Sweden)

    Daniel Sieiro

    Full Text Available The fusion of myoblasts into multinucleated myotubes is a crucial step of muscle growth during development and of muscle repair in the adult. While multiple genes were shown to play a role in this process, a vertebrate model where novel candidates can be tested and analyzed at high throughput and relative ease has been lacking. Here, we show that the early chicken embryo is a fast and robust model in which functional testing of muscle fusion candidate genes can be performed. We have used known modulators of muscle fusion, Rac1 and Cdc42, along with the in vivo electroporation of integrated, inducible vectors, to show that the chicken embryo is a suitable model in which their function can be tested and quantified. In addition to nuclei content, specific characteristics of the experimental model allow a fine characterization of additional morphological features that are nearly impossible to assess in other model organisms. This study should establish the chicken embryo as a cheap, reliable and powerful model in which novel vertebrate muscle fusion candidates can be evaluated.

  14. Study on MPGA-BP of Gravity Dam Deformation Prediction

    Directory of Open Access Journals (Sweden)

    Xiaoyu Wang

    2017-01-01

    Full Text Available Displacement is an important physical quantity of hydraulic structures deformation monitoring, and its prediction accuracy is the premise of ensuring the safe operation. Most existing metaheuristic methods have three problems: (1 falling into local minimum easily, (2 slowing convergence, and (3 the initial value’s sensitivity. Resolving these three problems and improving the prediction accuracy necessitate the application of genetic algorithm-based backpropagation (GA-BP neural network and multiple population genetic algorithm (MPGA. A hybrid multiple population genetic algorithm backpropagation (MPGA-BP neural network algorithm is put forward to optimize deformation prediction from periodic monitoring surveys of hydraulic structures. This hybrid model is employed for analyzing the displacement of a gravity dam in China. The results show the proposed model is superior to an ordinary BP neural network and statistical regression model in the aspect of global search, convergence speed, and prediction accuracy.

  15. Uncertainties in modeling of consequences of tritium release from fusion reactors. Plasma Fusion Center No. PFC/TR-79-5

    International Nuclear Information System (INIS)

    Piet, S.J.; Kazimi, M.S.

    1979-07-01

    The bases for various models concerned with all phases of estimating doses from routine tritium releases from fusion reactors have been examined. The implications of uncertainties in parameters and assumptions for the uncertainty of the calculated doses and resulting maximum permissible releases are presented. Global dispersion models are most affected by the assumptions made concerning movement, such as the role of the ocean as a sink. Dose models were generally found to agree within a factor of two, with the largest variation due to agricultural data. Plant tritium flow studies are the least developed and require substantial improvement in the data base. Based on two possible arbitrary global standards, the maximum allowable releases were found to range from 1.6 to 20,000 Ci/day. The local criteria imply releases between 5 and 20 Ci/day

  16. Innovative three-dimensional neutronics analyses directly coupled with cad models of geometrically complex fusion systems

    International Nuclear Information System (INIS)

    Sawan, M.; Wilson, P.; El-Guebaly, L.; Henderson, D.; Sviatoslavsky, G.; Bohm, T.; Kiedrowski, B.; Ibrahim, A.; Smith, B.; Slaybaugh, R.; Tautges, T.

    2007-01-01

    Fusion systems are, in general, geometrically complex requiring detailed three-dimensional (3-D) nuclear analysis. This analysis is required to address tritium self-sufficiency, nuclear heating, radiation damage, shielding, and radiation streaming issues. To facilitate such calculations, we developed an innovative computational tool that is based on the continuous energy Monte Carlo code MCNP and permits the direct use of CAD-based solid models in the ray-tracing. This allows performing the neutronics calculations in a model that preserves the geometrical details without any simplification, eliminates possible human error in modeling the geometry for MCNP, and allows faster design iterations. In addition to improving the work flow for simulating complex 3- D geometries, it allows a richer representation of the geometry compared to the standard 2nd order polynomial representation. This newly developed tool has been successfully tested for a detailed 40 degree sector benchmark of the International Thermonuclear Experimental Reactor (ITER). The calculations included determining the poloidal variation of the neutron wall loading, flux and nuclear heating in the divertor components, nuclear heating in toroidal field coils, and radiation streaming in the mid-plane port. The tool has been applied to perform 3-D nuclear analysis for several fusion designs including the ARIES Compact Stellarator (ARIES-CS), the High Average Power Laser (HAPL) inertial fusion power plant, and ITER first wall/shield (FWS) modules. The ARIES-CS stellarator has a first wall shape and a plasma profile that varies toroidally within each field period compared to the uniform toroidal shape in tokamaks. Such variation cannot be modeled analytically in the standard MCNP code. The impact of the complex helical geometry and the non-uniform blanket and divertor on the overall tritium breeding ratio and total nuclear heating was determined. In addition, we calculated the neutron wall loading variation in

  17. Improved zero dimensional model of a reversed field pinch fusion device

    International Nuclear Information System (INIS)

    Haynes, K.E.

    1987-01-01

    A zero-dimensional model has been developed which accurately predicts conditions observed during several runs of the ZT-40M reversed field pinch fusion device at Los Alamos National Laboratory. The model is based on a physical model developed by E.H. Klevans at Penn State University. Improvements made to this model included the use of coronal non-equilibrium equations for predicting impurity effects, the inclusion of an exponentially decaying ion heating term, and the relaxation of the assumption that ion and electron densities are equal in the device. The model has been used to simulate ZT-40M in both flat-top and slowly ramped current modes. Using experimentally measured density and current evolutions, the model accurately predicts observed tau/sub E/, β/sub Θ/, T/sub e/, T/sub i/, Z/sub eff/, and radiated power. The continuing goal of this work is to predict conditions in the ZT-H device, which is under construction. 28 refs., 18 figs

  18. Generalized liquid drop model and fission, fusion, alpha and cluster radioactivity and superheavy nuclei

    International Nuclear Information System (INIS)

    Royer, G.

    2012-01-01

    A particular version of the liquid drop model taking into account both the mass and charge asymmetries, the proximity energy, the rotational energy, the shell and pairing energies and the temperature has been developed to describe smoothly the transition between one and two-body shapes in entrance and exit channels of nuclear reactions. In the quasi-molecular shape valley where the proximity energy is optimized, the calculated l-dependent fusion and fission barriers, alpha and cluster radioactivity half-lives as well as actinide half-lives are in good agreement with the available experimental data. In this particular deformation path, double-humped potential barriers begin to appear even macroscopically for heavy nuclear systems due to the influence of the proximity forces and, consequently, quasi-molecular isomeric states can survive in the second minimum of the potential barriers in a large angular momentum range

  19. Improved Frequency Fluctuation Model for Spectral Line Shape Calculations in Fusion Plasmas

    International Nuclear Information System (INIS)

    Ferri, S.; Calisti, A.; Mosse, C.; Talin, B.; Lisitsa, V.

    2010-01-01

    A very fast method to calculate spectral line shapes emitted by plasmas accounting for charge particle dynamics and effects of an external magnetic field is proposed. This method relies on a new formulation of the Frequency Fluctuation Model (FFM), which yields to an expression of the dynamic line profile as a functional of the static distribution function of frequencies. This highly efficient formalism, not limited to hydrogen-like systems, allows to calculate pure Stark and Stark-Zeeman line shapes for a wide range of density, temperature and magnetic field values, which is of importance in plasma physics and astrophysics. Various applications of this method are presented for conditions related to fusion plasmas.

  20. Three-dimensional modeling of beam emission spectroscopy measurements in fusion plasmas

    Energy Technology Data Exchange (ETDEWEB)

    Guszejnov, D.; Pokol, G. I. [Department of Nuclear Techniques, Budapest University of Technology and Economics, Association EURATOM, H-1111 Budapest (Hungary); Pusztai, I. [Nuclear Engineering, Applied Physics, Chalmers University of Technology, SE-412 96 Goeteborg (Sweden); Refy, D.; Zoletnik, S. [MTA Wigner FK RMI, Association EURATOM, Pf. 49, H-1525 Budapest (Hungary); Lampert, M. [Department of Nuclear Techniques, Budapest University of Technology and Economics, Association EURATOM, H-1111 Budapest (Hungary); MTA Wigner FK RMI, Association EURATOM, Pf. 49, H-1525 Budapest (Hungary); Nam, Y. U. [National Fusion Research Institute, Gwahangno 113, Daejeon 305-333 (Korea, Republic of)

    2012-11-15

    One of the main diagnostic tools for measuring electron density profiles and the characteristics of long wavelength turbulent wave structures in fusion plasmas is beam emission spectroscopy (BES). The increasing number of BES systems necessitated an accurate and comprehensive simulation of BES diagnostics, which in turn motivated the development of the Rate Equations for Neutral Alkali-beam TEchnique (RENATE) simulation code that is the topic of this paper. RENATE is a modular, fully three-dimensional code incorporating all key features of BES systems from the atomic physics to the observation, including an advanced modeling of the optics. Thus RENATE can be used both in the interpretation of measured signals and the development of new BES systems. The most important components of the code have been successfully benchmarked against other simulation codes. The primary results have been validated against experimental data from the KSTAR tokamak.

  1. Calculational models for the treatment of pulsed/intermittent activation within fusion energy devices

    International Nuclear Information System (INIS)

    Spangler, S.E.; Sisolak, J.E.; Henderson, D.L.

    1993-01-01

    Two calculationally efficient methods have been developed to compute the induced radioactivity due to pulsed/intermittent irradiation histories as encountered in both magnetic and inertial fusion energy devices. The numerical algorithms are based on the linear chain method (Bateman Equations) and employ series reduction and matrix algebra. The first method models the case in which the irradiated materials are present throughout a series of irradiation pulses. The second method treats the case where a fixed amount of radioactive and transmuted material is created during each pulse. Analytical solutions are given for each method for a three nuclide linear chain. Numerical results and comparisons are presented for a select number of linear chains. (orig.)

  2. Models and analyses for inertial-confinement fusion-reactor studies

    International Nuclear Information System (INIS)

    Bohachevsky, I.O.

    1981-05-01

    This report describes models and analyses devised at Los Alamos National Laboratory to determine the technical characteristics of different inertial confinement fusion (ICF) reactor elements required for component integration into a functional unit. We emphasize the generic properties of the different elements rather than specific designs. The topics discussed are general ICF reactor design considerations; reactor cavity phenomena, including the restoration of interpulse ambient conditions; first-wall temperature increases and material losses; reactor neutronics and hydrodynamic blanket response to neutron energy deposition; and analyses of loads and stresses in the reactor vessel walls, including remarks about the generation and propagation of very short wavelength stress waves. A discussion of analytic approaches useful in integrations and optimizations of ICF reactor systems concludes the report

  3. Drucker-Prager-Cap creep modelling of pebble beds in fusion blankets

    International Nuclear Information System (INIS)

    Hofer, D.; Kamlah, M.

    2005-01-01

    Modelling of thermal and mechanical behaviour of pebble beds for fusion blankets is an important issue to understand the interaction of solid breeder and beryllium pebble beds with the surrounding structural material. Especially the differing coefficients of thermal expansion of these materials cause high stresses and strains during irradiation induced volumetric heating. To describe this process, the coupled thermomechanical behaviour of both pebble bed materials has to be modelled. Additionally, creep has to be considered contributing to bed deformations and stress relaxation. Motivated by experiments, we use a continuum mechanical approach called Drucker-Prager/Cap theory to model the macroscopic pebble bed behaviour. The model accounts for pressure dependent shear failure, inelastic hardening, and volumetric creep. The elastic part is described by a nonlinear elasticity law. The model has been implemented by user-defined routines in the commercial finite-element code ABAQUS. To check the numerics, the implementation is compared to an analytical solution. Furthermore, the Drucker-Prager/Cap tool is applied to a single ceramic breeder bed subject to creep under volumetric heating

  4. On the hyperporous non-linear elasticity model for fusion-relevant pebble beds

    International Nuclear Information System (INIS)

    Di Maio, P.A.; Giammusso, R.; Vella, G.

    2010-01-01

    Packed pebble beds are particular granular systems composed of a large amount of small particles, arranged in irregular lattices and surrounded by a gas filling interstitial spaces. Due to their heterogeneous structure, pebble beds have non-linear and strongly coupled thermal and mechanical behaviours whose constitutive models seem limited, being not suitable for fusion-relevant design-oriented applications. Within the framework of the modelling activities promoted for the lithiated ceramics and beryllium pebble beds foreseen in the Helium-Cooled Pebble Bed breeding blanket concept of DEMO, at the Department of Nuclear Engineering of the University of Palermo (DIN) a thermo-mechanical constitutive model has been set-up assuming that pebble beds can be considered as continuous, homogeneous and isotropic media. The present paper deals with the DIN non-linear elasticity constitutive model, based on the assumption that during the reversible straining of a pebble bed its effective logarithmic bulk modulus depends on the equivalent pressure according to a modified power law and its effective Poisson modulus remains constant. In these hypotheses the functional dependence of the effective tangential and secant bed deformation moduli on either the equivalent pressure or the volumetric strain have been derived in a closed analytical form. A procedure has been, then, defined to assess the model parameters for a given pebble bed from its oedometric test results and it has been applied to both polydisperse lithium orthosilicate and single size beryllium pebble beds.

  5. Fokker-Planck Modelling of Delayed Loss of Charged Fusion Products in TFTR

    International Nuclear Information System (INIS)

    Edenstrasser, J.W.; Goloborod'ko, V.Ya.; Reznik, S.N.; Yavorskij, V.A.; Zweben, S.

    1998-01-01

    The results of a Fokker-Planck simulation of the ripple-induced loss of charged fusion products in the Tokamak Fusion Test Reactor (TFTR) are presented. It is shown that the main features of the measured ''delayed loss'' of partially thermalized fusion products, such as the differences between deuterium-deuterium and deuterium-tritium discharges, the plasma current and major radius dependencies, etc., are in satisfactory agreement with the classical collisional ripple transport mechanism. The inclusion of the inward shift of the vacuum flux surfaces turns out to be necessary for an adequate and consistent explanation of the origin of the partially thermalized fusion product loss to the bottom of TFTR

  6. BP - bisnis põhjas? / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2010-01-01

    Seoses Mehhiko lahe naftareostusega ootab BP-d kuni 21 mld. dollari suurune trahv, kahjude hüvitamiseks peab BP müüma osa oma varast. Ekspertide hinnangul tähendavad Mehhiko lahe sündmused suuri muutusi kogu naftaäris

  7. A Neural Network Approach for Building An Obstacle Detection Model by Fusion of Proximity Sensors Data

    Science.gov (United States)

    Peralta, Emmanuel; Vargas, Héctor; Hermosilla, Gabriel

    2018-01-01

    Proximity sensors are broadly used in mobile robots for obstacle detection. The traditional calibration process of this kind of sensor could be a time-consuming task because it is usually done by identification in a manual and repetitive way. The resulting obstacles detection models are usually nonlinear functions that can be different for each proximity sensor attached to the robot. In addition, the model is highly dependent on the type of sensor (e.g., ultrasonic or infrared), on changes in light intensity, and on the properties of the obstacle such as shape, colour, and surface texture, among others. That is why in some situations it could be useful to gather all the measurements provided by different kinds of sensor in order to build a unique model that estimates the distances to the obstacles around the robot. This paper presents a novel approach to get an obstacles detection model based on the fusion of sensors data and automatic calibration by using artificial neural networks. PMID:29495338

  8. Extended MHD modeling of nonlinear instabilities in fusion and space plasmas

    Energy Technology Data Exchange (ETDEWEB)

    Germaschewski, Kai [Univ. of New Hampshire, Durham, NH (United States)

    2017-11-15

    A number of different sub-projects where pursued within this DOE early career project. The primary focus was on using fully nonlinear, curvilinear, extended MHD simulations of instabilities with applications to fusion and space plasmas. In particular, we performed comprehensive studies of the dynamics of the double tearing mode in different regimes and confi gurations, using Cartesian and cyclindrical geometry and investigating both linear and non-linear dynamics. In addition to traditional extended MHD involving Hall term and electron pressure gradient, we also employed a new multi-fluid moment model, which shows great promise to incorporate kinetic effects, in particular off-diagonal elements of the pressure tensor, in a fluid model, which is naturally computationally much cheaper than fully kinetic particle or Vlasov simulations. We used our Vlasov code for detailed studies of how weak collisions effect plasma echos. In addition, we have played an important supporting role working with the PPPL theory group around Will Fox and Amitava Bhattacharjee on providing simulation support for HED plasma experiments performed at high-powered laser facilities like OMEGA-EP in Rochester, NY. This project has support a great number of computational advances in our fluid and kinetic plasma models, and has been crucial to winning multiple INCITE computer time awards that supported our computational modeling.

  9. Fusion of Terrestrial and Airborne Laser Data for 3D modeling Applications

    Science.gov (United States)

    Mohammed, Hani Mahmoud

    This thesis deals with the 3D modeling phase of the as-built large BIM projects. Among several means of BIM data capturing, such as photogrammetric or range tools, laser scanners have been one of the most efficient and practical tool for a long time. They can generate point clouds with high resolution for 3D models that meet nowadays' market demands. The current 3D modeling projects of as-built BIMs are mainly focused on using one type of laser scanner data, such as Airborne or Terrestrial. According to the literatures, no significant (few) efforts were made towards the fusion of heterogeneous laser scanner data despite its importance. The importance of the fusion of heterogeneous data arises from the fact that no single type of laser data can provide all the information about BIM, especially for large BIM projects that are existing on a large area, such as university buildings, or Heritage places. Terrestrial laser scanners are able to map facades of buildings and other terrestrial objects. However, they lack the ability to map roofs or higher parts in the BIM project. Airborne laser scanner on the other hand, can map roofs of the buildings efficiently and can map only small part of the facades. Short range laser scanners can map the interiors of the BIM projects, while long range scanners are used for mapping wide exterior areas in BIM projects. In this thesis the long range laser scanner data obtained in the Stop-and-Go mapping mode, the short range laser scanner data, obtained in a fully static mapping mode, and the airborne laser data are all fused together to bring a complete effective solution for a large BIM project. Working towards the 3D modeling of BIM projects, the thesis framework starts with the registration of the data, where a new fast automatic registration algorithm were developed. The next step is to recognize the different objects in the BIM project (classification), and obtain 3D models for the buildings. The last step is the development of an

  10. Higgs boson decays and production via gluon fusion at LHC in littlest Higgs models with T parity

    International Nuclear Information System (INIS)

    Wang Lei; Yang Jinmin

    2009-01-01

    We study the Higgs boson decays and production via gluon fusion at the LHC as a probe of two typical littlest Higgs models which introduce a top quark partner with different (even and odd) T parity to cancel the Higgs mass quadratic divergence contributed by the top quark. For each model, we consider two different choices for the down-type quark Yukawa couplings. We first examine the branching ratios of the Higgs boson decays and then study the production via gluon fusion followed by the decay into two photons or two weak gauge bosons. We find that the predictions can be quite different for different models or different choices of down-type quark Yukawa couplings, and all these predictions can sizably deviate from the standard model predictions. So the Higgs boson processes at the LHC can be a sensitive probe for these littlest Higgs models.

  11. RanBP2 modulates Cox11 and hexokinase I activities and haploinsufficiency of RanBP2 causes deficits in glucose metabolism.

    Directory of Open Access Journals (Sweden)

    Azamat Aslanukov

    2006-10-01

    Full Text Available The Ran-binding protein 2 (RanBP2 is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/- are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/- mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.

  12. RanBP2 modulates Cox11 and hexokinase I activities and haploinsufficiency of RanBP2 causes deficits in glucose metabolism.

    Science.gov (United States)

    Aslanukov, Azamat; Bhowmick, Reshma; Guruju, Mallikarjuna; Oswald, John; Raz, Dorit; Bush, Ronald A; Sieving, Paul A; Lu, Xinrong; Bock, Cheryl B; Ferreira, Paulo A

    2006-10-01

    The Ran-binding protein 2 (RanBP2) is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s) of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI) via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/-) are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/-) mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.

  13. Incompressible LFR MHD. A fluid model for stability analysis of a fusion plasma

    International Nuclear Information System (INIS)

    Scheffel, J.; Faghihi, M.

    1986-10-01

    A fluid model including FLR effects, named Incompressible Finite Larmor Radius MagnetoHydroDynamics, is presented and derived in this paper. It is an extension of ordinary, incompressible MHD to include the Larmor radius effects due to ion gyroviscosity, Hall current and electron diamagnetism. It is intended to use the model for stability analysis, on the Alfven wave time scale, of a fusion plasma and it is consequently based on transport coefficients in the collisionless limit. It will be demonstrated that for a fairly dense and cool plasma, such as for the EXTRAP z-pinch, all three Larmor radius effects may become important, that for a JET-type plasma no FLR effect is pronounced, and that in a reactor plasma the Hall and electron diamagnetism term may play a role. For scaling lengths signigicantly smaller than the plasma radius the effect of the FLR terms becomes enhanced. To study the importance of the choice of equations of state for the model the m=1 and k 2 r 2 towards infinity instability in cylindrical geometry is given special attention for zero Larmor radius. The full stability criterion of the double adiabatic model, including pressure anisotropy, is presented for what we believe to be the first time. It is found that when perpendicular p > parallel p stability can be reached for very high plasma perpendicular β-values. We demonstrate that no less complicated energy conserving fluid model, which takes into account pressure anisotropy, other than the double adiabativ model can be obtained. Since pressure anisotropy generally only weakly affects stability, we can assume isotropy in the Incompressible FLR MHD model. Also, the energy equation is replaced by the incompressibility condition, making FLR terms appearing in the energy equation irrelevant. (authors)

  14. Thought-action fusion: a comprehensive analysis using structural equation modeling.

    Science.gov (United States)

    Marino, Teresa L; Lunt, Rachael A; Negy, Charles

    2008-07-01

    Thought-action fusion (TAF), the phenomenon whereby one has difficulty separating cognitions from corresponding behaviors, has implications in a wide variety of disturbances, including eating disorders, obsessive-compulsive disorder, generalized anxiety disorder, and panic disorder. Numerous constructs believed to contribute to the etiology or maintenance of TAF have been identified in the literature, but to date, no study has empirically integrated these findings into a comprehensive model. In this study, we examined simultaneously an array of variables thought to be related to TAF, and subsequently developed a model that elucidates the role of those variables that seem most involved in this phenomenon using a structural equation modeling approach. Results indicated that religiosity, as predicted by ethnic identity, was a significant predictor of TAF. Additionally, the relation between ethnic identity and TAF was partially mediated by an inflated sense of responsibility. Both TAF and obsessive-compulsive symptoms were found to be significant predictors of engagement in neutralization activities. Clinical and theoretical implications are discussed.

  15. Experimental investigation of opacity models for stellar interior, inertial fusion, and high energy density plasmas

    International Nuclear Information System (INIS)

    Bailey, J. E.; Rochau, G. A.; Mancini, R. C.; Iglesias, C. A.; MacFarlane, J. J.; Golovkin, I. E.; Blancard, C.; Cosse, Ph.; Faussurier, G.

    2009-01-01

    Theoretical opacities are required for calculating energy transport in plasmas. In particular, understanding stellar interiors, inertial fusion, and Z pinches depends on the opacities of mid-atomic-number elements over a wide range of temperatures. The 150-300 eV temperature range is particularly interesting. The opacity models are complex and experimental validation is crucial. For example, solar models presently disagree with helioseismology and one possible explanation is inadequate theoretical opacities. Testing these opacities requires well-characterized plasmas at temperatures high enough to produce the ion charge states that exist in the sun. Typical opacity experiments heat a sample using x rays and measure the spectrally resolved transmission with a backlight. The difficulty grows as the temperature increases because the heating x-ray source must supply more energy and the backlight must be bright enough to overwhelm the plasma self-emission. These problems can be overcome with the new generation of high energy density (HED) facilities. For example, recent experiments at Sandia's Z facility [M. K. Matzen et al., Phys. Plasmas 12, 055503 (2005)] measured the transmission of a mixed Mg and Fe plasma heated to 156±6 eV. This capability will also advance opacity science for other HED plasmas. This tutorial reviews experimental methods for testing opacity models, including experiment design, transmission measurement methods, accuracy evaluation, and plasma diagnostics. The solar interior serves as a focal problem and Z facility experiments illustrate the techniques.

  16. Modeling of liquid-metal corrosion/deposition in a fusion reactor blanket

    International Nuclear Information System (INIS)

    Malang, S.; Smith, D.L.

    1984-04-01

    A model has been developed for the investigation of the liquid-metal corrosion and the corrosion product transport in a liquid-metal-cooled fusion reactor blanket. The model describes the two-dimensional transport of wall material in the liquid-metal flow and is based on the following assumptions: (1) parallel flow in a straight circular tube; (2) transport of wall material perpendicular to the flow direction by diffusion and turbulent exchange; in flow direction by the flow motion only; (3) magnetic field causes uniform velocity profile with thin boundary layer and suppresses turbulent mass exchange; and (4) liquid metal at the interface is saturated with wall material. A computer code based on this model has been used to analyze the corrosion of ferritic steel by lithium lead and the deposition of wall material in the cooler part of a loop. Three cases have been investigated: (1) ANL forced convection corrosion experiment (without magnetic field); (2) corrosion in the MARS liquid-metal-cooled blanket (with magnetic field); and (3) deposition of wall material in the corrosion product cleanup system of the MARS blanket loop

  17. Data Field Modeling and Spectral-Spatial Feature Fusion for Hyperspectral Data Classification.

    Science.gov (United States)

    Liu, Da; Li, Jianxun

    2016-12-16

    Classification is a significant subject in hyperspectral remote sensing image processing. This study proposes a spectral-spatial feature fusion algorithm for the classification of hyperspectral images (HSI). Unlike existing spectral-spatial classification methods, the influences and interactions of the surroundings on each measured pixel were taken into consideration in this paper. Data field theory was employed as the mathematical realization of the field theory concept in physics, and both the spectral and spatial domains of HSI were considered as data fields. Therefore, the inherent dependency of interacting pixels was modeled. Using data field modeling, spatial and spectral features were transformed into a unified radiation form and further fused into a new feature by using a linear model. In contrast to the current spectral-spatial classification methods, which usually simply stack spectral and spatial features together, the proposed method builds the inner connection between the spectral and spatial features, and explores the hidden information that contributed to classification. Therefore, new information is included for classification. The final classification result was obtained using a random forest (RF) classifier. The proposed method was tested with the University of Pavia and Indian Pines, two well-known standard hyperspectral datasets. The experimental results demonstrate that the proposed method has higher classification accuracies than those obtained by the traditional approaches.

  18. Improvement of density models of geological structures by fusion of gravity data and cosmic muon radiographies

    Science.gov (United States)

    Jourde, K.; Gibert, D.; Marteau, J.

    2015-08-01

    This paper examines how the resolution of small-scale geological density models is improved through the fusion of information provided by gravity measurements and density muon radiographies. Muon radiography aims at determining the density of geological bodies by measuring their screening effect on the natural flux of cosmic muons. Muon radiography essentially works like a medical X-ray scan and integrates density information along elongated narrow conical volumes. Gravity measurements are linked to density by a 3-D integration encompassing the whole studied domain. We establish the mathematical expressions of these integration formulas - called acquisition kernels - and derive the resolving kernels that are spatial filters relating the true unknown density structure to the density distribution actually recovered from the available data. The resolving kernel approach allows one to quantitatively describe the improvement of the resolution of the density models achieved by merging gravity data and muon radiographies. The method developed in this paper may be used to optimally design the geometry of the field measurements to be performed in order to obtain a given spatial resolution pattern of the density model to be constructed. The resolving kernels derived in the joined muon-gravimetry case indicate that gravity data are almost useless for constraining the density structure in regions sampled by more than two muon tomography acquisitions. Interestingly, the resolution in deeper regions not sampled by muon tomography is significantly improved by joining the two techniques. The method is illustrated with examples for the La Soufrière volcano of Guadeloupe.

  19. Computational Intelligence Based Data Fusion Algorithm for Dynamic sEMG and Skeletal Muscle Force Modelling

    Energy Technology Data Exchange (ETDEWEB)

    Chandrasekhar Potluri,; Madhavi Anugolu; Marco P. Schoen; D. Subbaram Naidu

    2013-08-01

    In this work, an array of three surface Electrography (sEMG) sensors are used to acquired muscle extension and contraction signals for 18 healthy test subjects. The skeletal muscle force is estimated using the acquired sEMG signals and a Non-linear Wiener Hammerstein model, relating the two signals in a dynamic fashion. The model is obtained from using System Identification (SI) algorithm. The obtained force models for each sensor are fused using a proposed fuzzy logic concept with the intent to improve the force estimation accuracy and resilience to sensor failure or misalignment. For the fuzzy logic inference system, the sEMG entropy, the relative error, and the correlation of the force signals are considered for defining the membership functions. The proposed fusion algorithm yields an average of 92.49% correlation between the actual force and the overall estimated force output. In addition, the proposed fusionbased approach is implemented on a test platform. Experiments indicate an improvement in finger/hand force estimation.

  20. Fiducial-based fusion of 3D dental models with magnetic resonance imaging.

    Science.gov (United States)

    Abdi, Amir H; Hannam, Alan G; Fels, Sidney

    2018-04-16

    Magnetic resonance imaging (MRI) is widely used in study of maxillofacial structures. While MRI is the modality of choice for soft tissues, it fails to capture hard tissues such as bone and teeth. Virtual dental models, acquired by optical 3D scanners, are becoming more accessible for dental practice and are starting to replace the conventional dental impressions. The goal of this research is to fuse the high-resolution 3D dental models with MRI to enhance the value of imaging for applications where detailed analysis of maxillofacial structures are needed such as patient examination, surgical planning, and modeling. A subject-specific dental attachment was digitally designed and 3D printed based on the subject's face width and dental anatomy. The attachment contained 19 semi-ellipsoidal concavities in predetermined positions where oil-based ellipsoidal fiducial markers were later placed. The MRI was acquired while the subject bit on the dental attachment. The spatial position of the center of mass of each fiducial in the resultant MR Image was calculated by averaging its voxels' spatial coordinates. The rigid transformation to fuse dental models to MRI was calculated based on the least squares mapping of corresponding fiducials and solved via singular-value decomposition. The target registration error (TRE) of the proposed fusion process, calculated in a leave-one-fiducial-out fashion, was estimated at 0.49 mm. The results suggest that 6-9 fiducials suffice to achieve a TRE of equal to half the MRI voxel size. Ellipsoidal oil-based fiducials produce distinguishable intensities in MRI and can be used as registration fiducials. The achieved accuracy of the proposed approach is sufficient to leverage the merged 3D dental models with the MRI data for a finer analysis of the maxillofacial structures where complete geometry models are needed.

  1. A Comprehensive Decision-Making Approach Based on Hierarchical Attribute Model for Information Fusion Algorithms’ Performance Evaluation

    Directory of Open Access Journals (Sweden)

    Lianhui Li

    2014-01-01

    Full Text Available Aiming at the problem of fusion algorithm performance evaluation in multiradar information fusion system, firstly the hierarchical attribute model of track relevance performance evaluation model is established based on the structural model and functional model and quantization methods of evaluation indicators are given; secondly a combination weighting method is proposed to determine the weights of evaluation indicators, in which the objective and subjective weights are separately determined by criteria importance through intercriteria correlation (CRITIC and trapezoidal fuzzy scale analytic hierarchy process (AHP, and then experience factor is introduced to obtain the combination weight; at last the improved technique for order preference by similarity to ideal solution (TOPSIS replacing Euclidean distance with Kullback-Leibler divergence (KLD is used to sort the weighted indicator value of the evaluation object. An example is given to illustrate the correctness and feasibility of the proposed method.

  2. Fusion spectroscopy

    International Nuclear Information System (INIS)

    Peacock, N.J.

    1995-09-01

    This article traces developments in the spectroscopy of high temperature laboratory plasma used in controlled fusion research from the early 1960's until the present. These three and a half decades have witnessed many orders of magnitude increase in accessible plasma parameters such as density and temperature as well as particle and energy confinement timescales. Driven by the need to interpret the radiation in terms of the local plasma parameters, the thrust of fusion spectroscopy has been to develop our understanding of (i) the atomic structure of highly ionised atoms, usually of impurities in the hydrogen isotope fuel; (ii) the atomic collision rates and their incorporation into ionization structure and emissivity models that take into account plasma phenomena like plasma-wall interactions, particle transport and radiation patterns; (iii) the diagnostic applications of spectroscopy aided by increasingly sophisticated characterisation of the electron fluid. These topics are discussed in relation to toroidal magnetically confined plasmas, particularly the Tokamak which appears to be the most promising approach to controlled fusion to date. (author)

  3. Predictive modelling of edge transport phenomena in ELMy H-mode tokamak fusion plasmas

    International Nuclear Information System (INIS)

    Loennroth, J.-S.

    2009-01-01

    This thesis discusses a range of work dealing with edge plasma transport in magnetically confined fusion plasmas by means of predictive transport modelling, a technique in which qualitative predictions and explanations are sought by running transport codes equipped with models for plasma transport and other relevant phenomena. The focus is on high confinement mode (H-mode) tokamak plasmas, which feature improved performance thanks to the formation of an edge transport barrier. H-mode plasmas are generally characterized by the occurrence of edge localized modes (ELMs), periodic eruptions of particles and energy, which limit confinement and may turn out to be seriously damaging in future tokamaks. The thesis introduces schemes and models for qualitative study of the ELM phenomenon in predictive transport modelling. It aims to shed new light on the dynamics of ELMs using these models. It tries to explain various experimental observations related to the performance and ELM-behaviour of H-mode plasmas. Finally, it also tries to establish more generally the potential effects of ripple-induced thermal ion losses on H-mode plasma performance and ELMs. It is demonstrated that the proposed ELM modelling schemes can qualitatively reproduce the experimental dynamics of a number of ELM regimes. Using a theory-motivated ELM model based on a linear instability model, the dynamics of combined ballooning-peeling mode ELMs is studied. It is shown that the ELMs are most often triggered by a ballooning mode instability, which renders the plasma peeling mode unstable, causing the ELM to continue in a peeling mode phase. Understanding the dynamics of ELMs will be a key issue when it comes to controlling and mitigating the ELMs in future large tokamaks. By means of integrated modelling, it is shown that an experimentally observed increase in the ELM frequency and deterioration of plasma confinement triggered by external neutral gas puffing might be due to a transition from the second to

  4. EMP Fusion

    OpenAIRE

    KUNTAY, Isık

    2010-01-01

    This paper introduces a novel fusion scheme, called EMP Fusion, which has the promise of achieving breakeven and realizing commercial fusion power. The method is based on harnessing the power of an electromagnetic pulse generated by the now well-developed flux compression technology. The electromagnetic pulse acts as a means of both heating up the plasma and confining the plasma, eliminating intermediate steps. The EMP Fusion device is simpler compared to other fusion devices and this reduces...

  5. Beating Heart Motion Accurate Prediction Method Based on Interactive Multiple Model: An Information Fusion Approach

    Science.gov (United States)

    Xie, Weihong; Yu, Yang

    2017-01-01

    Robot-assisted motion compensated beating heart surgery has the advantage over the conventional Coronary Artery Bypass Graft (CABG) in terms of reduced trauma to the surrounding structures that leads to shortened recovery time. The severe nonlinear and diverse nature of irregular heart rhythm causes enormous difficulty for the robot to realize the clinic requirements, especially under arrhythmias. In this paper, we propose a fusion prediction framework based on Interactive Multiple Model (IMM) estimator, allowing each model to cover a distinguishing feature of the heart motion in underlying dynamics. We find that, at normal state, the nonlinearity of the heart motion with slow time-variant changing dominates the beating process. When an arrhythmia occurs, the irregularity mode, the fast uncertainties with random patterns become the leading factor of the heart motion. We deal with prediction problem in the case of arrhythmias by estimating the state with two behavior modes which can adaptively “switch” from one to the other. Also, we employed the signal quality index to adaptively determine the switch transition probability in the framework of IMM. We conduct comparative experiments to evaluate the proposed approach with four distinguished datasets. The test results indicate that the new proposed approach reduces prediction errors significantly. PMID:29124062

  6. Beating Heart Motion Accurate Prediction Method Based on Interactive Multiple Model: An Information Fusion Approach

    Directory of Open Access Journals (Sweden)

    Fan Liang

    2017-01-01

    Full Text Available Robot-assisted motion compensated beating heart surgery has the advantage over the conventional Coronary Artery Bypass Graft (CABG in terms of reduced trauma to the surrounding structures that leads to shortened recovery time. The severe nonlinear and diverse nature of irregular heart rhythm causes enormous difficulty for the robot to realize the clinic requirements, especially under arrhythmias. In this paper, we propose a fusion prediction framework based on Interactive Multiple Model (IMM estimator, allowing each model to cover a distinguishing feature of the heart motion in underlying dynamics. We find that, at normal state, the nonlinearity of the heart motion with slow time-variant changing dominates the beating process. When an arrhythmia occurs, the irregularity mode, the fast uncertainties with random patterns become the leading factor of the heart motion. We deal with prediction problem in the case of arrhythmias by estimating the state with two behavior modes which can adaptively “switch” from one to the other. Also, we employed the signal quality index to adaptively determine the switch transition probability in the framework of IMM. We conduct comparative experiments to evaluate the proposed approach with four distinguished datasets. The test results indicate that the new proposed approach reduces prediction errors significantly.

  7. A fusion networking model for smart grid power distribution backbone communication network based on PTN

    Directory of Open Access Journals (Sweden)

    Wang Hao

    2016-01-01

    Full Text Available In current communication network for distribution in Chinese power grid systems, the fiber communication backbone network for distribution and TD-LTE power private wireless backhaul network of power grid are both bearing by the SDH optical transmission network, which also carries the communication network of transformer substation and main electric. As the data traffic of the distribution communication and TD-LTE power private wireless network grow rapidly in recent years, it will have a big impact with the SDH network’s bearing capacity which is mainly used for main electric communication in high security level. This paper presents a fusion networking model which use a multiple-layer PTN network as the unified bearing of the TD-LTE power private wireless backhaul network and fiber communication backbone network for distribution. Network dataflow analysis shows that this model can greatly reduce the capacity pressure of the traditional SDH network as well as ensure the reliability of the transmission of the communication network for distribution and TD-LTE power private wireless network.

  8. Resonances and fusion in heavy ion reactions: new models and developments

    International Nuclear Information System (INIS)

    Cindro, N.

    1982-01-01

    Several aspects of the problem of the resonant behaviour of heavy-ion induced reactions are discussed. First, the problem is set in its relation to fundamental nuclear physics and our understanding of nuclear structure. It is suggested that, if the resonant behaviour of heavy-ion reactions is indeed due to the presence of particular configurations in the composite systems, these configurations must have a very specific nature which prevents their mixing with the adjacent states or else other conditons (e.g. low level density) should be met. Further on, the problem of resonant behaviour observed in back-angle elastic scattering and in forward-angle reaction data is discussed. Collisions between heavy ions leading to the composite systems 36 Ar and 40 Ca are used to discuss the apparent lack of correlation between these two sets of data. A way to understand it, based on the fragmentation of broad resonances, is suggested. In the third part the relation between structure in the fusion cross section excitation functions and that in reaction channel cross sections is discussed. Finally, in the fourth part, the orbiting-cluster model of heavy-ion resonances is briefly described and its predictions discussed. Based on this model a list is given of colliding heavy-ion systems where resonances are expected. (author)

  9. 基于BP神经网络的音乐情感分类及评价模型%Music emotion classification and evaluation model based on BP neural network

    Institute of Scientific and Technical Information of China (English)

    赵伟

    2015-01-01

    针对多音轨MIDI文件,提出一种多音轨MIDI音乐主旋律识别方法,通过对表征音乐旋律特征的音高、音长、音色、速度和力度5个特征向量的提取,构建基于BP神经网络的情感模型,并且用200首不同情感特征的歌曲对其进行训练和验证。实验结果显示取得了较好的效果。%The audio track of music melody includes a lot of useful information of music melody, which is the basic of music character recognition and also the premise work in the design of the performance plan of music foundation .Five eigenvectors:pitch, length, tone tempo and strength are extracted for the expression of music melody, by which, the basic music character recognition system can be set up. A emotion model is formed by using BP neural network.200 songs with different emotional characteristic songs will be used as the sample data for the training and validation of the neural network. The results of validation shows the effectiveness of the emotion model.

  10. Fusion of Nonionic Vesicles

    DEFF Research Database (Denmark)

    Bulut, Sanja; Oskolkova, M. Z.; Schweins, R.

    2010-01-01

    We present an experimental study of vesicle fusion using light and neutron scattering to monitor fusion events. Vesicles are reproducibly formed with an extrusion procedure using an single amphiphile triethylene glycol mono-n-decyl ether in water. They show long-term stability for temperatures ar...... a barrier to fusion changing from 15 k(B)T at T = 26 degrees C to 10k(H) T at T = 35 degrees C. These results are compatible with the theoretical predictions using the stalk model of vesicle fusion....

  11. Data Fusion of Gridded Snow Products Enhanced with Terrain Covariates and a Simple Snow Model

    Science.gov (United States)

    Snauffer, A. M.; Hsieh, W. W.; Cannon, A. J.

    2017-12-01

    Hydrologic planning requires accurate estimates of regional snow water equivalent (SWE), particularly areas with hydrologic regimes dominated by spring melt. While numerous gridded data products provide such estimates, accurate representations are particularly challenging under conditions of mountainous terrain, heavy forest cover and large snow accumulations, contexts which in many ways define the province of British Columbia (BC), Canada. One promising avenue of improving SWE estimates is a data fusion approach which combines field observations with gridded SWE products and relevant covariates. A base artificial neural network (ANN) was constructed using three of the best performing gridded SWE products over BC (ERA-Interim/Land, MERRA and GLDAS-2) and simple location and time covariates. This base ANN was then enhanced to include terrain covariates (slope, aspect and Terrain Roughness Index, TRI) as well as a simple 1-layer energy balance snow model driven by gridded bias-corrected ANUSPLIN temperature and precipitation values. The ANN enhanced with all aforementioned covariates performed better than the base ANN, but most of the skill improvement was attributable to the snow model with very little contribution from the terrain covariates. The enhanced ANN improved station mean absolute error (MAE) by an average of 53% relative to the composing gridded products over the province. Interannual peak SWE correlation coefficient was found to be 0.78, an improvement of 0.05 to 0.18 over the composing products. This nonlinear approach outperformed a comparable multiple linear regression (MLR) model by 22% in MAE and 0.04 in interannual correlation. The enhanced ANN has also been shown to estimate better than the Variable Infiltration Capacity (VIC) hydrologic model calibrated and run for four BC watersheds, improving MAE by 22% and correlation by 0.05. The performance improvements of the enhanced ANN are statistically significant at the 5% level across the province and

  12. BP Investment Exceeds $4 Bln in china

    Institute of Scientific and Technical Information of China (English)

    Wang Ping

    2008-01-01

    @@ British Petroleum (BP) recently signed a series of agreements with China including those in clean energy and wind power generation, during British Prime Minister Gordon Brown's visit to China in mid-January.

  13. BP teatas harvast edusammust / Hendrik Vosman

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2010-01-01

    Naftakompanii BP teatas, et suudab Mehhiko lahest päevas kinni püüda sinna lekkinud 10 000 barrelit naftat. Tegu on ajutise lahendusega, lõplikult peaks naftavoo peatama merepõhja puuritavad nn. asenduskaevud

  14. Osteoclast Fusion

    DEFF Research Database (Denmark)

    Marie Julie Møller, Anaïs; Delaissé, Jean-Marie; Søe, Kent

    2017-01-01

    on the nuclearity of fusion partners. While CD47 promotes cell fusions involving mono-nucleated pre-osteoclasts, syncytin-1 promotes fusion of two multi-nucleated osteoclasts, but also reduces the number of fusions between mono-nucleated pre-osteoclasts. Furthermore, CD47 seems to mediate fusion mostly through...... individual fusion events using time-lapse and antagonists of CD47 and syncytin-1. All time-lapse recordings have been studied by two independent observers. A total of 1808 fusion events were analyzed. The present study shows that CD47 and syncytin-1 have different roles in osteoclast fusion depending...... broad contact surfaces between the partners' cell membrane while syncytin-1 mediate fusion through phagocytic-cup like structure. J. Cell. Physiol. 9999: 1-8, 2016. © 2016 Wiley Periodicals, Inc....

  15. An epidemic model for biological data fusion in ad hoc sensor networks

    Science.gov (United States)

    Chang, K. C.; Kotari, Vikas

    2009-05-01

    Bio terrorism can be a very refined and a catastrophic approach of attacking a nation. This requires the development of a complete architecture dedicatedly designed for this purpose which includes but is not limited to Sensing/Detection, Tracking and Fusion, Communication, and others. In this paper we focus on one such architecture and evaluate its performance. Various sensors for this specific purpose have been studied. The accent has been on use of Distributed systems such as ad-hoc networks and on application of epidemic data fusion algorithms to better manage the bio threat data. The emphasis has been on understanding the performance characteristics of these algorithms under diversified real time scenarios which are implemented through extensive JAVA based simulations. Through comparative studies on communication and fusion the performance of channel filter algorithm for the purpose of biological sensor data fusion are validated.

  16. Engineering human cell spheroids to model embryonic tissue fusion in vitro.

    Science.gov (United States)

    Epithelial-mesenchymal interactions drive embryonic fusion events during development and upon perturbation can result in birth defects. Cleft palate and neural tube defects can result from genetic defects or environmental exposures during development, yet very little is known abo...

  17. Data for human cell spheroid model of embryonic tissue fusion in vitro.

    Data.gov (United States)

    U.S. Environmental Protection Agency — Epithelial-mesenchymal interactions drive embryonic fusion events during development and upon perturbation can result in birth defects. Cleft palate and neural tube...

  18. Modeling of cascade and sub-cascade formation at high pka energies in irradiated fusion structural materials

    International Nuclear Information System (INIS)

    Ryazanov, A.; Metelkin, E.V.; Semenov, E.A.

    2007-01-01

    Full text of publication follows: A new theoretical model is developed for the investigations of cascade and sub-cascade formation in fusion structural materials under fast neutron irradiation at high primary knock atom (PKA) energies. Under 14 MeV neutron irradiation especially of light fusion structural materials such as Be, C, SiC materials PKA will have the energies up to 1 MeV. At such high energies it is very difficult to use the Monte Carlo or molecular dynamic simulations. The developed model is based on the analytical consideration of elastic collisions between displaced moving atoms into atomic cascades produced by a PKAs with the some kinetic energy obtained from fast neutrons. The Tomas-Fermy interaction potential is used for the describing of elastic collisions between moving atoms. The suggested model takes into account also the electronic losses for moving atoms between elastic collisions. The self consistent criterion for sub-cascade formation is suggested here which is based on the comparison of mean distance between two consequent PKA collisions and size of sub-cascade produced by PKA. The analytical relations for the most important characteristics of cascades and sub-cascade are determined including the average number of sub-cascades per one PKA in the dependence on PKA energy, the distance between sub-cascades and the average cascade and sub-cascade sizes as a function of PKA energy. The developed model allows determining the total numbers, distribution functions of cascades and sub-cascades in dependence on their sizes and generation rate of cascades and sub-cascades for different fusion neutron energy spectra. Based on the developed model the numerical calculations for main characteristics of cascades and sub-cascades in different fusion structural materials are performed using the neutron flux and PKA energy spectra for fusion reactors: ITER and DEMO. The main characteristics for cascade and sub-cascade formation are calculated here for the

  19. Modeling of cascade and sub-cascade formation at high PKA energies in irradiated fusion structural materials

    International Nuclear Information System (INIS)

    Ryazanov, A.I.; Metelkin, E.V.; Semenov, E.V.

    2009-01-01

    A new theoretical model is developed for the investigations of cascade and sub-cascade formation in fusion structural materials under fast neutron irradiation at high primary knock-on atom energies. Light fusion structural materials: such as Be, C and SiC under 14 MeV neutron irradiation in fusion reactor will have the primary knock-on atoms with the energies up to 1 MeV. It is very difficult to use at such high energies the Monte-Carlo or molecular dynamic simulations [H.L. Heinisch, B.N. Singh, Philos. Mag. A67 (1993) 407; H.L. Heinisch, B.N. Singh, J. Nucl. Mater. 251 (1997) 77]. The developed model is based on the analytical consideration of elastic collisions between displaced moving atoms produced by primary knock-on atoms with some kinetic energies obtained from fast neutrons and crystal lattice atoms. The Thomas-Fermi interaction potential is used here for the description of these elastic atomic collisions. The suggested model takes into account also the electronic losses for moving atoms between elastic collisions. The self-consistent criterion for sub-cascade formation is suggested here which is based on the comparison of mean distance of primary knock-on atoms between consequent collisions of them with the target atoms and a size of sub-cascade produced by moving secondary knock-on atoms produced in such collisions. The analytical relations for the most important characteristics of cascades and sub-cascades are determined including the average number of sub-cascades per one primary knock-on atom in the dependence on its energy, the distance between sub-cascades and the average cascade and sub-cascade sizes. The developed model allows determining the total numbers, distribution functions of cascades and sub-cascades in dependence on their sizes and generation rate of cascades and sub-cascades for the different fusion neutron energy spectra. On the basis of this developed model the numerical calculations for main characteristics of cascades and sub

  20. Modeling Drift Compression in an Integrated Beam Experiment for Heavy-Ion-Fusion

    Science.gov (United States)

    Sharp, W. M.; Barnard, J. J.; Friedman, A.; Grote, D. P.; Celata, C. M.; Yu, S. S.

    2003-10-01

    The Integrated Beam Experiment (IBX) is an induction accelerator being designed to further develop the science base for heavy-ion fusion. The experiment is being developed jointly by Lawrence Berkeley National Laboratory, Lawrence Livermore National Laboratory, and Princeton Plasma Physics Laboratory. One conceptual approach would first accelerate a 0.5-1 A beam of singly charged potassium ions to 5 MeV, impose a head-to-tail velocity tilt to compress the beam longitudinally, and finally focus the beam radiallly using a series of quadrupole lenses. The lengthwise compression is a critical step because the radial size must be controlled as the current increases, and the beam emittance must be kept minimal. The work reported here first uses the moment-based model HERMES to design the drift-compression beam line and to assess the sensitivity of the final beam profile to beam and lattice errors. The particle-in-cell code WARP is then used to validate the physics design, study the phase-space evolution, and quantify the emittance growth.

  1. The Asian Correction Can Be Quantitatively Forecasted Using a Statistical Model of Fusion-Fission Processes.

    Science.gov (United States)

    Teh, Boon Kin; Cheong, Siew Ann

    2016-01-01

    The Global Financial Crisis of 2007-2008 wiped out US$37 trillions across global financial markets, this value is equivalent to the combined GDPs of the United States and the European Union in 2014. The defining moment of this crisis was the failure of Lehman Brothers, which precipitated the October 2008 crash and the Asian Correction (March 2009). Had the Federal Reserve seen these crashes coming, they might have bailed out Lehman Brothers, and prevented the crashes altogether. In this paper, we show that some of these market crashes (like the Asian Correction) can be predicted, if we assume that a large number of adaptive traders employing competing trading strategies. As the number of adherents for some strategies grow, others decline in the constantly changing strategy space. When a strategy group grows into a giant component, trader actions become increasingly correlated and this is reflected in the stock price. The fragmentation of this giant component will leads to a market crash. In this paper, we also derived the mean-field market crash forecast equation based on a model of fusions and fissions in the trading strategy space. By fitting the continuous returns of 20 stocks traded in Singapore Exchange to the market crash forecast equation, we obtain crash predictions ranging from end October 2008 to mid-February 2009, with early warning four to six months prior to the crashes.

  2. The Asian Correction Can Be Quantitatively Forecasted Using a Statistical Model of Fusion-Fission Processes.

    Directory of Open Access Journals (Sweden)

    Boon Kin Teh

    Full Text Available The Global Financial Crisis of 2007-2008 wiped out US$37 trillions across global financial markets, this value is equivalent to the combined GDPs of the United States and the European Union in 2014. The defining moment of this crisis was the failure of Lehman Brothers, which precipitated the October 2008 crash and the Asian Correction (March 2009. Had the Federal Reserve seen these crashes coming, they might have bailed out Lehman Brothers, and prevented the crashes altogether. In this paper, we show that some of these market crashes (like the Asian Correction can be predicted, if we assume that a large number of adaptive traders employing competing trading strategies. As the number of adherents for some strategies grow, others decline in the constantly changing strategy space. When a strategy group grows into a giant component, trader actions become increasingly correlated and this is reflected in the stock price. The fragmentation of this giant component will leads to a market crash. In this paper, we also derived the mean-field market crash forecast equation based on a model of fusions and fissions in the trading strategy space. By fitting the continuous returns of 20 stocks traded in Singapore Exchange to the market crash forecast equation, we obtain crash predictions ranging from end October 2008 to mid-February 2009, with early warning four to six months prior to the crashes.

  3. Fundamental study on target plate model with high thermal conductive ceramics for fusion power plants

    International Nuclear Information System (INIS)

    Ishiyama, Shintaro

    2004-01-01

    Target plate model (35 mm x 25 mm x 100 mm) of divertor device for fusion reactor was fabricated using low activated and light material, Si/xSiC Metal Matrix Composite (MMC) and high strength and thermal conductive SiC. This model has bonding structure of armor tile (25 mm x 25 mm x 10 mmt) of Hot Pressed (HP) and Hot Isostatic Pressed (HIP) Si/SiC (10 wt%)-MMC and substrate (25 mm x 25 mm x 100 mm) of SiC/BeO (1 wt%) with water cooling channel (φ15 mm). Armor tile material, Si/10SiC-MMC shows high thermal conductive and low resistivity with over 200 MPa peak bending strength at high temperature. This material behaves super plasticity over peak temperature corresponding to peak bending strength and low temperature brittleness of this material was improved to degrade DBTT to 673 K by optimization of Hot Press (HP) and Hot Isostatic Press (HIP) conditions. Substrate body material, SiC/1BeO behaves major characteristics of high bending strength over 500 MPa, high density of 3.2 g/cm 3 and high thermal conductivity of 270 W/m·K at room temperature. Target plate model with water cooling by 293 K and 2 MPa pressurized water at 1 m/s was exposed under 5 MW/m 2 x 30 s high heat flux H + ion beam and showed very good cooling performance and no damage was found after this test. (author)

  4. Modeling and control simulation of an electromechanical mm-wave launching system for thermonuclear fusion applications

    Energy Technology Data Exchange (ETDEWEB)

    Tsironis, Christos, E-mail: ctsiron@mail.ntua.gr [School of Electrical and Computer Engineering, National Technical University of Athens, 157 73 Athens (Greece); Department of Physics, Aristotle University of Thessaloniki, 54 136 Thessaloniki (Greece); Giannopoulos, Iordanis K.; Vasileiadou, Soultana; Kakogiannos, Ioannis D.; Kalligeropoulos, Dimitrios [Department of Automation, Technological Education Institute of Piraeus, 122 44 Piraeus (Greece)

    2016-11-15

    Highlights: • Open-loop modeling and control simulation of an electromechanical mm-wave launcher. • Simulations of the experiment without employing the real (hardware) system. • Launcher mirror dynamics correspond to a second-order weakly-nonlinear system. • Closed-loop control design in terms of cascade PIDs achieves required performance. - Abstract: Controlled thermonuclear fusion via magnetic confinement, still in experimental stage, has the potential to become a viable and environment-friendly solution to the energy problem, especially for the high-power needs of modern industry. In order to optimize the operation of devices based on the tokamak principle, automatic control systems are envisaged to fulfill the requirements for the magnetic equilibrium and plasma stability, with copper coils, neutral gas injectors and microwave sources used as actuators. In present-day experiments, the implemented control loops are simple and practical, however in future devices like ITER (presently under construction) more sophisticated control design will be required, based on realistic closed-loop simulations with efficient computational tools and real-time diagnosing. For magnetohydrodynamic instability control, the system should include physics/engineering models for the plasma dynamics, the wave actuation and the diagnostic sensors, as well as controllers based on classical or modern principles. In this work, we present a model for a specific design of a controlled electromechanical millimeter-wave launcher, which executes the major part of the wave actuation, and perform numerical simulations of its open-loop dynamics and closed-loop control for scenarios relevant to tearing mode stabilization in medium-sized tokamaks.

  5. Flares on a Bp Star

    Science.gov (United States)

    Mullan, D. J.

    2009-09-01

    Two large X-ray flares have been reported from the direction of a magnetic B2p star (σ Ori E). Sanz-Forcada et al. have suggested that the flares did not occur on the B2p star but on a companion of late spectral type. A star which is a candidate for a late-type flare star near σ Ori E has recently been identified by Bouy et al. However, based on the properties of the flares, and based on a recent model of rotating magnetospheres, we argue that, rather than attributing the two flares to a late-type dwarf, it is a viable hypothesis that the flares were magnetic phenomena associated with the rotating magnetosphere of the B2p star itself.

  6. FLARES ON A Bp STAR

    International Nuclear Information System (INIS)

    Mullan, D. J.

    2009-01-01

    Two large X-ray flares have been reported from the direction of a magnetic B2p star (σ Ori E). Sanz-Forcada et al. have suggested that the flares did not occur on the B2p star but on a companion of late spectral type. A star which is a candidate for a late-type flare star near σ Ori E has recently been identified by Bouy et al. However, based on the properties of the flares, and based on a recent model of rotating magnetospheres, we argue that, rather than attributing the two flares to a late-type dwarf, it is a viable hypothesis that the flares were magnetic phenomena associated with the rotating magnetosphere of the B2p star itself.

  7. Glucocorticoid induced osteopenia in cancellous bone of sheep: validation of large animal model for spine fusion and biomaterial research

    DEFF Research Database (Denmark)

    Ding, Ming; Cheng, Liming; Bollen, Peter

    2010-01-01

    STUDY DESIGN: Glucocorticoid with low calcium and phosphorus intake induces osteopenia in cancellous bone of sheep. OBJECTIVE: To validate a large animal model for spine fusion and biomaterial research. SUMMARY OF BACKGROUND DATA: A variety of ovariectomized animals has been used to study...... osteoporosis. Most experimental spine fusions were based on normal animals, and there is a great need for suitable large animal models with adequate bone size that closely resemble osteoporosis in humans. METHODS: Eighteen female skeletal mature sheep were randomly allocated into 3 groups, 6 each. Group 1 (GC......-1) received prednisolone (GC) treatment (0.60 mg/kg/day, 5 times weekly) for 7 months. Group 2 (GC-2) received the same treatment as GC-1 for 7 months followed by 3 months without treatment. Group 3 was left untreated and served as the controls. All sheep received restricted diet with low calcium...

  8. Intensive Versus Standard Blood Pressure Control in SPRINT-Eligible Participants of ACCORD-BP.

    Science.gov (United States)

    Buckley, Leo F; Dixon, Dave L; Wohlford, George F; Wijesinghe, Dayanjan S; Baker, William L; Van Tassell, Benjamin W

    2017-12-01

    We sought to determine the effect of intensive blood pressure (BP) control on cardiovascular outcomes in participants with type 2 diabetes mellitus (T2DM) and additional risk factors for cardiovascular disease (CVD). This study was a post hoc, multivariate, subgroup analysis of ACCORD-BP (Action to Control Cardiovascular Risk in Diabetes Blood Pressure) participants. Participants were eligible for the analysis if they were in the standard glucose control arm of ACCORD-BP and also had the additional CVD risk factors required for SPRINT (Systolic Blood Pressure Intervention Trial) eligibility. We used a Cox proportional hazards regression model to compare the effect of intensive versus standard BP control on CVD outcomes. The "SPRINT-eligible" ACCORD-BP participants were pooled with SPRINT participants to determine whether the effects of intensive BP control interacted with T2DM. The mean baseline Framingham 10-year CVD risk scores were 14.5% and 14.8%, respectively, in the intensive and standard BP control groups. The mean achieved systolic BP values were 120 and 134 mmHg in the intensive and standard BP control groups ( P control reduced the composite of CVD death, nonfatal myocardial infarction (MI), nonfatal stroke, any revascularization, and heart failure (hazard ratio 0.79; 95% CI 0.65-0.96; P = 0.02). Intensive BP control also reduced CVD death, nonfatal MI, and nonfatal stroke (hazard ratio 0.69; 95% CI 0.51-0.93; P = 0.01). Treatment-related adverse events occurred more frequently in participants receiving intensive BP control (4.1% vs. 2.1%; P = 0.003). The effect of intensive BP control on CVD outcomes did not differ between patients with and without T2DM ( P > 0.62). Intensive BP control reduced CVD outcomes in a cohort of participants with T2DM and additional CVD risk factors. © 2017 by the American Diabetes Association.

  9. The Markov multi-phase transferable belief model: A data fusion theory for enhancing cyber situational awareness

    OpenAIRE

    Ioannou, Georgios

    2015-01-01

    This thesis was submitted for the award of Doctor of Philosophy and was awarded by Brunel University London. eXfiltration Advanced Persistent Threats (XAPTs) increasingly account for incidents concerned with critical information exfiltration from High Valued Targets (HVT's) by terrorists, cyber criminals or enemy states. Existing Cyber Defence frameworks and data fusion models do not adequately address (i) the multi-stage nature of XAPTs and (ii) the uncertainty and conflicting...

  10. Lamin A/C-dependent interaction with 53BP1 promotes cellular responses to DNA damage

    DEFF Research Database (Denmark)

    Gibbs-Seymour, Ian; Markiewicz, Ewa; Bekker-Jensen, Simon

    2015-01-01

    Lamins A/C have been implicated in DNA damage response pathways. We show that the DNA repair protein 53BP1 is a lamin A/C binding protein. In undamaged human dermal fibroblasts (HDF), 53BP1 is a nucleoskeleton protein. 53BP1 binds to lamins A/C via its Tudor domain, and this is abrogated by DNA...... damage. Lamins A/C regulate 53BP1 levels and consequently lamin A/C-null HDF display a 53BP1 null-like phenotype. Our data favour a model in which lamins A/C maintain a nucleoplasmic pool of 53BP1 in order to facilitate its rapid recruitment to sites of DNA damage and could explain why an absence...

  11. SU-F-T-140: Assessment of the Proton Boron Fusion Reaction for Practical Radiation Therapy Applications Using MCNP6

    Energy Technology Data Exchange (ETDEWEB)

    Adam, D; Bednarz, B [University of Wisconsin, Madison, WI (United States)

    2016-06-15

    Purpose: The proton boron fusion reaction is a reaction that describes the creation of three alpha particles as the result of the interaction of a proton incident upon a 11B target. Theoretically, the proton boron fusion reaction is a desirable reaction for radiation therapy applications in that, with the appropriate boron delivery agent, it could potentially combine the localized dose delivery protons exhibit (Bragg peak) and the local deposition of high LET alpha particles in cancerous sites. Previous efforts have shown significant dose enhancement using the proton boron fusion reaction; the overarching purpose of this work is an attempt to validate previous Monte Carlo results of the proton boron fusion reaction. Methods: The proton boron fusion reaction, 11B(p, 3α), is investigated using MCNP6 to assess the viability for potential use in radiation therapy. Simple simulations of a proton pencil beam incident upon both a water phantom and a water phantom with an axial region containing 100ppm boron were modeled using MCNP6 in order to determine the extent of the impact boron had upon the calculated energy deposition. Results: The maximum dose increase calculated was 0.026% for the incident 250 MeV proton beam scenario. The MCNP simulations performed demonstrated that the proton boron fusion reaction rate at clinically relevant boron concentrations was too small in order to have any measurable impact on the absorbed dose. Conclusion: For all MCNP6 simulations conducted, the increase of absorbed dose of a simple water phantom due to the 11B(p, 3α) reaction was found to be inconsequential. In addition, it was determined that there are no good evaluations of the 11B(p, 3α) reaction for use in MCNPX/6 and further work should be conducted in cross section evaluations in order to definitively evaluate the feasibility of the proton boron fusion reaction for use in radiation therapy applications.

  12. Research on wind field algorithm of wind lidar based on BP neural network and grey prediction

    Science.gov (United States)

    Chen, Yong; Chen, Chun-Li; Luo, Xiong; Zhang, Yan; Yang, Ze-hou; Zhou, Jie; Shi, Xiao-ding; Wang, Lei

    2018-01-01

    This paper uses the BP neural network and grey algorithm to forecast and study radar wind field. In order to reduce the residual error in the wind field prediction which uses BP neural network and grey algorithm, calculating the minimum value of residual error function, adopting the residuals of the gray algorithm trained by BP neural network, using the trained network model to forecast the residual sequence, using the predicted residual error sequence to modify the forecast sequence of the grey algorithm. The test data show that using the grey algorithm modified by BP neural network can effectively reduce the residual value and improve the prediction precision.

  13. Fusion power

    International Nuclear Information System (INIS)

    Hancox, R.

    1981-01-01

    The principles of fusion power, and its advantages and disadvantages, are outlined. Present research programmes and future plans directed towards the development of a fusion power reactor, are summarized. (U.K.)

  14. Multi-Decadal Coastal Behavioural States From A Fusion Of Geohistorical Conceptual Modelling With 2-D Morphodynamic Modelling

    Science.gov (United States)

    Goodwin, I. D.; Mortlock, T.

    2016-02-01

    Geohistorical archives of shoreline and foredune planform geometry provides a unique evidence-based record of the time integral response to coupled directional wave climate and sediment supply variability on annual to multi-decadal time scales. We develop conceptual shoreline modelling from the geohistorical shoreline archive using a novel combination of methods, including: LIDAR DEM and field mapping of coastal geology; a decadal-scale climate reconstruction of sea-level pressure, marine windfields, and paleo-storm synoptic type and frequency, and historical bathymetry. The conceptual modelling allows for the discrimination of directional wave climate shifts and the relative contributions of cross-shore and along-shore sand supply rates at multi-decadal resolution. We present regional examples from south-eastern Australia over a large latitudinal gradient from subtropical Queensland (S 25°) to mid-latitude Bass Strait (S 40°) that illustrate the morphodynamic evolution and reorganization to wave climate change. We then use the conceptual modeling to inform a two-dimensional coupled spectral wave-hydrodynamic-morphodynamic model to investigate the shoreface response to paleo-directional wind and wave climates. Unlike one-line shoreline modelling, this fully dynamical approach allows for the investigation of cumulative and spatial bathymetric change due to wave-induced currents, as well as proxy-shoreline change. The fusion of the two modeling approaches allows for: (i) the identification of the natural range of coastal planform geometries in response to wave climate shifts; and, (ii) the decomposition of the multidecadal coastal change into the cross-shore and along-shore sand supply drivers, according to the best-matching planforms.

  15. Fusion: introduction

    International Nuclear Information System (INIS)

    Decreton, M.

    2006-01-01

    The article gives an overview and introduction to the activities of SCK-CEN's research programme on fusion. The decision to construct the ITER international nuclear fusion experiment in Cadarache is highlighted. A summary of the Belgian contributions to fusion research is given with particular emphasis on studies of radiation effects on diagnostics systems, radiation effects on remote handling sensing systems, fusion waste management and socio-economic studies

  16. Incomplete fusion studies

    International Nuclear Information System (INIS)

    Singh, B.P.

    2011-01-01

    In order to study the incomplete fusion reaction dynamics at energies ≅ 4-7 MeV/nucleon, several experiments have been carried out using accelerator facilities available in India. The measurements presented here cover a wide range of projectile-target combinations and enhance significantly our knowledge about incomplete fusion reaction dynamics. Here, the three sets of measurements have been presented; (i) excitation functions, (ii) forward recoil range distributions and (iii) the spin distributions. The first evidence of these reactions has been obtained from the measurement and analysis of excitation functions for xn/αxn/2αxn-channels. The measured excitation functions have been analyzed within the framework of compound nucleus model. The results obtained indicate the occurrence of fusion incompleteness at low beam energies. However, in order to determine the relative contribution of complete and incomplete fusion reaction processes, the recoil range distributions of the heavy residues have also been measured and analyzed within the framework of breakup fusion model which confirmed the fusion incompleteness in several heavy ion reactions involving α-emitting reaction channels. Further, in order to study the role of l-values in these reactions the spin distributions of the residues populated in case of complete and incomplete channels have been measured and are found to be distinctly different. The analysis of the data on spin distribution measurements indicate that the mean values of driving input angular momenta associated with direct-α-emitting (incomplete fusion) channels are higher than that observed for fusion-evaporation xn or α-emitting (complete fusion) channels, and is found to increase with direct α-multiplicity in the forward cone. One of the important conclusions drawn in the present work is that, there is significant incomplete fusion contribution even at energies slightly above the barrier. Further, the projectile structure has been found to

  17. Keyhole formation and thermal fluid flow-induced porosity during laser fusion welding in titanium alloys: Experimental and modelling

    International Nuclear Information System (INIS)

    Panwisawas, Chinnapat; Perumal, Bama; Ward, R. Mark; Turner, Nathanael; Turner, Richard P.; Brooks, Jeffery W.; Basoalto, Hector C.

    2017-01-01

    High energy-density beam welding, such as electron beam or laser welding, has found a number of industrial applications for clean, high-integrity welds. The deeply penetrating nature of the joints is enabled by the formation of metal vapour which creates a narrow fusion zone known as a “keyhole”. However the formation of the keyhole and the associated keyhole dynamics, when using a moving laser heat source, requires further research as they are not fully understood. Porosity, which is one of a number of process induced phenomena related to the thermal fluid dynamics, can form during beam welding processes. The presence of porosity within a welded structure, inherited from the fusion welding operation, degrades the mechanical properties of components during service such as fatigue life. In this study, a physics-based model for keyhole welding including heat transfer, fluid flow and interfacial interactions has been used to simulate keyhole and porosity formation during laser welding of Ti-6Al-4V titanium alloy. The modelling suggests that keyhole formation and the time taken to achieve keyhole penetration can be predicted, and it is important to consider the thermal fluid flow at the melting front as this dictates the evolution of the fusion zone. Processing induced porosity is significant when the fusion zone is only partially penetrating through the thickness of the material. The modelling results are compared with high speed camera imaging and measurements of porosity from welded samples using X-ray computed tomography, radiography and optical micrographs. These are used to provide a better understanding of the relationship between process parameters, component microstructure and weld integrity.

  18. Membrane fusion

    DEFF Research Database (Denmark)

    Bendix, Pól Martin

    2015-01-01

    At Stanford University, Boxer lab, I worked on membrane fusion of small unilamellar lipid vesicles to flat membranes tethered to glass surfaces. This geometry closely resembles biological systems in which liposomes fuse to plasma membranes. The fusion mechanism was studied using DNA zippering...... between complementary strands linked to the two apposing membranes closely mimicking the zippering mechanism of SNARE fusion complexes....

  19. Fusion Canada

    International Nuclear Information System (INIS)

    1987-07-01

    This first issue of a quarterly newsletter announces the startup of the Tokamak de Varennes, describes Canada's national fusion program, and outlines the Canadian Fusion Fuels Technology Program. A map gives the location of the eleven principal fusion centres in Canada. (L.L.)

  20. In-Service Design and Performance Prediction of Advanced Fusion Material Systems by Computational Modeling and Simulation

    International Nuclear Information System (INIS)

    G. R. Odette; G. E. Lucas

    2005-01-01

    This final report on ''In-Service Design and Performance Prediction of Advanced Fusion Material Systems by Computational Modeling and Simulation'' (DE-FG03-01ER54632) consists of a series of summaries of work that has been published, or presented at meetings, or both. It briefly describes results on the following topics: (1) A Transport and Fate Model for Helium and Helium Management; (2) Atomistic Studies of Point Defect Energetics, Dynamics and Interactions; (3) Multiscale Modeling of Fracture consisting of: (3a) A Micromechanical Model of the Master Curve (MC) Universal Fracture Toughness-Temperature Curve Relation, KJc(T - To), (3b) An Embrittlement DTo Prediction Model for the Irradiation Hardening Dominated Regime, (3c) Non-hardening Irradiation Assisted Thermal and Helium Embrittlement of 8Cr Tempered Martensitic Steels: Compilation and Analysis of Existing Data, (3d) A Model for the KJc(T) of a High Strength NFA MA957, (3e) Cracked Body Size and Geometry Effects of Measured and Effective Fracture Toughness-Model Based MC and To Evaluations of F82H and Eurofer 97, (3f) Size and Geometry Effects on the Effective Toughness of Cracked Fusion Structures; (4) Modeling the Multiscale Mechanics of Flow Localization-Ductility Loss in Irradiation Damaged BCC Alloys; and (5) A Universal Relation Between Indentation Hardness and True Stress-Strain Constitutive Behavior. Further details can be found in the cited references or presentations that generally can be accessed on the internet, or provided upon request to the authors. Finally, it is noted that this effort was integrated with our base program in fusion materials, also funded by the DOE OFES

  1. 2-D fluid dynamics models for laser driven fusion on IBM 3090 vector multiprocessors

    International Nuclear Information System (INIS)

    Atzeni, S.

    1988-01-01

    Fluid-dynamics codes for laser fusion are complex research codes, consisting of many distinct modules and embodying a variety of numerical methods. They are therefore good candidates for testing general purpose advanced computer architectures and the related software. In this paper, after a brief outline of the basic concepts of laser fusion, the implementation of the 2-D laser fusion fluid code DUED on the IBM 3090 VF vector multiprocessors is discussed. Emphasis is put on parallelization, performed by means of IBM Parallel FORTRAN (PF). It is shown how different modules have been optimized by using different features of PF: i) modules based on depth-2 nested loops exploit automatic parallelization; ii) laser light ray tracing is partitioned by scheduling parallel ICCG algorithm (executed in parallel by appropiately synchronized parallel subroutines). Performance results are given for separate modules of the code, as well as for typical complete runs

  2. Three-stage classical molecular dynamics model for simulation of heavy-ion fusion

    Directory of Open Access Journals (Sweden)

    Godre Subodh S.

    2015-01-01

    Full Text Available A three-stage Classical Molecular Dynamics (3S-CMD approach for heavy-ion fusion is developed. In this approach the Classical Rigid-Body Dynamics simulation for heavy-ion collision involving light deformed nucleus is initiated on their Rutherford trajectories at very large initial separation. Collision simulation is then followed by relaxation of the rigid-body constrains for one or both the colliding nuclei at distances close to the barrier when the trajectories of all the nucleons are obtained in a Classical Molecular Dynamics approach. This 3S-CMD approach explicitly takes into account not only the long range Coulomb reorientation of the deformed collision partner but also the internal vibrational excitations of one or both the nuclei at distances close to the barrier. The results of the dynamical simulation for 24Mg+208Pb collision show significant modification of the fusion barrier and calculated fusion cross sections due to internal excitations.

  3. An approach to 3D model fusion in GIS systems and its application in a future ECDIS

    Science.gov (United States)

    Liu, Tao; Zhao, Depeng; Pan, Mingyang

    2016-04-01

    Three-dimensional (3D) computer graphics technology is widely used in various areas and causes profound changes. As an information carrier, 3D models are becoming increasingly important. The use of 3D models greatly helps to improve the cartographic expression and design. 3D models are more visually efficient, quicker and easier to understand and they can express more detailed geographical information. However, it is hard to efficiently and precisely fuse 3D models in local systems. The purpose of this study is to propose an automatic and precise approach to fuse 3D models in geographic information systems (GIS). It is the basic premise for subsequent uses of 3D models in local systems, such as attribute searching, spatial analysis, and so on. The basic steps of our research are: (1) pose adjustment by principal component analysis (PCA); (2) silhouette extraction by simple mesh silhouette extraction and silhouette merger; (3) size adjustment; (4) position matching. Finally, we implement the above methods in our system Automotive Intelligent Chart (AIC) 3D Electronic Chart Display and Information Systems (ECDIS). The fusion approach we propose is a common method and each calculation step is carefully designed. This approach solves the problem of cross-platform model fusion. 3D models can be from any source. They may be stored in the local cache or retrieved from Internet, or may be manually created by different tools or automatically generated by different programs. The system can be any kind of 3D GIS system.

  4. Applying the Upper Integral to the Biometric Score Fusion Problem in the Identification Model

    Directory of Open Access Journals (Sweden)

    Khalid Fakhar

    2015-08-01

    Full Text Available This paper presents a new biometric score fusion approach in an identification system using the upper integral with respect to Sugeno’s fuzzy measure. First, the proposed method considers each individual matcher as a fuzzy set in order to handle uncertainty and imperfection in matching scores. Then, the corresponding fuzzy entropy estimates the reliability of the information provided by each biometric matcher. Next, the fuzzy densities are generated based on rank information and training accuracy. Finally, the results are aggregated using the upper fuzzy integral. Experimental results compared with other fusion methods demonstrate the good performance of the proposed approach.

  5. TopBP1/Dpb11 binds DNA anaphase bridges to prevent genome instability

    DEFF Research Database (Denmark)

    Germann, Susanne Manuela; Schramke, Vera; Pedersen, Rune Troelsgaard

    2014-01-01

    yeast Saccharomyces cerevisiae and the avian DT40 cell line as model systems for studying DNA anaphase bridges and show that TopBP1/Dpb11 plays an evolutionarily conserved role in their metabolism. Together with the single-stranded DNA binding protein RPA, TopBP1/Dpb11 binds to UFBs, and depletion...

  6. 18 Ka BP records of climatic changes, Bay of Bengal: Isotopic and sedimentological evidences

    Digital Repository Service at National Institute of Oceanography (India)

    Chauhan, O.S.; Suneethi, J.

    are also identified at 10.3 and 11.5 Ka BP. The later event matches well with that of the ‘Younger Dryas’ event of world climate models. The beginning of the Holocene is marked by lighter d18O values (at around 9.5 Ka BP), which has been interpreted...

  7. Hydrodynamic modelling of the shock ignition scheme for inertial confinement fusion

    International Nuclear Information System (INIS)

    Vallet, Alexandra

    2014-01-01

    The shock ignition concept in inertial confinement fusion uses an intense power spike at the end of an assembly laser pulse. The key features of shock ignition are the generation of a high ablation pressure, the shock pressure amplification by at least a factor of a hundred in the cold fuel shell and the shock coupling to the hot-spot. In this thesis, new semi-analytical hydrodynamic models are developed to describe the ignitor shock from its generation up to the moment of fuel ignition. A model is developed to describe a spherical converging shock wave in a pre-heated hot spot. The self-similar solution developed by Guderley is perturbed over the shock Mach number Ms ≥≥1. The first order correction accounts for the effects of the shock strength. An analytical ignition criterion is defined in terms of the shock strength and the hot-spot areal density. The ignition threshold is higher when the initial Mach number of the shock is lower. A minimal shock pressure of 20 Gbar is needed when it enters the hot-spot. The shock dynamics in the imploding shell is then analyzed. The shock is propagating into a non inertial medium with a high radial pressure gradient and an overall pressure increase with time. The collision with a returning shock coming from the assembly phase enhances further the ignitor shock pressure. The analytical theory allows to describe the shock pressure and strength evolution in a typical shock ignition implosion. It is demonstrated that, in the case of the HiPER target design, a generation shock pressure near the ablation zone on the order of 300-400 Mbar is needed. An analysis of experiments on the strong shock generation performed on the OMEGA laser facility is presented. It is shown that a shock pressure close to 300 Mbar near the ablation zone has been reached with an absorbed laser intensity up to 2 * 10 15 W:cm -2 and a laser wavelength of 351 nm. This value is two times higher than the one expected from collisional laser absorption only

  8. Investigations of image fusion

    Science.gov (United States)

    Zhang, Zhong

    1999-12-01

    The objective of image fusion is to combine information from multiple images of the same scene. The result of image fusion is a single image which is more suitable for the purpose of human visual perception or further image processing tasks. In this thesis, a region-based fusion algorithm using the wavelet transform is proposed. The identification of important features in each image, such as edges and regions of interest, are used to guide the fusion process. The idea of multiscale grouping is also introduced and a generic image fusion framework based on multiscale decomposition is studied. The framework includes all of the existing multiscale-decomposition- based fusion approaches we found in the literature which did not assume a statistical model for the source images. Comparisons indicate that our framework includes some new approaches which outperform the existing approaches for the cases we consider. Registration must precede our fusion algorithms. So we proposed a hybrid scheme which uses both feature-based and intensity-based methods. The idea of robust estimation of optical flow from time- varying images is employed with a coarse-to-fine multi- resolution approach and feature-based registration to overcome some of the limitations of the intensity-based schemes. Experiments show that this approach is robust and efficient. Assessing image fusion performance in a real application is a complicated issue. In this dissertation, a mixture probability density function model is used in conjunction with the Expectation- Maximization algorithm to model histograms of edge intensity. Some new techniques are proposed for estimating the quality of a noisy image of a natural scene. Such quality measures can be used to guide the fusion. Finally, we study fusion of images obtained from several copies of a new type of camera developed for video surveillance. Our techniques increase the capability and reliability of the surveillance system and provide an easy way to obtain 3-D

  9. BP1 Homeoprotein Enhances Metastatic Potential in ER-negative Breast Cancer

    Science.gov (United States)

    Fu, Yebo; Lian, Yi; Kim, Kyung Soon; Zhang, Lei; Hindle, A. Katharine; Brody, Fred; Siegel, Robert S.; McCaffrey, Timothy A.; Fu, Sidney W.

    2010-01-01

    Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER-) tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. We sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target for ER- breast cancer. PMID:20842225

  10. Evaluation of multimodality imaging using image fusion with ultrasound tissue elasticity imaging in an experimental animal model.

    Science.gov (United States)

    Paprottka, P M; Zengel, P; Cyran, C C; Ingrisch, M; Nikolaou, K; Reiser, M F; Clevert, D A

    2014-01-01

    To evaluate the ultrasound tissue elasticity imaging by comparison to multimodality imaging using image fusion with Magnetic Resonance Imaging (MRI) and conventional grey scale imaging with additional elasticity-ultrasound in an experimental small-animal-squamous-cell carcinoma-model for the assessment of tissue morphology. Human hypopharynx carcinoma cells were subcutaneously injected into the left flank of 12 female athymic nude rats. After 10 days (SD ± 2) of subcutaneous tumor growth, sonographic grey scale including elasticity imaging and MRI measurements were performed using a high-end ultrasound system and a 3T MR. For image fusion the contrast-enhanced MRI DICOM data set was uploaded in the ultrasonic device which has a magnetic field generator, a linear array transducer (6-15 MHz) and a dedicated software package (GE Logic E9), that can detect transducers by means of a positioning system. Conventional grey scale and elasticity imaging were integrated in the image fusion examination. After successful registration and image fusion the registered MR-images were simultaneously shown with the respective ultrasound sectional plane. Data evaluation was performed using the digitally stored video sequence data sets by two experienced radiologist using a modified Tsukuba Elasticity score. The colors "red and green" are assigned for an area of soft tissue, "blue" indicates hard tissue. In all cases a successful image fusion and plan registration with MRI and ultrasound imaging including grey scale and elasticity imaging was possible. The mean tumor volume based on caliper measurements in 3 dimensions was ~323 mm3. 4/12 rats were evaluated with Score I, 5/12 rates were evaluated with Score II, 3/12 rates were evaluated with Score III. There was a close correlation in the fused MRI with existing small necrosis in the tumor. None of the scored II or III lesions was visible by conventional grey scale. The comparison of ultrasound tissue elasticity imaging enables a

  11. Rovibrationally Resolved Time-Dependent Collisional-Radiative Model of Molecular Hydrogen and Its Application to a Fusion Detached Plasma

    Directory of Open Access Journals (Sweden)

    Keiji Sawada

    2016-12-01

    Full Text Available A novel rovibrationally resolved collisional-radiative model of molecular hydrogen that includes 4,133 rovibrational levels for electronic states whose united atom principal quantum number is below six is developed. The rovibrational X 1 Σ g + population distribution in a SlimCS fusion demo detached divertor plasma is investigated by solving the model time dependently with an initial 300 K Boltzmann distribution. The effective reaction rate coefficients of molecular assisted recombination and of other processes in which atomic hydrogen is produced are calculated using the obtained time-dependent population distribution.

  12. Complimentary Advanced Fusion Exploration

    National Research Council Canada - National Science Library

    Alford, Mark G; Jones, Eric C; Bubalo, Adnan; Neumann, Melissa; Greer, Michael J

    2005-01-01

    .... The focus areas were in the following regimes: multi-tensor homographic computer vision image fusion, out-of-sequence measurement and track data handling, Nash bargaining approaches to sensor management, pursuit-evasion game theoretic modeling...

  13. Control oriented modeling and simulation of the sawtooth instability in nuclear fusion tokamak plasmas

    NARCIS (Netherlands)

    Witvoet, G.; Westerhof, E.; Steinbuch, M.; Doelman, N.J.; Baar, de M.R.

    2009-01-01

    Tokamak plasmas in nuclear fusion are subject to various instabilities. A clear example is the sawtooth instability, which has both positive and negative effects on the plasma. To optimize between these effects control of the sawtooth period is necessary. This paper presents a simple control

  14. Constructing seasonal LAI trajectory by data-model fusion for global evergreen needle-leaf forests

    Science.gov (United States)

    Wang, R.; Chen, J.; Mo, G.

    2010-12-01

    For decades, advancements in optical remote sensors made it possible to produce maps of a biophysical parameter--the Leaf Area Index (LAI), which is critically necessary in regional and global modeling of exchanges of carbon, water, energy and other substances, across large areas in a fast way. Quite a few global LAI products have been generated since 2000, e.g. GLOBCARBON (Deng et al., 2006), MODIS Collection 5 (Shabanov et al., 2007), CYCLOPES (Baret et al., 2007), etc. Albeit these progresses, the basic physics behind the technology restrains it from accurate estimation of LAI in winter, especially for northern high-latitude evergreen needle-leaf forests. Underestimation of winter LAI in these regions has been reported in literature (Yang et al., 2000; Cohen et al., 2003; Tian et al., 2004; Weiss et al., 2007; Pisek et al., 2007), and the distortion is usually attributed to the variations of canopy reflectance caused by understory change (Weiss et al., 2007) as well as by the presence of ice and snow on leaves and ground (Cohen, 2003; Tian et al., 2004). Seasonal changes in leaf pigments can also be another reason for low LAI retrieved in winter. Low conifer LAI values in winter retrieved from remote sensing make them unusable for surface energy budget calculations. To avoid these drawbacks of remote sensing approaches, we attempt to reconstruct the seasonal LAI trajectory through model-data fusion. A 1-degree LAI map of global evergreen needle-leaf forests at 10-day interval is produced based on the carbon allocation principle in trees. With net primary productivity (NPP) calculated by the Boreal Ecosystems Productivity Simulator (BEPS) (Chen et al., 1999), carbon allocated to needles is quantitatively evaluated and then can be further transformed into LAI using the specific leaf area (SLA). A leaf-fall scheme is developed to mimic the carbon loss caused by falling needles throughout the year. The seasonally maximum LAI from remote sensing data for each pixel

  15. A classical approach in simple nuclear fusion reaction 1H2+1H3 using two-dimension granular molecular dynamics model

    International Nuclear Information System (INIS)

    Viridi, S.; Kurniadi, R.; Waris, A.; Perkasa, Y. S.

    2012-01-01

    Molecular dynamics in 2-D accompanied by granular model provides an opportunity to investigate binding between nuclei particles and its properties that arises during collision in a fusion reaction. A fully classical approach is used to observe the influence of initial angle of nucleus orientation to the product yielded by the reaction. As an example, a simplest fusion reaction between 1 H 2 and 1 H 3 is observed. Several products of the fusion reaction have been obtained, even the unreported ones, including temporary 2 He 4 nucleus.

  16. Reference architecture and interoperability model for data mining and fusion in scientific cross-domain infrastructures

    Science.gov (United States)

    Haener, Rainer; Waechter, Joachim; Grellet, Sylvain; Robida, Francois

    2017-04-01

    Interoperability is the key factor in establishing scientific research environments and infrastructures, as well as in bringing together heterogeneous, geographically distributed risk management, monitoring, and early warning systems. Based on developments within the European Plate Observing System (EPOS), a reference architecture has been devised that comprises architectural blue-prints and interoperability models regarding the specification of business processes and logic as well as the encoding of data, metadata, and semantics. The architectural blueprint is developed on the basis of the so called service-oriented architecture (SOA) 2.0 paradigm, which combines intelligence and proactiveness of event-driven with service-oriented architectures. SOA 2.0 supports analysing (Data Mining) both, static and real-time data in order to find correlations of disparate information that do not at first appear to be intuitively obvious: Analysed data (e.g., seismological monitoring) can be enhanced with relationships discovered by associating them (Data Fusion) with other data (e.g., creepmeter monitoring), with digital models of geological structures, or with the simulation of geological processes. The interoperability model describes the information, communication (conversations) and the interactions (choreographies) of all participants involved as well as the processes for registering, providing, and retrieving information. It is based on the principles of functional integration, implemented via dedicated services, communicating via service-oriented and message-driven infrastructures. The services provide their functionality via standardised interfaces: Instead of requesting data directly, users share data via services that are built upon specific adapters. This approach replaces the tight coupling at data level by a flexible dependency on loosely coupled services. The main component of the interoperability model is the comprehensive semantic description of the information

  17. Fusion strategies for selecting multiple tuning parameters for multivariate calibration and other penalty based processes: A model updating application for pharmaceutical analysis

    International Nuclear Information System (INIS)

    Tencate, Alister J.; Kalivas, John H.; White, Alexander J.

    2016-01-01

    New multivariate calibration methods and other processes are being developed that require selection of multiple tuning parameter (penalty) values to form the final model. With one or more tuning parameters, using only one measure of model quality to select final tuning parameter values is not sufficient. Optimization of several model quality measures is challenging. Thus, three fusion ranking methods are investigated for simultaneous assessment of multiple measures of model quality for selecting tuning parameter values. One is a supervised learning fusion rule named sum of ranking differences (SRD). The other two are non-supervised learning processes based on the sum and median operations. The effect of the number of models evaluated on the three fusion rules are also evaluated using three procedures. One procedure uses all models from all possible combinations of the tuning parameters. To reduce the number of models evaluated, an iterative process (only applicable to SRD) is applied and thresholding a model quality measure before applying the fusion rules is also used. A near infrared pharmaceutical data set requiring model updating is used to evaluate the three fusion rules. In this case, calibration of the primary conditions is for the active pharmaceutical ingredient (API) of tablets produced in a laboratory. The secondary conditions for calibration updating is for tablets produced in the full batch setting. Two model updating processes requiring selection of two unique tuning parameter values are studied. One is based on Tikhonov regularization (TR) and the other is a variation of partial least squares (PLS). The three fusion methods are shown to provide equivalent and acceptable results allowing automatic selection of the tuning parameter values. Best tuning parameter values are selected when model quality measures used with the fusion rules are for the small secondary sample set used to form the updated models. In this model updating situation, evaluation of

  18. Fusion strategies for selecting multiple tuning parameters for multivariate calibration and other penalty based processes: A model updating application for pharmaceutical analysis

    Energy Technology Data Exchange (ETDEWEB)

    Tencate, Alister J. [Department of Chemistry, Idaho State University, Pocatello, ID 83209 (United States); Kalivas, John H., E-mail: kalijohn@isu.edu [Department of Chemistry, Idaho State University, Pocatello, ID 83209 (United States); White, Alexander J. [Department of Physics and Optical Engineering, Rose-Hulman Institute of Technology, Terre Huate, IN 47803 (United States)

    2016-05-19

    New multivariate calibration methods and other processes are being developed that require selection of multiple tuning parameter (penalty) values to form the final model. With one or more tuning parameters, using only one measure of model quality to select final tuning parameter values is not sufficient. Optimization of several model quality measures is challenging. Thus, three fusion ranking methods are investigated for simultaneous assessment of multiple measures of model quality for selecting tuning parameter values. One is a supervised learning fusion rule named sum of ranking differences (SRD). The other two are non-supervised learning processes based on the sum and median operations. The effect of the number of models evaluated on the three fusion rules are also evaluated using three procedures. One procedure uses all models from all possible combinations of the tuning parameters. To reduce the number of models evaluated, an iterative process (only applicable to SRD) is applied and thresholding a model quality measure before applying the fusion rules is also used. A near infrared pharmaceutical data set requiring model updating is used to evaluate the three fusion rules. In this case, calibration of the primary conditions is for the active pharmaceutical ingredient (API) of tablets produced in a laboratory. The secondary conditions for calibration updating is for tablets produced in the full batch setting. Two model updating processes requiring selection of two unique tuning parameter values are studied. One is based on Tikhonov regularization (TR) and the other is a variation of partial least squares (PLS). The three fusion methods are shown to provide equivalent and acceptable results allowing automatic selection of the tuning parameter values. Best tuning parameter values are selected when model quality measures used with the fusion rules are for the small secondary sample set used to form the updated models. In this model updating situation, evaluation of

  19. PIXIE3D: An efficient, fully implicit, parallel, 3D extended MHD code for fusion plasma modeling

    International Nuclear Information System (INIS)

    Chacon, L.

    2007-01-01

    PIXIE3D is a modern, parallel, state-of-the-art extended MHD code that employs fully implicit methods for efficiency and accuracy. It features a general geometry formulation, and is therefore suitable for the study of many magnetic fusion configurations of interest. PIXIE3D advances the state of the art in extended MHD modeling in two fundamental ways. Firstly, it employs a novel conservative finite volume scheme which is remarkably robust and stable, and demands very small physical and/or numerical dissipation. This is a fundamental requirement when one wants to study fusion plasmas with realistic conductivities. Secondly, PIXIE3D features fully-implicit time stepping, employing Newton-Krylov methods for inverting the associated nonlinear systems. These methods have been shown to be scalable and efficient when preconditioned properly. Novel preconditioned ideas (so-called physics based), which were prototypes in the context of reduced MHD, have been adapted for 3D primitive-variable resistive MHD in PIXIE3D, and are currently being extended to Hall MHD. PIXIE3D is fully parallel, employing PETSc for parallelism. PIXIE3D has been thoroughly benchmarked against linear theory and against other available extended MHD codes on nonlinear test problems (such as the GEM reconnection challenge). We are currently in the process of extending such comparisons to fusion-relevant problems in realistic geometries. In this talk, we will describe both the spatial discretization approach and the preconditioning strategy employed for extended MHD in PIXIE3D. We will report on recent benchmarking studies between PIXIE3D and other 3D extended MHD codes, and will demonstrate its usefulness in a variety of fusion-relevant configurations such as Tokamaks and Reversed Field Pinches. (Author)

  20. Fusion Physics

    Energy Technology Data Exchange (ETDEWEB)

    Kikuchi, Mitsuru; Lackner, Karl; Tran, Minh Quang [eds.

    2012-09-15

    Recreating the energy production process of the Sun - nuclear fusion - on Earth in a controlled fashion is one of the greatest challenges of this century. If achieved at affordable costs, energy supply security would be greatly enhanced and environmental degradation from fossil fuels greatly diminished. Fusion Physics describes the last fifty years or so of physics and research in innovative technologies to achieve controlled thermonuclear fusion for energy production. The International Atomic Energy Agency (IAEA) has been involved since its establishment in 1957 in fusion research. It has been the driving force behind the biennial conferences on Plasma Physics and Controlled Thermonuclear Fusion, today known as the Fusion Energy Conference. Hosted by several Member States, this biennial conference provides a global forum for exchange of the latest achievements in fusion research against the backdrop of the requirements for a net energy producing fusion device and, eventually, a fusion power plant. The scientific and technological knowledge compiled during this series of conferences, as well as by the IAEA Nuclear Fusion journal, is immense and will surely continue to grow in the future. It has led to the establishment of the International Thermonuclear Experimental Reactor (ITER), which represents the biggest experiment in energy production ever envisaged by humankind.

  1. Fusion breeder

    International Nuclear Information System (INIS)

    Moir, R.W.

    1982-01-01

    The fusion breeder is a fusion reactor designed with special blankets to maximize the transmutation by 14 MeV neutrons of uranium-238 to plutonium or thorium to uranium-233 for use as a fuel for fission reactors. Breeding fissile fuels has not been a goal of the US fusion energy program. This paper suggests it is time for a policy change to make the fusion breeder a goal of the US fusion program and the US nuclear energy program. The purpose of this paper is to suggest this policy change be made and tell why it should be made, and to outline specific research and development goals so that the fusion breeder will be developed in time to meet fissile fuel needs

  2. Directions for improved fusion reactors

    International Nuclear Information System (INIS)

    Krakowski, R.A.; Miller, R.L.; Delene, J.G.

    1986-01-01

    Conceptual fusion reactor studies over the past 10 to 15 years have projected systems that may be too large, complex, and costly to be of commercial interest. One main direction for improved fusion reactors points towards smaller, higher-power-density approaches. First-order economic issues (i.e., unit direct cost and cost of electricity) are used to support the need for more compact fusion reactors. A generic fusion physics/engineering/costing model is used to provide a quantiative basis for these arguments for specific fusion concepts

  3. Fusion Implementation

    International Nuclear Information System (INIS)

    Schmidt, J.A.

    2002-01-01

    If a fusion DEMO reactor can be brought into operation during the first half of this century, fusion power production can have a significant impact on carbon dioxide production during the latter half of the century. An assessment of fusion implementation scenarios shows that the resource demands and waste production associated with these scenarios are manageable factors. If fusion is implemented during the latter half of this century it will be one element of a portfolio of (hopefully) carbon dioxide limiting sources of electrical power. It is time to assess the regional implications of fusion power implementation. An important attribute of fusion power is the wide range of possible regions of the country, or countries in the world, where power plants can be located. Unlike most renewable energy options, fusion energy will function within a local distribution system and not require costly, and difficult, long distance transmission systems. For example, the East Coast of the United States is a prime candidate for fusion power deployment by virtue of its distance from renewable energy sources. As fossil fuels become less and less available as an energy option, the transmission of energy across bodies of water will become very expensive. On a global scale, fusion power will be particularly attractive for regions separated from sources of renewable energy by oceans

  4. Superconducting magnets for model ship propulsion and for material tests of a nuclear fusion reactor

    International Nuclear Information System (INIS)

    Horiuchi, T.; Matsumoto, K.; Monju, Y.; Tatara, I.; Hamada, M.

    1982-01-01

    Nuclear fusion reactors, magnetically levitated trains, and MHD generators, etc., all need a very high magnetic field; which in order to be attained a means the application of superconductors is inevitable. This paper describes the development of ''CRYOZITT'', a superconductor featuring high current density and high mechanical strength. CRYOZITT has already been used in the manufacture of two race-track shaped superconducting magnets, and delivered to highly satisfied customers. (author)

  5. Breakout Prediction Based on BP Neural Network in Continuous Casting Process

    Directory of Open Access Journals (Sweden)

    Zhang Ben-guo

    2016-01-01

    Full Text Available An improved BP neural network model was presented by modifying the learning algorithm of the traditional BP neural network, based on the Levenberg-Marquardt algorithm, and was applied to the breakout prediction system in the continuous casting process. The results showed that the accuracy rate of the model for the temperature pattern of sticking breakout was 96.43%, and the quote rate was 100%, that verified the feasibility of the model.

  6. A Technical Analysis Information Fusion Approach for Stock Price Analysis and Modeling

    Science.gov (United States)

    Lahmiri, Salim

    In this paper, we address the problem of technical analysis information fusion in improving stock market index-level prediction. We present an approach for analyzing stock market price behavior based on different categories of technical analysis metrics and a multiple predictive system. Each category of technical analysis measures is used to characterize stock market price movements. The presented predictive system is based on an ensemble of neural networks (NN) coupled with particle swarm intelligence for parameter optimization where each single neural network is trained with a specific category of technical analysis measures. The experimental evaluation on three international stock market indices and three individual stocks show that the presented ensemble-based technical indicators fusion system significantly improves forecasting accuracy in comparison with single NN. Also, it outperforms the classical neural network trained with index-level lagged values and NN trained with stationary wavelet transform details and approximation coefficients. As a result, technical information fusion in NN ensemble architecture helps improving prediction accuracy.

  7. Fault Diagnosis of Power System Based on Improved Genetic Optimized BP-NN

    Directory of Open Access Journals (Sweden)

    Yuan Pu

    2015-01-01

    Full Text Available BP neural network (Back-Propagation Neural Network, BP-NN is one of the most widely neural network models and is applied to fault diagnosis of power system currently. BP neural network has good self-learning and adaptive ability and generalization ability, but the operation process is easy to fall into local minima. Genetic algorithm has global optimization features, and crossover is the most important operation of the Genetic Algorithm. In this paper, we can modify the crossover of traditional Genetic Algorithm, using improved genetic algorithm optimized BP neural network training initial weights and thresholds, to avoid the problem of BP neural network fall into local minima. The results of analysis by an example, the method can efficiently diagnose network fault location, and improve fault-tolerance and grid fault diagnosis effect.

  8. Conformational Dynamics of apo-GlnBP Revealed by Experimental and Computational Analysis

    KAUST Repository

    Feng, Yitao

    2016-10-13

    The glutamine binding protein (GlnBP) binds l-glutamine and cooperates with its cognate transporters during glutamine uptake. Crystal structure analysis has revealed an open and a closed conformation for apo- and holo-GlnBP, respectively. However, the detailed conformational dynamics have remained unclear. Herein, we combined NMR spectroscopy, MD simulations, and single-molecule FRET techniques to decipher the conformational dynamics of apo-GlnBP. The NMR residual dipolar couplings of apo-GlnBP were in good agreement with a MD-derived structure ensemble consisting of four metastable states. The open and closed conformations are the two major states. This four-state model was further validated by smFRET experiments and suggests the conformational selection mechanism in ligand recognition of GlnBP. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim

  9. Conformational Dynamics of apo-GlnBP Revealed by Experimental and Computational Analysis

    KAUST Repository

    Feng, Yitao; Zhang, Lu; Wu, Shaowen; Liu, Zhijun; Gao, Xin; Zhang, Xu; Liu, Maili; Liu, Jianwei; Huang, Xuhui; Wang, Wenning

    2016-01-01

    The glutamine binding protein (GlnBP) binds l-glutamine and cooperates with its cognate transporters during glutamine uptake. Crystal structure analysis has revealed an open and a closed conformation for apo- and holo-GlnBP, respectively. However, the detailed conformational dynamics have remained unclear. Herein, we combined NMR spectroscopy, MD simulations, and single-molecule FRET techniques to decipher the conformational dynamics of apo-GlnBP. The NMR residual dipolar couplings of apo-GlnBP were in good agreement with a MD-derived structure ensemble consisting of four metastable states. The open and closed conformations are the two major states. This four-state model was further validated by smFRET experiments and suggests the conformational selection mechanism in ligand recognition of GlnBP. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim

  10. Development and application of a multiscale model for the magnetic fusion edge plasma region

    International Nuclear Information System (INIS)

    Hasenbeck, Felix Martin Michael

    2016-01-01

    Plasma edge particle and energy transport perpendicular to the magnetic field plays a decisive role for the performance and lifetime of a magnetic fusion reactor. For the particles, classical and neoclassical theories underestimate the associated radial transport by at least an order of magnitude. Drift fluid models, including mesoscale processes on scales down to tenths of millimeters and microseconds, account for the experimentally found level of radial transport; however, numerical simulations for typical reactor scales (of the order of seconds and centimeters) are computationally very expensive. Large scale code simulations are less costly but usually lack an adequate model for the radial transport. The multiscale model presented in this work aims at improving the description of radial particle transport in large scale codes by including the effects of averaged local drift fluid dynamics on the macroscale profiles. The multiscale balances are derived from a generic multiscale model for a fluid, using the Braginskii closure for a collisional, magnetized plasma, and the assumptions of the B2 code model (macroscale balances) and the model of the local version of the drift fluid code ATTEMPT (mesoscale balances). A combined concurrent-sequential coupling procedure is developed for the implementation of the multiscale model within a coupled code system. An algorithm for the determination of statistically stationary states and adequate averaging intervals for the mesoscale data is outlined and tested, proving that it works consistently and efficiently. The general relation between mesoscale and macroscale dynamics is investigated exemplarily by means of a passive scalar system. While mesoscale processes are convective in this system, earlier studies for small Kubo numbers K<<1 have shown that the macroscale behavior is diffusive. In this work it is demonstrated by numerical experiments that also in the regime of large Kubo numbers K<<1 the macroscale transport

  11. Development and application of a multiscale model for the magnetic fusion edge plasma region

    Energy Technology Data Exchange (ETDEWEB)

    Hasenbeck, Felix Martin Michael

    2016-07-01

    Plasma edge particle and energy transport perpendicular to the magnetic field plays a decisive role for the performance and lifetime of a magnetic fusion reactor. For the particles, classical and neoclassical theories underestimate the associated radial transport by at least an order of magnitude. Drift fluid models, including mesoscale processes on scales down to tenths of millimeters and microseconds, account for the experimentally found level of radial transport; however, numerical simulations for typical reactor scales (of the order of seconds and centimeters) are computationally very expensive. Large scale code simulations are less costly but usually lack an adequate model for the radial transport. The multiscale model presented in this work aims at improving the description of radial particle transport in large scale codes by including the effects of averaged local drift fluid dynamics on the macroscale profiles. The multiscale balances are derived from a generic multiscale model for a fluid, using the Braginskii closure for a collisional, magnetized plasma, and the assumptions of the B2 code model (macroscale balances) and the model of the local version of the drift fluid code ATTEMPT (mesoscale balances). A combined concurrent-sequential coupling procedure is developed for the implementation of the multiscale model within a coupled code system. An algorithm for the determination of statistically stationary states and adequate averaging intervals for the mesoscale data is outlined and tested, proving that it works consistently and efficiently. The general relation between mesoscale and macroscale dynamics is investigated exemplarily by means of a passive scalar system. While mesoscale processes are convective in this system, earlier studies for small Kubo numbers K<<1 have shown that the macroscale behavior is diffusive. In this work it is demonstrated by numerical experiments that also in the regime of large Kubo numbers K<<1 the macroscale transport

  12. AcEST: BP918406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B06 468 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B06. BP918406 - Show BP918406...is mRNA. clone: YMU001_000113_B06. Accession BP918406 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-vene...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-veneris m

  13. AcEST: BP918011 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_E11 519 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E11. BP918011 - Show BP91801...is mRNA. clone: YMU001_000108_E11. Accession BP918011 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiant...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiantum cap

  14. Cold fusion

    International Nuclear Information System (INIS)

    Bush, R.T.

    1991-01-01

    The transmission resonance model (TRM) is combined with some electrochemistry of the cathode surface and found to provide a good fit to new data on excess heat. For the first time, a model for cold fusion not only fits calorimetric data but also predicts optimal trigger points. This suggests that the model is meaningful and that the excess heat phenomenon claimed by Fleischmann and Pons is genuine. A crucial role is suggested for the overpotential and, in particular, for the concentration overpotential, i.e., the hydrogen overvoltage. Self-similar geometry, or scale invariance, i.e., a fractal nature, is revealed by the relative excess power function. Heat bursts are predicted with a scale invariance in time, suggesting a possible link between the TRM and chaos theory. The model describes a near-surface phenomenon with an estimated excess power yield of ∼1 kW/cm 3 Pd, as compared to 50 W/cm 3 of reactor core for a good fission reactor. Transmission resonance-induced nuclear transmutation, a new type of nuclear reaction, is strongly suggested with two types emphasized: transmission resonance-induced neutron transfer reactions yielding essentially the same end result as Teller's hypothesized catalytic neutron transfer and a three-body reaction promoted by standing de Broglie waves. In this paper suggestions for the anomalous production of heat, particles, and radiation are given

  15. 884 Cal.BP and all that

    International Nuclear Information System (INIS)

    Switsur, Roy

    1986-01-01

    A history of the development of the technique of radiocarbon dating highlights the two problems with this method. The first is calibration; the radiocarbon calendar is not linear. However two independent experiments to provide high precision measurements in tree rings have resulted in a high precision calibration curve. The second is how to denote radiocarbon ages and calibrated dates, as this depends on how the dendrochronology time scale used in the calibration is transferred to the actual calendar. If the zero of the dendroscale is transferred from the origin of the Christian calendar to AD 1950, radiocarbon ages are designated CAL BP (BP = before present). There is an alternative method which results in CAL AD and CAL BC. A suggestion for a standard notation is made to avoid the confusion of two systems. (U.K.)

  16. BP Oil Company's approach to risk management

    International Nuclear Information System (INIS)

    Fryman, C.E.

    1996-01-01

    The oil and chemical industries face major challenges in deciding how to handle the numerous recommendations coming from various audits, reviews and studies conducted in the functional areas of personnel health and safety, loss prevention, and environmental protection. And, the number of recommendations continues to grow with time, as regulations and normal business requirements are met. BP Oil has developed a methodology for risk ranking the events leading to specific recommendations and then determining the cost-effectiveness of the recommendations in reducing the risk. The author completed successful pilot tests of this methodology at two of BP Oil's petroleum refineries, examining the recommendations from process hazards analyses and studies completed over the past few years. The methodology has since been implemented throughout their petroleum refining, distribution, transportation, and retail business streams

  17. Efficacy comparison of Accell Evo3 and Grafton demineralized bone matrix putties against autologous bone in a rat posterolateral spine fusion model.

    Science.gov (United States)

    Brecevich, Antonio T; Kiely, Paul D; Yoon, B Victor; Nguyen, Joseph T; Cammisa, Frank P; Abjornson, Celeste

    2017-06-01

    Spinal fusion procedures are intended to stabilize the spinal column for a multitude of disorders including abnormal curvature, traumatic instability, degenerative instability, and damage from infections or tumors. As an aid in the bone healing response, bone graft materials are used to bridge joints for arthrodesis and promote unions in pseudoarthrosis. Currently, the gold standard for stabilizing fusion masses in spinal procedures involves using the osteogenic, osteoinductive, and osteoconductive properties of autologous iliac crest corticocancellous bone. However, considerable morbidity is associated with harvesting the autologous graft. Donor site complications including infection, large hematomas, and pain have been reported at rates as high as 50% (Boden and Jeffrey, 1995). Biologically, the rate of bone repair dictates the rate at which the fusion mass will unite under autologous graft conditions. The purpose of this study is to compare the quality and rate of fusion between Accell Evo3 and Grafton demineralized bone matrix (DBM), with the gold standard iliac crest bone graft (ICBG) as the control, in athymic rat posterolateral fusion. This study was a randomized, controlled study in a laboratory setting at the Hospital for Special Surgery in New York City. Blinded observations were made, which created an assessment of outcomes for successful fusions between each method. Forty-eight (48) athymic rats were used in this study and underwent posterolateral lumbar fusion. They were assessed at either 3 weeks or 9 weeks to see the rate and efficacy of fusion. Outcome measures will be the efficacy of the different bone grafts and their success rates of fusion in the rats. A comparison of the quality and rate of fusion between Accell Evo3® (DBM A) and Grafton (DBM B), with the gold standard iliac crest bone graft (ICBG) as the control, was performed using the established posterolateral intertransverse process on an athymic rat model. Materials were evaluated for

  18. BP's driving safety strategy

    Energy Technology Data Exchange (ETDEWEB)

    Herman, B. [BP Canada Energy Company, Calgary, AB (Canada)

    2006-07-01

    This presentation focused on why it is important to drive safely. It addressed driver fatigue as well as BP's global driving standard. The Standard applies to all BP employees and contractors that drive any vehicle on BP business and consists of 10 mandatory elements focusing on safety of the driver, the safety of the journey, and the safety of the vehicle. The driving standards focus on several themes, including skill and competency of the driver, safety of the journey, and safety of the vehicle. Fatigue causes more than 20 per cent of motorway accidents and is the most frequent cause of accidental death of truck drivers. The presentation also discussed vehicle data recorders, driving immersion, and Driving Safety Program results. Journey management, driver training, vehicle inspections and policies, and statistics on vehicle incidents were also provided. The presentation revealed that a lack of pre-trip journey management, inadequate training or recall of training, and not following safe driving practices were major contributors to incident occurrences. It also revealed that traveling on gravel or ice and avoiding wildlife were factors in many vehicle incidents. 1 tab., 1 fig.

  19. Fusion Simulation Program

    International Nuclear Information System (INIS)

    Greenwald, Martin

    2011-01-01

    Many others in the fusion energy and advanced scientific computing communities participated in the development of this plan. The core planning team is grateful for their important contributions. This summary is meant as a quick overview the Fusion Simulation Program's (FSP's) purpose and intentions. There are several additional documents referenced within this one and all are supplemental or flow down from this Program Plan. The overall science goal of the DOE Office of Fusion Energy Sciences (FES) Fusion Simulation Program (FSP) is to develop predictive simulation capability for magnetically confined fusion plasmas at an unprecedented level of integration and fidelity. This will directly support and enable effective U.S. participation in International Thermonuclear Experimental Reactor (ITER) research and the overall mission of delivering practical fusion energy. The FSP will address a rich set of scientific issues together with experimental programs, producing validated integrated physics results. This is very well aligned with the mission of the ITER Organization to coordinate with its members the integrated modeling and control of fusion plasmas, including benchmarking and validation activities. (1). Initial FSP research will focus on two critical Integrated Science Application (ISA) areas: ISA1, the plasma edge; and ISA2, whole device modeling (WDM) including disruption avoidance. The first of these problems involves the narrow plasma boundary layer and its complex interactions with the plasma core and the surrounding material wall. The second requires development of a computationally tractable, but comprehensive model that describes all equilibrium and dynamic processes at a sufficient level of detail to provide useful prediction of the temporal evolution of fusion plasma experiments. The initial driver for the whole device model will be prediction and avoidance of discharge-terminating disruptions, especially at high performance, which are a critical

  20. Fusion reactor materials

    International Nuclear Information System (INIS)

    Anon.

    1977-01-01

    The following topics are briefly discussed: (1) surface blistering studies on fusion reactor materials, (2) TFTR design support activities, (3) analysis of samples bombarded in-situ in PLT, (4) chemical sputtering effects, (5) modeling of surface behavior, (6) ion migration in glow discharge tube cathodes, (7) alloy development for irradiation performance, (8) dosimetry and damage analysis, and (9) development of tritium migration in fusion devices and reactors

  1. Thermonuclear fusion

    International Nuclear Information System (INIS)

    Weisse, J.

    2000-01-01

    This document takes stock of the two ways of thermonuclear fusion research explored today: magnetic confinement fusion and inertial confinement fusion. The basic physical principles are recalled first: fundamental nuclear reactions, high temperatures, elementary properties of plasmas, ignition criterion, magnetic confinement (charged particle in a uniform magnetic field, confinement and Tokamak principle, heating of magnetized plasmas (ohmic, neutral particles, high frequency waves, other heating means), results obtained so far (scale laws and extrapolation of performances, tritium experiments, ITER project), inertial fusion (hot spot ignition, instabilities, results (Centurion-Halite program, laser experiments). The second part presents the fusion reactor and its associated technologies: principle (tritium production, heat source, neutron protection, tritium generation, materials), magnetic fusion (superconducting magnets, divertor (role, principle, realization), inertial fusion (energy vector, laser adaptation, particle beams, reaction chamber, stresses, chamber concepts (dry and wet walls, liquid walls), targets (fabrication, injection and pointing)). The third chapter concerns the socio-economic aspects of thermonuclear fusion: safety (normal operation and accidents, wastes), costs (costs structure and elementary comparison, ecological impact and external costs). (J.S.)

  2. Fusion devices

    International Nuclear Information System (INIS)

    Fowler, T.K.

    1977-01-01

    Three types of thermonuclear fusion devices currently under development are reviewed for an electric utilities management audience. Overall design features of laser fusion, tokamak, and magnetic mirror type reactors are described and illustrated. Thrusts and trends in current research on these devices that promise to improve performance are briefly reviewed. Twenty photographs and drawings are included

  3. Prediction of BP Reactivity to Talking Using Hybrid Soft Computing Approaches

    Directory of Open Access Journals (Sweden)

    Gurmanik Kaur

    2014-01-01

    Full Text Available High blood pressure (BP is associated with an increased risk of cardiovascular diseases. Therefore, optimal precision in measurement of BP is appropriate in clinical and research studies. In this work, anthropometric characteristics including age, height, weight, body mass index (BMI, and arm circumference (AC were used as independent predictor variables for the prediction of BP reactivity to talking. Principal component analysis (PCA was fused with artificial neural network (ANN, adaptive neurofuzzy inference system (ANFIS, and least square-support vector machine (LS-SVM model to remove the multicollinearity effect among anthropometric predictor variables. The statistical tests in terms of coefficient of determination (R2, root mean square error (RMSE, and mean absolute percentage error (MAPE revealed that PCA based LS-SVM (PCA-LS-SVM model produced a more efficient prediction of BP reactivity as compared to other models. This assessment presents the importance and advantages posed by PCA fused prediction models for prediction of biological variables.

  4. Prediction of BP reactivity to talking using hybrid soft computing approaches.

    Science.gov (United States)

    Kaur, Gurmanik; Arora, Ajat Shatru; Jain, Vijender Kumar

    2014-01-01

    High blood pressure (BP) is associated with an increased risk of cardiovascular diseases. Therefore, optimal precision in measurement of BP is appropriate in clinical and research studies. In this work, anthropometric characteristics including age, height, weight, body mass index (BMI), and arm circumference (AC) were used as independent predictor variables for the prediction of BP reactivity to talking. Principal component analysis (PCA) was fused with artificial neural network (ANN), adaptive neurofuzzy inference system (ANFIS), and least square-support vector machine (LS-SVM) model to remove the multicollinearity effect among anthropometric predictor variables. The statistical tests in terms of coefficient of determination (R (2)), root mean square error (RMSE), and mean absolute percentage error (MAPE) revealed that PCA based LS-SVM (PCA-LS-SVM) model produced a more efficient prediction of BP reactivity as compared to other models. This assessment presents the importance and advantages posed by PCA fused prediction models for prediction of biological variables.

  5. Embry-Riddle Aeronautical University multispectral sensor and data fusion laboratory: a model for distributed research and education

    Science.gov (United States)

    McMullen, Sonya A. H.; Henderson, Troy; Ison, David

    2017-05-01

    The miniaturization of unmanned systems and spacecraft, as well as computing and sensor technologies, has opened new opportunities in the areas of remote sensing and multi-sensor data fusion for a variety of applications. Remote sensing and data fusion historically have been the purview of large government organizations, such as the Department of Defense (DoD), National Aeronautics and Space Administration (NASA), and National Geospatial-Intelligence Agency (NGA) due to the high cost and complexity of developing, fielding, and operating such systems. However, miniaturized computers with high capacity processing capabilities, small and affordable sensors, and emerging, commercially available platforms such as UAS and CubeSats to carry such sensors, have allowed for a vast range of novel applications. In order to leverage these developments, Embry-Riddle Aeronautical University (ERAU) has developed an advanced sensor and data fusion laboratory to research component capabilities and their employment on a wide-range of autonomous, robotic, and transportation systems. This lab is unique in several ways, for example, it provides a traditional campus laboratory for students and faculty to model and test sensors in a range of scenarios, process multi-sensor data sets (both simulated and experimental), and analyze results. Moreover, such allows for "virtual" modeling, testing, and teaching capability reaching beyond the physical confines of the facility for use among ERAU Worldwide students and faculty located around the globe. Although other institutions such as Georgia Institute of Technology, Lockheed Martin, University of Dayton, and University of Central Florida have optical sensor laboratories, the ERAU virtual concept is the first such lab to expand to multispectral sensors and data fusion, while focusing on the data collection and data products and not on the manufacturing aspect. Further, the initiative is a unique effort among Embry-Riddle faculty to develop multi

  6. Collaboration on Modeling of Ion Bernstein Wave Antenna Array and Coupling to Plasma on Tokamak Fusion Text Reactor. Final report

    International Nuclear Information System (INIS)

    Intrator, T.

    2000-01-01

    This proposal was peer reviewed and funded as a Collaboration on ''Low Phase Speed Radio Frequency Current Drive Experiments at the Tokamak Fusion Test Reactor''. The original plans we had were to carry out the collaboration proposal by including a post doctoral scientist stationed at PPPL. In response to a 60+% funding cut, all expenses were radically pruned. The post doctoral position was eliminated, and the Principal Investigator (T. Intrator) carried out the brunt of the collaboration. Visits to TFTR enabled T. Intrator to set up access to the TFTR computing network, database, and get familiar with the new antennas that were being installed in TFTR during an up to air. One unfortunate result of the budget squeeze that TFTR felt for its last year of operation was that the experiments that we specifically got funded to perform were not granted run time on TFTR., On the other hand we carried out some modeling of the electric field structure around the four strap direct launch Ion Bernstein Wave (IBW) antenna that was operated on TFTR. This turned out to be a useful exercise and shed some light on the operational characteristics of the IBW antenna and its coupling to the plasma. Because of this turn of events, the project was renamed ''Modeling of Ion Bernstein Wave Antenna Array and Coupling to Plasma on Tokamak Fusion Test Reactor''

  7. Assessment of Novel Anti-thrombotic Fusion Proteins for Inhibition of Stenosis in a Porcine Model of Arteriovenous Graft.

    Directory of Open Access Journals (Sweden)

    Christi M Terry

    Full Text Available Hemodialysis arteriovenous synthetic grafts (AVG provide high volumetric blood flow rates shortly after surgical placement. However, stenosis often develops at the vein-graft anastomosis contributing to thrombosis and early graft failure. Two novel fusion proteins, ANV-6L15 and TAP-ANV, inhibit the tissue factor/factor VIIa coagulation complex and the factor Xa/factor Va complex, respectively. Each inhibitor domain is fused to an annexin V domain that targets the inhibitor activity to sites of vascular injury to locally inhibit thrombosis. This study's objective was to determine if these antithrombotic proteins are safe and effective in inhibiting AVG stenosis.A bolus of either TAP-ANV or ANV-6L15 fusion protein was administered intravenously immediately prior to surgical placement of a synthetic graft between the external jugular vein and common carotid artery in a porcine model. At surgery, the vein and artery were irrigated with the anti-thrombotic fusion protein. Control animals received intravenous heparin. At 4 weeks, MRI was performed to evaluate graft patency, the pigs were then euthanized and grafts and attached vessels were explanted for histomorphometric assessment of neointimal hyperplasia at the vein-graft anastomosis. Blood was collected at surgery, immediately after surgery and at euthanasia for serum metabolic panels and coagulation chemistries.No acute thrombosis occurred in the control group or in either experimental group. No abnormal serum chemistries, activated clotting times or PT, PTT values were observed after treatment in experimental or control animals. However, at the vein-graft anastomosis, there was no difference between the control and experimental groups in cross-sectional lumen areas, as measured on MRI, and no difference in hyperplasia areas as determined by histomorphometry. These results suggest that local irrigation of TAP-ANV or ANV-6L15 intra-operatively was as effective in inhibiting acute graft thrombosis

  8. An optimized data fusion method and its application to improve lateral boundary conditions in winter for Pearl River Delta regional PM2.5 modeling, China

    Science.gov (United States)

    Huang, Zhijiong; Hu, Yongtao; Zheng, Junyu; Zhai, Xinxin; Huang, Ran

    2018-05-01

    Lateral boundary conditions (LBCs) are essential for chemical transport models to simulate regional transport; however they often contain large uncertainties. This study proposes an optimized data fusion approach to reduce the bias of LBCs by fusing gridded model outputs, from which the daughter domain's LBCs are derived, with ground-level measurements. The optimized data fusion approach follows the framework of a previous interpolation-based fusion method but improves it by using a bias kriging method to correct the spatial bias in gridded model outputs. Cross-validation shows that the optimized approach better estimates fused fields in areas with a large number of observations compared to the previous interpolation-based method. The optimized approach was applied to correct LBCs of PM2.5 concentrations for simulations in the Pearl River Delta (PRD) region as a case study. Evaluations show that the LBCs corrected by data fusion improve in-domain PM2.5 simulations in terms of the magnitude and temporal variance. Correlation increases by 0.13-0.18 and fractional bias (FB) decreases by approximately 3%-15%. This study demonstrates the feasibility of applying data fusion to improve regional air quality modeling.

  9. BP1 Homeoprotein Enhances Metastatic Potential in Er-Negative Breast Cancer

    Directory of Open Access Journals (Sweden)

    Yebo Fu, Yi Lian, Kyung Soon Kim, Lei Zhang, A. Katharine Hindle, Fred Brody, Robert S. Siegel, Timothy A. McCaffrey, Sidney W. Fu

    2010-01-01

    Full Text Available Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER- tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. I sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p<0.005, and enhanced the in vitro invasive activity by 25-65 fold (p<0.001. Microarray experiments were performed to identify differentially expressed genes when BP1 is overexpressed. The gene expression profile of the transfected cell lines were compared, resulting in 71 differentially expressed genes with a fold-change of >=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target.

  10. Sleep-time BP: prognostic marker of type 2 diabetes and therapeutic target for prevention.

    Science.gov (United States)

    Hermida, Ramón C; Ayala, Diana E; Mojón, Artemio; Fernández, José R

    2016-02-01

    We investigated the prognostic value of clinic and ambulatory BP (ABP) to predict new-onset diabetes and whether risk reduction is related to the progressive decrease of clinic BP or awake or asleep ABP. We prospectively evaluated 2,656 individuals without diabetes, 1,292 men and 1,364 women, 50.6 ± 14.3 years of age, with baseline BP ranging from normotension to hypertension according to ABP criteria. At baseline and annually (more frequently if hypertension treatment was adjusted based on ABP) thereafter, ABP and physical activity (wrist actigraphy) were simultaneously monitored for 48 h to accurately derive the awake and asleep BP means. During a 5.9-year median follow-up, 190 participants developed type 2 diabetes. The asleep systolic ABP mean was the most significant predictor of new-onset diabetes in a Cox proportional-hazard model adjusted for age, waist circumference, glucose, chronic kidney disease (CKD) and hypertension treatment. Daytime clinic BP and awake or 48 h ABP mean had no predictive value when corrected by the asleep ABP mean. Analyses of BP changes during follow-up revealed a 30% reduction in the risk of new-onset diabetes per 1-SD decrease in asleep systolic ABP mean, independent of changes in clinic BP or awake or 48 h ABP means. Sleep-time BP is a highly significant independent prognostic marker for new-onset diabetes. Alteration in sleep-time BP regulation seems to precede, rather than follow, the development of new-onset diabetes. Most important, lowering asleep BP, a novel therapeutic target requiring ABP evaluation, could be a significant method for reducing new-onset diabetes risk.

  11. Atomic fusion, Gerrard atomic fusion

    International Nuclear Information System (INIS)

    Gerrard, T.H.

    1980-01-01

    In the approach to atomic fusion described here the heat produced in a fusion reaction, which is induced in a chamber by the interaction of laser beams and U.H.F. electromagnetic beams with atom streams, is transferred to a heat exchanger for electricity generation by a coolant flowing through a jacket surrounding the chamber. (U.K.)

  12. Fusion plasma physics

    CERN Document Server

    Stacey, Weston M

    2012-01-01

    This revised and enlarged second edition of the popular textbook and reference contains comprehensive treatments of both the established foundations of magnetic fusion plasma physics and of the newly developing areas of active research. It concludes with a look ahead to fusion power reactors of the future. The well-established topics of fusion plasma physics -- basic plasma phenomena, Coulomb scattering, drifts of charged particles in magnetic and electric fields, plasma confinement by magnetic fields, kinetic and fluid collective plasma theories, plasma equilibria and flux surface geometry, plasma waves and instabilities, classical and neoclassical transport, plasma-materials interactions, radiation, etc. -- are fully developed from first principles through to the computational models employed in modern plasma physics. The new and emerging topics of fusion plasma physics research -- fluctuation-driven plasma transport and gyrokinetic/gyrofluid computational methodology, the physics of the divertor, neutral ...

  13. Overview of Theory and Modeling in the Heavy Ion Fusion Virtual National Laboratory

    International Nuclear Information System (INIS)

    Davidson, R.C.; Kaganovich, I.D.; Lee, W.W.; Qin, H.; Startsev, E.A.; Tzenov, S.; Friedman, A.; Barnard, J.J.; Cohen, R.H.; Grote, D.P.; Lund, S.M.; Sharp, W.M.; Celata, C.M.; De Hoon, M.; Henestroza, E.; Lee, E.P.; Yu, S.S.; Vay, J.-L.; Welch, D.R.; Rose, D.V.; Olson, C.L.

    2003-01-01

    This paper presents analytical and simulation studies of intense heavy ion beam propagation, including the injection, acceleration, transport and compression phases, and beam transport and focusing in background plasma in the target chamber. Analytical theory and simulations that support the High Current Experiment (HCX), the Neutralized Transport Experiment (NTX), and the advanced injector development program are being used to provide a basic understanding of the nonlinear beam dynamics and collective processes, and to develop design concepts for the next-step Integrated Beam Experiment (IBX), an Integrated Research Experiment (IRE), and a heavy ion fusion driver. Three-dimensional (3-D) nonlinear perturbative simulations have been applied to collective instabilities driven by beam temperature anisotropy and to two-stream interactions between the beam ions and any unwanted background electrons. Three-dimensional particle-in-cell simulations of the 2 MV Electrostatic Quadrupole (ESQ) injector have clarified the influence of pulse rise time. Analytical studies and simulations of the drift compression process have been carried out. Syntheses of a four-dimensional (4-D) particle distribution function from phase-space projections have been developed. And, studies of the generation and trapping of stray electrons in the beam self-fields have been performed. Particle-in-cell simulations, involving preformed plasma, are being used to study the influence of charge and current neutralization on the focusing of the ion beam in Neutralized Transport Experiment and in a fusion chamber

  14. a Probability Model for Drought Prediction Using Fusion of Markov Chain and SAX Methods

    Science.gov (United States)

    Jouybari-Moghaddam, Y.; Saradjian, M. R.; Forati, A. M.

    2017-09-01

    Drought is one of the most powerful natural disasters which are affected on different aspects of the environment. Most of the time this phenomenon is immense in the arid and semi-arid area. Monitoring and prediction the severity of the drought can be useful in the management of the natural disaster caused by drought. Many indices were used in predicting droughts such as SPI, VCI, and TVX. In this paper, based on three data sets (rainfall, NDVI, and land surface temperature) which are acquired from MODIS satellite imagery, time series of SPI, VCI, and TVX in time limited between winters 2000 to summer 2015 for the east region of Isfahan province were created. Using these indices and fusion of symbolic aggregation approximation and hidden Markov chain drought was predicted for fall 2015. For this purpose, at first, each time series was transformed into the set of quality data based on the state of drought (5 group) by using SAX algorithm then the probability matrix for the future state was created by using Markov hidden chain. The fall drought severity was predicted by fusion the probability matrix and state of drought severity in summer 2015. The prediction based on the likelihood for each state of drought includes severe drought, middle drought, normal drought, severe wet and middle wet. The analysis and experimental result from proposed algorithm show that the product of this algorithm is acceptable and the proposed algorithm is appropriate and efficient for predicting drought using remote sensor data.

  15. High Level Information Fusion (HLIF) with nested fusion loops

    Science.gov (United States)

    Woodley, Robert; Gosnell, Michael; Fischer, Amber

    2013-05-01

    Situation modeling and threat prediction require higher levels of data fusion in order to provide actionable information. Beyond the sensor data and sources the analyst has access to, the use of out-sourced and re-sourced data is becoming common. Through the years, some common frameworks have emerged for dealing with information fusion—perhaps the most ubiquitous being the JDL Data Fusion Group and their initial 4-level data fusion model. Since these initial developments, numerous models of information fusion have emerged, hoping to better capture the human-centric process of data analyses within a machine-centric framework. 21st Century Systems, Inc. has developed Fusion with Uncertainty Reasoning using Nested Assessment Characterizer Elements (FURNACE) to address challenges of high level information fusion and handle bias, ambiguity, and uncertainty (BAU) for Situation Modeling, Threat Modeling, and Threat Prediction. It combines JDL fusion levels with nested fusion loops and state-of-the-art data reasoning. Initial research has shown that FURNACE is able to reduce BAU and improve the fusion process by allowing high level information fusion (HLIF) to affect lower levels without the double counting of information or other biasing issues. The initial FURNACE project was focused on the underlying algorithms to produce a fusion system able to handle BAU and repurposed data in a cohesive manner. FURNACE supports analyst's efforts to develop situation models, threat models, and threat predictions to increase situational awareness of the battlespace. FURNACE will not only revolutionize the military intelligence realm, but also benefit the larger homeland defense, law enforcement, and business intelligence markets.

  16. ATM signaling and 53BP1

    International Nuclear Information System (INIS)

    Zgheib, Omar; Huyen, Yentram; DiTullio, Richard A.; Snyder, Andrew; Venere, Monica; Stavridi, Elena S.; Halazonetis, Thanos D.

    2005-01-01

    The ATM (mutated in Ataxia-Telangiectasia) protein kinase is an important player in signaling the presence of DNA double strand breaks (DSBs) in higher eukaryotes. Recent studies suggest that ATM monitors the presence of DNA DSBs indirectly, through DNA DSB-induced changes in chromatin structure. One of the proteins that sense these chromatin structure changes is 53BP1, a DNA damage checkpoint protein conserved in all eukaryotes and the putative ortholog of the S. cerevisiae RAD9 protein. We review here the mechanisms by which ATM is activated in response to DNA DSBs, as well as key ATM substrates that control cell cycle progression, apoptosis and DNA repair

  17. Fusion rules and four-point functions in the AdS3 Wess-Zumino-Novikov-Witten model

    International Nuclear Information System (INIS)

    Baron, Walter H.; Nunez, Carmen A.

    2009-01-01

    We study the operator product expansion in the AdS 3 Wess-Zumino-Novikov-Witten (WZNW) model. The operator-product expansion of primary fields and their spectral flow images is computed from the analytic continuation of the expressions in the H 3 + WZNW model, adding spectral flow. We argue that the symmetries of the affine algebra require a truncation which establishes the closure of the fusion rules on the Hilbert space of the theory. Although the physical mechanism determining the decoupling is not completely understood, we present several consistency checks on the results. A preliminary analysis of factorization allows to obtain some properties of four-point functions involving fields in generic sectors of the theory, to verify that they agree with the spectral flow selection rules and to show that the truncation must be realized in physical amplitudes for consistency.

  18. An Ensemble Deep Convolutional Neural Network Model with Improved D-S Evidence Fusion for Bearing Fault Diagnosis.

    Science.gov (United States)

    Li, Shaobo; Liu, Guokai; Tang, Xianghong; Lu, Jianguang; Hu, Jianjun

    2017-07-28

    Intelligent machine health monitoring and fault diagnosis are becoming increasingly important for modern manufacturing industries. Current fault diagnosis approaches mostly depend on expert-designed features for building prediction models. In this paper, we proposed IDSCNN, a novel bearing fault diagnosis algorithm based on ensemble deep convolutional neural networks and an improved Dempster-Shafer theory based evidence fusion. The convolutional neural networks take the root mean square (RMS) maps from the FFT (Fast Fourier Transformation) features of the vibration signals from two sensors as inputs. The improved D-S evidence theory is implemented via distance matrix from evidences and modified Gini Index. Extensive evaluations of the IDSCNN on the Case Western Reserve Dataset showed that our IDSCNN algorithm can achieve better fault diagnosis performance than existing machine learning methods by fusing complementary or conflicting evidences from different models and sensors and adapting to different load conditions.

  19. Local effect of zoledronic acid on new bone formation in posterolateral spinal fusion with demineralized bone matrix in a murine model.

    Science.gov (United States)

    Zwolak, Pawel; Farei-Campagna, Jan; Jentzsch, Thorsten; von Rechenberg, Brigitte; Werner, Clément M

    2018-01-01

    Posterolateral spinal fusion is a common orthopaedic surgery performed to treat degenerative and traumatic deformities of the spinal column. In posteriolateral spinal fusion, different osteoinductive demineralized bone matrix products have been previously investigated. We evaluated the effect of locally applied zoledronic acid in combination with commercially available demineralized bone matrix putty on new bone formation in posterolateral spinal fusion in a murine in vivo model. A posterolateral sacral spine fusion in murine model was used to evaluate the new bone formation. We used the sacral spine fusion model to model the clinical situation in which a bone graft or demineralized bone matrix is applied after dorsal instrumentation of the spine. In our study, group 1 received decortications only (n = 10), group 2 received decortication, and absorbable collagen sponge carrier, group 3 received decortication and absorbable collagen sponge carrier with zoledronic acid in dose 10 µg, group 4 received demineralized bone matrix putty (DBM putty) plus decortication (n = 10), and group 5 received DBM putty, decortication and locally applied zoledronic acid in dose 10 µg. Imaging was performed using MicroCT for new bone formation assessment. Also, murine spines were harvested for histopathological analysis 10 weeks after surgery. The surgery performed through midline posterior approach was reproducible. In group with decortication alone there was no new bone formation. Application of demineralized bone matrix putty alone produced new bone formation which bridged the S1-S4 laminae. Local application of zoledronic acid to demineralized bone matrix putty resulted in significant increase of new bone formation as compared to demineralized bone matrix putty group alone. A single local application of zoledronic acid with DBM putty during posterolateral fusion in sacral murine spine model increased significantly new bone formation in situ in our model. Therefore, our

  20. Constraining a complex biogeochemical model for CO2 and N2O emission simulations from various land uses by model-data fusion

    Science.gov (United States)

    Houska, Tobias; Kraus, David; Kiese, Ralf; Breuer, Lutz

    2017-07-01

    This study presents the results of a combined measurement and modelling strategy to analyse N2O and CO2 emissions from adjacent arable land, forest and grassland sites in Hesse, Germany. The measured emissions reveal seasonal patterns and management effects, including fertilizer application, tillage, harvest and grazing. The measured annual N2O fluxes are 4.5, 0.4 and 0.1 kg N ha-1 a-1, and the CO2 fluxes are 20.0, 12.2 and 3.0 t C ha-1 a-1 for the arable land, grassland and forest sites, respectively. An innovative model-data fusion concept based on a multicriteria evaluation (soil moisture at different depths, yield, CO2 and N2O emissions) is used to rigorously test the LandscapeDNDC biogeochemical model. The model is run in a Latin-hypercube-based uncertainty analysis framework to constrain model parameter uncertainty and derive behavioural model runs. The results indicate that the model is generally capable of predicting trace gas emissions, as evaluated with RMSE as the objective function. The model shows a reasonable performance in simulating the ecosystem C and N balances. The model-data fusion concept helps to detect remaining model errors, such as missing (e.g. freeze-thaw cycling) or incomplete model processes (e.g. respiration rates after harvest). This concept further elucidates the identification of missing model input sources (e.g. the uptake of N through shallow groundwater on grassland during the vegetation period) and uncertainty in the measured validation data (e.g. forest N2O emissions in winter months). Guidance is provided to improve the model structure and field measurements to further advance landscape-scale model predictions.

  1. Transgenic Mouse Model Harboring the Transcriptional Fusion Ccl20-Luciferase as a Novel Reporter of Pro-Inflammatory Response

    Science.gov (United States)

    Crispo, Martina; Van Maele, Laurye; Tabareau, Julien; Cayet, Delphine; Errea, Agustina; Ferreira, Ana María; Rumbo, Martin; Sirard, Jean Claude

    2013-01-01

    The chemokine CCL20, the unique ligand of CCR6 functions as an attractant of immune cells. Expression of CCL20 is induced by Toll-like Receptor (TLR) signaling or proinflammatory cytokine stimulation. However CCL20 is also constitutively produced at specific epithelial sites of mucosa. This expression profile is achieved by transcriptional regulation. In the present work we characterized regulatory features of mouse Ccl20 gene. Transcriptional fusions between the mouse Ccl20 promoter and the firefly luciferase (luc) encoding gene were constructed and assessed in in vitro and in vivo assays. We found that liver CCL20 expression and luciferase activity were upregulated by systemic administration of the TLR5 agonist flagellin. Using shRNA and dominant negative form specific for mouse TLR5, we showed that this expression was controlled by TLR5. To address in situ the regulation of gene activity, a transgenic mouse line harboring a functional Ccl20-luc fusion was generated. The luciferase expression was highly concordant with Ccl20 expression in different tissues. Our data indicate that the transgenic mouse model can be used to monitor activation of innate response in vivo. PMID:24265691

  2. Multiple local feature representations and their fusion based on an SVR model for iris recognition using optimized Gabor filters

    Science.gov (United States)

    He, Fei; Liu, Yuanning; Zhu, Xiaodong; Huang, Chun; Han, Ye; Dong, Hongxing

    2014-12-01

    Gabor descriptors have been widely used in iris texture representations. However, fixed basic Gabor functions cannot match the changing nature of diverse iris datasets. Furthermore, a single form of iris feature cannot overcome difficulties in iris recognition, such as illumination variations, environmental conditions, and device variations. This paper provides multiple local feature representations and their fusion scheme based on a support vector regression (SVR) model for iris recognition using optimized Gabor filters. In our iris system, a particle swarm optimization (PSO)- and a Boolean particle swarm optimization (BPSO)-based algorithm is proposed to provide suitable Gabor filters for each involved test dataset without predefinition or manual modulation. Several comparative experiments on JLUBR-IRIS, CASIA-I, and CASIA-V4-Interval iris datasets are conducted, and the results show that our work can generate improved local Gabor features by using optimized Gabor filters for each dataset. In addition, our SVR fusion strategy may make full use of their discriminative ability to improve accuracy and reliability. Other comparative experiments show that our approach may outperform other popular iris systems.

  3. Glucocorticoid induced osteopenia in cancellous bone of sheep: validation of large animal model for spine fusion and biomaterial research.

    Science.gov (United States)

    Ding, Ming; Cheng, Liming; Bollen, Peter; Schwarz, Peter; Overgaard, Søren

    2010-02-15

    Glucocorticoid with low calcium and phosphorus intake induces osteopenia in cancellous bone of sheep. To validate a large animal model for spine fusion and biomaterial research. A variety of ovariectomized animals has been used to study osteoporosis. Most experimental spine fusions were based on normal animals, and there is a great need for suitable large animal models with adequate bone size that closely resemble osteoporosis in humans. Eighteen female skeletal mature sheep were randomly allocated into 3 groups, 6 each. Group 1 (GC-1) received prednisolone (GC) treatment (0.60 mg/kg/day, 5 times weekly) for 7 months. Group 2 (GC-2) received the same treatment as GC-1 for 7 months followed by 3 months without treatment. Group 3 was left untreated and served as the controls. All sheep received restricted diet with low calcium and phosphorus during experiment. After killing the animals, cancellous bone specimens from the vertebra, femurs, and tibias were micro-CT scanned and tested mechanically. Serum biomarkers were determined. In lumbar vertebra, the GC treatment resulted in significant decrease of cancellous bone volume fraction and trabecular thickness, and bone strength. However, the microarchitecture and bone strength of GC-2 recovered to a similar level of the controls. A similar trend of microarchitectural changes was also observed in the distal femur and proximal tibia of both GC treated sheep. The bone formation marker serum-osteocalcin was largely reduced in GC-1 compared to the controls, but recovered with a rebound increase at month 10 in GC-2. The current investigation demonstrates that the changes in microarchitecture and mechanical properties were comparable with those observed in humans after long-term GC treatment. A prolonged GC treatment is needed for a long-term observation to keep osteopenic bone. This model resembles long-term glucocorticoid treated osteoporotic model, and is useful in preclinical studies.

  4. Cold fusion

    International Nuclear Information System (INIS)

    Suh, Suk Yong; Sung, Ki Woong; Kang, Joo Sang; Lee, Jong Jik

    1995-02-01

    So called 'cold fusion phenomena' are not confirmed yet. Excess heat generation is very delicate one. Neutron generation is most reliable results, however, the records are erratic and the same results could not be repeated. So there is no reason to exclude the malfunction of testing instruments. The same arguments arise in recording 4 He, 3 He, 3 H, which are not rich in quantity basically. An experiment where plenty of 4 He were recorded is attached in appendix. The problem is that we are trying to search cold fusion which is permitted by nature or not. The famous tunneling effect in quantum mechanics will answer it, however, the most fusion rate is known to be negligible. The focus of this project is on the theme that how to increase that negligible fusion rate. 6 figs, 4 tabs, 1512 refs. (Author)

  5. Cold fusion

    Energy Technology Data Exchange (ETDEWEB)

    Suh, Suk Yong; Sung, Ki Woong; Kang, Joo Sang; Lee, Jong Jik [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)

    1995-02-01

    So called `cold fusion phenomena` are not confirmed yet. Excess heat generation is very delicate one. Neutron generation is most reliable results, however, the records are erratic and the same results could not be repeated. So there is no reason to exclude the malfunction of testing instruments. The same arguments arise in recording {sup 4}He, {sup 3}He, {sup 3}H, which are not rich in quantity basically. An experiment where plenty of {sup 4}He were recorded is attached in appendix. The problem is that we are trying to search cold fusion which is permitted by nature or not. The famous tunneling effect in quantum mechanics will answer it, however, the most fusion rate is known to be negligible. The focus of this project is on the theme that how to increase that negligible fusion rate. 6 figs, 4 tabs, 1512 refs. (Author).

  6. Laser fusion

    International Nuclear Information System (INIS)

    Ashby, D.E.T.F.

    1976-01-01

    A short survey is given on laser fusion its basic concepts and problems and the present theoretical and experimental methods. The future research program of the USA in this field is outlined. (WBU) [de

  7. [Clinical significance of NS1-BP expression in esophageal squamous cell carcinoma].

    Science.gov (United States)

    Ren, K; Qian, D; Wang, Y W; Pang, Q S; Zhang, W C; Yuan, Z Y; Wang, P

    2018-01-23

    Objective: To investigate the clinical significance of NS1-BP expression in patients with esophageal squamous cell carcinoma (ESCC), and to study the roles of NS1-BP in proliferation and apoptosis of ESCC cells. Methods: A total of 98 tumor tissues and 30 adjacent normal tissues from 98 ESCC patients were used as study group and control group, and these samples were collected in Sun Yat-Sen University Cancer Center between 2002 and 2008. In addition, 46 ESCC tissues which were collected in Cancer Institute and Hospital of Tianjin Medical University were used as validation group. Expression of mucosal NS1-BP was detected by immunohistochemistry. Kaplan-Meier curve and log-rank test were used to analyze the survival rate. Multivariate Cox proportional hazard model was used to analyze the prognostic factors. Furthermore, NS1-BP was over expressed or knocked down in ESCC cells by transient transfection. Protein levels of c-Myc were detected by western blot. Cell viability and apoptosis was analyzed by MTT assay and flow cytometry. Results: Among all of tested samples, NS1-BP were down-regulated in 9 out of 30 non-tumorous normal esophageal tissues (30.0%) and 85 out of 144 ESCC tissues (59.0%), respectively, showing a statistically significant difference ( P =0.012). In the study group, three-year disease-free survival rate of NS1-BP high expression group (53.2%) was significantly higher than that of NS1-BP low expression group (27.6%; P =0.009). In the validation group, the three-year disease-free survival rates were 57.8% and 25.5% in NS1-BP high and low levels groups, respectively, showing a similar results ( P =0.016). Importantly, multivariate analyses showed that low expression of NS1-BP was an independent predictor for chemoradiotherapy sensitivity and shorter disease-free survival time in ESCC patients( P <0.05 for all). Furthermore, overexpressed NS1-BP in TE-1 cells repressed c-Myc expression, inhibited cell proliferation and promoted apoptosis. In contrast

  8. Overview of Theory and Modeling in the Heavy Ion Fusion Virtual National Laboratory

    CERN Document Server

    Davidson, R C; Celata, C M; Cohen, R H; De Hoon, M; Friedman, A; Grote, D P; Henestroza, E; Kaganovich, I D; Lee, E P; Lee, W W; Lund, S M; Olson, C L; Qin, H; Rose, D V; Sharp, W M; Startsev, E A; Tzenov, Stephan I; Vay, J L; Welch, D R; Yu, S S

    2003-01-01

    This paper presents analytical and simulation studies of intense heavy ion beam propagation, including the injection, acceleration, transport and compression phases, and beam transport and focusing in background plasma in the target chamber. Analytical theory and simulations that support the High Current Experiment (HCX), the Neutralized Transport Experiment (NTX), and the advanced injector development program are being used to provide a basic understanding of the nonlinear beam dynamics and collective processes, and to develop design concepts for the next-step Integrated Beam Experiment (IBX), an Integrated Research Experiment (IRE), and a heavy ion fusion driver. Three-dimensional (3-D) nonlinear perturbative simulations have been applied to collective instabilities driven by beam temperature anisotropy and to two-stream interactions between the beam ions and any unwanted background electrons. Three-dimensional particle-in-cell simulations of the 2 MV Electrostatic Quadrupole (ESQ) injector have clarified t...

  9. Research on oral test modeling based on multi-feature fusion

    Science.gov (United States)

    Shi, Yuliang; Tao, Yiyue; Lei, Jun

    2018-04-01

    In this paper, the spectrum of speech signal is taken as an input of feature extraction. The advantage of PCNN in image segmentation and other processing is used to process the speech spectrum and extract features. And a new method combining speech signal processing and image processing is explored. At the same time of using the features of the speech map, adding the MFCC to establish the spectral features and integrating them with the features of the spectrogram to further improve the accuracy of the spoken language recognition. Considering that the input features are more complicated and distinguishable, we use Support Vector Machine (SVM) to construct the classifier, and then compare the extracted test voice features with the standard voice features to achieve the spoken standard detection. Experiments show that the method of extracting features from spectrograms using PCNN is feasible, and the fusion of image features and spectral features can improve the detection accuracy.

  10. A statistical approach for predicting thermal diffusivity profiles in fusion plasmas as a transport model

    International Nuclear Information System (INIS)

    Yokoyama, Masayuki

    2014-01-01

    A statistical approach is proposed to predict thermal diffusivity profiles as a transport “model” in fusion plasmas. It can provide regression expressions for the ion and electron heat diffusivities (χ i and χ e ), separately, to construct their radial profiles. An approach that this letter is proposing outstrips the conventional scaling laws for the global confinement time (τ E ) since it also deals with profiles (temperature, density, heating depositions etc.). This approach has become possible with the analysis database accumulated by the extensive application of the integrated transport analysis suite to experiment data. In this letter, TASK3D-a analysis database for high-ion-temperature (high-T i ) plasmas in the LHD (Large Helical Device) is used as an example to describe an approach. (author)

  11. Assessment of ion-atom collision data for magnetic fusion plasma edge modelling

    International Nuclear Information System (INIS)

    Phaneuf, R.A.

    1990-01-01

    Cross-section data for ion-atom collision processes which play important roles in the edge plasma of magnetically-confined fusion devices are surveyed and reviewed. The species considered include H, He, Li, Be, C, O, Ne, Al, Si, Ar, Ti, Cr, Fe, Ni, Cu, Mo, W and their ions. The most important ion-atom collision processes occurring in the edge plasma are charge-exchange reactions. Excitation and ionization processes are also considered. The scope is limited to atomic species and to collision velocities corresponding to plasma ion temperatures in the 2-200 eV range. Sources of evaluated or recommended data are presented where possible, and deficiencies in the data base are indicated. 42 refs., 1 fig., 4 tabs

  12. Cost Modeling for Fabrication of Direct Drive Inertial Fusion Energy Targets

    International Nuclear Information System (INIS)

    Rickman, William Samuel; Goodin, Daniel T.

    2003-01-01

    Chemical engineering analyses are underway for a commercial-scale [1000-MW(electric)] divinyl benzene foam-based Inertial Fusion Energy (IFE) Target Fabrication Facility (TFF). This facility is designed to supply 500,000, 4-mm-outer diameter targets per day - coated via interfacial polycondensation, dried with supercritical CO 2 , sputter coated with Au and/or Pd, and filled with deuterium-tritium layered at cryogenic temperatures and injected into the fusion chamber. Such targets would be used in a direct-drive IFE power plant.The work uses manufacturing processes being developed in the laboratory, chemical engineering scaleup principles, and established cost-estimating methods. The plant conceptual design includes a process flow diagram, mass and energy balances, equipment sizing and sketches, storage tanks, and facility views.The cost estimate includes both capital and operating costs. Initial results for a TFF dedicated to one 1000-MW(electric) plant indicate that the costs per target are well within the commercially viable range. Larger TFF plants [3000 MW(electric)] are projected to lead to significantly reduced costs per injected target. Additional cost reductions are possible by producing dried, sputter-coated empty shells at a central facility that services multiple power plants.The results indicate that the installed capital cost is about $100 million and the annual operating costs will be about $20 million, for a cost per target of about $0.17 each. These design and cost projections assume that a significant process development and scaleup program is successfully completed for all of the basic unit operations included in the facility

  13. Fusion energy

    International Nuclear Information System (INIS)

    Anon.

    1979-01-01

    The efforts of the Chemical Technology Division in fusion energy include the areas of fuel handling, processing, and containment. Current studies are concerned largely with the development of vacuum pumps for fusion reactors and experiments and with development and evaluation of techniques for recovering tritium from solid or liquid breeding blankets. In addition, a small effort is devoted to support of the ORNL design of a major Tokamak experiment, The Next Step (TNS)

  14. Laser fusion

    International Nuclear Information System (INIS)

    Key, M.H.; Oxford Univ.

    1990-04-01

    The use of lasers to drive implosions for the purpose of inertially confined fusion is an area of intense activity where progress compares favourably with that made in magnetic fusion and there are significant prospects for future development. In this brief review the basic concept is summarised and the current status is outlined both in the area of laser technology and in the most recent results from implosion experiments. Prospects for the future are also considered. (author)

  15. Sediment Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  16. Air Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  17. Waste Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  18. Air Monitoring Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  19. Surface Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  20. Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  1. Nuclear fusion

    International Nuclear Information System (INIS)

    Al-zaelic, M.M.

    2013-01-01

    Nuclear fusion can be relied on to solve the global energy crisis if the process of limiting the heat produced by the fusion reaction (Plasma) is successful. Currently scientists are progressively working on this aspect whereas there are two methods to limit the heat produced by fusion reaction, the two methods are auto-restriction using laser beam and magnetic restriction through the use of magnetic fields and research is carried out to improve these two methods. It is expected that at the end of this century the nuclear fusion energy will play a vital role in overcoming the global energy crisis and for these reasons, acquiring energy through the use of nuclear fusion reactors is one of the most urge nt demands of all mankind at this time. The conclusion given is that the source of fuel for energy production is readily available and inexpensive ( hydrogen atoms) and whole process is free of risks and hazards, especially to general health and the environment . Nuclear fusion importance lies in the fact that energy produced by the process is estimated to be about four to five times the energy produced by nuclear fission. (author)

  2. CEMRACS 2010: Numerical methods for fusion

    International Nuclear Information System (INIS)

    2011-01-01

    This CEMRACS summer school is devoted to the mathematical and numerical modeling of plasma problems that occur in magnetic or inertial fusion. The main topics of this year are the following: -) asymptotic solutions for fluid models of plasma, -) the hydrodynamics of the implosion and the coupling with radiative transfer in inertial fusion, -) gyrokinetic simulations of magnetic fusion plasmas, and -) Landau damping.

  3. Fusion of biological membranes

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 64; Issue 6. Fusion of biological membranes. K Katsov M Müller M Schick. Invited Talks:- Topic 11. Biologically motivated problems (protein-folding models, dynamics at the scale of the cell; biological networks, evolution models, etc.) Volume 64 Issue 6 June 2005 pp ...

  4. AcEST: BP918019 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F08 47 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F08. BP918019 - Show BP91801... mRNA. clone: YMU001_000108_F08. Accession BP918019 Tissue type prothallium Developmental stage - Contig ID

  5. Theoretical study of inertial confinement: model development and analyses of laser induced fusion by implosion of D--T pellets

    International Nuclear Information System (INIS)

    Davis, E.C.

    1977-01-01

    An accurate account of the spherical effects was included in all calculations; as two distinct plasma plume shells were included to obtain improved accuracy in the analysis; as an exact solution to the spherically symmetric laser intensity equation was derived; and as a more realistic physical model was employed for the absorption of the laser beam as it traverses the plasma plume region. Moreover, the complete space--time history of the pulsed laser-driven thermonuclear reaction wave and fusion energy yields was explicitly calculated. This is in direct contrast to the average or total values reported in earlier work. The space--time histories provide a valuable insight into the reaction wave's progression through the pellet

  6. Development of models and computational tools for thermo-fluid dynamic analysis in fusion technology; Desarrollo de modelos y herramientas de computacion para analisis termo-fluidodinamico en tecnologia de fusion

    Energy Technology Data Exchange (ETDEWEB)

    Batet, Ll.; Mas de les Valss, E.; Fradera, J.; Reventos, F.

    2012-07-01

    The article describes the activities of the Thermal-Hydraulics Studies Group at the Universitat Politecnica de Catalunya (UPC) in fusion technology. Activities started in 2006 and at the beginning were focused on magneto-hydrodynamics (MHD) of liquid metals. the study of the tritium transport modelling started in 2008. thanks to the participation in the project TECNO{sub F}US, the group has consolidated these activity lines and has proceeded two doctoral thesis to this date one in MHD of liquid metals and the second one on the modeling of the tritium transport mechanisms. (Author) 8 refs.

  7. Recent advances in modeling and simulation of the exposure and response of tungsten to fusion energy conditions

    Energy Technology Data Exchange (ETDEWEB)

    Marian, Jaime; Becquart, Charlotte S.; Domain, Christophe; Dudarev, Sergei L.; Gilbert, Mark R.; Kurtz, Richard J.; Mason, Daniel R.; Nordlund, Kai; Sand, Andrea E.; Snead, Lance L.; Suzudo, Tomoaki; Wirth, Brian D.

    2017-06-09

    Under the anticipated operating conditions for demonstration magnetic fusion reactors beyond ITER, structural materials will be exposed to unprecedented conditions of irradiation, heat flux, and temperature. While such extreme environments remain inaccessible experimentally, computational modeling and simulation can provide qualitative and quantitative insights into materials response and complement the available experimental measurements with carefully validated predictions. For plasma facing components such as the first wall and the divertor, tungsten (W) has been selected as the best candidate material due to its superior high-temperature and irradiation properties. In this paper we provide a review of recent efforts in computational modeling of W both as a plasma-facing material exposed to He deposition as well as a bulk structural material subjected to fast neutron irradiation. We use a multiscale modeling approach –commonly used as the materials modeling paradigm– to define the outline of the paper and highlight recent advances using several classes of techniques and their interconnection. We highlight several of the most salient findings obtained via computational modeling and point out a number of remaining challenges and future research directions

  8. Estimating spillover benefits of large R and D projects: Application of real options modelling approach to the case of thermonuclear fusion R and D programme

    International Nuclear Information System (INIS)

    Bednyagin, Denis; Gnansounou, Edgard

    2012-01-01

    This paper is focused on the analysis of spillover benefits of the ongoing R and D programme on thermonuclear fusion technology. The spillover effects are understood here as positive externalities of publicly funded R and D, demonstration and deployment (RDDD) activities that may be revealed at the companies' level in the form of newly created knowledge stock; development of innovative products/processes with broader market applications; strengthening of R and D, manufacturing and marketing capabilities; etc. An integrated compound real options model is proposed that allows to estimate the strategic net social present value of fusion RDDD programme taking into account the different types of spillover benefits along with the hidden real options value arising due to uncertainty and managerial flexibility. It was found that the value of spillover effects, modelled as “expansion option”, could represent a significant proportion of the overall socio-economic value of fusion RDDD programme (nearly 20%). This paper clearly demonstrates that, besides a high-level mission to assure sustainable energy supply, fusion RDDD programme may yield substantial net socio-economic benefits that may be at least two times higher compared to the expected RD and D costs, and hence the pursuit of even more ambitious programme is economically justified. - Highlights: ► Evaluate the strategic net social present value of fusion RDDD programme. ► Consider different types of spillover effects. ► Economic value of spillovers is estimated with a compound real options model. ► Spillover benefits could represent up to 20% of the value of fusion RDDD programme.

  9. The distribution of silicon on BP Boo

    International Nuclear Information System (INIS)

    Hatzes, A.P.

    1990-01-01

    A version of the Doppler imaging technique which incorporates the principles of maximum entropy reconstruction is used to derive the silicon distribution on the Ap star BP Boo (HR 5857). The method used made it possible to detect an error in the published photometric period and a new value of 1.29557 d was determined. The silicon distribution consists of two depleted spots of unequal area separated by about 180deg in longitude. These spots may coincide with the location of the magnetic poles of the star as in the case of γ 2 Ari. Near the larger of the depleted silicon spots is a spot of enhanced abundance. The unequal area of the depleted spots as well as the close proximity of the enhanced spot to one of the depleted regions suggests the presence of non-axisymmetric magnetic field lines. (author)

  10. AcEST: BP919406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G04 562 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G04. BP919406 - Show BP919406...is mRNA. clone: YMU001_000124_G04. Accession BP919406 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-...ucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-veneris mRNA, c

  11. AcEST: BP914061 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D09 599 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D09. BP91406...1 CL1730Contig1 Show BP914061 Clone id YMU001_000039_D09 Library YMU01 Length 599 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D09. Accession BP914061 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adia...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adiantum capillus-veneris mRNA, c

  12. AcEST: BP914068 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E04 420 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E04. BP914068 - Show BP91406...is mRNA. clone: YMU001_000039_E04. Accession BP914068 Tissue type prothallium Developmental stage - Contig I...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914068|Adiantum capillus-veneris mRNA, clone:

  13. AcEST: BP913406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_H06 570 Adiantum capillus-veneris mRNA. clone: YMU001_000029_H06. BP913406 - Show BP913406...is mRNA. clone: YMU001_000029_H06. Accession BP913406 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capillus-veneris mRNA, clone: YMU00...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capil...LDVTRGLVNGARGVVVAFES--GKHG---------------LPH 406 Query: 387 VRFACNRAEIVIGPDRQTVESGGMQVARRIQVPLILAWALSVHKCQGM

  14. AcEST: BP915406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_B11 433 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B11. BP915406 - Show BP915406...is mRNA. clone: YMU001_000071_B11. Accession BP915406 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: Y...leic Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B11. (433

  15. AcEST: BP914064 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D12 560 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D12. BP91406...4 CL532Contig1 Show BP914064 Clone id YMU001_000039_D12 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_D12. Accession BP914064 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adiantum capillus-vener...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adi

  16. AcEST: BP912406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_F09 348 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F09. BP912406... CL1894Contig1 Show BP912406 Clone id YMU001_000018_F09 Library YMU01 Length 348 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_F09. Accession BP912406 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406|Adiantum capillus-veneris mRNA...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406

  17. AcEST: BP916406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_D01 556 Adiantum capillus-veneris mRNA. clone: YMU001_000087_D01. BP916406... CL1913Contig1 Show BP916406 Clone id YMU001_000087_D01 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_D01. Accession BP916406 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capill...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capillus-veneris mRNA, c

  18. AcEST: BP917406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_D10 492 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D10. BP917406... CL2033Contig1 Show BP917406 Clone id YMU001_000100_D10 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_D10. Accession BP917406 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917406...Nucleic Acids Res. 25:3389-3402. Query= BP917406|Adiantum capillus-veneris mRNA,

  19. AcEST: BP914406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_E09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E09. BP914406... CL513Contig1 Show BP914406 Clone id YMU001_000058_E09 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000058_E09. Accession BP914406 Tissue type prothallium Developmental stage...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406|Adiantum capillus...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406

  20. AcEST: BP921000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D05 407 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D05. BP921000 - Show BP921000...is mRNA. clone: YMU001_000144_D05. Accession BP921000 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum cap...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum capillus-veneris mRN

  1. AcEST: BP920140 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E03 489 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E03. BP92014...0 CL2574Contig1 Show BP920140 Clone id YMU001_000133_E03 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E03. Accession BP920140 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920140|Adian... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  2. AcEST: BP920147 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F01 365 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F01. BP920147 - Show BP92014...is mRNA. clone: YMU001_000133_F01. Accession BP920147 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920147|Adiantum capillus-veneris mRNA, clone: YMU001_...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201

  3. AcEST: BP920143 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E07 533 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E07. BP92014...3 CL2377Contig1 Show BP920143 Clone id YMU001_000133_E07 Library YMU01 Length 533 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E07. Accession BP920143 Tissue type prothallium Developmental stag...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E0...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum

  4. AcEST: BP920144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E09 265 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E09. BP920144 - Show BP92014...is mRNA. clone: YMU001_000133_E09. Accession BP920144 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920144|Adiantum capillus-veneris mRNA, clone: YMU001...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  5. AcEST: BP920141 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E04 528 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E04. BP920141 - Show BP92014...is mRNA. clone: YMU001_000133_E04. Accession BP920141 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (528 lette...cleic Acids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (52

  6. AcEST: BP920148 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F02 429 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F02. BP92014...8 CL3819Contig1 Show BP920148 Clone id YMU001_000133_F02 Library YMU01 Length 429 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F02. Accession BP920148 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920148|Adiantum capillus-vener...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  7. AcEST: BP920145 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E11 274 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E11. BP920145 - Show BP92014...is mRNA. clone: YMU001_000133_E11. Accession BP920145 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E11.... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adian

  8. AcEST: BP920142 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E05 486 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E05. BP920142 - Show BP92014...is mRNA. clone: YMU001_000133_E05. Accession BP920142 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris ...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  9. AcEST: BP920998 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D03 529 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D03. BP92099...8 CL1935Contig1 Show BP920998 Clone id YMU001_000144_D03 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_D03. Accession BP920998 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-veneris mRNA, clon... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-ven

  10. AcEST: BP920996 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D01. BP92099...6 CL262Contig1 Show BP920996 Clone id YMU001_000144_D01 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D01. Accession BP920996 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920996|Adiantum capillus-ve

  11. AcEST: BP920995 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C12 350 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C12. BP920995 - Show BP92099...is mRNA. clone: YMU001_000144_C12. Accession BP920995 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

  12. AcEST: BP912099 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_B05 315 Adiantum capillus-veneris mRNA. clone: YMU001_000015_B05. BP912099 - Show BP912099...is mRNA. clone: YMU001_000015_B05. Accession BP912099 Tissue type prothallium Developmental stage - Contig I...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099|Adiantum capillus-vene

  13. AcEST: BP918801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000117_F03 542 Adiantum capillus-veneris mRNA. clone: YMU001_000117_F03. BP918801 - Show BP918801...is mRNA. clone: YMU001_000117_F03. Accession BP918801 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum capillus-veneris mRNA, clone: YMU0...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum ca

  14. AcEST: BP916801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000091_G06 127 Adiantum capillus-veneris mRNA. clone: YMU001_000091_G06. BP916801... CL2168Contig1 Show BP916801 Clone id YMU001_000091_G06 Library YMU01 Length 127 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000091_G06. Accession BP916801 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP916801|Adiantum capillus-veneris mRNA, clone: YMU0...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916801

  15. AcEST: BP918015 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F03 437 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F03. BP918015 - Show BP91801...is mRNA. clone: YMU001_000108_F03. Accession BP918015 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP918015|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F03. (437 letters) Data...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  16. AcEST: BP918013 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F01 490 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F01. BP918013 - Show BP91801...is mRNA. clone: YMU001_000108_F01. Accession BP918013 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...idylinositol-4-phosphate 5-kinase 1 OS=Oryza sativa subsp. japonica GN=PIPK1 PE=2 SV=2 Length = 801 Score = ..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  17. AcEST: BP918018 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F06 436 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F06. BP918018 - Show BP91801...is mRNA. clone: YMU001_000108_F06. Accession BP918018 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918018|Adiantum capillus-veneris mRNA, clone: YM...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  18. AcEST: BP913801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000035_D11 562 Adiantum capillus-veneris mRNA. clone: YMU001_000035_D11. BP913801... CL482Contig1 Show BP913801 Clone id YMU001_000035_D11 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000035_D11. Accession BP913801 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum capillus-veneris mRNA, clone: YMU0

  19. AcEST: BP917801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_F04 280 Adiantum capillus-veneris mRNA. clone: YMU001_000105_F04. BP917801 - Show BP917801...is mRNA. clone: YMU001_000105_F04. Accession BP917801 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-ve... Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-veneris mRNA, clone: YMU001_000105_F04.

  20. AcEST: BP918017 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F05 267 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F05. BP918017 - Show BP91801...is mRNA. clone: YMU001_000108_F05. Accession BP918017 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris m...cleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F05. (26

  1. AcEST: BP911801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_C12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000009_C12. BP911801 - Show BP911801...is mRNA. clone: YMU001_000009_C12. Accession BP911801 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911801.... 25:3389-3402. Query= BP911801|Adiantum capillus-veneris mRNA, clone: YMU001_000

  2. AcEST: BP915801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000077_B02 555 Adiantum capillus-veneris mRNA. clone: YMU001_000077_B02. BP915801 - Show BP915801...is mRNA. clone: YMU001_000077_B02. Accession BP915801 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP915801|Adiantum capillus-veneris mRNA, clone: YMU001_000077_B02. ...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915801|A

  3. AcEST: BP920801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000141_G10 454 Adiantum capillus-veneris mRNA. clone: YMU001_000141_G10. BP920801... CL819Contig1 Show BP920801 Clone id YMU001_000141_G10 Library YMU01 Length 454 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000141_G10. Accession BP920801 Tissue type prothallium Developmental stage... Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-veneris mRNA, clone: ...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-

  4. AcEST: BP912801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000023_A07 527 Adiantum capillus-veneris mRNA. clone: YMU001_000023_A07. BP912801 - Show BP912801...is mRNA. clone: YMU001_000023_A07. Accession BP912801 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912801...es. 25:3389-3402. Query= BP912801|Adiantum capillus-veneris mRNA, clone: YMU001_0

  5. AcEST: BP918012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_E12 547 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E12. BP918012 - Show BP91801...is mRNA. clone: YMU001_000108_E12. Accession BP918012 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108_E1

  6. Comparison of the osteogenesis and fusion rates between activin A/BMP-2 chimera (AB204) and rhBMP-2 in a beagle's posterolateral lumbar spine model.

    Science.gov (United States)

    Zheng, Guang Bin; Yoon, Byung-Hak; Lee, Jae Hyup

    2017-10-01

    Activin A/BMP-2 chimera (AB204) could promote bone healing more effectively than recombinant bone morphogenetic protein 2 (rhBMP-2) with much lower dose in a rodent model, but there is no report about the effectiveness of AB204 in a large animal model. The purpose of this study was to compare the osteogenesis and fusion rate between AB204 and rhBMP-2 using biphasic calcium phosphate (BCP) as a carrier in a beagle's posterolateral lumbar fusion model. This is a randomized control animal study. Seventeen male beagle dogs were included. Bilateral posterolateral fusion was performed at the L1-L2 and L4-L5 levels. Biphasic calcium phosphate (2 cc), rhBMP-2 (50 µg)+BCP (2 cc), or AB204 (50 µg)+BCP (2 cc) were implanted into the intertransverse space randomly. X-ray was performed at 4 and 8 weeks. After 8 weeks, the animals were sacrificed, and new bone formation and fusion rate were evaluated by manual palpation, computed tomography (CT), and undecalcified histology. The AB204 group showed significantly higher fusion rate (90%) than the rhBMP-2 group (15%) or the Osteon group (6.3%) by manual palpation. On x-ray and CT assessment, fusion rate and the volume of newly formed bone were also significantly higher in AB204 group than other groups. In contrast, more osteolysis was found in rhBMP-2 group (40%) than in AB204 group (10%) on CT study. In histologic results, new bone formation was sufficient between transverse processes in AB204 group, and obvious trabeculation and bone remodeling were observed. But in rhBMP-2 group, new bone formation was less than AB204 group and osteolysis was observed between the intertransverse spaces. A low dose of AB204 with BCP as a carrier significantly promotes the fusion rate in a large animal model when compared with the rhBMP-2. These findings demonstrate that AB204 could be an alternative to rhBMP-2 to improve fusion rate. Copyright © 2017 Elsevier Inc. All rights reserved.

  7. Computational modeling of direct-drive fusion pellets and KrF-driven foil experiments

    International Nuclear Information System (INIS)

    Gardner, J.H.; Schmitt, A.J.; Dahlburg, J.P.; Pawley, C.J.; Bodner, S.E.; Obenschain, S.P.; Serlin, V.; Aglitskiy, Y.

    1998-01-01

    FAST is a radiation transport hydrodynamics code that simulates laser matter interactions of relevance to direct-drive laser fusion target design. FAST solves the Euler equations of compressible flow using the Flux-Corrected Transport finite volume method. The advection algorithm provides accurate computation of flows from nearly incompressible vortical flows to those that are highly compressible and dominated by strong pressure and density gradients. In this paper we describe the numerical techniques and physics packages. FAST has also been benchmarked with Nike laser facility experiments in which linearly perturbed, low adiabat planar plastic targets are ablatively accelerated to velocities approaching 10 7 cm/s. Over a range of perturbation wavelengths, the code results agree with the measured Rayleigh endash Taylor growth from the linear through the deeply nonlinear regimes. FAST has been applied to the two-dimensional spherical simulation design to provide surface finish and laser bandwidth tolerances for a promising new direct-drive pellet that uses a foam ablator

  8. Fusion of Ultraviolet-Visible and Infrared Transient Absorption Spectroscopy Data to Model Ultrafast Photoisomerization.

    Science.gov (United States)

    Debus, Bruno; Orio, Maylis; Rehault, Julien; Burdzinski, Gotard; Ruckebusch, Cyril; Sliwa, Michel

    2017-08-03

    Ultrafast photoisomerization reactions generally start at a higher excited state with excess of internal vibrational energy and occur via conical intersections. This leads to ultrafast dynamics which are difficult to investigate with a single transient absorption spectroscopy technique, be it in the ultraviolet-visible (UV-vis) or infrared (IR) domain. On one hand, the information available in the UV-vis domain is limited as only slight spectral changes are observed for different isomers. On the other hand, the interpretation of vibrational spectra is strongly hindered by intramolecular relaxation and vibrational cooling. These limitations can be circumvented by fusing UV-vis and IR transient absorption spectroscopy data in a multiset multivariate curve resolution analysis. We apply this approach to describe the spectrodynamics of the ultrafast cis-trans photoisomerization around the C-N double bond observed for aromatic Schiff bases. Twisted intermediate states could be elucidated, and isomerization was shown to occur through a continuous complete rotation. More broadly, data fusion can be used to rationalize a vast range of ultrafast photoisomerization processes of interest in photochemistry.

  9. Magnetic fusion energy and computers

    International Nuclear Information System (INIS)

    Killeen, J.

    1982-01-01

    The application of computers to magnetic fusion energy research is essential. In the last several years the use of computers in the numerical modeling of fusion systems has increased substantially. There are several categories of computer models used to study the physics of magnetically confined plasmas. A comparable number of types of models for engineering studies are also in use. To meet the needs of the fusion program, the National Magnetic Fusion Energy Computer Center has been established at the Lawrence Livermore National Laboratory. A large central computing facility is linked to smaller computer centers at each of the major MFE laboratories by a communication network. In addition to providing cost effective computing services, the NMFECC environment stimulates collaboration and the sharing of computer codes among the various fusion research groups

  10. Cold fusion

    International Nuclear Information System (INIS)

    Koster, J.

    1989-01-01

    In this contribution the author the phenomenom of so-called cold fusion, inspired by the memorable lecture of Moshe Gai on his own search for this effect. Thus much of what follows was presented by Dr. Gai; the rest is from independent reading. What is referred to as cold fusion is of course the observation of possible products of deuteron-deuteron (d-d) fusion within deuterium-loaded (dentended) electrodes. The debate over the two vanguard cold fusion experiments has raged under far more public attention than usually accorded new scientific phenomena. The clamor commenced with the press conference of M. Fleishmann and S. Pons on March 23, 1989 and the nearly simultaneous wide circulation of a preprint of S. Jones and collaborators. The majority of work attempting to confirm these observations has at the time of this writing yet to appear in published form, but contributions to conferences and electronic mail over computer networks were certainly filled with preliminary results. To keep what follows to a reasonable length the author limit this discussion to the searches for neutron (suggested by ref. 2) or for excessive heat production (suggested by ref. 1), following a synopsis of the hypotheses of cold fusion

  11. Fusion reaction cross-sections using the Wong model within Skyrme energy density based semiclassical extended Thomas Fermi approach

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Raj, E-mail: rajkumarfzr@gmail.com [Department of Physics, Panjab University, Chandigarh-160014 (India); School of Physics and Material Science, Thapar University, Patiala-147004 (India); Sharma, Manoj K. [School of Physics and Material Science, Thapar University, Patiala-147004 (India); Gupta, Raj K. [Department of Physics, Panjab University, Chandigarh-160014 (India)

    2011-11-15

    First, the nuclear proximity potential, obtained by using the semiclassical extended Thomas Fermi (ETF) approach in Skyrme energy density formalism (SEDF), is shown to give more realistic barriers in frozen density approximation, as compared to the sudden approximation. Then, taking advantage of the fact that, in ETF method, different Skyrme forces give different barriers (height, position and curvature), we use the l-summed extended-Wong model of Gupta and collaborators (2009) under frozen densities approximation for calculating the cross-sections, where the Skyrme force is chosen with proper barrier characteristics, not-requiring additional 'barrier modification' effects (lowering or narrowing, etc.), for a best fit to data at sub-barrier energies. The method is applied to capture cross-section data from {sup 48}Ca + {sup 238}U, {sup 244}Pu, and {sup 248}Cm reactions and to fusion-evaporation cross-sections from {sup 58}Ni + {sup 58}Ni, {sup 64}Ni + {sup 64}Ni, and {sup 64}Ni + {sup 100}Mo reactions, with effects of deformations and orientations of nuclei included, wherever required. Interestingly, whereas the capture cross-sections in Ca-induced reactions could be fitted to any force, such as SIII, SV and GSkI, by allowing a small change of couple of units in deduced l{sub max}-values at below-barrier energies, the near-barrier data point of {sup 48}Ca + {sup 248}Cm reaction could not be fitted to l{sub max}-values deduced for below-barrier energies, calling for a check of data. On the other hand, the fusion-evaporation cross-sections in Ni-induced reactions at sub-barrier energies required different Skyrme forces, representing 'modifications of the barrier', for the best fit to data at all incident center-of-mass energies E{sub c.m.}'s, displaying a kind of fusion hindrance at sub-barrier energies. This barrier modification effect is taken into care here by using different Skyrme forces for reactions belonging to different regions of

  12. Evaluation of economical introduction of nuclear fusion based on a long-term world energy and environment model

    International Nuclear Information System (INIS)

    Tokimatsu, K.; Asaoka, Y.; Okano, K.; Konishi, S.; Ogawa, Y.; Yamaji, K.

    2003-01-01

    Debates about whether or not to invest heavily in nuclear fusion as a future innovative energy option have been made within the context of energy technology development strategies. The time frame by which nuclear fusion could become competitive in the energy market has not been adequately studied, nor has roles of the nuclear fusion in energy systems and the environment. The present study has two objectives. One is to reveal the conditions under which nuclear fusion could be introduced economically (hereafter, we refer to such introductory conditions as breakeven prices) in future energy systems. The other objective is to evaluate the future roles of nuclear fusion in energy systems and in the environment. Here we chose two roles that nuclear fusion will take on when breakeven prices are achieved: i) reduction of annual global total energy systems cost, and ii) mitigation of carbon tax (shadow price of carbon) under CO 2 constraints. Future uncertainties are key issues in evaluating nuclear fusion. Here we treated the following uncertainties: energy demand scenarios, introduction time frame for nuclear fusion, capacity projections of nuclear fusion, CO 2 target in 2100. From our investigations, we conclude that the presently designed nuclear fusion reactors may be ready for economical introduction into energy systems beginning around 2050-2060, and we can confirm that the favorable introduction of the reactors would reduce both the annual energy systems cost and the carbon tax (the shadow price of carbon) under a CO 2 concentration constraint; however, latter introduction of them decreases the cost and the tax less than five times. Earlier introduction of nuclear fusion reactors are desirable for energy systems and environment. (author)

  13. Immunization with FSHβ fusion protein antigen prevents bone loss in a rat ovariectomy-induced osteoporosis model

    Energy Technology Data Exchange (ETDEWEB)

    Geng, Wenxin; Yan, Xingrong; Du, Huicong; Cui, Jihong; Li, Liwen, E-mail: liven@nwu.edu.cn; Chen, Fulin, E-mail: chenfl@nwu.edu.cn

    2013-05-03

    Highlights: •A GST-FSH fusion protein was successfully expressed in E. coli. •Immunization with GST-FSH antigen can raise high-titer anti-FSH polyclonal sera. •Anti-FSH polyclonal sera can neutralize osteoclastogenic effect of FSH in vitro. •FSH immunization can prevent bone loss in a rat osteoporosis model. -- Abstract: Osteoporosis, a metabolic bone disease, threatens postmenopausal women globally. Hormone replacement therapy (HTR), especially estrogen replacement therapy (ERT), is used widely in the clinic because it has been generally accepted that postmenopausal osteoporosis is caused by estrogen deficiency. However, hypogonadal α and β estrogen receptor null mice were only mildly osteopenic, and mice with either receptor deleted had normal bone mass, indicating that estrogen may not be the only mediator that induces osteoporosis. Recently, follicle-stimulating hormone (FSH), the serum concentration of which increases from the very beginning of menopause, has been found to play a key role in postmenopausal osteoporosis by promoting osteoclastogenesis. In this article, we confirmed that exogenous FSH can enhance osteoclast differentiation in vitro and that this effect can be neutralized by either an anti-FSH monoclonal antibody or anti-FSH polyclonal sera raised by immunizing animals with a recombinant GST-FSHβ fusion protein antigen. Moreover, immunizing ovariectomized rats with the GST-FSHβ antigen does significantly prevent trabecular bone loss and thereby enhance the bone strength, indicating that a FSH-based vaccine may be a promising therapeutic strategy to slow down bone loss in postmenopausal women.

  14. Fusion events

    International Nuclear Information System (INIS)

    Aboufirassi, M; Angelique, J.C.; Bizard, G.; Bougault, R.; Brou, R.; Buta, A.; Colin, J.; Cussol, D.; Durand, D.; Genoux-Lubain, A.; Horn, D.; Kerambrun, A.; Laville, J.L.; Le Brun, C.; Lecolley, J.F.; Lefebvres, F.; Lopez, O.; Louvel, M.; Meslin, C.; Metivier, V.; Nakagawa, T.; Peter, J.; Popescu, R.; Regimbart, R.; Steckmeyer, J.C.; Tamain, B.; Vient, E.; Wieloch, A.; Yuasa-Nakagawa, K.

    1998-01-01

    The fusion reactions between low energy heavy ions have a very high cross section. First measurements at energies around 30-40 MeV/nucleon indicated no residue of either complete or incomplete fusion, thus demonstrating the disappearance of this process. This is explained as being due to the high amount o energies transferred to the nucleus, what leads to its total dislocation in light fragments and particles. Exclusive analyses have permitted to mark clearly the presence of fusion processes in heavy systems at energies above 30-40 MeV/nucleon. Among the complete events of the Kr + Au reaction at 60 MeV/nucleon the majority correspond to binary collisions. Nevertheless, for the most considerable energy losses, a class of events do occur for which the detected fragments appears to be emitted from a unique source. These events correspond to an incomplete projectile-target fusion followed by a multifragmentation. Such events were singled out also in the reaction Xe + Sn at 50 MeV/nucleon. For the events in which the energy dissipation was maximal it was possible to isolate an isotropic group of events showing all the characteristics of fusion nuclei. The fusion is said to be incomplete as pre-equilibrium Z = 1 and Z = 2 particles are emitted. The cross section is of the order of 25 mb. Similar conclusions were drown for the systems 36 Ar + 27 Al and 64 Zn + nat Ti. A cross section value of ∼ 20 mb was determined at 55 MeV/nucleon in the first case, while the measurement of evaporation light residues in the last system gave an upper limit of 20-30 mb for the cross section at 50 MeV/nucleon

  15. Fusion and diversification in information retrieval

    NARCIS (Netherlands)

    Liang, S.

    2014-01-01

    Data fusion and search result diversification are two critical research topics in information retrieval. Data fusion approaches combine search result lists in order to produce a new and hopefully better ranking. We propose two data fusion models for microblog search that exploit temporal information

  16. The need for fusion

    International Nuclear Information System (INIS)

    Llewellyn Smith, Chris

    2005-01-01

    World energy use is predicted to double in the next 40 years. Currently 80% is provided by burning fossil fuels, but this is not sustainable indefinitely because (i) it is driving climate change, and (ii) fossil fuels will eventually be exhausted (starting with oil). The resulting potential energy crisis requires increased investment in energy research and development (which is currently very small on the scale of the $3 trillion p.a. energy market, and falling). The wide portfolio of energy work that should be supported must include fusion, which is one of the very few options that are capable in principle of supplying a large fraction of need. The case for fusion has been strengthened by recent advances in plasma physics and fusion technology that are reflected in the forthcoming European Fusion Power Plant Conceptual Study, which addresses safety and cost issues. The big questions are - How can we deliver fusion power as fast as possible? How long is it likely to take? I argue for a fast track programme, and describe a fast-track model developed at Culham, which is intended to stimulate debate on the way ahead and the resources that are needed

  17. Fusion Reactor Materials

    International Nuclear Information System (INIS)

    Decreton, M.

    2000-01-01

    SCK-CEN's research and development programme on fusion reactor materials includes: (1) the study of the mechanical behaviour of structural materials under neutron irradiation (including steels, inconel, molybdenum, chromium); (2) the determination and modelling of the characteristics of irradiated first wall materials such as beryllium; (3) the detection of abrupt electrical degradation of insulating ceramics under high temperature and neutron irradiation; (4) the study of the dismantling and waste disposal strategy for fusion reactors.; (5) a feasibility study for the testing of blanket modules under neutron radiation. Main achievements in these topical areas in the year 1999 are summarised

  18. Fusion Reactor Materials

    Energy Technology Data Exchange (ETDEWEB)

    Decreton, M

    2000-07-01

    SCK-CEN's research and development programme on fusion reactor materials includes: (1) the study of the mechanical behaviour of structural materials under neutron irradiation (including steels, inconel, molybdenum, chromium); (2) the determination and modelling of the characteristics of irradiated first wall materials such as beryllium; (3) the detection of abrupt electrical degradation of insulating ceramics under high temperature and neutron irradiation; (4) the study of the dismantling and waste disposal strategy for fusion reactors.; (5) a feasibility study for the testing of blanket modules under neutron radiation. Main achievements in these topical areas in the year 1999 are summarised.

  19. Heavy Ion Fusion Systems Assessment study

    International Nuclear Information System (INIS)

    Dudziak, D.J.; Herrmannsfeldt, W.B.

    1986-07-01

    The Heavy Ion Fusion Systems Assessment (HIFSA) study was conducted with the specific objective of evaluating the prospects of using induction linac drivers to generate economical electrical power from inertial confinement fusion. The study used algorithmic models of representative components of a fusion system to identify favored areas in the multidimensional parameter space. The resulting cost-of-electricity (COE) projections are comparable to those from other (magnetic) fusion scenarios, at a plant size of 100 MWe

  20. CacyBP/SIP binds ERK1/2 and affects transcriptional activity of Elk-1

    International Nuclear Information System (INIS)

    Kilanczyk, Ewa; Filipek, Slawomir; Jastrzebska, Beata; Filipek, Anna

    2009-01-01

    In this work we showed for the first time that mouse CacyBP/SIP interacts with extracellular signal regulated kinases 1 and 2 (ERK1/2). We also established that a calcium binding protein, S100A6, competes for this interaction. Moreover, the E217K mutant of CacyBP/SIP does not bind significantly to ERK1/2 although it retains the ability to interact with S100A6. Molecular modeling shows that the E217K mutation in the 189-219 CacyBP/SIP fragment markedly changes its electrostatic potential, suggesting that the binding with ERK1/2 might have an electrostatic character. We also demonstrate that CacyBP/SIP-ERK1/2 interaction inhibits phosphorylation of the Elk-1 transcription factor in vitro and in the nuclear fraction of NB2a cells. Altogether, our data suggest that the binding of CacyBP/SIP with ERK1/2 might regulate Elk-1 phosphorylation/transcriptional activity and that S100A6 might further modulate this effect via Ca 2+ -dependent interaction with CacyBP/SIP and competition with ERK1/2.

  1. Nuclear fusion

    International Nuclear Information System (INIS)

    Huber, H.

    1978-01-01

    A comprehensive survey is presented of the present state of knowledge in nuclear fusion research. In the first part, potential thermonuclear reactions, basic energy balances of the plasma (Lawson criterion), and the main criteria to be observed in the selection of appropriate thermonuclear reactions are dealt with. This is followed by a discussion of the problems encountered in plasma physics (plasma confinement and heating, transport processes, plasma impurities, plasma instabilities and plasma diagnostics) and by a consideration of the materials problems involved, such as material of the first wall, fuel inlet and outlet, magnetic field generation, as well as repair work and in-service inspections. Two main methods have been developed to tackle these problems: reactor concepts using the magnetic pinch (stellarator, Tokamak, High-Beta reactors, mirror machines) on the one hand, and the other concept using the inertial confinement (laser fusion reactor). These two approaches and their specific problems as well as past, present and future fusion experiments are treated in detail. The last part of the work is devoted to safety and environmental aspects of the potential thermonuclear aspects of the potential thermonuclear reactor, discussing such problems as fusion-specific hazards, normal operation and potential hazards, reactor incidents, environmental pollution by thermal effluents, radiological pollution, radioactive wastes and their disposal, and siting problems. (orig./GG) [de

  2. Short fusion

    CERN Multimedia

    2002-01-01

    French and UK researchers are perfecting a particle accelerator technique that could aid the quest for fusion energy or make X-rays that are safer and produce higher-resolution images. Led by Dr Victor Malka from the Ecole Nationale Superieure des Techniques Avancees in Paris, the team has developed a better way of accelerating electrons over short distances (1 page).

  3. Magnetic fusion

    International Nuclear Information System (INIS)

    2002-01-01

    This document is a detailed lecture on thermonuclear fusion. The basic physics principles are recalled and the technological choices that have led to tokamaks or stellarators are exposed. Different aspects concerning thermonuclear reactors such as safety, economy and feasibility are discussed. Tore-supra is described in details as well as the ITER project

  4. Cold fusion

    International Nuclear Information System (INIS)

    Seo, Suk Yong; You, Jae Jun

    1996-01-01

    Nearly every technical information is chased in the world. All of them are reviewed and analyzed. Some of them are chosen to study further more to review every related documents. And a probable suggestion about the excitonic process in deuteron absorbed condensed matter is proposed a way to cold fusion. 8 refs. (Author)

  5. Vibration and acoustic frequency spectra for industrial process modeling using selective fusion multi-condition samples and multi-source features

    Science.gov (United States)

    Tang, Jian; Qiao, Junfei; Wu, ZhiWei; Chai, Tianyou; Zhang, Jian; Yu, Wen

    2018-01-01

    Frequency spectral data of mechanical vibration and acoustic signals relate to difficult-to-measure production quality and quantity parameters of complex industrial processes. A selective ensemble (SEN) algorithm can be used to build a soft sensor model of these process parameters by fusing valued information selectively from different perspectives. However, a combination of several optimized ensemble sub-models with SEN cannot guarantee the best prediction model. In this study, we use several techniques to construct mechanical vibration and acoustic frequency spectra of a data-driven industrial process parameter model based on selective fusion multi-condition samples and multi-source features. Multi-layer SEN (MLSEN) strategy is used to simulate the domain expert cognitive process. Genetic algorithm and kernel partial least squares are used to construct the inside-layer SEN sub-model based on each mechanical vibration and acoustic frequency spectral feature subset. Branch-and-bound and adaptive weighted fusion algorithms are integrated to select and combine outputs of the inside-layer SEN sub-models. Then, the outside-layer SEN is constructed. Thus, "sub-sampling training examples"-based and "manipulating input features"-based ensemble construction methods are integrated, thereby realizing the selective information fusion process based on multi-condition history samples and multi-source input features. This novel approach is applied to a laboratory-scale ball mill grinding process. A comparison with other methods indicates that the proposed MLSEN approach effectively models mechanical vibration and acoustic signals.

  6. Multivalent display of the antimicrobial peptides BP100 and BP143

    Directory of Open Access Journals (Sweden)

    Imma Güell

    2012-12-01

    Full Text Available Carbohydrates are considered as promising templates for the display of multiple copies of antimicrobial peptides. Herein, we describe the design and synthesis of chimeric structures containing two or four copies of the antimicrobial peptides KKLFKKILKYL-NH2 (BP100 and KKLfKKILKYL-NH2 (BP143 attached to the carbohydrate template cyclodithioerythritol (cDTE or α-D-galactopyranoside (Galp. The synthesis involved the preparation of the corresponding peptide aldehyde followed by coupling to an aminooxy-functionalized carbohydrate template. After purification, the multivalent display systems were obtained in high purities (90–98% and in good yields (42–64%. These compounds were tested against plant and human pathogenic bacteria and screened for their cytotoxicity on eukaryotic cells. They showed lower MIC values than the parent peptides against the bacteria analyzed. In particular, the carbopeptides derived from cDTE and Galp, which contained two or four copies of BP100, respectively, were 2- to 8-fold more active than the monomeric peptide against the phytopathogenic bacteria. These results suggest that preassembling antimicrobial peptides to multimeric structures is not always associated with a significant improvement of the activity. In contrast, the carbopeptides synthesized were active against human red blood cells pointing out that peptide preassembly is critical for the hemolytic activity. Notably, peptide preassembly resulted in an enhanced bactericidal effect.

  7. Finite element modeling and experimental study of brittle fracture in tempered martensitic steels for thermonuclear fusion applications

    International Nuclear Information System (INIS)

    Mueller, P. F.

    2009-10-01

    The present report studies the brittle fracture in high-chromium reduced activation tempered martensitic steels foreseen as structural materials for thermonuclear fusion reactors. Developing the adequate materials that can withstand the severe irradiation conditions of the burning plasma in a fusion reactor is one of the major challenges to be solved in order to make profit from the great advantages of thermonuclear fusion as an energy source. High-chromium tempered martensitic steels such as F82H and the most advanced version Eurofer97 are among the main candidate materials for structural applications in future fusion power plants due to low irradiation-induced swelling, good mechanical and thermal properties, and reasonably fast radioactive decay. Drawback of this kind of steels is irradiation embrittlement, which is manifested by a ductile-to-brittle transition temperature shift to higher temperatures after irradiation. The laboratory specimen fracture data has to be transferred to real components in order to assess the performance of these steels in the different operating and transient conditions they could find during the operation life of a fusion reactor. The specimen geometry effects and specimen size effects on measured fracture toughness need to be properly understood, taken into account and predicted with an appropriate model. The microstructure of Eurofer97 and F82H has been characterized and compared by means of optical microscopy, scanning electron microscopy, transmission electron microscopy and energy-dispersive X-ray spectroscopy in order to identify microstructural features that could play a role in the measured fracture toughness. Both steels have similar but slightly different chemical composition and final heat treatments but the prior austenitic grain size measured in F82H is approximately 8 times larger than in Eurofer97. The alloying element tantalum is added to stabilize the austenite grain size. In Eurofer97 it forms carbides of an

  8. Structural characterization of respiratory syncytial virus fusion inhibitor escape mutants: homology model of the F protein and a syncytium formation assay

    International Nuclear Information System (INIS)

    Morton, Craig J.; Cameron, Rachel; Lawrence, Lynne J.; Lin Bo; Lowe, Melinda; Luttick, Angela; Mason, Anthony; McKimm-Breschkin, Jenny; Parker, Michael W.; Ryan, Jane; Smout, Michael; Sullivan, Jayne; Tucker, Simon P.; Young, Paul R.

    2003-01-01

    Respiratory syncytial virus (RSV) is a ubiquitous human pathogen and the leading cause of lower respiratory tract infections in infants. Infection of cells and subsequent formation of syncytia occur through membrane fusion mediated by the RSV fusion protein (RSV-F). A novel in vitro assay of recombinant RSV-F function has been devised and used to characterize a number of escape mutants for three known inhibitors of RSV-F that have been isolated. Homology modeling of the RSV-F structure has been carried out on the basis of a chimera derived from the crystal structures of the RSV-F core and a fragment from the orthologous fusion protein from Newcastle disease virus (NDV). The structure correlates well with the appearance of RSV-F in electron micrographs, and the residues identified as contributing to specific binding sites for several monoclonal antibodies are arranged in appropriate solvent-accessible clusters. The positions of the characterized resistance mutants in the model structure identify two promising regions for the design of fusion inhibitors

  9. Data fusion qualitative sensitivity analysis

    International Nuclear Information System (INIS)

    Clayton, E.A.; Lewis, R.E.

    1995-09-01

    Pacific Northwest Laboratory was tasked with testing, debugging, and refining the Hanford Site data fusion workstation (DFW), with the assistance of Coleman Research Corporation (CRC), before delivering the DFW to the environmental restoration client at the Hanford Site. Data fusion is the mathematical combination (or fusion) of disparate data sets into a single interpretation. The data fusion software used in this study was developed by CRC. The data fusion software developed by CRC was initially demonstrated on a data set collected at the Hanford Site where three types of data were combined. These data were (1) seismic reflection, (2) seismic refraction, and (3) depth to geologic horizons. The fused results included a contour map of the top of a low-permeability horizon. This report discusses the results of a sensitivity analysis of data fusion software to variations in its input parameters. The data fusion software developed by CRC has a large number of input parameters that can be varied by the user and that influence the results of data fusion. Many of these parameters are defined as part of the earth model. The earth model is a series of 3-dimensional polynomials with horizontal spatial coordinates as the independent variables and either subsurface layer depth or values of various properties within these layers (e.g., compression wave velocity, resistivity) as the dependent variables

  10. Role and use of nuclear theories and models in practical evaluation of neutron nuclear data needed for fission and fusion reactor design and other nuclear applications

    International Nuclear Information System (INIS)

    Prince, A.

    1975-01-01

    A review of the various nuclear models used in the evaluation of neutron nuclear data for fission and fusion reactors is presented. Computer codes embodying the principles of the relevant nuclear models are compared with each other and with experimental data. The regions of validity and limitations of the conceptual formalisms are also included, along with the effects of the numerical procedures used in the codes themselves. Conclusions and recommendations for future demands are outlined.15 tables, 15 figures, 90 references

  11. The role and use of nuclear theories and models in practical evaluation of neutron nuclear data needed for fission and fusion reactor design and other nuclear applications

    International Nuclear Information System (INIS)

    Prince, A.

    1976-01-01

    A review of the various nuclear models used in the evaluation of neutron nuclear data for fission and fusion reactors is presented. Computer codes embodying the principles of the relevant nuclear models are compared with each other and with experimental data. The regions of validity and limitations of the conceptual formalisms are also included, along with the effects of the numerical procedures used in the codes themselves. Conclusions and recommendations for future demands are outlined. (author)

  12. Estimating the melting point, entropy of fusion, and enthalpy of fusion of organic compounds via SPARC

    Science.gov (United States)

    The entropies of fusion, enthalies of fusion, and melting points of organic compounds can be estimated through three models developed using the SPARC (SPARC Performs Automated Reasoning in Chemistry) platform. The entropy of fusion is modeled through a combination of interaction ...

  13. A CCA+ICA based model for multi-task brain imaging data fusion and its application to schizophrenia.

    Science.gov (United States)

    Sui, Jing; Adali, Tülay; Pearlson, Godfrey; Yang, Honghui; Sponheim, Scott R; White, Tonya; Calhoun, Vince D

    2010-05-15

    Collection of multiple-task brain imaging data from the same subject has now become common practice in medical imaging studies. In this paper, we propose a simple yet effective model, "CCA+ICA", as a powerful tool for multi-task data fusion. This joint blind source separation (BSS) model takes advantage of two multivariate methods: canonical correlation analysis and independent component analysis, to achieve both high estimation accuracy and to provide the correct connection between two datasets in which sources can have either common or distinct between-dataset correlation. In both simulated and real fMRI applications, we compare the proposed scheme with other joint BSS models and examine the different modeling assumptions. The contrast images of two tasks: sensorimotor (SM) and Sternberg working memory (SB), derived from a general linear model (GLM), were chosen to contribute real multi-task fMRI data, both of which were collected from 50 schizophrenia patients and 50 healthy controls. When examining the relationship with duration of illness, CCA+ICA revealed a significant negative correlation with temporal lobe activation. Furthermore, CCA+ICA located sensorimotor cortex as the group-discriminative regions for both tasks and identified the superior temporal gyrus in SM and prefrontal cortex in SB as task-specific group-discriminative brain networks. In summary, we compared the new approach to some competitive methods with different assumptions, and found consistent results regarding each of their hypotheses on connecting the two tasks. Such an approach fills a gap in existing multivariate methods for identifying biomarkers from brain imaging data.

  14. Comparison of three calcium phosphate bone graft substitutes from biomechanical, histological, and crystallographic perspectives using a rat posterolateral lumbar fusion model

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Ming-Hsien [Department of Biomedical Engineering, National Cheng Kung University, Tainan 701, Taiwan (China); Department of Orthopedics, Show-Chwan Memorial Hospital, Changhua 50544, Taiwan (China); Department of Orthopedic Surgery, Faculty of Medicine, National Yang-Ming University, Taipei 112, Taiwan (China); Lee, Pei-Yuan [Department of Biomedical Engineering, National Cheng Kung University, Tainan 701, Taiwan (China); Department of Orthopedics, Show-Chwan Memorial Hospital, Changhua 50544, Taiwan (China); Chen, Wen-Cheng, E-mail: wincheng0925@yahoo.com.tw [Department of Fiber and Composite Materials, College of Engineering, Feng Chia University, Taichung 40724, Taiwan (China); Hu, Jin-Jia, E-mail: jjhu@mail.ncku.edu.tw [Department of Biomedical Engineering, National Cheng Kung University, Tainan 701, Taiwan (China); Medical Device Innovation Center, National Cheng Kung University, Tainan 701, Taiwan (China)

    2014-12-01

    This study evaluated the effectiveness of three calcium phosphate bone graft substitutes with different chemical compositions on spinal fusion using a rat posterolateral lumbar fusion model. Specifically, two recently developed non-dispersive tetracalcium phosphate/dicalcium phosphate anhydrous-based calcium phosphate cements (CPCs), namely a CPC consisting of equimolar amounts of the two compounds (nd-CPC) and a CPC consisting of a two-fold greater amount of dicalcium phosphate anhydrous (DCP-rich CPC), were compared with a commercial calcium phosphate bone graft (c-CPG) consisting of hydroxyapatite (60%) and β-tricalcium phosphate (40%). Single-level posterolateral lumbar fusion was performed at the L4–L5 vertebrae in fifteen adult rats (n = 5 for each group). Spinal fusion was evaluated with radiographs, manual palpation, mechanical testing, micro-CT, and histology 8 weeks post-surgery. In particular, the crystallographic phases in the three substitutes were identified before and 8 weeks after their implantation. Manual palpation revealed stable constructs in nearly all of the spine specimens. The stiffness and bending load of fused spines in the two CPC groups were comparable to those in the c-CPG group. The radiographs specifically revealed implant resorption and bone remodeling in the DCP-rich CPC group. Analysis of 3D micro-CT images revealed that the bone volume ratio in the DCP-rich CPC group was significantly greater than those in the nd-CPC and c-CPG groups. Histology showed that the DCP-rich CPC group exhibited the highest degree of bone regeneration and osseointegration. Notably, DCP-rich CPC led to a pronounced phase transformation, generating the greatest amount of poorly crystalline apatite among the three groups, which together with adequate resorption may explain the aforementioned positive findings. We therefore conclude that of the bone graft substitutes considered, DCP-rich CPC has the greatest potential to be used in spinal fusion

  15. Face recognition based on improved BP neural network

    Directory of Open Access Journals (Sweden)

    Yue Gaili

    2017-01-01

    Full Text Available In order to improve the recognition rate of face recognition, face recognition algorithm based on histogram equalization, PCA and BP neural network is proposed. First, the face image is preprocessed by histogram equalization. Then, the classical PCA algorithm is used to extract the features of the histogram equalization image, and extract the principal component of the image. And then train the BP neural network using the trained training samples. This improved BP neural network weight adjustment method is used to train the network because the conventional BP algorithm has the disadvantages of slow convergence, easy to fall into local minima and training process. Finally, the BP neural network with the test sample input is trained to classify and identify the face images, and the recognition rate is obtained. Through the use of ORL database face image simulation experiment, the analysis results show that the improved BP neural network face recognition method can effectively improve the recognition rate of face recognition.

  16. Congenital Arthrogryposis: An Extension of the 15q11.2 BP1-BP2 Microdeletion Syndrome?

    Directory of Open Access Journals (Sweden)

    K. M. Usrey

    2014-01-01

    Full Text Available The proximal 15q11–q13 region contains 5 breakpoints (BP1–BP5. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes. The genes in this region are known to play a role in central nervous system development and/or function. Microdeletions within the 15q11.2 BP1-BP2 region have been reported in patients with neurological dysfunction, developmental delays, behavioral problems, and dysmorphic features. We report two unrelated subjects with the 15q11.2 BP1-BP2 microdeletion and presenting with congenital arthrogryposis, a feature which has not been previously reported as part of this newly recognized microdeletion syndrome. While arthrogryposis seen in these two subjects may be coincidental, we propose that congenital arthrogryposis may result from neurological dysfunction and involvement of the microdeletion of the 15q11.2 BP1-BP2 region, further expanding the phenotype of this microdeletion syndrome. We encourage others to report patients with this chromosome microdeletion and neurological findings to further characterize the clinical phenotype.

  17. Environment model creation and ADAS architecture for trucks : design and implementation of a sensor fusion algorithm

    NARCIS (Netherlands)

    Stamatopoulos, E.

    2016-01-01

    This report presents a structural approach for environment model creation and ADAS architecture for trucks. In particular, an appropriate sensor suite that is suitable for a set of ADAS functions is defined. On this basis, the development of a proof of concept for an Environment Model system, by

  18. ALS and TLS data fusion in cultural heritage documentation and modeling

    Directory of Open Access Journals (Sweden)

    A. Fryskowska

    2015-08-01

    Full Text Available One of the most important aspects of documenting cultural heritage sites is acquiring detailed and accurate data. A popular method of storing 3D information about historical structures is using 3D models. These models are built based on terrestrial or aerial laser scanning data. These methods are seldom used together. Historical buildings usually have a very complex design, therefore the input data, on the basis of which their 3D models are being built, must provide a high enough accuracy to model these complexities. The data processing methods used, as well as the modeling algorithms implemented, should be highly automated and universal. The main of the presented research was to analyze and compare various methods for extracting matching points. The article presents the results of combining data from ALS and TLS using reference points extracted both manually and automatically. Finally, the publication also includes an analysis of the accuracy of the data merging process.

  19. A CRE/AP-1-like motif is essential for induced syncytin-2 expression and fusion in human trophoblast-like model.

    Directory of Open Access Journals (Sweden)

    Chirine Toufaily

    Full Text Available Syncytin-2 is encoded by the envelope gene of Endogenous Retrovirus-FRD (ERVFRD-1 and plays a critical role in fusion of placental trophoblasts leading to the formation of the multinucleated syncytiotrophoblast. Its expression is consequently regulated in a strict manner. In the present study, we have identified a forskolin-responsive region located between positions -300 to -150 in the Syncytin-2 promoter region. This 150 bp region in the context of a minimal promoter mediated an 80-fold induction of promoter activity following forskolin stimulation. EMSA analyses with competition experiments with nuclear extracts from forskolin-stimulated BeWo cells demonstrated that the -211 to -177 region specifically bound two forskolin-induced complexes, one of them containing a CRE/AP-1-like motif. Site-directed mutagenesis of the CRE/AP-1 binding site in the context of the Syncytin-2 promoter or a heterologous promoter showed that this motif was mostly essential for forskolin-induced promoter activity. Transfection experiments with dominant negative mutants and constitutively activated CREB expression vectors in addition to Chromatin Immunoprecipitation suggested that a CREB family member, CREB2 was binding and acting through the CRE/AP-1 motif. We further demonstrated the binding of JunD to this same motif. Similar to forskolin and soluble cAMP, CREB2 and JunD overexpression induced Syncytin-2 promoter activity in a CRE/AP-1-dependent manner and Syncytin-2 expression. In addition, BeWo cell fusion was induced by both CREB2 and JunD overexpression, while being repressed following silencing of either gene. These results thereby demonstrate that induced expression of Syncytin-2 is highly dependent on the interaction of bZIP-containing transcription factors to a CRE/AP-1 motif and that this element is important for the regulation of Syncytin-2 expression, which results in the formation of the peripheral syncytiotrophoblast layer.

  20. Cold fusion, Alchemist's dream

    International Nuclear Information System (INIS)

    Clayton, E.D.

    1989-09-01

    In this report the following topics relating to cold fusion are discussed: muon catalysed cold fusion; piezonuclear fusion; sundry explanations pertaining to cold fusion; cosmic ray muon catalysed cold fusion; vibrational mechanisms in excited states of D 2 molecules; barrier penetration probabilities within the hydrogenated metal lattice/piezonuclear fusion; branching ratios of D 2 fusion at low energies; fusion of deuterons into 4 He; secondary D+T fusion within the hydrogenated metal lattice; 3 He to 4 He ratio within the metal lattice; shock induced fusion; and anomalously high isotopic ratios of 3 He/ 4 He

  1. Magnetic fusion; La fusion magnetique

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-07-01

    This document is a detailed lecture on thermonuclear fusion. The basic physics principles are recalled and the technological choices that have led to tokamaks or stellarators are exposed. Different aspects concerning thermonuclear reactors such as safety, economy and feasibility are discussed. Tore-supra is described in details as well as the ITER project.

  2. Thermo-mechanical Modelling of Pebble Beds in Fusion Blankets and its Implementation by a Return-Mapping Algorithm

    International Nuclear Information System (INIS)

    Gan, Yixiang; Kamlah, Marc

    2008-01-01

    In this investigation, a thermo-mechanical model of pebble beds is adopted and developed based on experiments by Dr. Reimann at Forschungszentrum Karlsruhe (FZK). The framework of the present material model is composed of a non-linear elastic law, the Drucker-Prager-Cap theory, and a modified creep law. Furthermore, the volumetric inelastic strain dependent thermal conductivity of beryllium pebble beds is taken into account and full thermo-mechanical coupling is considered. Investigation showed that the Drucker-Prager-Cap model implemented in ABAQUS can not fulfill the requirements of both the prediction of large creep strains and the hardening behaviour caused by creep, which are of importance with respect to the application of pebble beds in fusion blankets. Therefore, UMAT (user defined material's mechanical behaviour) and UMATHT (user defined material's thermal behaviour) routines are used to re-implement the present thermo-mechanical model in ABAQUS. An elastic predictor radial return mapping algorithm is used to solve the non-associated plasticity iteratively, and a proper tangent stiffness matrix is obtained for cost-efficiency in the calculation. An explicit creep mechanism is adopted for the prediction of time-dependent behaviour in order to represent large creep strains in high temperature. Finally, the thermo-mechanical interactions are implemented in a UMATHT routine for the coupled analysis. The oedometric compression tests and creep tests of pebble beds at different temperatures are simulated with the help of the present UMAT and UMATHT routines, and the comparison between the simulation and the experiments is made. (authors)

  3. AcEST: BP912612 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H07. BP912612 - Show BP912612... Clone id YMU001_000020_H07 Library YMU01 Length 512 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000020_H07. Accession BP912612 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912612|Adiantum cap...illus-veneris mRNA, clone: YMU001_000020_H07. (512 letters) Database: uniprot_sprot.fasta 412,525 sequences;

  4. AcEST: BP912712 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show BP912712...is mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, cl...one: YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI

  5. AcEST: BP912126 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa

  6. AcEST: BP912212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D11 457 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D11. BP912212... CL1085Contig1 Show BP912212 Clone id YMU001_000016_D11 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D11. Accession BP912212 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912212...|Adiantum capillus-veneris mRNA, clone: YMU001_000016_D11. (457 letters) Database: uniprot_sprot.fasta 412

  7. AcEST: BP912312 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000017_F01 489 Adiantum capillus-veneris mRNA. clone: YMU001_000017_F01. BP912312... CL1779Contig1 Show BP912312 Clone id YMU001_000017_F01 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000017_F01. Accession BP912312 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912312...|Adiantum capillus-veneris mRNA, clone: YMU001_000017_F01. (489 letters) Database: uniprot_sprot.fasta 412

  8. AcEST: BP912128 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D10 477 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D10. BP91212...8 CL2328Contig1 Show BP912128 Clone id YMU001_000015_D10 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D10. Accession BP912128 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...8|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D10. (461 letters) Database: uniprot_sprot.fasta 412

  9. AcEST: BP912012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP912012... CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...mRNA, clone: YMU001_000012_A06. (542 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 t

  10. AcEST: BP912123 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D05 496 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D05. BP91212...3 CL498Contig1 Show BP912123 Clone id YMU001_000015_D05 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D05. Accession BP912123 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...3|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D05. (478 letters) Database: uniprot_sprot.fasta 412

  11. AcEST: BP912912 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000024_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000024_C05. BP912912... CL1433Contig1 Show BP912912 Clone id YMU001_000024_C05 Library YMU01 Length 413 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000024_C05. Accession BP912912 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912912|Adiantum capillus-ven...eris mRNA, clone: YMU001_000024_C05. (413 letters) Database: uniprot_sprot.fasta 412

  12. AcEST: BP919999 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_G09 554 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G09. BP919999... CL2968Contig1 Show BP919999 Clone id YMU001_000131_G09 Library YMU01 Length 554 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_G09. Accession BP919999 Tissue type prothallium Developmental stag...b Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generatio...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919999|Adiantum capillus-ve

  13. AcEST: BP913636 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000032_E04 520 Adiantum capillus-veneris mRNA. clone: YMU001_000032_E04. BP913636... CL2643Contig1 Show BP913636 Clone id YMU001_000032_E04 Library YMU01 Length 520 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000032_E04. Accession BP913636 Tissue type prothallium Developmental stag...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP913636|Adiantum capillus-veneris mRNA, clone: YMU001_00003...tative phospholipid-transporting ATPase ... 149 8e-36 sp|Q9LNQ4|ALA4_ARATH Putati

  14. AcEST: BP920997 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D02. BP92099...7 CL10Contig1 Show BP920997 Clone id YMU001_000144_D02 Library YMU01 Length 534 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_D02. Accession BP920997 Tissue type prothallium Developmental stage ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920997|Adian...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2

  15. AcEST: BP917373 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_A08 270 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A08. BP917373 CL2373...Contig1 Show BP917373 Clone id YMU001_000100_A08 Library YMU01 Length 270 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_A08. Accession BP917373 Tissue type prothallium Developmental stage - Contig ID CL2373...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917373|Adiantum capillus-veneris mRNA, clone: YMU...EGAVKHVGVLSS 206 K+ GC+S G SRHGES V KE H SS Sbjct: 473 KKEKGCSSPGSSRHGESHKGVSHTPI

  16. Nuclear physics for nuclear fusion

    International Nuclear Information System (INIS)

    Li Xingzhong; Liu Bin; Wei Qingming; Ren Xianzhe

    2004-01-01

    The D-T fusion cross-section is calculated using quantum mechanics with the model of square nuclear potential well and Coulomb potential barrier. The agreement between ENDF data and the theoretically calculated results is well in the range of 0.2-280 keV. It shows that the application of Breit-Wigner formula is not suitable for the case of the light nuclei fusion reaction. When this model is applied to the nuclear reaction between the charged particles confined in a lattice, it explains the 'abnormal phenomena'. It implies a prospect of nuclear fusion energy without strong nuclear radiations

  17. Forecasting tidal marsh elevation and habitat change through fusion of Earth observations and a process model

    Science.gov (United States)

    Byrd, Kristin B.; Windham-Myers, Lisamarie; Leeuw, Thomas; Downing, Bryan D.; Morris, James T.; Ferner, Matthew C.

    2016-01-01

    Reducing uncertainty in data inputs at relevant spatial scales can improve tidal marsh forecasting models, and their usefulness in coastal climate change adaptation decisions. The Marsh Equilibrium Model (MEM), a one-dimensional mechanistic elevation model, incorporates feedbacks of organic and inorganic inputs to project elevations under sea-level rise scenarios. We tested the feasibility of deriving two key MEM inputs—average annual suspended sediment concentration (SSC) and aboveground peak biomass—from remote sensing data in order to apply MEM across a broader geographic region. We analyzed the precision and representativeness (spatial distribution) of these remote sensing inputs to improve understanding of our study region, a brackish tidal marsh in San Francisco Bay, and to test the applicable spatial extent for coastal modeling. We compared biomass and SSC models derived from Landsat 8, DigitalGlobe WorldView-2, and hyperspectral airborne imagery. Landsat 8-derived inputs were evaluated in a MEM sensitivity analysis. Biomass models were comparable although peak biomass from Landsat 8 best matched field-measured values. The Portable Remote Imaging Spectrometer SSC model was most accurate, although a Landsat 8 time series provided annual average SSC estimates. Landsat 8-measured peak biomass values were randomly distributed, and annual average SSC (30 mg/L) was well represented in the main channels (IQR: 29–32 mg/L), illustrating the suitability of these inputs across the model domain. Trend response surface analysis identified significant diversion between field and remote sensing-based model runs at 60 yr due to model sensitivity at the marsh edge (80–140 cm NAVD88), although at 100 yr, elevation forecasts differed less than 10 cm across 97% of the marsh surface (150–200 cm NAVD88). Results demonstrate the utility of Landsat 8 for landscape-scale tidal marsh elevation projections due to its comparable performance with the other sensors

  18. Finite Element Modelling of a Field-Sensed Magnetic Suspended System for Accurate Proximity Measurement Based on a Sensor Fusion Algorithm with Unscented Kalman Filter.

    Science.gov (United States)

    Chowdhury, Amor; Sarjaš, Andrej

    2016-09-15

    The presented paper describes accurate distance measurement for a field-sensed magnetic suspension system. The proximity measurement is based on a Hall effect sensor. The proximity sensor is installed directly on the lower surface of the electro-magnet, which means that it is very sensitive to external magnetic influences and disturbances. External disturbances interfere with the information signal and reduce the usability and reliability of the proximity measurements and, consequently, the whole application operation. A sensor fusion algorithm is deployed for the aforementioned reasons. The sensor fusion algorithm is based on the Unscented Kalman Filter, where a nonlinear dynamic model was derived with the Finite Element Modelling approach. The advantage of such modelling is a more accurate dynamic model parameter estimation, especially in the case when the real structure, materials and dimensions of the real-time application are known. The novelty of the paper is the design of a compact electro-magnetic actuator with a built-in low cost proximity sensor for accurate proximity measurement of the magnetic object. The paper successively presents a modelling procedure with the finite element method, design and parameter settings of a sensor fusion algorithm with Unscented Kalman Filter and, finally, the implementation procedure and results of real-time operation.

  19. Probability Distribution and Deviation Information Fusion Driven Support Vector Regression Model and Its Application

    Directory of Open Access Journals (Sweden)

    Changhao Fan

    2017-01-01

    Full Text Available In modeling, only information from the deviation between the output of the support vector regression (SVR model and the training sample is considered, whereas the other prior information of the training sample, such as probability distribution information, is ignored. Probabilistic distribution information describes the overall distribution of sample data in a training sample that contains different degrees of noise and potential outliers, as well as helping develop a high-accuracy model. To mine and use the probability distribution information of a training sample, a new support vector regression model that incorporates probability distribution information weight SVR (PDISVR is proposed. In the PDISVR model, the probability distribution of each sample is considered as the weight and is then introduced into the error coefficient and slack variables of SVR. Thus, the deviation and probability distribution information of the training sample are both used in the PDISVR model to eliminate the influence of noise and outliers in the training sample and to improve predictive performance. Furthermore, examples with different degrees of noise were employed to demonstrate the performance of PDISVR, which was then compared with those of three SVR-based methods. The results showed that PDISVR performs better than the three other methods.

  20. Towards the optimal fusion of high-resolution Digital Elevation Models for detailed urban flood assessment

    Science.gov (United States)

    Leitão, J. P.; de Sousa, L. M.

    2018-06-01

    Newly available, more detailed and accurate elevation data sets, such as Digital Elevation Models (DEMs) generated on the basis of imagery from terrestrial LiDAR (Light Detection and Ranging) systems or Unmanned Aerial Vehicles (UAVs), can be used to improve flood-model input data and consequently increase the accuracy of the flood modelling results. This paper presents the first application of the MBlend merging method and assesses the impact of combining different DEMs on flood modelling results. It was demonstrated that different raster merging methods can have different and substantial impacts on these results. In addition to the influence associated with the method used to merge the original DEMs, the magnitude of the impact also depends on (i) the systematic horizontal and vertical differences of the DEMs, and (ii) the orientation between the DEM boundary and the terrain slope. The greater water depth and flow velocity differences between the flood modelling results obtained using the reference DEM and the merged DEMs ranged from -9.845 to 0.002 m, and from 0.003 to 0.024 m s-1 respectively; these differences can have a significant impact on flood hazard estimates. In most of the cases investigated in this study, the differences from the reference DEM results were smaller for the MBlend method than for the results of the two conventional methods. This study highlighted the importance of DEM merging when conducting flood modelling and provided hints on the best DEM merging methods to use.

  1. Using model-data fusion to analyze the interannual variability of NEE of an alpine grassland

    Science.gov (United States)

    Scholz, Katharina; Hammerle, Albin; Hiltbrunner, Erika; Wohlfahrt, Georg

    2017-04-01

    To understand the processes and magnitude of carbon dynamics of the biosphere, modeling approaches are an important tool to analyze carbon budgets from regional to global scale. Here, a simple process-based ecosystem carbon model was used to investigate differences in CO2 fluxes of a high mountain grassland near Furka Pass in the Swiss central Alps at an elevation of about 2400 m a.s.l. during two growing seasons differing in snow melt date. Data on net ecosystem CO2 exchange (NEE) as well as meteorological conditions was available from 20.06.2013 - 08.10.2014 covering two snow free periods. The NEE data indicates that the carbon uptake during the growing season in 2013 was considerably lower than in 2014. To investigate whether the lower carbon uptake in 2013 was mainly due to the short growing season, an effect of biotic response to spring environmental conditions, or the direct effect of the weather conditions during the growing season, a modeling approach was applied. For this purpose, an ecosystem mass balance C model with 13 unknown parameters was constructed based on the DALEC model to represent the major C fluxes among six carbon pools (foliage, roots, necromass, litter, soil organic carbon and a labile pool to support leaf onset in spring) of the grassland ecosystem. Daily gross primary production was estimated by use of a sun/shade big-leaf model of canopy photosynthesis. By calibrating the model with NEE data from individual years, two sets of parameters were retrieved which were then used to run the model under environmental conditions of the same as well as the other year. The parameter estimation was done using DREAM, an algorithm for statistical inference of parameters using Bayesian statistics. In order to account for non-normality, heteroscedasticity and correlation of model residuals, a common problem in ecological modeling, a generalized likelihood function was applied. The results indicate that the late growing season start in 2013 led to a

  2. Splenogonadal Fusion

    Directory of Open Access Journals (Sweden)

    Sung-Lang Chen

    2008-11-01

    Full Text Available Splenogonadal fusion (SGF is a rare congenital non-malignant anomaly characterized by fusion of splenic tissue to the gonad, and can be continuous or discontinuous. Very few cases have been diagnosed preoperatively, and many patients who present with testicular swelling undergo unnecessary orchiectomy under the suspicion of testicular neoplasm. A 16-year-old boy presented with a left scrotal mass and underwent total excision of a 1.6-cm tumor without damaging the testis, epididymis or its accompanying vessels. Pathologic examination revealed SFG (discontinuous type. If clinically suspected before surgery, the diagnosis may be confirmed by Tc-99m sulfur colloid imaging, which shows uptake in both the spleen and accessory splenic tissue within the scrotum. Frozen section should be considered if there remains any doubt regarding the diagnosis during operation.

  3. In-Situ monitoring and modeling of metal additive manufacturing powder bed fusion

    Science.gov (United States)

    Alldredge, Jacob; Slotwinski, John; Storck, Steven; Kim, Sam; Goldberg, Arnold; Montalbano, Timothy

    2018-04-01

    One of the major challenges in metal additive manufacturing is developing in-situ sensing and feedback control capabilities to eliminate build errors and allow qualified part creation without the need for costly and destructive external testing. Previously, many groups have focused on high fidelity numerical modeling and true temperature thermal imaging systems. These approaches require large computational resources or costly hardware that requires complex calibration and are difficult to integrate into commercial systems. In addition, due to the rapid change in the state of the material as well as its surface properties, getting true temperature is complicated and difficult. Here, we describe a different approach where we implement a low cost thermal imaging solution allowing for relative temperature measurements sufficient for detecting unwanted process variability. We match this with a faster than real time qualitative model that allows the process to be rapidly modeled during the build. The hope is to combine these two, allowing for the detection of anomalies in real time, enabling corrective action to potentially be taken, or parts to be stopped immediately after the error, saving material and time. Here we describe our sensor setup, its costs and abilities. We also show the ability to detect in real time unwanted process deviations. We also show that the output of our high speed model agrees qualitatively with experimental results. These results lay the groundwork for our vision of an integrated feedback and control scheme that combines low cost, easy to use sensors and fast modeling for process deviation monitoring.

  4. A comparison of non-local electron transport models relevant to inertial confinement fusion

    Science.gov (United States)

    Sherlock, Mark; Brodrick, Jonathan; Ridgers, Christopher

    2017-10-01

    We compare the reduced non-local electron transport model developed by Schurtz et al. to Vlasov-Fokker-Planck simulations. Two new test cases are considered: the propagation of a heat wave through a high density region into a lower density gas, and a 1-dimensional hohlraum ablation problem. We find the reduced model reproduces the peak heat flux well in the ablation region but significantly over-predicts the coronal preheat. The suitability of the reduced model for computing non-local transport effects other than thermal conductivity is considered by comparing the computed distribution function to the Vlasov-Fokker-Planck distribution function. It is shown that even when the reduced model reproduces the correct heat flux, the distribution function is significantly different to the Vlasov-Fokker-Planck prediction. Two simple modifications are considered which improve agreement between models in the coronal region. This work was performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344.

  5. Simulation of leaf area index on site scale based on model data fusion

    Science.gov (United States)

    Yang, Y.; Wang, J. B.

    2017-12-01

    The world's grassland area is about 24 × 108hm2, accounting for about one-fifth of the global land area. It is one of the most widely distributed terrestrial ecosystems on Earth. And currently, it is the most affected area of human activity. A considerable portion of the global CO2 emissions are fixed by grassland, and the grassland carbon cycle plays an important role in the global carbon cycle (Li Bo, Yongshen Peng, Li Yao, China's Prairie, 1990). In recent years, the carbon cycle and its influencing factors of grassland ecosystems have become one of the hotspots in ecology, geology, botany and agronomy under the background of global change ( Mu Shaojie, 2014) . And the model is now as a popular and effective method of research. However, there are still some uncertainties in this approach. CEVSA ( Carbon Exchange between Vegetation, Soil and Atmosphere) is a biogeochemical cycle model based on physiological and ecological processes to simulate plant-soil-atmosphere system energy exchange and water-carbon-nitrogen coupling cycles (Cao at al., 1998a; 1998b; Woodward et al., 1995). In this paper, the remote sensing observation data of leaf area index are integrated into the model, and the CEVSA model of site version is optimized by Markov chain-Monte Carlo method to achieve the purpose of increasing the accuracy of model results.

  6. Impact of histone H4 lysine 20 methylation on 53BP1 responses to chromosomal double strand breaks.

    Directory of Open Access Journals (Sweden)

    Andrea J Hartlerode

    Full Text Available Recruitment of 53BP1 to chromatin flanking double strand breaks (DSBs requires γH2AX/MDC1/RNF8-dependent ubiquitination of chromatin and interaction of 53BP1 with histone H4 methylated on lysine 20 (H4K20me. Several histone methyltransferases have been implicated in 53BP1 recruitment, but their quantitative contributions to the 53BP1 response are unclear. We have developed a multi-photon laser (MPL system to target DSBs to subfemtoliter nuclear volumes and used this to mathematically model DSB response kinetics of MDC1 and of 53BP1. In contrast to MDC1, which revealed first order kinetics, the 53BP1 MPL-DSB response is best fitted by a Gompertz growth function. The 53BP1 MPL response shows the expected dependency on MDC1 and RNF8. We determined the impact of altered H4K20 methylation on 53BP1 MPL response kinetics in mouse embryonic fibroblasts (MEFs lacking key H4K20 histone methyltransferases. This revealed no major requirement for the known H4K20 dimethylases Suv4-20h1 and Suv4-20h2 in 53BP1 recruitment or DSB repair function, but a key role for the H4K20 monomethylase, PR-SET7. The histone methyltransferase MMSET/WHSC1 has recently been implicated in 53BP1 DSB recruitment. We found that WHSC1 homozygous mutant MEFs reveal an alteration in balance of H4K20 methylation patterns; however, 53BP1 DSB responses in these cells appear normal.

  7. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    Energy Technology Data Exchange (ETDEWEB)

    Gago-Ferrero, Pablo, E-mail: pablo.gago@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Badia-Fabregat, Marina, E-mail: marina.badia@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Olivares, Alba, E-mail: esalba.olivares@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Pina, Benjamin, E-mail: benjami.pina@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Blanquez, Paqui, E-mail: paqui.blanquez@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Vicent, Teresa, E-mail: teresa.vicent@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Caminal, Gloria, E-mail: gloria.caminal@uab.cat [Unitat de Biocatalisi Aplicada associada al IQAC (CSIC-UAB). Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Diaz-Cruz, M. Silvia, E-mail: silvia.diaz@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); and others

    2012-06-15

    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: Black-Right-Pointing-Pointer Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. Black-Right-Pointing-Pointer BP3 is not degraded under simulated sunlight. Black-Right-Pointing-Pointer Glycoconjugates have been identified as the main intermediate metabolites. Black-Right-Pointing-Pointer Decrease in endocrine activity

  8. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    International Nuclear Information System (INIS)

    Gago-Ferrero, Pablo; Badia-Fabregat, Marina; Olivares, Alba; Piña, Benjamin; Blánquez, Paqui; Vicent, Teresa; Caminal, Gloria; Díaz-Cruz, M. Silvia

    2012-01-01

    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: ► Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. ► BP3 is not degraded under simulated sunlight. ► Glycoconjugates have been identified as the main intermediate metabolites. ► Decrease in endocrine activity was found in both photodegradation and biodegradation.

  9. Relationships between thought-action fusion, thought suppression and obsessive-compulsive symptoms: a structural equation modeling approach.

    Science.gov (United States)

    Rassin, E; Muris, P; Schmidt, H; Merckelbach, H

    2000-09-01

    Research has shown that there are strong similarities in content between the obsessions and compulsions that characterize obsessive-compulsive disorder and nonclinical obsessions and compulsions. However, clinical and nonclinical obsessions and compulsions do differ with respect to characteristics like frequency, intensity, discomfort and elicited resistance. Two separate concepts have been invoked to explain how normal obsessions and compulsions may develop into clinical phenomena. First, it is suggested that thought-action fusion (TAF) contributes to obsessive-compulsive symptoms. Second, thought suppression may intensify obsessive-compulsive symptoms due to its paradoxical effect on intrusive thoughts. Although both phenomena have been found to contribute to obsessive-compulsive symptoms, possible interactions between these two have never been investigated. The current study explored how TAF and thought suppression interact in the development of obsessive-compulsive symptoms. Undergraduate psychology students (N = 173) completed questionnaires pertaining to TAF, thought suppression and obsessive-compulsive symptoms. Covariances between the scores on these questionnaires were analyzed by means of structural equation modeling. Results suggest that TAF triggers thought suppression, while thought suppression, in turn, promotes obsessive-compulsive symptoms.

  10. Calibrating the BOLD signal during a motor task using an extended fusion model incorporating DOT, BOLD and ASL data

    Science.gov (United States)

    Yücel, Meryem A.; Huppert, Theodore J.; Boas, David A.; Gagnon, Louis

    2012-01-01

    Multimodal imaging improves the accuracy of the localization and the quantification of brain activation when measuring different manifestations of the hemodynamic response associated with cerebral activity. In this study, we incorporated cerebral blood flow (CBF) changes measured with arterial spin labeling (ASL), Diffuse Optical Tomography (DOT) and blood oxygen level-dependent (BOLD) recordings to reconstruct changes in oxy- (ΔHbO2) and deoxyhemoglobin (ΔHbR). Using the Grubb relation between relative changes in CBF and cerebral blood volume (CBV), we incorporated the ASL measurement as a prior to the total hemoglobin concentration change (ΔHbT). We applied this ASL fusion model to both synthetic data and experimental multimodal recordings during a 2-sec finger-tapping task. Our results show that the new approach is very powerful in estimating ΔHbO2 and ΔHbR with high spatial and quantitative accuracy. Moreover, our approach allows the computation of baseline total hemoglobin concentration (HbT0) as well as of the BOLD calibration factor M on a single subject basis. We obtained an average HbT0 of 71 μM, an average M value of 0.18 and an average increase of 13 % in cerebral metabolic rate of oxygen (CMRO2), all of which are in agreement with values previously reported in the literature. Our method yields an independent measurement of M, which provides an alternative measurement to validate the hypercapnic calibration of the BOLD signal. PMID:22546318

  11. Revision of Drucker-Prager cap creep modelling of pebble beds in fusion blankets

    International Nuclear Information System (INIS)

    Hofer, D.; Kamlah, M.; Hermsmeyer, S.

    2004-01-01

    A continuum model commonly used in soil mechanics analysis is compiled by use of a finite element software and has been used to simulate the thermomechanical behaviour of pebble beds. The Drucker-Prager Cap theory accounts for inelastic volume change, cap hardening, nonlinear elasticity and pressure dependent shear failure. The hardening mechanism allows for defining the hydrostatic pressure yield stress as a function of the volumetric inelastic strain. Volumetric creep is considered in order to simulate the pebble bed behaviour at high temperatures. Here, the strain hardening option has been used for the consolidation creep mechanism. The model has been calibrated using the fitting curves of the oedometric test given by Reimann et al. The fitted data has been used to calculate a pebble bed with simplified boundary conditions loaded by non-uniform volumetric heating. This calculation demonstrated that the model is capable of representing creep behaviour under volumetric heating conditions. (author)

  12. Model-data fusion across ecosystems: from multisite optimizations to global simulations

    Science.gov (United States)

    Kuppel, S.; Peylin, P.; Maignan, F.; Chevallier, F.; Kiely, G.; Montagnani, L.; Cescatti, A.

    2014-11-01

    This study uses a variational data assimilation framework to simultaneously constrain a global ecosystem model with eddy covariance measurements of daily net ecosystem exchange (NEE) and latent heat (LE) fluxes from a large number of sites grouped in seven plant functional types (PFTs). It is an attempt to bridge the gap between the numerous site-specific parameter optimization works found in the literature and the generic parameterization used by most land surface models within each PFT. The present multisite approach allows deriving PFT-generic sets of optimized parameters enhancing the agreement between measured and simulated fluxes at most of the sites considered, with performances often comparable to those of the corresponding site-specific optimizations. Besides reducing the PFT-averaged model-data root-mean-square difference (RMSD) and the associated daily output uncertainty, the optimization improves the simulated CO2 balance at tropical and temperate forests sites. The major site-level NEE adjustments at the seasonal scale are reduced amplitude in C3 grasslands and boreal forests, increased seasonality in temperate evergreen forests, and better model-data phasing in temperate deciduous broadleaf forests. Conversely, the poorer performances in tropical evergreen broadleaf forests points to deficiencies regarding the modelling of phenology and soil water stress for this PFT. An evaluation with data-oriented estimates of photosynthesis (GPP - gross primary productivity) and ecosystem respiration (Reco) rates indicates distinctively improved simulations of both gross fluxes. The multisite parameter sets are then tested against CO2 concentrations measured at 53 locations around the globe, showing significant adjustments of the modelled seasonality of atmospheric CO2 concentration, whose relevance seems PFT-dependent, along with an improved interannual variability. Lastly, a global-scale evaluation with remote sensing NDVI (normalized difference vegetation index

  13. Laser fusion

    International Nuclear Information System (INIS)

    Eliezer, S.

    1982-02-01

    In this paper, the physics of laser fusion is described on an elementary level. The irradiated matter consists of a dense inner core surrounded by a less dense plasma corona. The laser radiation is mainly absorbed in the outer periphery of the plasma. The absorbed energy is transported inward to the ablation surface where plasma flow is created. Due to this plasma flow, a sequence of inward going shock waves and heat waves are created, resulting in the compression and heating of the core to high density and temperature. The interaction physics between laser and matter leading to thermonuclear burn is summarized by the following sequence of events: Laser absorption → Energy transport → Compression → Nuclear Fusion. This scenario is shown in particular for a Nd:laser with a wavelength of 1 μm. The wavelength scaling of the physical processes is also discussed. In addition to the laser-plasma physics, the Nd high power pulsed laser is described. We give a very brief description of the oscillator, the amplifiers, the spatial filters, the isolators and the diagnostics involved. Last, but not least, the concept of reactors for laser fusion and the necessary laser system are discussed. (author)

  14. Dusty Plasma Modeling of the Fusion Reactor Sheath Including Collisional-Radiative Effects

    International Nuclear Information System (INIS)

    Dezairi, Aouatif; Samir, Mhamed; Eddahby, Mohamed; Saifaoui, Dennoun; Katsonis, Konstantinos; Berenguer, Chloe

    2008-01-01

    The structure and the behavior of the sheath in Tokamak collisional plasmas has been studied. The sheath is modeled taking into account the presence of the dust 2 and the effects of the charged particle collisions and radiative processes. The latter may allow for optical diagnostics of the plasma.

  15. Zero-dimensional model of a reversed field pinch fusion reactor

    International Nuclear Information System (INIS)

    Veerasingam, R.

    1987-12-01

    A zero-dimensional model for the energy balance for electrons and ions of a Reversed Field Pinch (RFP) device has been developed. The model can be used as a tool for parametric studies and has been applied to simulate some ZT-40M experiments. In the model multiplicative coefficients C 1 , C 2 , C 3 and C 4 are introduced to treat anomalous resistivity, electron and ion energy confinement times and to account for the instability driven ion heating that is observed in RFP experiments. Parametric studies were performed to determine the sensitivity of the model to changes in multiplicative coefficients. A set of coefficients which can simulate a number of ZT-40M experiments have been obtained and the sensitivity of T/sub e/ and T/sub i/ to these coefficients was examined. Both flat top and ramp current waveforms were studied. The effects of different levels of impurities were also examined. The results showed that while all the three impurities used, viz., carbon, oxygen and nickel contributed to Z/sub eff/, nickel dominated the impurity radiation power. The results were then applied to study the behavior of the ZT-H device which is being built in the Confinement Physics Research Facility at the Los Alamos National Laboratory. 30 refs., 39 figs., 12 tabs

  16. Ensemble modelling of nitrogen fluxes: data fusion for a Swedish meso-scale catchment

    Directory of Open Access Journals (Sweden)

    J.-F. Exbrayat

    2010-12-01

    Full Text Available Model predictions of biogeochemical fluxes at the landscape scale are highly uncertain, both with respect to stochastic (parameter and structural uncertainty. In this study 5 different models (LASCAM, LASCAM-S, a self-developed tool, SWAT and HBV-N-D designed to simulate hydrological fluxes as well as mobilisation and transport of one or several nitrogen species were applied to the mesoscale River Fyris catchment in mid-eastern Sweden.

    Hydrological calibration against 5 years of recorded daily discharge at two stations gave highly variable results with Nash-Sutcliffe Efficiency (NSE ranging between 0.48 and 0.83. Using the calibrated hydrological parameter sets, the parameter uncertainty linked to the nitrogen parameters was explored in order to cover the range of possible predictions of exported loads for 3 nitrogen species: nitrate (NO3, ammonium (NH4 and total nitrogen (Tot-N. For each model and each nitrogen species, predictions were ranked in two different ways according to the performance indicated by two different goodness-of-fit measures: the coefficient of determination R2 and the root mean square error RMSE. A total of 2160 deterministic Single Model Ensembles (SME was generated using an increasing number of members (from the 2 best to the 10 best single predictions. Finally the best SME for each model, nitrogen species and discharge station were selected and merged into 330 different Multi-Model Ensembles (MME. The evolution of changes in R2 and RMSE was used as a performance descriptor of the ensemble procedure.

    In each studied case, numerous ensemble merging schemes were identified which outperformed any of their members. Improvement rates were generally higher when worse members were introduced. The highest improvements were achieved for the nitrogen SMEs compiled with multiple linear regression models with R2 selected members, which

  17. Modeling of hydrogen/deuterium dynamics and heat generation on palladium nanoparticles for hydrogen storage and solid-state nuclear fusion

    Directory of Open Access Journals (Sweden)

    Katsuaki Tanabe

    2016-01-01

    Full Text Available We modeled the dynamics of hydrogen and deuterium adsorbed on palladium nanoparticles including the heat generation induced by the chemical adsorption and desorption, as well as palladium-catalyzed reactions. Our calculations based on the proposed model reproduce the experimental time-evolution of pressure and temperature with a single set of fitting parameters for hydrogen and deuterium injection. The model we generated with a highly generalized set of formulations can be applied for any combination of a gas species and a catalytic adsorbent/absorbent. Our model can be used as a basis for future research into hydrogen storage and solid-state nuclear fusion technologies.

  18. Modeling of hydrogen/deuterium dynamics and heat generation on palladium nanoparticles for hydrogen storage and solid-state nuclear fusion.

    Science.gov (United States)

    Tanabe, Katsuaki

    2016-01-01

    We modeled the dynamics of hydrogen and deuterium adsorbed on palladium nanoparticles including the heat generation induced by the chemical adsorption and desorption, as well as palladium-catalyzed reactions. Our calculations based on the proposed model reproduce the experimental time-evolution of pressure and temperature with a single set of fitting parameters for hydrogen and deuterium injection. The model we generated with a highly generalized set of formulations can be applied for any combination of a gas species and a catalytic adsorbent/absorbent. Our model can be used as a basis for future research into hydrogen storage and solid-state nuclear fusion technologies.

  19. Intrusion detection model using fusion of chi-square feature selection and multi class SVM

    Directory of Open Access Journals (Sweden)

    Ikram Sumaiya Thaseen

    2017-10-01

    Full Text Available Intrusion detection is a promising area of research in the domain of security with the rapid development of internet in everyday life. Many intrusion detection systems (IDS employ a sole classifier algorithm for classifying network traffic as normal or abnormal. Due to the large amount of data, these sole classifier models fail to achieve a high attack detection rate with reduced false alarm rate. However by applying dimensionality reduction, data can be efficiently reduced to an optimal set of attributes without loss of information and then classified accurately using a multi class modeling technique for identifying the different network attacks. In this paper, we propose an intrusion detection model using chi-square feature selection and multi class support vector machine (SVM. A parameter tuning technique is adopted for optimization of Radial Basis Function kernel parameter namely gamma represented by ‘ϒ’ and over fitting constant ‘C’. These are the two important parameters required for the SVM model. The main idea behind this model is to construct a multi class SVM which has not been adopted for IDS so far to decrease the training and testing time and increase the individual classification accuracy of the network attacks. The investigational results on NSL-KDD dataset which is an enhanced version of KDDCup 1999 dataset shows that our proposed approach results in a better detection rate and reduced false alarm rate. An experimentation on the computational time required for training and testing is also carried out for usage in time critical applications.

  20. The Application and Research of the GA-BP Neural Network Algorithm in the MBR Membrane Fouling

    Directory of Open Access Journals (Sweden)

    Chunqing Li

    2014-01-01

    Full Text Available It is one of the important issues in the field of today's sewage treatment of researching the MBR membrane flux prediction for membrane fouling. Firstly this paper used the principal component analysis method to achieve dimensionality and correlation of input variables and obtained the three major factors affecting membrane fouling most obvious: MLSS, total resistance, and operating pressure. Then it used the BP neural network to establish the system model of the MBR intelligent simulation, the relationship between three parameters, and membrane flux characterization of the degree of membrane fouling, because the BP neural network has slow training speed, is sensitive to the initial weights and the threshold, is easy to fall into local minimum points, and so on. So this paper used genetic algorithm to optimize the initial weights and the threshold of BP neural network and established the membrane fouling prediction model based on GA-BP network. As this research had shown, under the same conditions, the BP network model optimized by GA of MBR membrane fouling is better than that not optimized for prediction effect of membrane flux. It demonstrates that the GA-BP network model of MBR membrane fouling is more suitable for simulation of MBR membrane fouling process, comparing with the BP network.