WorldWideScience

Sample records for bp explosive cycle

  1. Application of genetic BP network to discriminating earthquakes and explosions

    Institute of Scientific and Technical Information of China (English)

    边银菊

    2002-01-01

    In this paper, we develop GA-BP algorithm by combining genetic algorithm (GA) with back propagation (BP) algorithm and establish genetic BP neural network. We also applied BP neural network based on BP algorithm and genetic BP neural network based on GA-BP algorithm to discriminate earthquakes and explosions. The obtained result shows that the discriminating performance of genetic BP network is slightly better than that of BP network.

  2. Research on safety assessment of gas explosion hazard in heading face based on BP neural network

    Institute of Scientific and Technical Information of China (English)

    TIAN Shui-cheng; ZHU Li-jun; CHEN Yong-gang; WANG Li

    2005-01-01

    According to hazard theory and the principle of selecting assessment index,combining the causes and mechanism of gas explosion, established assessment index system of gas explosion in heading face. Based on the method of gray clustering, principle of BP neural network and characters of gas explosion in heading face, safety assessment procedural diagram of BP neural network on gas explosion hazard in heading face is designed. Meanwhile, concrete heading face of the gas explosion hazard is assessed by safety assessment method of BP neural network and grades of comprehensive safety assessment are got. The static and dynamic safety assessment can be achieved by this method. It is practical to improve safety management and to develop safety assessment technology in coalmine.

  3. The risk evaluation of mine coal-dust explosion based on BP neural network

    Institute of Scientific and Technical Information of China (English)

    CHEN Lian-jun; CHENG Wei-min

    2007-01-01

    Introduced the theory of three types of hazardous sources, and it recognized and analysed such three types of hazardous sources as the factor of inherent hazardous source, factor of inducing hazardous source and factor of men, which affect the safety and reliability of coal-dust explosion risk system and then builds up the risk factor indices of coal-dust explosion according to analysis of conditions inducing the coal-dust explosion. It fixes the risk degree of coal-dust explosion risk system by analyzing loss probability and loss scope of risk system and by means of the probabilistic hazard evaluation method and risk matrix method, etc.. According to the feature of strong capability of nonlinear approximation of BP neural network, the paper designed the structure of BP neural network for the risk evaluation of the mine coal-dust explosion with BP neural network. And the weight of the network was finally determined by training the given samples so that the risk degree of samples to be measured could be exactly evaluated and the risk of mine coal-dust explosion could be alarmed in good time.

  4. Initial concepts on energetics and mass releases during nonnuclear explosive events in fuel cycle facilities

    International Nuclear Information System (INIS)

    Non-nuclear explosions are one of the initiating events (accidents) considered in the US Nuclear Regulatory Commission study of formal methods for estimating the airborne release of radionuclides from fuel cycle facilities. Methods currently available to estimate the energetics and mass airborne release from the four types of non-nuclear explosive events (fast and slow physical explosions and fast and slow chemical explosions) are reviewed. The likelihood that fast physical explosions will occur in fuel cycle facilities appears to be remote and this type of explosion is not considered. Methods to estimate the consequences of slow physical and fast chemical explosions are available. Methods to estimate the consequences of slow chemical explosions are less well defined

  5. Grain-size cycles in Salawusu River valley since 150 ka BP

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The palaeo-mobile dune sands and fluvio-lacustrine facies with palaeosols in Milanggouwan stratigraphic section of the Salawusu River valley situated at the southeast of the Mu Us Desert experienced abundant remarkable alternative changes of coarse and fine rhythms in grainsize since 150 ka BP, and the grain-size parameters - Mz, σ, Sk, Kg and SC/I also respond to the situation of multi-fluctuational alternations between peak and valley values. Simultaneity the grainsize eigenvalues - Ф5, Ф16, P25, Ф50, Ф75, Ф84 and Ф95 are respondingly manifested as greatly cadent jumpiness. Hereby, the Milanggouwan section can be divided into 27 grain-size coarse and fine sedimentary cycles, which can be regarded as a real and integreted record of climate-geological process of desert vicissitude resulted from the alternative evolvement of the ancient winter and summer monsoons of East Asia since 150 ka BP.

  6. Sedimentary cycles of trace elements in Salawusu River Valley since 150 ka BP

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The paper makes some analyses on 11 trace elements in the Milanggouwan stratigraphical section in the Salawusu River valley, which is regarded as a prototype geology-palaeoclimate record since 150 ka BP. The results show that the content and variation of trace elements has experienced remarkably regular changes in the pace with coarse and fine sedimentary cycles of palaeo-aeolian sands to its overlying fluvio-lacustrine facies or/and palaeosols. The trace elements with chemical properties of relatively active (V, Sr, Cu, Ni, As) and relatively stable (P, Pb, Rb, Mn, Nb, Zr) are a manifestation of the corresponding 27 changeable cycles between peak and valley values, appearing a multi-fluctuational process line of relative gathering and migration since then. The low numerical value distribution of these two types of trace elements in the aeolian sand facies represents erosion and accumulation under wind force during the cold-dry climate. Whereas their enrichments in both fluvio-lacustrine facies and palaeosols are related to the valley's special low-lying physiognomic position between the Ordos Plateau and the Loess Plateau under the warm and humid climate conditions. The above relatively migrated and gathered change of the trace elements is the result of 27 climatic cycles of cold-dry and warm-humid, which is probably caused by repeated alternations of winter monsoon and summer monsoon in the Mu Us Sandy Land influenced by the climate vicissitudes in northern hemisphere during glacial and interglacial periods since 150 ka BP.

  7. Explosion of limit cycles and chaotic waves in a simple nonlinear chemical system

    DEFF Research Database (Denmark)

    Brøns, Morten; Sturis, Jeppe

    2001-01-01

    A model of an autocatalytic chemical reaction was employed to study the explosion of limit cycles and chaotic waves in a nonlinear chemical system. The bifurcation point was determined using asymptotic analysis and perturbations. Scaling laws for amplitude and period were derived. A strong...

  8. The latest explosive eruptions of Ciomadul (Csomád) volcano, East Carpathians - A tephrostratigraphic approach for the 51-29 ka BP time interval

    Science.gov (United States)

    Karátson, D.; Wulf, S.; Veres, D.; Magyari, E. K.; Gertisser, R.; Timar-Gabor, A.; Novothny, Á.; Telbisz, T.; Szalai, Z.; Anechitei-Deacu, V.; Appelt, O.; Bormann, M.; Jánosi, Cs.; Hubay, K.; Schäbitz, F.

    2016-06-01

    The most recent, mainly explosive eruptions of Ciomadul, the youngest volcano in the Carpatho-Pannonian Region, have been constrained by detailed field volcanological studies, major element pumice glass geochemistry, luminescence and radiocarbon dating, and a critical evaluation of available geochronological data. These investigations were complemented by the first tephrostratigraphic studies of the lacustrine infill of Ciomadul's twin craters (St. Ana and Mohoş) that received tephra deposition during the last eruptions of the volcano. Our analysis shows that significant explosive activity, collectively called EPPA (Early Phreatomagmatic and Plinian Activity), started at Ciomadul in or around the present-day Mohoş, the older crater, at ≥ 51 ka BP. These eruptions resulted in a thick succession of pyroclastic-fall deposits found in both proximal and medial/distal localities around the volcano, characterized by highly silicic (rhyolitic) glass chemical compositions (ca. 75.2-79.8 wt.% SiO2). The EPPA stage was terminated by a subplinian/plinian eruption at ≥ 43 ka BP, producing pumiceous pyroclastic-fall and -flow deposits of similar glass composition, probably from a "Proto-St. Ana" vent located at or around the younger crater hosting the present-day Lake St. Ana. After a quiescent period with a proposed lava dome growth in the St. Ana crater, a new explosive stage began, defined as MPA (Middle Plinian Activity). In particular, a significant two-phase eruption occurred at ~ 31.5 ka BP, producing pyroclastic flows from vulcanian explosions disrupting the preexisting lava dome of Sf. Ana, and followed by pumiceous fallout from a plinian eruption column. Related pyroclastic deposits show a characteristic, less evolved rhyolitic glass composition (ca. 70.2-74.5 wt.% SiO2) and occur both in proximal and medial/distal localities up to 21 km from source. The MPA eruptions, that may have pre-shaped a crater similar to, but possibly smaller than, the present-day St

  9. Canard explosion of limit cycles in templator models of self-replication mechanisms

    DEFF Research Database (Denmark)

    Brøns, Morten

    2011-01-01

    Templators are differential equation models for self-replicating chemical systems. Beutel and Peacock-López [J. Chem. Phys. 126, 125104 (2007)]10.1063/1.2716396 have numerically analyzed a model for a cross-catalytic self-replicating system and found two cases of canard explosion, that is......, a substantial change of amplitude of a limit cycle over a very short parameter interval. We show how the model can be reduced to a two-dimensional system and how canard theory for slow-fast equations can be applied to yield analytic information about the canard explosion. In particular, simple expressions...... for the parameter value where the canard explosion occurs are obtained. The connection to mixed-mode oscillations also observed in the model is briefly discussed. © 2011 American Institute of Physics....

  10. Highly explosive eruption of the monogenetic 8.6 ka BP La Vache et Lassolas scoria cone complex (Chaîne des Puys, France)

    Science.gov (United States)

    Jordan, S. C.; Le Pennec, J.-L.; Gurioli, L.; Roche, O.; Boivin, P.

    2016-03-01

    The eruption of the trachy-basaltic La Vache and Lassolas cone complex was the youngest eruption (ca. 8.6 ka BP) and one of the most violent in the Chaîne des Puys, France. Here we present field data and results of grain size, componentry and clast density measurements of different layers of the widespread tephra deposit that is associated with this cone-forming eruption. Our data indicates five main eruption phases comprising a vent-opening phase, a second sustained highly explosive phase, a third and fourth violent Strombolian phase and a fifth dominantly effusive phase. The layer formed by the opening phase is rich in lithic material, which was previously considered to be the result of phreatomagmatic activity. The data presented here on the componentry and textures of the pyroclastic material contradict this hypothesis. We propose instead that the material of the basal layer results from fragmentation caused by the explosion of a first arriving gas-dominated phase. The variations in eruption intensity during the main eruption phases are interpreted here to be the result of gas segregation within the plumbing system and fluxes in the magma ascent rate during the eruption. Significant amount of gas segregation is indicated by the deposition of both gas-poor and gas-rich material and by the presence of plate tephra. This is also supported by the simultaneous ejection of tephra and lava from both cones during most of the explosive activity. We suggest that gas segregation occurred within shallow intrusions and that fresh ascending material in the main conduit mixed with degassed material that flow back into the conduit from the intrusion before fragmentation. The interaction of the ascending magma and the opening of intrusions may have controlled the evolution and explosivity of the eruption. The high explosivity at the beginning of the eruption and the wide dispersal area, demonstrate that scoria cone eruptions in monogenetic fields can impose a major threat to

  11. Ionization and Coulomb explosion of Xenon clusters by intense, few-cycle laser pulses

    CERN Document Server

    Mathur, D

    2010-01-01

    Intense, ultrashort pulses of 800 nm laser light (12 fs, $\\sim$4 optical cycles) of peak intensity 5$\\times$10$^{14}$ W cm$^{-2}$ have been used to irradiate gas-phase Xe$_n$ clusters ($n$=500-25,000) so as to induce multiple ionization and subsequent Coulomb explosion. Energy distributions of exploding ions are measured in the few-cycle domain that does not allow sufficient time for the cluster to undergo Coulomb-driven expansion. This results in overall dynamics that appear to be significantly different to those in the many-cycle regime. One manifestation is that the maximum ion energies are measured to be much lower than those obtained when longer pulses of the same intensity are used. Ion yields are cluster-size independent but polarization dependent in that they are significantly larger when the polarization is perpendicular to the detection axis than along it. This unexpected behavior is qualitatively rationalized in terms of a spatially anisotropic shielding effect induced by the electronic charge clou...

  12. C-terminal binding protein (CtBP activates the expression of E-box clock genes with CLOCK/CYCLE in Drosophila.

    Directory of Open Access Journals (Sweden)

    Taichi Q Itoh

    Full Text Available In Drosophila, CLOCK/CYCLE heterodimer (CLK/CYC is the primary activator of circadian clock genes that contain the E-box sequence in their promoter regions (hereafter referred to as "E-box clock genes". Although extensive studies have investigated the feedback regulation of clock genes, little is known regarding other factors acting with CLK/CYC. Here we show that Drosophila C-terminal binding protein (dCtBP, a transcriptional co-factor, is involved in the regulation of the E-box clock genes. In vivo overexpression of dCtBP in clock cells lengthened or abolished circadian locomotor rhythm with up-regulation of a subset of the E-box clock genes, period (per, vrille (vri, and PAR domain protein 1ε (Pdp1ε. Co-expression of dCtBP with CLK in vitro also increased the promoter activity of per, vri, Pdp1ε and cwo depending on the amount of dCtBP expression, whereas no effect was observed without CLK. The activation of these clock genes in vitro was not observed when we used mutated dCtBP which carries amino acid substitutions in NAD+ domain. These results suggest that dCtBP generally acts as a putative co-activator of CLK/CYC through the E-box sequence.

  13. Cycles of explosive and effusive eruptions at Kīlauea Volcano, Hawai‘i

    Science.gov (United States)

    Swanson, Don; Rose, Timothy R.; Mucek, Adonara E; Garcia, Michael O.; Fiske, Richard S.; Mastin, Larry G.

    2014-01-01

    The subaerial eruptive activity at Kīlauea Volcano (Hawai‘i) for the past 2500 yr can be divided into 3 dominantly effusive and 2 dominantly explosive periods, each lasting several centuries. The prevailing style of eruption for 60% of this time was explosive, manifested by repeated phreatic and phreatomagmatic activity in a deep summit caldera. During dominantly explosive periods, the magma supply rate to the shallow storage volume beneath the summit dropped to only a few percent of that during mainly effusive periods. The frequency and duration of explosive activity are contrary to the popular impression that Kīlauea is almost unceasingly effusive. Explosive activity apparently correlates with the presence of a caldera intersecting the water table. The decrease in magma supply rate may result in caldera collapse, because erupted or intruded magma is not replaced. Glasses with unusually high MgO, TiO2, and K2O compositions occur only in explosive tephra (and one related lava flow) and are consistent with disruption of the shallow reservoir complex during caldera formation. Kīlauea is a complex, modulated system in which melting rate, supply rate, conduit stability (in both mantle and crust), reservoir geometry, water table, and many other factors interact with one another. The hazards associated with explosive activity at Kīlauea’s summit would have major impact on local society if a future dominantly explosive period were to last several centuries. The association of lowered magma supply, caldera formation, and explosive activity might characterize other basaltic volcanoes, but has not been recognized.

  14. Integration of BpMADS4 on various linkage groups improves the utilization of the rapid cycle breeding system in apple.

    Science.gov (United States)

    Weigl, Kathleen; Wenzel, Stephanie; Flachowsky, Henryk; Peil, Andreas; Hanke, Magda-Viola

    2015-02-01

    Rapid cycle breeding in apple is a new approach for the rapid introgression of agronomically relevant traits (e.g. disease resistances) from wild apple species into domestic apple cultivars (Malus × domestica Borkh.). This technique drastically shortens the long-lasting juvenile phase of apple. The utilization of early-flowering apple lines overexpressing the BpMADS4 gene of the European silver birch (Betula pendula Roth.) in hybridization resulted in one breeding cycle per year. Aiming for the selection of non-transgenic null segregants at the end of the breeding process, the flower-inducing transgene and the gene of interest (e.g. resistance gene) that will be introgressed by hybridization need to be located on different chromosomes. To improve the flexibility of the existing approach in apple, this study was focused on the development and characterization of eleven additional BpMADS4 overexpressing lines of four different apple cultivars. In nine lines, the flowering gene was mapped to different linkage groups. The differences in introgressed T-DNA sequences and plant genome deletions post-transformation highlighted the unique molecular character of each line. However, transgenic lines demonstrated no significant differences in flower organ development and pollen functionality compared with non-transgenic plants. Hybridization studies using pollen from the fire blight-resistant wild species accession Malus fusca MAL0045 and the apple scab-resistant cultivar 'Regia' indicated that BpMADS4 introgression had no significant effect on the breeding value of each transgenic line.

  15. TopBP1和ATR-ATRIP在细胞周期中的作用及联系%Role and Relationship of TopBP1 and ATR-ATRIP in the Cell Life Cycle

    Institute of Scientific and Technical Information of China (English)

    黄神安; 熊高飞; 张吉翔

    2006-01-01

    TopBP1(topoisomerase Ⅱ beta-binding protein 1)和ATR(ataxia-telangiectasia mutated-and rad3-related)-ATRIP(ATR-interacting protein)通过调节一些因子在DNA损伤检控点(DNA damage checkpoint)中起着关键的作用,其中TopBP1可以激活ATR-ATRIP的复合体.文章着重阐述了TopBP1和ATR-ATRIP如何调控细胞周期并发挥其维护基因组完整性的作用.

  16. Comprehensive Characterization of Voids and Microstructure in TATB-based Explosives from 10 nm to 1 cm: Effects of Temperature Cycling and Compressive Creep

    Energy Technology Data Exchange (ETDEWEB)

    Willey, T M; Lauderbach, L; Gagliardi, F; Cunningham, B; Lorenz, K T; Lee, J I; van Buuren, T; Call, R; Landt, L; Overturf, G

    2010-02-26

    This paper outlines the characterization of voids and Microstructure in TATB-based Explosives over several orders of magnitude, from sizes on the order of 10 nm to about 1 cm. This is accomplished using ultra small angle x-ray scattering to investigate voids from a few nm to a few microns, ultra small angle neutron scattering for voids from 100 nm to 10 microns, and x-ray computed microtomography to investigate microstructure from a few microns to a few centimeters. The void distributions of LX-17 are outlined, and the microstructure of LX-17 is presented. Temperature cycling and compressive creep cause drastically different damage to the microstructure. Temperature cycling leads to a volume expansion (ratchet growth) in TATB-based explosives, and x-ray scattering techniques that are sensitive to sizes up to a few microns indicated changes to the void volume distribution that had previously accounted for most, but not all of the change in density. This paper presents the microstructural damage larger than a few microns caused by ratchet growth. Temperature cycling leads to void creation in the binder poor regions associated with the interior portion of formulated prills. Conversely, compressive creep causes characteristically different changes to microstructure; fissures form at binder-rich prill boundaries prior to mechanical failure.

  17. Primary explosives

    Energy Technology Data Exchange (ETDEWEB)

    Matyas, Robert; Pachman, Jiri [Pardubice Univ. (Czech Republic). Faculty of Chemical Technology

    2013-06-01

    The first chapter provides background such as the basics of initiation and differences between requirements on primary explosives used in detonators and igniters. The authors then clarify the influence of physical characteristics on explosive properties, focusing on those properties required for primary explosives. Furthermore, the issue of sensitivity is discussed. All the chapters on particular groups of primary explosives are structured in the same way, including introduction, physical and chemical properties, explosive properties, preparation and documented use.

  18. Tracing the Cycling and Fate of the Explosive 2,4,6-Trinitrotoluene in Coastal Marine Systems with a Stable Isotopic Tracer, (15)N-[TNT].

    Science.gov (United States)

    Smith, Richard W; Vlahos, Penny; Böhlke, J K; Ariyarathna, Thivanka; Ballentine, Mark; Cooper, Christopher; Fallis, Stephen; Groshens, Thomas J; Tobias, Craig

    2015-10-20

    2,4,6-Trinitrotoluene (TNT) has been used as a military explosive for over a hundred years. Contamination concerns have arisen as a result of manufacturing and use on a large scale; however, despite decades of work addressing TNT contamination in the environment, its fate in marine ecosystems is not fully resolved. Here we examine the cycling and fate of TNT in the coastal marine systems by spiking a marine mesocosm containing seawater, sediments, and macrobiota with isotopically labeled TNT ((15)N-[TNT]), simultaneously monitoring removal, transformation, mineralization, sorption, and biological uptake over a period of 16 days. TNT degradation was rapid, and we observed accumulation of reduced transformation products dissolved in the water column and in pore waters, sorbed to sediments and suspended particulate matter (SPM), and in the tissues of macrobiota. Bulk δ(15)N analysis of sediments, SPM, and tissues revealed large quantities of (15)N beyond that accounted for in identifiable derivatives. TNT-derived N was also found in the dissolved inorganic N (DIN) pool. Using multivariate statistical analysis and a (15)N mass balance approach, we identify the major transformation pathways of TNT, including the deamination of reduced TNT derivatives, potentially promoted by sorption to SPM and oxic surface sediments. PMID:26375037

  19. Autophagy regulates T lymphocyte proliferation through selective degradation of the cell-cycle inhibitor CDKN1B/p27Kip1.

    Science.gov (United States)

    Jia, Wei; He, Ming-Xiao; McLeod, Ian X; Guo, Jian; Ji, Dong; He, You-Wen

    2015-01-01

    The highly conserved cellular degradation pathway, macroautophagy, regulates the homeostasis of organelles and promotes the survival of T lymphocytes. Previous results indicate that Atg3-, Atg5-, or Pik3c3/Vps34-deficient T cells cannot proliferate efficiently. Here we demonstrate that the proliferation of Atg7-deficient T cells is defective. By using an adoptive transfer and Listeria monocytogenes (LM) mouse infection model, we found that the primary immune response against LM is intrinsically impaired in autophagy-deficient CD8(+) T cells because the cell population cannot expand after infection. Autophagy-deficient T cells fail to enter into S-phase after TCR stimulation. The major negative regulator of the cell cycle in T lymphocytes, CDKN1B, is accumulated in autophagy-deficient naïve T cells and CDKN1B cannot be degraded after TCR stimulation. Furthermore, our results indicate that genetic deletion of one allele of CDKN1B in autophagy-deficient T cells restores proliferative capability and the cells can enter into S-phase after TCR stimulation. Finally, we found that natural CDKN1B forms polymers and is physiologically associated with the autophagy receptor protein SQSTM1/p62 (sequestosome 1). Collectively, autophagy is required for maintaining the expression level of CDKN1B in naïve T cells and selectively degrades CDKN1B after TCR stimulation.

  20. Mechanism of Sea Level Change at the Earth Orbital Parameter Cycles during the Last 2 Ma BP%近2 Ma BP 以来地球轨道参数周期上全球海平面变化机制

    Institute of Scientific and Technical Information of China (English)

    李文宝; 王汝建

    2016-01-01

    stacked RSL and atmospheric CO 2 concentration,sea surface temperature (SST)in middle-high latitudinal oceans and benthic oxygen isotope (δ1 8 O B )record are separately discussed in detail.The results show that:(1)the new stacked RSL has the similar change trend to the original RSL records during the last 2 Ma BP,and the correlation coefficients are all nearly 0.9.Meanwhile,the new stacked RSL also responds well to the global climate change events at the earth orbital parameter cy-cles;(2)The new stacked RSL and LR04-δ1 8 O B have high negative correlation in glacial-interglacial cycles during the last 2 Ma BP,with the correlation coefficient of about 0.81,which is much higher than those of the new stacked RSL with SST and at-mospheric CO 2 concentration;(3)Based on the cross-spectral analytical results between the new stacked RSL and CO 2 ,SST andδ1 8 O B ,individually,the new stacked RSL is nearly in phase withδ1 8 O B ,and both lags SST and CO 2 at the eccentricity band,and lags SST but leads CO 2 at the obliquity band.It is concluded that the polar ice sheet volume was influenced by chan-ges of SST and atmospheric CO 2 concentration,which might be caused by the change of solar insolation and finally influenced the sea level change at the earth orbital parameter cycles.

  1. Explosive laser

    International Nuclear Information System (INIS)

    This patent relates to a laser system wherein reaction products from the detonation of a condensed explosive expand to form a gaseous medium with low translational temperature but high vibration population. Thermal pumping of the upper laser level and de-excitation of the lower laser level occur during the expansion, resulting in a population inversion. The expansion may be free or through a nozzle as in a gas-dynamic configuration. In one preferred embodiment, the explosive is such that its reaction products are CO2 and other species that are beneficial or at least benign to CO2 lasing

  2. Explosive complexes

    Science.gov (United States)

    Huynh, My Hang V.

    2009-09-22

    Lead-free primary explosives of the formula [M.sup.II(A).sub.R(B.sup.X).sub.S](C.sup.Y).sub.T, where A is 1,5-diaminotetrazole, and syntheses thereof are described. Substantially stoichiometric equivalents of the reactants lead to high yields of pure compositions thereby avoiding dangerous purification steps.

  3. Niche explosion.

    Science.gov (United States)

    Normark, Benjamin B; Johnson, Norman A

    2011-05-01

    The following syndrome of features occurs in several groups of phytophagous insects: (1) wingless females, (2) dispersal by larvae, (3) woody hosts, (4) extreme polyphagy, (5) high abundance, resulting in status as economic pests, (6) invasiveness, and (7) obligate parthenogenesis in some populations. If extreme polyphagy is defined as feeding on 20 or more families of hostplants, this syndrome is found convergently in several species of bagworm moths, tussock moths, root weevils, and 5 families of scale insects. We hypothesize that extreme polyphagy in these taxa results from "niche explosion", a positive feedback loop connecting large population size to broad host range. The niche explosion has a demographic component (sometimes called the "amplification effect" in studies of pathogens) as well as a population-genetic component, due mainly to the increased effectiveness of natural selection in larger populations. The frequent origins of parthenogenesis in extreme polyphages are, in our interpretation, a consequence of this increased effectiveness of natural selection and consequent reduced importance of sexuality. The niche explosion hypothesis makes detailed predictions about the comparative genomics and population genetics of extreme polyphages and related specialists. It has a number of potentially important implications, including an explanation for the lack of observed trade-offs between generalists and specialists, a re-interpretation of the ecological correlates of parthenogenesis, and a general expectation that Malthusian population explosions may be amplified by Darwinian effects.

  4. 78 FR 64246 - Commerce in Explosives; List of Explosives Materials

    Science.gov (United States)

    2013-10-28

    ... isomorphously substituted inorganic salts. *ANFO . Aromatic nitro-compound explosive mixtures. Azide explosives.... Explosive mixtures containing tetranitromethane (nitroform). Explosive nitro compounds of aromatic... polyhydric alcohol explosives. Nitric acid and a nitro aromatic compound explosive. Nitric acid...

  5. Leidenfrost explosions

    CERN Document Server

    Moreau, F; Dorbolo, S

    2012-01-01

    We present a fluid dynamics video showing the behavior of Leidenfrost droplets composed by a mixture of water and surfactant (SDS, Sodium Dodecyl sulfate). When a droplet is released on a plate heated above a given temperature a thin layer of vapor isolates the droplet from the plate. The droplet levitates over the plate. This is called the Leidenfrost effect. In this work we study the influence of the addition of a surfactant on the Leidenfrost phenomenon. As the droplet evaporates the concentration of SDS rises up to two orders of magnitude over the Critical Micelle Concentration (CMC). An unexpected and violent explosive behavior is observed. The video presents several explosions taken with a high speed camera (IDT-N4 at 30000 fps). All the presented experiments were performed on a plate heated at 300{\\deg}C. On the other hand, the initial quantity of SDS was tuned in two ways: (i) by varying the initial concentration of SDS and (ii) by varying the initial size of the droplet. By measuring the volume of th...

  6. Un fusible de méthane pour l'explosion cambrienne : les cycles du carbone et dérive des pôles

    Science.gov (United States)

    Kirschvink, Joseph L.; Raub, Timothy D.

    2003-01-01

    The dramatic diversification of animal groups known as the Cambrian Explosion (evolution's 'Big Bang') remains an unsolved puzzle in Earth Science. The Vendian-Cambrian interval is characterized by anomalously high rates of apparent plate motion, interpreted as True Polar Wander (TPW), and by more than a dozen large, high-frequency perturbations in carbon isotopes that dwarf all others observed through the past 65 million years. We suggest that these biological, tectonic, and geochemical events are intimately related in the following fashion. First, tropical continental margins and shelf-slopes which formed during fragmentation of the supercontinent Rodinia accumulated massive quantities of isotopically-light organic carbon during Late Neoproterozoic time, as indicated by strikingly heavy isotope ratios in inorganic carbon during interglacial intervals. Second, an initial phase of Vendian TPW moved these organic-rich deposits to high latitude, where conditions favored trapping biogenic methane in layers of gas hydrate and perhaps permafrost. Continued sedimentation during Late Vendian time added additional hydrate/gas storage volume and stabilized underlying units until the geothermal gradient moved them out of the clathrate stability field, building up deep reservoirs of highly pressurized methane. Finally, a burst of TPW brought these deposits back to the Tropics, where they gradually warmed and were subjected to regional-scale thermohaline eddy variation and related sedimentation regime changes. Responding to the stochastic character of such changes, each reservoir reached a critical failure point independently at times throughout the Cambrian. By analogy with the Late Paleocene Thermal Maximum event, these methane deposits yield transient, greenhouse-induced pulses of global warming when they erupt. Temperature correlates powerfully with biodiversity; the biochemical kinetics of metabolism at higher temperature decrease generation time and maintain relatively

  7. Chaotic Explosions

    CERN Document Server

    Altmann, Eduardo G; Tél, Tamás

    2015-01-01

    We investigate chaotic dynamical systems for which the intensity of trajectories might grow unlimited in time. We show that (i) the intensity grows exponentially in time and is distributed spatially according to a fractal measure with an information dimension smaller than that of the phase space,(ii) such exploding cases can be described by an operator formalism similar to the one applied to chaotic systems with absorption (decaying intensities), but (iii) the invariant quantities characterizing explosion and absorption are typically not directly related to each other, e.g., the decay rate and fractal dimensions of absorbing maps typically differ from the ones computed in the corresponding inverse (exploding) maps. We illustrate our general results through numerical simulation in the cardioid billiard mimicking a lasing optical cavity, and through analytical calculations in the baker map.

  8. Extrusion cast explosive

    Science.gov (United States)

    Scribner, Kenneth J.

    1985-01-01

    Improved, multiphase, high performance, high energy, extrusion cast explosive compositions, comprising, a crystalline explosive material; an energetic liquid plasticizer; a urethane prepolymer, comprising a blend of polyvinyl formal, and polycaprolactone; a polyfunctional isocyanate; and a catalyst are disclosed. These new explosive compositions exhibit higher explosive content, a smooth detonation front, excellent stability over long periods of storage, and lower sensitivity to mechanical stimulants.

  9. Chemical profiling of explosives

    NARCIS (Netherlands)

    G.M.H. Brust

    2014-01-01

    The primary goal of this thesis is to develop analytical methods for the chemical profiling of explosives. Current methodologies for the forensic analysis of explosives focus on identification of the explosive material. However, chemical profiling of explosives becomes increasingly important, as thi

  10. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    Energy Technology Data Exchange (ETDEWEB)

    Kanginakudru, Sriramana, E-mail: skangina@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); DeSmet, Marsha, E-mail: mdesmet@iupui.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Thomas, Yanique, E-mail: ysthomas@umail.iu.edu [Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States); Morgan, Iain M., E-mail: immorgan@vcu.edu [VCU Philips Institute for Oral Health Research, Virginia Commonwealth University, Richmond, Virginia (United States); Androphy, Elliot J., E-mail: eandro@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States)

    2015-04-15

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication.

  11. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    International Nuclear Information System (INIS)

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication

  12. Understanding vented gas explosions

    Energy Technology Data Exchange (ETDEWEB)

    Lautkaski, R. [VTT Energy, Espoo (Finland). Energy Systems

    1997-12-31

    The report is an introduction to vented gas explosions for nonspecialists, particularly designers of plants for flammable gases and liquids. The phenomena leading to pressure generation in vented gas explosions in empty and congested rooms are reviewed. The four peak model of vented gas explosions is presented with simple methods to predict the values of the individual peaks. Experimental data on the external explosion of dust and gas explosions is discussed. The empirical equation relating the internal and external peak pressures in vented dust explosions is shown to be valid for gas explosion tests in 30 m{sup 3} and 550 m{sup 3} chambers. However, the difficulty of predicting the internal peak pressure in large chambers remains. Methods of explosion relief panel design and principles of vent and equipment layout to reduce explosion overpressures are reviewed. (orig.) 65 refs.

  13. 76 FR 64974 - Commerce in Explosives; List of Explosive Materials (2011R-18T)

    Science.gov (United States)

    2011-10-19

    ... inorganic salts. * ANFO . Aromatic nitro-compound explosive mixtures. Azide explosives. B Baranol. Baratol...). Explosive nitro compounds of aromatic hydrocarbons. Explosive organic nitrate mixtures. Explosive powders. F... explosive. Nitrated polyhydric alcohol explosives. Nitric acid and a nitro aromatic compound...

  14. 75 FR 1085 - Commerce in Explosives; List of Explosive Materials (2009R-18T)

    Science.gov (United States)

    2010-01-08

    .... *ANFO . Aromatic nitro-compound explosive mixtures. Azide explosives. B Baranol. Baratol. BEAF . Black...). Explosive nitro compounds of aromatic hydrocarbons. Explosive organic nitrate mixtures. Explosive powders. F... explosive. Nitrated polyhydric alcohol explosives. Nitric acid and a nitro aromatic compound...

  15. Convergence of BP Algorithm for Training MLP with Linear Output

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The capability of multilayer perceptrons (MLPs) for approximating continuous functions with arbitrary accuracy has been demonstrated in the past decades. Back propagation (BP) algorithm is the most popular learning algorithm for training of MLPs. In this paper, a simple iteration formula is used to select the learning rate for each cycle of training procedure, and a convergence result is presented for the BP algorithm for training MLP with a hidden layer and a linear output unit. The monotonicity of the error function is also guaranteed during the training iteration.

  16. Explosive Technology Group

    Data.gov (United States)

    Federal Laboratory Consortium — The Explosive Technology Group (ETG) provides diverse technical expertise and an agile, integrated approach to solve complex challenges for all classes of energetic...

  17. Prognostic Importance of Cell Cycle Regulators Cyclin D1 (CCND1) and Cyclin-Dependent Kinase Inhibitor 1B (CDKN1B/p27) in Sporadic Gastric Cancers

    Science.gov (United States)

    Minarikova, Petra; Halkova, Tereza; Belsanova, Barbora; Tuckova, Inna; Belina, Frantisek; Dusek, Ladislav; Zavoral, Miroslav

    2016-01-01

    Background. Gastric cancer is known for a notable variety in the course of the disease. Clinical factors, such as tumor stage, grade, and localization, are key in patient survival. It is expected that molecular factors such as somatic mutations and gene amplifications are also underlying tumor biological behavior and may serve as factors for prognosis estimation. Aim. The purpose of this study was to examine gene amplifications from a panel of genes to uncover potential prognostic marker candidates. Methods. A panel of gene amplifications including 71 genes was tested by multiplex ligation-dependent probe amplification (MLPA) technique in 76 gastric cancer samples from a Caucasian population. The correlation of gene amplification status with patient survival was determined by the Kaplan-Meier method. Results. The amplification of two cell cycle regulators, CCND1 and CDKN1B, was identified to have a negative prognostic role. The medial survival of patients with gastric cancer displaying amplification compared to patients without amplification was 192 versus 725 days for CCND1 (P = 0.0012) and 165 versus 611 days for CDKN1B (P = 0.0098). Conclusion. Gene amplifications of CCND1 and CDKN1B are potential candidates to serve as prognostic markers for the stratification of patients based on the estimate of survival in the management of gastric cancer patients.

  18. Steam explosion studies review

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, Moon Kyu; Kim, Hee Dong

    1999-03-01

    When a cold liquid is brought into contact with a molten material with a temperature significantly higher than the liquid boiling point, an explosive interaction due to sudden fragmentation of the melt and rapid evaporation of the liquid may take place. This phenomenon is referred to as a steam explosion or vapor explosion. Depending upon the amount of the melt and the liquid involved, the mechanical energy released during a vapor explosion can be large enough to cause serious destruction. In hypothetical severe accidents which involve fuel melt down, subsequent interactions between the molten fuel and coolant may cause steam explosion. This process has been studied by many investigators in an effort to assess the likelihood of containment failure which leads to large scale release of radioactive materials to the environment. In an effort to understand the phenomenology of steam explosion, extensive studies has been performed so far. The report presents both experimental and analytical studies on steam explosion. As for the experimental studies, both small scale tests which involve usually less than 20 g of high temperature melt and medium/large scale tests which more than 1 kg of melt is used are reviewed. For the modelling part of steam explosions, mechanistic modelling as well as thermodynamic modelling is reviewed. (author)

  19. Steam explosion studies review

    International Nuclear Information System (INIS)

    When a cold liquid is brought into contact with a molten material with a temperature significantly higher than the liquid boiling point, an explosive interaction due to sudden fragmentation of the melt and rapid evaporation of the liquid may take place. This phenomenon is referred to as a steam explosion or vapor explosion. Depending upon the amount of the melt and the liquid involved, the mechanical energy released during a vapor explosion can be large enough to cause serious destruction. In hypothetical severe accidents which involve fuel melt down, subsequent interactions between the molten fuel and coolant may cause steam explosion. This process has been studied by many investigators in an effort to assess the likelihood of containment failure which leads to large scale release of radioactive materials to the environment. In an effort to understand the phenomenology of steam explosion, extensive studies has been performed so far. The report presents both experimental and analytical studies on steam explosion. As for the experimental studies, both small scale tests which involve usually less than 20 g of high temperature melt and medium/large scale tests which more than 1 kg of melt is used are reviewed. For the modelling part of steam explosions, mechanistic modelling as well as thermodynamic modelling is reviewed. (author)

  20. Explosions and static electricity

    DEFF Research Database (Denmark)

    Jonassen, Niels M

    1995-01-01

    The paper deals with the problem of electrostatic discharges as causes of ignition of vapor/gas and dust/gas mixtures. A series of examples of static-caused explosions will be discussed. The concepts of explosion limits, the incendiveness of various discharge types and safe voltages are explained...

  1. Shock Initiation of Damaged Explosives

    Energy Technology Data Exchange (ETDEWEB)

    Chidester, S K; Vandersall, K S; Tarver, C M

    2009-10-22

    Explosive and propellant charges are subjected to various mechanical and thermal insults that can increase their sensitivity over the course of their lifetimes. To quantify this effect, shock initiation experiments were performed on mechanically and thermally damaged LX-04 (85% HMX, 15% Viton by weight) and PBX 9502 (95% TATB, 5% Kel-F by weight) to obtain in-situ manganin pressure gauge data and run distances to detonation at various shock pressures. We report the behavior of the HMX-based explosive LX-04 that was damaged mechanically by applying a compressive load of 600 psi for 20,000 cycles, thus creating many small narrow cracks, or by cutting wedge shaped parts that were then loosely reassembled, thus creating a few large cracks. The thermally damaged LX-04 charges were heated to 190 C for long enough for the beta to delta solid - solid phase transition to occur, and then cooled to ambient temperature. Mechanically damaged LX-04 exhibited only slightly increased shock sensitivity, while thermally damaged LX-04 was much more shock sensitive. Similarly, the insensitive explosive PBX 9502 was mechanically damaged using the same two techniques. Since PBX 9502 does not undergo a solid - solid phase transition but does undergo irreversible or 'rachet' growth when thermally cycled, thermal damage to PBX 9502 was induced by this procedure. As for LX-04, the thermally damaged PBX 9502 demonstrated a greater shock sensitivity than mechanically damaged PBX 9502. The Ignition and Growth reactive flow model calculated the increased sensitivities by igniting more damaged LX-04 and PBX 9502 near the shock front based on the measured densities (porosities) of the damaged charges.

  2. Research topics in explosives - a look at explosives behaviors

    International Nuclear Information System (INIS)

    The behaviors of explosives under many conditions - e.g., sensitivity to inadvertent reactions, explosion, detonation - are controlled by the chemical and physical properties of the explosive materials. Several properties are considered for a range of improvised and conventional explosives. Here I compare these properties across a wide range of explosives to develop an understanding of explosive behaviors. For improvised explosives, which are generally heterogeneous mixtures of ingredients, a range of studies is identified as needed to more fully understand their behavior and properties. For conventional explosives, which are generally comprised of crystalline explosive molecules held together with a binder, I identify key material properties that determine overall sensitivity, including the extremely safe behavior of Insensitive High Explosives, and discuss an approach to predicting the sensitivity or insensitivity of an explosive.

  3. Influence of BP Ultimate on engine cleanliness

    OpenAIRE

    Mieghem, R.S.P. van

    2007-01-01

    During early 2005, BP introduced two new fuels in the Netherlands. These new products are called BP Ultimate 98 Unleaded and BP Ultimate Diesel. These fuels were formulated to offer several benefits compared to ordinary fuels, specifically in engine cleanliness. TNO was asked to evaluate the test results from BP, examine the stated claims and, if proven, to give a specific endorsement of calculated claims of the product(s). In order to understand the performed research and the arising conclus...

  4. Lake-expanding events in the Tibetan Plateau since 40 kaBP

    Institute of Scientific and Technical Information of China (English)

    贾玉连; 施雅风; 王苏民; 蒋雪中; 李世杰; 王爱军; 李徐生

    2001-01-01

    Since 40 kaBP, the current endorheism on the Tibetan Plateau had experienced at least four lake-expanding events, at 40-28 kaBP, 19-15 kaBP, 13-11 kaBP, 9.0-5.0 kaBP, respectively. The 40-28 kaBP and 9.0-5.0 kaBP lake-expanding events, corresponding to the global warming periods, were mainly determined by the abundant summer monsoon rainfall brought by strong Indian monsoon, aroused by enhanced solar radiation at earth orbital precessional cycle. The 40-28 kaBP lake-expanding event, also called the great lake period or the pan-lake period, for several great lake groups had come into being by the interconnection of the presently isolated and closed lake catchments. The total lake area over the Tibetan Plateau was estimated at least up to 150000 km2, 3.8 times of the present, and the lake supply coefficients were about 3-10. The 9.0-5.0 kaBP lake-expanding, with a total lake area of 68000 km2, less than the above mentioned reflected the Indian monsoon rainfall less than that of 40-28 kaBP. The expanded lak

  5. Liquid explosives detection

    Science.gov (United States)

    Burnett, Lowell J.

    1994-03-01

    A Liquid Explosives Screening System capable of scanning unopened bottles for liquid explosives has been developed. The system can be operated to detect specific explosives directly, or to verify the labeled or bar-coded contents of the container. In this system nuclear magnetic resonance (NMR) is used to interrogate the liquid. NMR produces an extremely rich data set and many parameters of the NMR response can be determined simultaneously. As a result, multiple NMR signatures may be defined for any given set of liquids, and the signature complexity then selected according to the level of threat.

  6. Explosive Components Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The 98,000 square foot Explosive Components Facility (ECF) is a state-of-the-art facility that provides a full-range of chemical, material, and performance analysis...

  7. Intermittent Explosive Disorder

    Directory of Open Access Journals (Sweden)

    Lut Tamam

    2011-09-01

    Full Text Available Intermittent explosive disorder is an impulse control disorder characterized by the occurrence of discrete episodes of failure to resist aggressive impulses that result in violent assault or destruction of property. Though the prevalence intermittent explosive disorder has been reported to be relatively rare in frontier studies on the field, it is now common opinion that intermittent explosive disorder is far more common than previously thought especially in clinical psychiatry settings. Etiological studies displayed the role of both psychosocial factors like childhood traumas and biological factors like dysfunctional neurotransmitter systems and genetics. In differential diagnosis of the disorder, disorders involving agression as a symptom such as alcohol and drug intoxication, antisocial and borderline personality disorders, personality changes due to general medical conditions and behavioral disorder should be considered. A combination of pharmacological and psychotherapeutic approaches are suggested in the treatment of the disorder. This article briefly reviews the historical background, diagnostic criteria, epidemiology, etiology and treatment of intermittent explosive disorder.

  8. Shock waves & explosions

    CERN Document Server

    Sachdev, PL

    2004-01-01

    Understanding the causes and effects of explosions is important to experts in a broad range of disciplines, including the military, industrial and environmental research, aeronautic engineering, and applied mathematics. Offering an introductory review of historic research, Shock Waves and Explosions brings analytic and computational methods to a wide audience in a clear and thorough way. Beginning with an overview of the research on combustion and gas dynamics in the 1970s and 1980s, the author brings you up to date by covering modeling techniques and asymptotic and perturbative methods and ending with a chapter on computational methods.Most of the book deals with the mathematical analysis of explosions, but computational results are also included wherever they are available. Historical perspectives are provided on the advent of nonlinear science, as well as on the mathematical study of the blast wave phenomenon, both when visualized as a point explosion and when simulated as the expansion of a high-pressure ...

  9. Modeling nuclear explosion

    Science.gov (United States)

    Redd, Jeremy; Panin, Alexander

    2012-10-01

    As a result of the Nuclear Test Ban Treaty, no nuclear explosion tests have been performed by the US since 1992. This appreciably limits valuable experimental data needed for improvement of existing weapons and development of new ones, as well as for use of nuclear devices in non-military applications (such as making underground oil reservoirs or compressed air energy storages). This in turn increases the value of numerical modeling of nuclear explosions and of their effects on the environment. We develop numerical codes simulating fission chain reactions in a supercritical U and Pu core and the dynamics of the subsequent expansion of generated hot plasma in order to better understand the impact of such explosions on their surroundings. The results of our simulations (of both above ground and underground explosions) of various energy yields are presented.

  10. Parametric Explosion Spectral Model

    Energy Technology Data Exchange (ETDEWEB)

    Ford, S R; Walter, W R

    2012-01-19

    Small underground nuclear explosions need to be confidently detected, identified, and characterized in regions of the world where they have never before occurred. We develop a parametric model of the nuclear explosion seismic source spectrum derived from regional phases that is compatible with earthquake-based geometrical spreading and attenuation. Earthquake spectra are fit with a generalized version of the Brune spectrum, which is a three-parameter model that describes the long-period level, corner-frequency, and spectral slope at high-frequencies. Explosion spectra can be fit with similar spectral models whose parameters are then correlated with near-source geology and containment conditions. We observe a correlation of high gas-porosity (low-strength) with increased spectral slope. The relationship between the parametric equations and the geologic and containment conditions will assist in our physical understanding of the nuclear explosion source.

  11. Aging of civil explosives (Poster)

    NARCIS (Netherlands)

    Krabbendam-La Haye, E.L.M.; Klerk, W.P.C. de; Hoen, C. 't; Krämer, R.E.

    2014-01-01

    For the Dutch MoD and police, TNO composed sets with different kinds of civil explosives to train their detection dogs. The manufacturer of these explosives guarantees several years of stability of these explosives. These sets of explosives are used under different conditions, like temperature and h

  12. Modelling of gas explosions

    OpenAIRE

    Vågsæther, Knut

    2010-01-01

    The content of this thesis is a study of gas explosions in complex geometries and presentation and validation of a method for simulating flame acceleration and deflagration to detonation transition. The thesis includes a description of the mechanisms of flame acceleration and DDT that need to be modeled when simulating all stages of gas explosions. These mechanisms are flame acceleration due to instabilities that occur in fluid flow and reactive systems, shock propagation, deflagration to det...

  13. Explosive Welding with Nitroguanidine.

    Science.gov (United States)

    Sadwin, L D

    1964-03-13

    By using the explosive nitroguanidine, continuous welds can be made between similar and dissimilar metals. Since low detonation pressures are attainable, pressure transfer media are not required between the explosive and the metal surface. The need for either a space or an angle between the metals is eliminated, and very low atmospheric pressures are not required. Successful welds have been made between tantalum and 4140 steel, 3003H14 aluminum and 4140 steel, and 304 stainless steel and 3003H14 aluminum.

  14. Chemical Explosion Database

    Science.gov (United States)

    Johansson, Peder; Brachet, Nicolas

    2010-05-01

    A database containing information on chemical explosions, recorded and located by the International Data Center (IDC) of the CTBTO, should be established in the IDC prior to entry into force of the CTBT. Nearly all of the large chemical explosions occur in connection with mining activity. As a first step towards the establishment of this database, a survey of presumed mining areas where sufficiently large explosions are conducted has been done. This is dominated by the large coal mining areas like the Powder River (U.S.), Kuznetsk (Russia), Bowen (Australia) and Ekibastuz (Kazakhstan) basins. There are also several other smaller mining areas, in e.g. Scandinavia, Poland, Kazakhstan and Australia, with large enough explosions for detection. Events in the Reviewed Event Bulletin (REB) of the IDC that are located in or close to these mining areas, and which therefore are candidates for inclusion in the database, have been investigated. Comparison with a database of infrasound events has been done as many mining blasts generate strong infrasound signals and therefore also are included in the infrasound database. Currently there are 66 such REB events in 18 mining areas in the infrasound database. On a yearly basis several hundreds of events in mining areas have been recorded and included in the REB. Establishment of the database of chemical explosions requires confirmation and ground truth information from the States Parties regarding these events. For an explosion reported in the REB, the appropriate authority in whose country the explosion occurred is encouraged, on a voluntary basis, to seek out information on the explosion and communicate this information to the IDC.

  15. Underground explosion barriers - a review

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, B.; O`Beirne, T. [ACIRL Ltd., Booval, Qld. (Australia)

    1997-12-31

    The paper focuses on explosibility conditions in underground coal mines, the behaviour of explosions from initiating gas ignition to violent dust explosions and the effectiveness and limits of operation of current designs of passive explosion barriers in suppressing the flame front. The paper also discusses performance evaluations made in full scale explosion galleries and the use of alternatives to passive barriers, including the installation of active barriers under some circumstances.

  16. Magnetospheric accretion on the T Tauri star BP Tauri

    CERN Document Server

    Donati, J F; Gregory, S G; Petit, P; Paletou, F; Bouvier, J; Dougados, C; Ménard, F; Cameron, A C; Harries, T J; Hussain, G A J; Unruh, Y; Morin, J; Marsden, S C; Manset, N; Aurière, M; Catala, C; Alecian, E

    2008-01-01

    From observations collected with the ESPaDOnS and NARVAL spectropolarimeters, we report the detection of Zeeman signatures on the classical T Tauri star BP Tau. Circular polarisation signatures in photospheric lines and in narrow emission lines tracing magnetospheric accretion are monitored throughout most of the rotation cycle of BP Tau at two different epochs in 2006. We observe that rotational modulation dominates the temporal variations of both unpolarised and circularly polarised spectral proxies tracing the photosphere and the footpoints of accretion funnels. From the complete data sets at each epoch, we reconstruct the large-scale magnetic topology and the location of accretion spots at the surface of BP Tau using tomographic imaging. We find that the field of BP Tau involves a 1.2 kG dipole and 1.6 kG octupole, both slightly tilted with respect to the rotation axis. Accretion spots coincide with the two main magnetic poles at high latitudes and overlap with dark photospheric spots; they cover about 2%...

  17. Interactions of the human MCM-BP protein with MCM complex components and Dbf4.

    Directory of Open Access Journals (Sweden)

    Tin Nguyen

    Full Text Available MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.

  18. Big Data and Cycling

    NARCIS (Netherlands)

    Romanillos, Gustavo; Zaltz Austwick, Martin; Ettema, Dick; De Kruijf, Joost

    2016-01-01

    Big Data has begun to create significant impacts in urban and transport planning. This paper covers the explosion in data-driven research on cycling, most of which has occurred in the last ten years. We review the techniques, objectives and findings of a growing number of studies we have classified

  19. Explosive Welding with Nitroguanidine.

    Science.gov (United States)

    Sadwin, L D

    1964-03-13

    By using the explosive nitroguanidine, continuous welds can be made between similar and dissimilar metals. Since low detonation pressures are attainable, pressure transfer media are not required between the explosive and the metal surface. The need for either a space or an angle between the metals is eliminated, and very low atmospheric pressures are not required. Successful welds have been made between tantalum and 4140 steel, 3003H14 aluminum and 4140 steel, and 304 stainless steel and 3003H14 aluminum. PMID:17833901

  20. Presentation of the Central Office for the Suppression of Trafficking in Arms, Explosives and Sensitive Materials, OCRTAEMS [International conference on safety and security of radioactive sources: Towards a global system for the continuous control of sources throughout their life cycle

    International Nuclear Information System (INIS)

    The Central Office for the Suppression of Trafficking in Arms, Explosives and Sensitive Materials (OCRTAEMS) was created on 13 December 1982. For around twenty years it was no more than a simple group within the Anti-Terrorist Division of the Central Directorate of the Criminal Police (DCPJ). At that time, it was almost exclusively terrorists who had recourse to explosives and weapons of war, hence the name. In April 2002, following the Nanterre massacre (March 2002), where a mad marksman decimated the Municipal Council of the town during a meeting, it was decided to reactivate this office. Its mandate was also redefined to cover general suppression of arms trafficking, whatever the area of crime: organized crime, common law crime, terrorism, crime in sensitive areas, etc. The arms office was removed from the National Anti-Terrorist Division (DNAT) and became a separate office directly under the Subdirectorate for Criminal Affairs. The number of its staff was set at 30. Its function is to promote and coordinate the fight against crime relating to the manufacture and possession of, trading in and illicit use of weapons, ammunition, explosives and sensitive materials (nuclear, radiological, biological and chemical). Its structure is traditional and comprises two inquiry groups, one technical and legal analysis unit and an operational documentation section. It has a ballistics and weapons expert, an explosives specialist and a nuclear, radiological, biological and chemical threat consultant. French investigation procedures and technical resources are discussed. International tensions and the current terrorist situation have prompted the security services to include all kinds of attack hypotheses in their prevention or response plans. The information services (Directorate for National Surveillance or General Information) are responsible at the Ministry of the Interior for collecting information which may be subject to judicial use by such specialized services as the

  1. 77 FR 58410 - Commerce in Explosives; List of Explosive Materials (2012R-10T)

    Science.gov (United States)

    2012-09-20

    ... salt lattice with isomorphously substituted inorganic salts. * ANFO . Aromatic nitro-compound explosive.... Explosive mixtures containing tetranitromethane (nitroform). Explosive nitro compounds of aromatic... polyhydric alcohol explosives. Nitric acid and a nitro aromatic compound explosive. Nitric acid...

  2. 75 FR 70291 - Commerce in Explosives; List of Explosive Materials (2010R-27T)

    Science.gov (United States)

    2010-11-17

    ... salt lattice with isomorphously substituted inorganic salts. * ANFO . Aromatic nitro-compound explosive.... Explosive mixtures containing tetranitromethane (nitroform). Explosive nitro compounds of aromatic... polyhydric alcohol explosives. Nitric acid and a nitro aromatic compound explosive. Nitric acid...

  3. Portable raman explosives detection

    Energy Technology Data Exchange (ETDEWEB)

    Moore, David Steven [Los Alamos National Laboratory; Scharff, Robert J [Los Alamos National Laboratory

    2008-01-01

    Recent advances in portable Raman instruments have dramatically increased their application to emergency response and forensics, as well as homeland defense. This paper reviews the relevant attributes and disadvantages of portable Raman spectroscopy, both essentially and instrumentally, to the task of explosives detection in the field.

  4. Cosmic Explosions in Three Dimensions

    Science.gov (United States)

    Höflich, Peter; Kumar, Pawan; Wheeler, J. Craig

    2004-12-01

    . X. Timmes and E. F. Brown; Part III. Theory of Core Collapse Supernovae: 21. Rotation of core collapse progenitors: single and binary stars N. Langer; 22. Large scale convection and the convective Supernova mechanism S. Colgate and M. E. Herant; 23. Topics in core-collapse Supernova A. Burrows, C. D. Ott and C. Meakin; 24. MHD Supernova jets: the missing link D. Meier and M. Nakamura; 25. Effects of super strong magnetic fields in core collapse Supernovae I. S. Akiyama; 26. Non radial instability of stalled accretion shocks advective-acoustic cycle T. Foglizzo and P. Galletti; 27. Asymmetry effects in Hypernovae K. Maeda, K. Nomoto, J. Deng and P.A. Mazzali; 28. Turbulent MHD jet collimation and thermal driving P. T. Williams; Part IV. Magnetars, N-Stars, Pulsars: 29. Supernova remnants and pulsar wind nebulae R. Chevalier; 30. X-Ray signatures of Supernovae D. Swartz; 31. Asymmetric Supernovae and Neutron Star Kicks D. Lai and D. Q. Lamb; 32. Triggers of magnetar outbursts R. Duncan; 33. Turbulent MHD Jet Collimation and Thermal Driving P. Williams; 34. The interplay between nuclear electron capture and fluid dynamics in core collapse Supernovae W. R. Hix, O. E. B. Messer and A. Mezzacappa; Part V. Gamma-Ray Bursts: 35. GRB 021004 and Gamma-ray burst distances B. E. Schaefer; 36. Gamma-ray bursts as a laboratory for the study of Type Ic Supernovae D. Q. Lamb, T. Q. Donaghy and C. Graziani; 37. The diversity of cosmic explosions: Gamma-ray bursts and Type Ib/c Supernovae E. Berger; 38. A GRB simulation using 3D relativistic hydrodynamics J. Cannizo, N. Gehrels and E. T. Vishniac; 39. The first direct link in the Supernova/GRB connection: GRB 030329 and SN 2003dh T. Matheson; Part VI. Summary: 40. Three-dimensional explosions C. Wheeler.

  5. Electronic states of BP, BP +, BP -, B 2P 2, B2P2- and B2P2+

    Science.gov (United States)

    Linguerri, Roberto; Komiha, Najia; Oswald, Rainer; Mitrushchenkov, Alexander; Rosmus, Pavel

    2008-05-01

    Using augmented sextuple zeta basis sets and internally contracted multireference configuration interaction (MRCI) wavefunctions, potential energy, electric dipole and transition moments have been computed for the X 3Π, a 1Σ +, b 1Π and A 3Σ - states of BP, X 2Σ + and A 2Π states of BP - and X 4Σ - and A 4Π states of BP +. From these data spectroscopic constants, radiative transition probabilities and photoelectron spectra of BP - and BP have been evaluated. The non-vanishing spin-orbit coupling elements between the four low lying triplet and singlet states of the neutral BP have also been calculated from MRCI wavefunctions. The treatment of the corresponding perturbations in the manifold of dense rovibrational states in the three lowest states would require a precise knowledge of the electronic excitation energies. Our best singlet-triplet separations (X-a) are calculated to be 2412 cm -1 (MRCI) and 2482 cm -1 (restricted coupled cluster with perturbative triples (RCCSD(T))) with an estimated error bound of about ±200 cm -1. All three states have long radiative lifetimes with cascading among the rovibrational levels of different states. The ionization energy IE e of BP is calculated to be 9.22 eV (MRCI) and 9.48 eV (RCCSD(T)), the electron affinity EA e 2.51 eV (MRCI) and 2.74 eV (RCCSD(T)). The photoelectron spectra of BP and BP - have been obtained from the Franck-Condon factors of the MRCI potentials. For the UV spectroscopy the dipole allowed radiative transition probabilities are given for A 3Σ - ↔ X 3Π, b 1Π ↔ a 1Σ + of BP, A 2Π ↔ X 2Σ + of BP - and A 4Π ↔ X 4Σ - of BP +. The ionization energy IE e of B 2P 2 of 8.71 eV and the electron affinity EA e of 2.34 eV have been calculated by the RCCSD(T)/aVQZ approach. Also the harmonic vibrational wavenumbers for the electronic ground states of the ions B2P2+ and B2P2- are given.

  6. Explosive Nucleosynthesis in Hypernovae

    CERN Document Server

    Nakamura, T; Iwamoto, K; Nomoto, K; Hashimoto, M; Hix, W R; Thielemann, F K; Nakamura, Takayoshi; Umeda, Hideyuki; Iwamoto, Koichi; Nomoto, Ken'ichi; Hashimoto, Masa-aki; Thielemann, Friedrich-Karl

    2000-01-01

    We examine the characteristics of nucleosynthesis in 'hypernovae', i.e., supernovae with very large explosion energies ($ \\gsim 10^{52} $ ergs). We carry out detailed nucleosynthesis calculations for these energetic explosions and compare the yields with those of ordinary core-collapse supernovae. We find that both complete and incomplete Si-burning takes place over more extended, lower density regions, so that the alpha-rich freezeout is enhanced in comparison with ordinary supernova nucleosynthesis. In addition, oxygen and carbon burning takes place in more extended, lower density regions than in ordinary supernovae. Therefore, the fuel elements O, C, Al are less abundant while a larger amount of burning products such as Si, S, and Ar are synthesized by oxygen burning. Implications for Galactic chemical evolution and the abundances in metal-poor stars are also discussed.

  7. BP Spill Sampling and Monitoring Data

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset analyzes waste from the the British Petroleum Deepwater Horizon Rig Explosion Emergency Response, providing opportunity to query data sets by metadata...

  8. Explosions in November

    OpenAIRE

    Steinitz, Richard

    2011-01-01

    Explosions in November tells the story of one of Europe’s leading cultural institutions, Huddersfield Contemporary Music Festival (hcmf), through the eyes of its founder and former artistic director, Professor Richard Steinitz. From its modest beginnings in 1978, when winter fog nearly sabotaged the inaugural programme, to today’s internationally renowned event, hcmf has been a pioneering champion of the best in contemporary music. Commissioning new work, reappraising existing legacies an...

  9. Explosives signatures and analysis

    Science.gov (United States)

    Fountain, Augustus Way, III; Oyler, Jonathan M.; Ostazeski, Stanley A.

    2008-04-01

    The challenge of sampling explosive materials for various high threat military and civilian operational scenarios requires the community to identify and exploit other chemical compounds within the mixtures that may be available to support stand-off detection techniques. While limited surface and vapor phase characterization of IEDs exist, they are insufficient to guide the future development and evaluation of field deployable explosives detection (proximity and standoff) capabilities. ECBC has conducted a limited investigation of three artillery ammunition types to determine what chemical vapors, if any, are available for sensing; the relative composition of the vapors which includes the more volatile compounds in munitions, i.e., plastersizers and binders; and the sensitivity needed detect these vapors at stand-off. Also in partnership with MIT-Lincoln Laboratory, we performed a background measurement campaign at the National Training Center to determine the baseline ambient amounts and variability of nitrates and nitro-ester compounds as vapors, particulates, and on surfaces; as well as other chemical compounds related to non-energetic explosive additives. Environmental persistence studies in contexts relevant to counter-IED sensing operations, such as surface residues, are still necessary.

  10. Characteristic Research on Evaporated Explosive Film

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    The evaporation source of evaporated explosive was designed and improved based on the inherent specialties of explosive. The compatibility of explosives and addition agent with evaporation vessels was analyzed. The influence of substrate temperature on explosive was analyzed, the control method of substrate temperature was suggested. The influences of evaporation rate on formation of explosive film and mixed explosive film were confirmed. Optimum evaporation rate for evaporation explosive and the better method for evaporating mixed explosive were presented. The necessary characteristics of the evaporated explosive film were obtained by the research of the differences between the evaporated explosive and other materials.

  11. Hydrological evolution in the Holocene (7,400 years BP) of Lake Sonachi (Kenya); L`evolution hydrologique du lac Sonachi (Kenya) a l`Holocene (7400-0 and BP)

    Energy Technology Data Exchange (ETDEWEB)

    Damnati, B.; Taieb, M. [Centre National de la Recherche Scientique, 13 -Aix-en-Provence (France)

    1996-08-01

    A sedimentary core (15.50 m long) was taken with a piston corer from a barge in the centre of the crater Lake Sonachi analysed for sedimentology (magnetic susceptibility) and geochemistry (organic matter and calcium carbonate) and radiocarbon dated. Two lacustrine phases are recognized between 7,400 and 3,200 a BP and between < 2,000 a BP and the present. The first phase of high lake-level is also recorded in the neighbouring lakes Naivasha, Nakuru and Elmenteita, and in several other East African lakes. This Holocene period is also marked by some volcanic explosions. (Authors). 20 refs., 5 figs.

  12. BP Investment Exceeds $4 Bln in china

    Institute of Scientific and Technical Information of China (English)

    Wang Ping

    2008-01-01

    @@ British Petroleum (BP) recently signed a series of agreements with China including those in clean energy and wind power generation, during British Prime Minister Gordon Brown's visit to China in mid-January.

  13. Spectroscopic observations of ASASSN-15bp

    Science.gov (United States)

    Williams, S. C.; Darnley, M. J.; Bode, M. F.; Copperwheat, C. M.

    2015-01-01

    We report spectroscopic observations of the optical transient ASASSN-15bp (ATel #6981) taken on 2015 January 25.31 UT using the FRODOSpec spectrograph (Barnsley et al. 2012) on the Liverpool Telescope (Steele et al. 2004).

  14. An iterative method for the canard explosion in general planar systems

    DEFF Research Database (Denmark)

    Brøns, Morten

    2013-01-01

    The canard explosion is the change of amplitude and period of a limit cycle born in a Hopf bifurcation in a very narrow parameter interval. The phenomenon is well understood in singular perturbation problems where a small parameter controls the slow/fast dynamics. However, canard explosions are a...

  15. An iterative method for the canard explosion in general planar systems

    DEFF Research Database (Denmark)

    Brøns, Morten

    2012-01-01

    The canard explosion is the change of amplitude and period of a limit cycle born in a Hopf bifurcation in a very narrow parameter interval. The phenomenon is well understood in singular perturbation problems where a small parameter controls the slow/fast dynamics. However, canard explosions are a...

  16. CENP-C facilitates the recruitment of M18BP1 to centromeric chromatin.

    Science.gov (United States)

    Dambacher, Silvia; Deng, Wen; Hahn, Matthias; Sadic, Dennis; Fröhlich, Jonathan; Nuber, Alexander; Hoischen, Christian; Diekmann, Stephan; Leonhardt, Heinrich; Schotta, Gunnar

    2012-01-01

    Centromeres are important structural constituents of chromosomes that ensure proper chromosome segregation during mitosis by providing defined sites for kinetochore attachment. In higher eukaryotes, centromeres have no specific DNA sequence and thus, they are rather determined through epigenetic mechanisms. A fundamental process in centromere establishment is the incorporation of the histone variant CENP-A into centromeric chromatin, which provides a binding platform for the other centromeric proteins. The Mis18 complex, and, in particular, its member M18BP1 was shown to be essential for both incorporation and maintenance of CENP-A. Here we show that M18BP1 displays a cell cycle-regulated association with centromeric chromatin in mouse embryonic stem cells. M18BP1 is highly enriched at centromeric regions from late anaphase through to G1 phase. An interaction screen against 16 core centromeric proteins revealed a novel interaction of M18BP1 with CENP-C. We mapped the interaction domain in M18BP1 to a central region containing a conserved SANT domain and in CENP-C to the C-terminus. Knock-down of CENP-C leads to reduced M18BP1 association and lower CENP-A levels at centromeres, suggesting that CENP-C works as an important factor for centromeric M18BP1 recruitment and thus for maintaining centromeric CENP-A. PMID:22540025

  17. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication.

    Science.gov (United States)

    Kanginakudru, Sriramana; DeSmet, Marsha; Thomas, Yanique; Morgan, Iain M; Androphy, Elliot J

    2015-04-01

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. PMID:25666521

  18. Fatigue of LX-14 and LX-19 plastic bonded explosives

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, D. M., LLNL

    1998-04-23

    The DOD uses the plastic bonded explosive (PBX) LX-14 in a wide variety of applications including shaped charges and explosively forged projectiles. LX- 19 is a higher energy explosive, which could be easily substituted for LX-14 because it contains the identical Estane 5703p binder and more energetic CL-20 explosive. Delivery systems for large shaped charges, such as TOW-2, include the Apache helicopter. Loads associated with vibrations and expansion from thermal excursions in field operations may, even at low levels over long time periods, cause flaws, already present in the PBX to grow. Flaws near the explosive/liner interface of a shaped charge can reduce performance. Small flaws in explosives are one mechanism (the hot spot mechanism) proposed for initiation and growth to detonation of PBXs like LX-14, PBXN 5, LX-04 and LX-17 among others. Unlike cast-cured explosives and propellants, PBXs cannot usually be compression molded to full density. Generally, the amount of explosive ignited by a shock wave is approximately equal to the original void volume. Whether or not these flaws or cracks grow during field operations to an extent sufficient to adversely affect the shaped charge performance or increase the vulnerability of the PBX is the ultimate question this effort could address. Currently the fatigue life of LX-14 under controlled conditions is being studied in order to generate its failure stress as a function of the number of fatigue cycles (S- N curve). Proposed future work will address flaw and crack growth and their relationship to hot-spot concentration and explosive vulnerability to shock and/or fragment initiation.

  19. Gas explosions in process pipes

    OpenAIRE

    Kristoffersen, Kjetil

    2004-01-01

    In this thesis, gas explosions inside pipes are considered. Laboratory experiments and numerical simulations are the basis of the thesis. The target of the work was to study gas explosions in pipes and to develop numer- ical models that could predict accidental gas explosions inside pipes. Experiments were performed in circular steel and plexiglass pipes. The steel pipes have an inner diameter of 22.3 mm and lengths of 1, 2, 5 and 11 m. The plexiglass pipe has an inner diame...

  20. PROBABILISTIC MODELING OF EXPLOSIVE LOADING

    OpenAIRE

    Mkrtychev Oleg Vartanovich; Dorozhinskiy Vladimir Bogdanovich

    2012-01-01

    According to existing design standards, explosive loading represents a special type of loading. Explosive loading is, in most cases, local in nature, although it can exceed the loads for which buildings are designed by a dozen of times. The analysis of terrorist attacks with explosives employed demonstrates that charges have a great power and, consequently, a substantial shock wave pressure. Blast effects are predictable with a certain probability. Therefore, we cannot discuss ...

  1. Equipment Design for Oxidation of 1BP/2BP Using NO_x

    Institute of Scientific and Technical Information of China (English)

    ZHOU; Xian-ming; CHANG; Shang-wen; LI; Gao-liang; LAN; Tian; LIU; Jin-ping; TANG; Hong-bin; HE; Hui

    2013-01-01

    NOx can Oxidize the reductants in 1BP and 2BP feed of Purex process,and can adjust the oxidation state of plutonium as Pu(Ⅳ)to meet the need of 2AF feed.Using NOx in Purex process can reduce the volumn of solid waste effectively,and attract more and more interest of researchers.In this work the oxidation of reductants in 1BP/2BP feed were investigated in glass column as the same-current mode,in

  2. Ballistic analysis during multiscale explosive eruption at Vesuvius and hazard implications

    Science.gov (United States)

    De Novellis, Vincenzo

    2016-04-01

    Ballistic Projectiles (BP) are rock-basement or magma fragments of variable size and density that are ejected from vents during explosive eruptions and follow almost parabolic trajectories that are influenced by gravity and drag forces before they reach their impact point on the surface. During the past century, numerous observers have described the violent ejection of large blocks and bombs from volcanoes during volcanic explosions. Starting from '40 years of last century, several authors developed a mathematical expression relating initial velocity and trajectory angle of ejected blocks to the range, taking into account air drag and assuming a constant drag coefficient; but only in the last 30 years was developed the first mathematical algorithm for ballistic trajectories in the volcanological literature that considered variations in drag coefficient with Reynolds number. Finally, with 21st century computer power, ballistic computation should be available to anyone as a back-of-the-envelope indicator of explosive power by a user-friendly computer program. At Mt. Vesuvius a series of explosion events accompanied eruptive mechanism stages during its history. In particular the explosive eruptive events at Vesuvius was affected by 3 types of energy activity: i) a normal strombolian activity that consists of rhythmic, mild to moderate explosions lasting a few seconds that eject scoriaceous lapilli and bombs, ash and lithic blocks; ii) a vulcanian or violent explosions characterized by short-lived events involving more than one vent, defined as strombolian paroxysms; iii) from sublinian to plinian activity, that have been the most powerful events observed at Mt. Vesuvius; on the other hand plinian was indicated as the energetic term to define the most famous eruption of 79 AD. In this study, an eruptive model appropriate for exanimated eruptions, is used to estimate initial conditions (ejection height, take-off angle, velocity) for BP, assuming a broad range of gas

  3. Computed tomography experiments of Pantex high explosives

    Science.gov (United States)

    Perkins, D. E.; Martz, H. E.; Hester, L. O.; Sobczak, G.; Pratt, C. L.

    1992-04-01

    X-ray computed tomography is an advanced imaging technique which provide three-dimensional nondestructive characterization of materials, components and assemblies. The CT Project group at Lawrence Livermore National Laboratory (LLNL) and the Pantex Plant are cooperating to examine the use of CT technology to inspect and characterize high-explosives pressings (e.g., PBX-9502, LX-10-2). High-explosives pressings manufactured by Pantex must be characterized prior to assembling into weapons systems; a nondestructive examination of all assembly parts would be preferable to the current sampling and destructive testing. The earlier in the processing cycle this can be done the more cost effective it will be. We have performed experiments that show that this characterization can be performed at the pressed billet stage using CT. We have detected 2-mm inclusions in a 15-cm diameter billet and 3.5-mm voids in a 20-cm diameter billet. Based on these results we show calculations that can be used to design production CT systems for characterization of high-explosives.

  4. Controlled by Distant Explosions

    Science.gov (United States)

    2007-03-01

    VLT Automatically Takes Detailed Spectra of Gamma-Ray Burst Afterglows Only Minutes After Discovery A time-series of high-resolution spectra in the optical and ultraviolet has twice been obtained just a few minutes after the detection of a gamma-ray bust explosion in a distant galaxy. The international team of astronomers responsible for these observations derived new conclusive evidence about the nature of the surroundings of these powerful explosions linked to the death of massive stars. At 11:08 pm on 17 April 2006, an alarm rang in the Control Room of ESO's Very Large Telescope on Paranal, Chile. Fortunately, it did not announce any catastrophe on the mountain, nor with one of the world's largest telescopes. Instead, it signalled the doom of a massive star, 9.3 billion light-years away, whose final scream of agony - a powerful burst of gamma rays - had been recorded by the Swift satellite only two minutes earlier. The alarm was triggered by the activation of the VLT Rapid Response Mode, a novel system that allows for robotic observations without any human intervention, except for the alignment of the spectrograph slit. ESO PR Photo 17a/07 ESO PR Photo 17a/07 Triggered by an Explosion Starting less than 10 minutes after the Swift detection, a series of spectra of increasing integration times (3, 5, 10, 20, 40 and 80 minutes) were taken with the Ultraviolet and Visual Echelle Spectrograph (UVES), mounted on Kueyen, the second Unit Telescope of the VLT. "With the Rapid Response Mode, the VLT is directly controlled by a distant explosion," said ESO astronomer Paul Vreeswijk, who requested the observations and is lead-author of the paper reporting the results. "All I really had to do, once I was informed of the gamma-ray burst detection, was to phone the staff astronomers at the Paranal Observatory, Stefano Bagnulo and Stan Stefl, to check that everything was fine." The first spectrum of this time series was the quickest ever taken of a gamma-ray burst afterglow

  5. Laser machining of explosives

    Science.gov (United States)

    Perry, Michael D.; Stuart, Brent C.; Banks, Paul S.; Myers, Booth R.; Sefcik, Joseph A.

    2000-01-01

    The invention consists of a method for machining (cutting, drilling, sculpting) of explosives (e.g., TNT, TATB, PETN, RDX, etc.). By using pulses of a duration in the range of 5 femtoseconds to 50 picoseconds, extremely precise and rapid machining can be achieved with essentially no heat or shock affected zone. In this method, material is removed by a nonthermal mechanism. A combination of multiphoton and collisional ionization creates a critical density plasma in a time scale much shorter than electron kinetic energy is transferred to the lattice. The resulting plasma is far from thermal equilibrium. The material is in essence converted from its initial solid-state directly into a fully ionized plasma on a time scale too short for thermal equilibrium to be established with the lattice. As a result, there is negligible heat conduction beyond the region removed resulting in negligible thermal stress or shock to the material beyond a few microns from the laser machined surface. Hydrodynamic expansion of the plasma eliminates the need for any ancillary techniques to remove material and produces extremely high quality machined surfaces. There is no detonation or deflagration of the explosive in the process and the material which is removed is rendered inert.

  6. Tenderizing Meat with Explosives

    Science.gov (United States)

    Gustavson, Paul K.; Lee, Richard J.; Chambers, George P.; Solomon, Morse B.; Berry, Brad W.

    2001-06-01

    Investigators at the Food Technology and Safety Laboratory have had success tenderizing meat by explosively shock loading samples submerged in water. This technique, referred to as the Hydrodynamic Pressure (HDP) Process, is being developed to improve the efficiency and reproducibility of the beef tenderization processing over conventional aging techniques. Once optimized, the process should overcome variability in tenderization currently plaguing the beef industry. Additional benefits include marketing lower quality grades of meat, which have not been commercially viable due to a low propensity to tenderization. The simplest and most successful arrangement of these tests has meat samples (50 to 75 mm thick) placed on a steel plate at the bottom of a plastic water vessel. Reported here are tests which were instrumented by Indian Head investigators. Carbon-composite resistor-gauges were used to quantify the shock profile delivered to the surface of the meat. PVDF and resistor gauges (used later in lieu of PVDF) provided data on the pressure-time history at the meat/steel interface. Resulting changes in tenderization were correlated with increasing shock duration, which were provided by various explosives.

  7. Neoproterozoic Land Colonisation, Rising Oxygen, Global Cooling and the Cambrian Explosion

    Science.gov (United States)

    Lenton, T. M.; Watson, A. J.

    2004-12-01

    The Neoproterozoic (1000-542 Ma BP) was a time of severe glaciations and a major transition from microscopic to macroscopic life forms. We develop the hypothesis that a rise in atmospheric oxygen in the Neoproterozoic was driven by the biological colonization of the land surface. If early forms of photosynthetic land life selectively weathered continental rock in order to extract nutrients, this would have led to an increase in the flux of biologically available phosphorus to the ocean. We show that recent models for coupled biogeochemical cycles, despite differences in the feedback mechanisms represented, predict this would lead to a rise in atmospheric oxygen concentration, consistent with biological and geochemical evidence. Increased weathering of silicate rocks would also have caused a decline in atmospheric carbon dioxide, which could have been a causal factor in the Neoproterozoic glaciations. A rise in oxygen may have provided a necessary condition for the evolution of animals with hard skeletons seen in the Cambrian explosion. Furthermore, an increase in phosphorus supply to the ocean may have driven an increase in the phosphorus content of marine primary producers. This would have represented an increase in food quality for grazing animals, which have a high phosphorus requirement, and may thus have removed a further limitation on their evolutionary radiation.

  8. Theory of bubble dynamics in condensed explosive during start-up transient

    Science.gov (United States)

    Benreuven, M.; Summerfield, M.

    1980-01-01

    Test firings with experimental liquid propellant gun systems indicate that the main concern standing in the way of practical application of LPG's is the possibility of unexpected explosions during start up when pressure is rapidly applied to the liquid monopropellant in the chamber. The phenomenon of many collapse-rebound cycles of imploding bubbles is theorized as the probable cause of explosions in LP systems. It may be concluded that LPG safety would be enhanced by choosing an LP with low bulk modulus, as well as low decomposition reaction rate, and that a benign looking DTA trace is not a sufficient quarantee of insensitivity to a pressure induced explosion. It is also shown that pre-pressurizing an LP charge, thus pre-compressing the bubbles near-isothermally, makes the system relatively insensitive to such pressure induced explosions. The applicability of this analysis to the question of acceleration induced explosion of explosive filled warheads is indicated.

  9. A universal, broad-environment energy conversion signature of explosive cyclones

    Science.gov (United States)

    Black, Mitchell Timothy; Pezza, Alexandre Bernardes

    2013-01-01

    This study presents the first analysis of the Lorenz energetics associated with a global climatology of explosive cyclones. Energy budgets of the large-scale environment are calculated for 32 year climatologies (1980-2011) of explosive cyclones within four of the most active regions in the world: the Northwest Pacific, the North Atlantic, the Southwest Pacific, and the South Atlantic. A robust signature in the Lorenz energy cycle is observed; anomalous energy conversions commence 48 h before explosive cyclone development and remain strong (i.e., significantly above background noise) for 120 h. Remarkably, the calculated signature of energy conversion is virtually identical for all four geographical regions. While the conversions imply a classic baroclinic growth cycle, they are not seen in regular cyclones that undergo a deepening of less than half that exhibited by explosive cyclones. This finding opens a new avenue of exploration of explosive storm behavior based on the large-scale environment.

  10. TopBP1 is required at mitosis to reduce transmission of DNA damage to G1 daughter cells.

    Science.gov (United States)

    Pedersen, Rune Troelsgaard; Kruse, Thomas; Nilsson, Jakob; Oestergaard, Vibe H; Lisby, Michael

    2015-08-17

    Genome integrity is critically dependent on timely DNA replication and accurate chromosome segregation. Replication stress delays replication into G2/M, which in turn impairs proper chromosome segregation and inflicts DNA damage on the daughter cells. Here we show that TopBP1 forms foci upon mitotic entry. In early mitosis, TopBP1 marks sites of and promotes unscheduled DNA synthesis. Moreover, TopBP1 is required for focus formation of the structure-selective nuclease and scaffold protein SLX4 in mitosis. Persistent TopBP1 foci transition into 53BP1 nuclear bodies (NBs) in G1 and precise temporal depletion of TopBP1 just before mitotic entry induced formation of 53BP1 NBs in the next cell cycle, showing that TopBP1 acts to reduce transmission of DNA damage to G1 daughter cells. Based on these results, we propose that TopBP1 maintains genome integrity in mitosis by controlling chromatin recruitment of SLX4 and by facilitating unscheduled DNA synthesis.

  11. TopBP1 is required at mitosis to reduce transmission of DNA damage to G1 daughter cells

    DEFF Research Database (Denmark)

    Pedersen, Rune Troelsgaard; Kruse, Thomas; Nilsson, Jakob;

    2015-01-01

    Genome integrity is critically dependent on timely DNA replication and accurate chromosome segregation. Replication stress delays replication into G2/M, which in turn impairs proper chromosome segregation and inflicts DNA damage on the daughter cells. Here we show that TopBP1 forms foci upon...... mitotic entry. In early mitosis, TopBP1 marks sites of and promotes unscheduled DNA synthesis. Moreover, TopBP1 is required for focus formation of the structure-selective nuclease and scaffold protein SLX4 in mitosis. Persistent TopBP1 foci transition into 53BP1 nuclear bodies (NBs) in G1 and precise...... temporal depletion of TopBP1 just before mitotic entry induced formation of 53BP1 NBs in the next cell cycle, showing that TopBP1 acts to reduce transmission of DNA damage to G1 daughter cells. Based on these results, we propose that TopBP1 maintains genome integrity in mitosis by controlling chromatin...

  12. Kaliski's explosive driven fusion experiments

    International Nuclear Information System (INIS)

    An experiment performed by a group in Poland on the production of DD fusion neutrons by purely explosive means is discussed. A method for multiplying shock velocities ordinarily available from high explosives by a factor of ten is described, and its application to DD fusion experiments is discussed

  13. Lidar Detection of Explosives Traces

    Science.gov (United States)

    Bobrovnikov, Sergei M.; Gorlov, Evgeny V.; Zharkov, Victor I.; Panchenko, Yury N.

    2016-06-01

    The possibility of remote detection of traces of explosives using laser fragmentation/laser-induced fluorescence (LF/LIF) is studied. Experimental data on the remote visualization of traces of trinitrotoluene (TNT), hexogen (RDX), trotyl-hexogen (Comp B), octogen (HMX), and tetryl with a scanning lidar detector of traces of nitrogen-containing explosives at a distance of 5 m are presented.

  14. Lidar Detection of Explosives Traces

    OpenAIRE

    Bobrovnikov Sergei M.; Gorlov Evgeny V.; Zharkov Victor I.; Panchenko Yury N.

    2016-01-01

    The possibility of remote detection of traces of explosives using laser fragmentation/laser-induced fluorescence (LF/LIF) is studied. Experimental data on the remote visualization of traces of trinitrotoluene (TNT), hexogen (RDX), trotyl-hexogen (Comp B), octogen (HMX), and tetryl with a scanning lidar detector of traces of nitrogen-containing explosives at a distance of 5 m are presented.

  15. A mitotic phosphorylation feedback network connects Cdk1, Plk1, 53BP1, and Chk2 to inactivate the G(2)/M DNA damage checkpoint

    DEFF Research Database (Denmark)

    van Vugt, Marcel A T M; Gardino, Alexandra K; Linding, Rune;

    2010-01-01

    the DNA damage response. We demonstrate that the non-enzymatic checkpoint adaptor protein 53BP1 is an in vivo target of the cell cycle kinases Cyclin-dependent kinase-1 and Polo-like kinase-1 (Plk1). We show that Plk1 binds 53BP1 during mitosis and that this interaction is required for proper inactivation......DNA damage checkpoints arrest cell cycle progression to facilitate DNA repair. The ability to survive genotoxic insults depends not only on the initiation of cell cycle checkpoints but also on checkpoint maintenance. While activation of DNA damage checkpoints has been studied extensively, molecular...... of the DNA damage checkpoint. 53BP1 mutants that are unable to bind Plk1 fail to restart the cell cycle after ionizing radiation-mediated cell cycle arrest. Importantly, we show that Plk1 also phosphorylates the 53BP1-binding checkpoint kinase Chk2 to inactivate its FHA domain and inhibit its kinase activity...

  16. Nanosensors for trace explosive detection

    Directory of Open Access Journals (Sweden)

    Larry Senesac

    2008-03-01

    Full Text Available Selective and sensitive detection of explosives is very important in countering terrorist threats. Detecting trace explosives has become a very complex and expensive endeavor because of a number of factors, such as the wide variety of materials that can be used as explosives, the lack of easily detectable signatures, the vast number of avenues by which these weapons can be deployed, and the lack of inexpensive sensors with high sensitivity and selectivity. High sensitivity and selectivity, combined with the ability to lower the deployment cost of sensors using mass production, is essential in winning the war on explosives-based terrorism. Nanosensors have the potential to satisfy all the requirements for an effective platform for the trace detection of explosives.

  17. Assessing nuclear explosions

    Science.gov (United States)

    Smith, Joseph V.

    The all-Union session on the Geophysical and Geochemical Consequences of Nuclear Explosions at the 1983 AGU Fall Meeting attracted a large audience, and many were unable to find a seat or standing room. The speakers and questioners emphasized the complexity of the processes and the need to extend the computer models. In particular, the global-circulation models presented byscientists from the National Center for Atmospheric Research showed that smoke/dust clouds should cause major changes in the weather systems with great contrast between the temperature perturbations over oceanic, coastal, and continental regions. Important developments in the models and conclusions can be expected over the next few years as AGU members from many disciplines contribute their skills.

  18. Nucleosynthesis in stellar explosions

    Energy Technology Data Exchange (ETDEWEB)

    Woosley, S.E.; Axelrod, T.S.; Weaver, T.A.

    1983-01-01

    The final evolution and explosion of stars from 10 M/sub solar/ to 10/sup 6/ M/sub solar/ are reviewed with emphasis on factors affecting the expected nucleosynthesis. We order our paper in a sequence of decreasing mass. If, as many suspect, the stellar birth function was peaked towards larger masses at earlier times (see e.g., Silk 1977; but also see Palla, Salpeter, and Stahler 1983), this sequence of masses might also be regarded as a temporal sequence. At each stage of Galactic chemical evolution stars form from the ashes of preceding generations which typically had greater mass. A wide variety of Type I supernova models, most based upon accreting white dwarf stars, are also explored using the expected light curves, spectra, and nucleosynthesis as diagnostics. No clearly favored Type I model emerges that is capable of simultaneously satisfying all three constraints.

  19. Nucleosynthesis in stellar explosions

    International Nuclear Information System (INIS)

    The final evolution and explosion of stars from 10 M/sub solar/ to 106 M/sub solar/ are reviewed with emphasis on factors affecting the expected nucleosynthesis. We order our paper in a sequence of decreasing mass. If, as many suspect, the stellar birth function was peaked towards larger masses at earlier times (see e.g., Silk 1977; but also see Palla, Salpeter, and Stahler 1983), this sequence of masses might also be regarded as a temporal sequence. At each stage of Galactic chemical evolution stars form from the ashes of preceding generations which typically had greater mass. A wide variety of Type I supernova models, most based upon accreting white dwarf stars, are also explored using the expected light curves, spectra, and nucleosynthesis as diagnostics. No clearly favored Type I model emerges that is capable of simultaneously satisfying all three constraints

  20. Mixing in explosions

    Energy Technology Data Exchange (ETDEWEB)

    Kuhl, A.L.

    1993-12-01

    Explosions always contain embedded turbulent mixing regions, for example: boundary layers, shear layers, wall jets, and unstable interfaces. Described here is one particular example of the latter, namely, the turbulent mixing occurring in the fireball of an HE-driven blast wave. The evolution of the turbulent mixing was studied via two-dimensional numerical simulations of the convective mixing processes on an adaptive mesh. Vorticity was generated on the fireball interface by baroclinic effects. The interface was unstable, and rapidly evolved into a turbulent mixing layer. Four phases of mixing were observed: (1) a strong blast wave phase; (2) and implosion phase; (3) a reshocking phase; and (4) an asymptotic mixing phase. The flowfield was azimuthally averaged to evaluate the mean and r.m.s. fluctuation profiles across the mixing layer. The vorticity decayed due to a cascade process. This caused the corresponding enstrophy parameter to increase linearly with time -- in agreement with homogeneous turbulence calculations of G.K. Batchelor.

  1. Lysine methylation-dependent binding of 53BP1 to the pRb tumor suppressor.

    Science.gov (United States)

    Carr, Simon M; Munro, Shonagh; Zalmas, Lykourgos-Panagiotis; Fedorov, Oleg; Johansson, Catrine; Krojer, Tobias; Sagum, Cari A; Bedford, Mark T; Oppermann, Udo; La Thangue, Nicholas B

    2014-08-01

    The retinoblastoma tumor suppressor protein pRb is a key regulator of cell cycle progression and mediator of the DNA damage response. Lysine methylation at K810, which occurs within a critical Cdk phosphorylation motif, holds pRb in the hypophosphorylated growth-suppressing state. We show here that methyl K810 is read by the tandem tudor domain containing tumor protein p53 binding protein 1 (53BP1). Structural elucidation of 53BP1 in complex with a methylated K810 pRb peptide emphasized the role of the 53BP1 tandem tudor domain in recognition of the methylated lysine and surrounding residues. Significantly, binding of 53BP1 to methyl K810 occurs on E2 promoter binding factor target genes and allows pRb activity to be effectively integrated with the DNA damage response. Our results widen the repertoire of cellular targets for 53BP1 and suggest a previously unidentified role for 53BP1 in regulating pRb tumor suppressor activity.

  2. Vegetation and Environment History for the Past 14000 yr BP from Dingnan, Jiangxi Province, South China

    Institute of Scientific and Technical Information of China (English)

    John Richard Dodson; Shirene Hickson; Rachel Khoo; Xiao-Qiang Li; Jemina Toia; Wei-Jian Zhou

    2006-01-01

    A Late Pleistocene-Holocene pollen, phosphorus, and charcoal record was reconstructed from apeatland in southern Jiangxi Province in southern China. The area today has a mountainous and rolling landscape with villages, small towns, and agriculture dominated by rice paddies, vegetable, and fruit gardens, as well as areas of secondary forest and pine re-afforestation. The record opens before 14 300 yr BP, with Alnus woodland dominating the wetland areas and with an open Quercus woodland on the surrounding slopes.The forest area becomes more complex from approximately 12 800 yr BP and further from 9 000 yr BP. At approximately 6 000 yr BP, there is evidence of clearing and, by 4 500-4 000 yr BP, a complete collapse in the wetland Alnus and terrestrial forest as the low-lying areas are converted to rice production. For much of the record, the occurrence of fire around the site was low, although there is evidence of regional fires. Fire was used as a tool in clearing and then used in the annual cycles of stubble burning after rice harvest. Nutrient levels, as reflected by total phosphorus in the sediment, seem to be closely related to forest changes and high values in the surface layers probably result from land-management techniques associated with agriculture. Therefore, human impact greatly altered forest cover, fire frequency, and nutrient dynamics; this has been evident for approximately 6 000 yr BP and then intensifies towards the present day.

  3. Role of 53BP1 in the regulation of DNA double-strand break repair pathway choice.

    Science.gov (United States)

    Gupta, Arun; Hunt, Clayton R; Chakraborty, Sharmistha; Pandita, Raj K; Yordy, John; Ramnarain, Deepti B; Horikoshi, Nobuo; Pandita, Tej K

    2014-01-01

    The p53-binding protein 1 (53BP1) is a well-known DNA damage response (DDR) factor, which is recruited to nuclear structures at the site of DNA damage and forms readily visualized ionizing radiation (IR) induced foci. Depletion of 53BP1 results in cell cycle arrest in G2/M phase as well as genomic instability in human as well as mouse cells. Within the DNA damage response mechanism, 53BP1 is classified as an adaptor/mediator, required for processing of the DNA damage response signal and as a platform for recruitment of other repair factors. More recently, specific 53BP1 contributions to DSB repair pathway choice have been recognized and are being characterized. In this review, we have summarized recent advances in understanding the role of 53BP1 in regulating DNA DSBs repair pathway choice, variable diversity joining [V(D)J] recombination and class-switch recombination (CSR). PMID:24320053

  4. Optical detection of explosives: spectral signatures for the explosive bouquet

    Science.gov (United States)

    Osborn, Tabetha; Kaimal, Sindhu; Causey, Jason; Burns, William; Reeve, Scott

    2009-05-01

    Research with canines suggests that sniffer dogs alert not on the odor from a pure explosive, but rather on a set of far more volatile species present in an explosive as impurities. Following the explosive trained canine example, we have begun examining the vapor signatures for many of these volatile impurities utilizing high resolution spectroscopic techniques in several molecular fingerprint regions. Here we will describe some of these high resolution measurements and discuss strategies for selecting useful spectral signature regions for individual molecular markers of interest.

  5. 2000 Johnston Site 2B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  6. 2000 Johnston Site 3B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 3B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 3, 2000. With a start point (meter 0) at...

  7. 2000 Johnston Site 1B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  8. AcEST: BP917025 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000094_H07 471 Adiantum capillus-veneris mRNA. clone: YMU001_000094_H07. BP917025 - Show BP917025...is mRNA. clone: YMU001_000094_H07. Accession BP917025 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP917025|Adiantum capillus-ven...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917025

  9. AcEST: BP917781 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D04 511 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D04. BP917781 - Show BP9177...is mRNA. clone: YMU001_000105_D04. Accession BP917781 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177... programs, Nucleic Acids Res. 25:3389-3402. Query= BP917781|Adiantum capillus-ven

  10. AcEST: BP920154 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F09 487 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F09. BP920154 - Show BP92015...is mRNA. clone: YMU001_000133_F09. Accession BP920154 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920154|Adia...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920154|Adiantum

  11. AcEST: BP919841 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G06 496 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G06. BP919841 - Show BP91984...is mRNA. clone: YMU001_000129_G06. Accession BP919841 Tissue type prothallium Developmental stage - Contig I...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919841|Adiantum ca...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919841|Adiantum capi

  12. AcEST: BP914066 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E02 515 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E02. BP914066 - Show BP91406...is mRNA. clone: YMU001_000039_E02. Accession BP914066 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP914066|Adiantum capillus-ve

  13. AcEST: BP918406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B06 468 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B06. BP918406 - Show BP918406...is mRNA. clone: YMU001_000113_B06. Accession BP918406 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-vene...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-veneris m

  14. AcEST: BP921101 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000145_F04 489 Adiantum capillus-veneris mRNA. clone: YMU001_000145_F04. BP921101 - Show BP921101...is mRNA. clone: YMU001_000145_F04. Accession BP921101 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921101|Adiantum cap... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921101

  15. AcEST: BP914473 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_C10 217 Adiantum capillus-veneris mRNA. clone: YMU001_000059_C10. BP914473 - Show BP9144...is mRNA. clone: YMU001_000059_C10. Accession BP914473 Tissue type prothallium Developmental stage - Contig I...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914473|Adiantum capil

  16. AcEST: BP919212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E05 508 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E05. BP919212 - Show BP91921...is mRNA. clone: YMU001_000122_E05. Accession BP919212 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919212|Adiantum capillus-ven...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919212|Adiantum capillus-

  17. Explosive signatures: Pre & post blast

    Science.gov (United States)

    Bernier, Evan Thomas

    Manuscripts 1 and 2 of this dissertation both involve the pre-blast detection of trace explosive material. The first manuscript explores the analysis of human hair as an indicator of exposure to explosives. Field analysis of hair for trace explosives is quick and non-invasive, and could prove to be a powerful linkage to physical evidence in the form of bulk explosive material. Individuals tested were involved in studies which required handling or close proximity to bulk high explosives such as TNT, PETN, and RDX. The second manuscript reports the results of research in the design and application of canine training aids for non-traditional, peroxide-based explosives. Organic peroxides such as triacetonetriperoxide (TATP) and hexamethylenetriperoxidediamine (HMTD) can be synthesized relatively easily with store-bought ingredients and have become popular improvised explosives with many terrorist groups. Due to the hazards of handling such sensitive compounds, this research established methods for preparing training aids which contained safe quantities of TATP and HMTD for use in imprinting canines with their characteristic odor. Manuscripts 3 and 4 of this dissertation focus on research conducted to characterize pipe bombs during and after an explosion (post-blast). Pipe bombs represent a large percentage of domestic devices encountered by law enforcement. The current project has involved the preparation and controlled explosion of over 90 pipe bombs of different configurations in order to obtain data on fragmentation patterns, fragment velocity, blast overpressure, and fragmentation distance. Physical data recorded from the collected fragments, such as mass, size, and thickness, was correlated with the relative power of the initial device. Manuscript 4 explores the microstructural analysis of select pipe bomb fragments. Shock-loading of the pipe steel led to plastic deformation and work hardening in the steel grain structure as evidenced by optical microscopy and

  18. Radiologic diagnosis of explosion casualties.

    Science.gov (United States)

    Eastridge, Brian J; Blackbourne, Lorne; Wade, Charles E; Holcomb, John B

    2008-01-01

    The threat of terrorist events on domestic soil remains an ever-present risk. Despite the notoriety of unconventional weapons, the mainstay in the armament of the terrorist organization is the conventional explosive. Conventional explosives are easily weaponized and readily obtainable, and the recipes are widely available over the Internet. According to the US Department of State and the Federal Bureau of Investigation, over one half of the global terrorist events involve explosions, averaging two explosive events per day worldwide in 2005 (Terrorism Research Center. Available at www.terrorism.com. Accessed April 1, 2007). The Future of Emergency Care in the United States Health System: Emergency Medical Services at the Crossroads, published by the Institute of Medicine, states that explosions were the most common cause of injuries associated with terrorism (Institute of Medicine Report: The Future of Emergency Care in the United States Health System: Emergency Medical Services at the Crossroads. Washington DC: National Academic Press, 2007). Explosive events have the potential to inflict numerous casualties with multiple injuries. The complexity of this scenario is exacerbated by the fact that few providers or medical facilities have experience with mass casualty events in which human and material resources can be rapidly overwhelmed. Care of explosive-related injury is based on same principles as that of standard trauma management paradigms. The basic difference between explosion-related injury and other injury mechanisms are the number of patients and multiplicity of injuries, which require a higher allocation of resources. With this caveat, the appropriate utilization of radiology resources has the potential to impact in-hospital diagnosis and triage and is an essential element in optimizing the management of the explosive-injured patients. PMID:19069034

  19. Cambrian explosion triggered by geosphere-biosphere feedbacks

    Science.gov (United States)

    von Bloh, Werner; Bounama, Christine; Franck, Siegfried

    2003-09-01

    A new hypothesis for the cause of the Cambrian explosion is presented. For that the evolution of the planet Earth is described by the co-evolution of the geosphere-biosphere system. Here we specify our previously published Earth system model for the long-term carbon cycle by introducing three different types of biosphere: procaryotes, eucaryotes, and complex multicellular life. They are characterized by different global temperature tolerance windows. The biotic enhancement of silicate weathering by complex multicellular life adds an additional feedback to the system and triggers the Cambrian explosion. The Cambrian explosion is characterized by a sudden increase of biomass and a rapid cooling, which amplified the spread of complex multicellular life. Cooling events in the Neoproterozoic, however, could force a premature appearance of complex multicellular life.

  20. The Terrestrial NPP Simulation in China since 6ka BP

    Institute of Scientific and Technical Information of China (English)

    HE Yong; DONG Wenjie; JI Jinjun; DAN Li

    2005-01-01

    A better understanding of the long-term global carbon cycle required estimate of the changes in terrestrial carbon storage after the last glacial period. The results of simulation at mid-Holocene (MH) from PMIP (Paleoclimate Modeling Intercomparison Project) and the modern data from CRU (Climate Research Unit,East Anglia University, UK) allow us to use the Atmosphere-Vegetation Interaction Model (AVIM) to simulate the Chinese terrestrial net primary productivity (NPP) at 6ka BP and present time. The change of NPP and total NPP in China from now to mid-Holocene are about 54 g m-2yr-1 and 0.63 Pg yr-1,respectively, mainly due to the build-up of temperate forest and tropical rainforest. Chinese terrestrial NPP variation from MH to now is closely related to the variation in intensity of Asian monsoon, which controlled the climate-vegetation pattern change.

  1. Active explosion barrier performance against methane and coal dust explosions

    Institute of Scientific and Technical Information of China (English)

    J J L du Plessis

    2015-01-01

    Preventing the propagation of methane or coal dust explosions through the use of active explosion-suppression systems remains one of the most underutilised explosion controls in underground coal mines. As part of the effort to develop better technologies to safeguard mines, the use of active barrier systems was investigated at Kloppersbos in South Africa. The system is designed to meet the requirements of the European Standard (EN 14591-4 2007) as well as the Mine Safety Standardisation in the Ministry of Coal Industry, Coal Industrial l Standard of the Peoples Republic of China (MT 694-1997). From the tests conducted, it can be concluded that the ExploSpot System was successful in stopping flame propagation for both methane and methane and coal dust hybrid explosions when ammonium phosphate powder was used as the suppression material. The use of this barrier will provide coal mine management with an additional explosion control close to the point of ignition and may find application within longwall faces further protecting mines against the risk of an explosion propagating throughout a mine.

  2. Multivalent display of the antimicrobial peptides BP100 and BP143

    OpenAIRE

    Imma Güell; Rafael Ferre; Kasper K. Sørensen; Esther Badosa; Iteng Ng-Choi; Emilio Montesinos; Eduard Bardají; Lidia Feliu; Jensen, Knud J; Marta Planas

    2012-01-01

    Carbohydrates are considered as promising templates for the display of multiple copies of antimicrobial peptides. Herein, we describe the design and synthesis of chimeric structures containing two or four copies of the antimicrobial peptides KKLFKKILKYL-NH2 (BP100) and KKLfKKILKYL-NH2 (BP143) attached to the carbohydrate template cyclodithioerythritol (cDTE) or α-D-galactopyranoside (Galp). The synthesis involved the preparation of the corresponding peptide aldehyde followed by coupling ...

  3. Explosive Contagion in Networks

    Science.gov (United States)

    Gómez-Gardeñes, J.; Lotero, L.; Taraskin, S. N.; Pérez-Reche, F. J.

    2016-01-01

    The spread of social phenomena such as behaviors, ideas or products is an ubiquitous but remarkably complex phenomenon. A successful avenue to study the spread of social phenomena relies on epidemic models by establishing analogies between the transmission of social phenomena and infectious diseases. Such models typically assume simple social interactions restricted to pairs of individuals; effects of the context are often neglected. Here we show that local synergistic effects associated with acquaintances of pairs of individuals can have striking consequences on the spread of social phenomena at large scales. The most interesting predictions are found for a scenario in which the contagion ability of a spreader decreases with the number of ignorant individuals surrounding the target ignorant. This mechanism mimics ubiquitous situations in which the willingness of individuals to adopt a new product depends not only on the intrinsic value of the product but also on whether his acquaintances will adopt this product or not. In these situations, we show that the typically smooth (second order) transitions towards large social contagion become explosive (first order). The proposed synergistic mechanisms therefore explain why ideas, rumours or products can suddenly and sometimes unexpectedly catch on.

  4. Disaster management following explosion.

    Science.gov (United States)

    Sharma, B R

    2008-01-01

    Explosions and bombings remain the most common deliberate cause of disasters involving large numbers of casualties, especially as instruments of terrorism. These attacks are virtually always directed against the untrained and unsuspecting civilian population. Unlike the military, civilians are poorly equipped or prepared to handle the severe emotional, logistical, and medical burdens of a sudden large casualty load, and thus are completely vulnerable to terrorist aims. To address the problem to the maximum benefit of mass disaster victims, we must develop collective forethought and a broad-based consensus on triage and these decisions must reach beyond the hospital emergency department. It needs to be realized that physicians should never be placed in a position of individually deciding to deny treatment to patients without the guidance of a policy or protocol. Emergency physicians, however, may easily find themselves in a situation in which the demand for resources clearly exceeds supply and for this reason, emergency care providers, personnel, hospital administrators, religious leaders, and medical ethics committees need to engage in bioethical decision-making. PMID:18522253

  5. Furball Explosive Breakout Test

    Energy Technology Data Exchange (ETDEWEB)

    Carroll, Joshua David [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-08-05

    For more than 30 years the Onionskin test has been the primary way to study the surface breakout of a detonation wave. Currently the Onionskin test allows for only a small, one dimensional, slice of the explosive in question to be observed. Asymmetrical features are not observable with the Onionskin test and its one dimensional view. As a result, in 2011, preliminary designs for the Hairball and Furball were developed then tested. The Hairball used shorting pins connected to an oscilloscope to determine the arrival time at 24 discrete points. This limited number of data points, caused by the limited number of oscilloscope channels, ultimately led to the Hairball’s demise. Following this, the Furball was developed to increase the number of data points collected. Instead of shorting pins the Furball uses fiber optics imaged by a streak camera to determine the detonation wave arrival time for each point. The original design was able to capture the detonation wave’s arrival time at 205 discrete points with the ability to increase the number of data points if necessary.

  6. The Cambrian explosion.

    Science.gov (United States)

    Briggs, Derek E G

    2015-10-01

    The sudden appearance of fossils that marks the so-called 'Cambrian explosion' has intrigued and exercised biologists since Darwin's time. In On the Origin of Species, Darwin made it clear that he believed that ancestral forms 'lived long before' their first fossil representatives. While he considered such an invisible record necessary to explain the level of complexity already seen in the fossils of early trilobites, Darwin was at a loss to explain why there were no corresponding fossils of these earlier forms. In chapter 9 of the Origin, entitled 'On the imperfection of the geological record', he emphasized the 'poorness of our palaeontological collections' and stated categorically that 'no organism wholly soft can be preserved'. Fortunately much has been discovered in the last 150 years, not least multiple examples of Cambrian and Precambrian soft-bodied fossils. We now know that the sudden appearance of fossils in the Cambrian (541-485 million years ago) is real and not an artefact of an imperfect fossil record: rapid diversification of animals coincided with the evolution of biomineralized shells. And although fossils in earlier rocks are rare, they are not absent: their rarity reflects the low diversity of life at this time, as well as the low preservation potential of Precambrian organisms (see Primer by Butterfield, in this issue). PMID:26439348

  7. Explosive Blast Neuropathology and Seizures

    Directory of Open Access Journals (Sweden)

    S. Krisztian eKovacs

    2014-04-01

    Full Text Available Traumatic brain injury (TBI due to explosive blast exposure is a leading combat casualty. It is also implicated as a key contributor to war related mental health diseases. A clinically important consequence of all types of TBI is a high risk for development of seizures and epilepsy. Seizures have been reported in patients who have suffered blast injuries in the Global War on Terror but the exact prevalence is unknown. The occurrence of seizures supports the contention that explosive blast leads to both cellular and structural brain pathology. Unfortunately, the exact mechanism by which explosions cause brain injury is unclear, which complicates development of meaningful therapies and mitigation strategies. To help improve understanding, detailed neuropathological analysis is needed. For this, histopathological techniques are extremely valuable and indispensable. In the following we will review the pathological results, including those from immunohistochemical and special staining approaches, from recent preclinical explosive blast studies.

  8. Suppression of stratified explosive interactions

    Energy Technology Data Exchange (ETDEWEB)

    Meeks, M.K.; Shamoun, B.I.; Bonazza, R.; Corradini, M.L. [Wisconsin Univ., Madison, WI (United States). Dept. of Nuclear Engineering and Engineering Physics

    1998-01-01

    Stratified Fuel-Coolant Interaction (FCI) experiments with Refrigerant-134a and water were performed in a large-scale system. Air was uniformly injected into the coolant pool to establish a pre-existing void which could suppress the explosion. Two competing effects due to the variation of the air flow rate seem to influence the intensity of the explosion in this geometrical configuration. At low flow rates, although the injected air increases the void fraction, the concurrent agitation and mixing increases the intensity of the interaction. At higher flow rates, the increase in void fraction tends to attenuate the propagated pressure wave generated by the explosion. Experimental results show a complete suppression of the vapor explosion at high rates of air injection, corresponding to an average void fraction of larger than 30%. (author)

  9. Explosion modelling for complex geometries

    Science.gov (United States)

    Nehzat, Naser

    A literature review suggested that the combined effects of fuel reactivity, obstacle density, ignition strength, and confinement result in flame acceleration and subsequent pressure build-up during a vapour cloud explosion (VCE). Models for the prediction of propagating flames in hazardous areas, such as coal mines, oil platforms, storage and process chemical areas etc. fall into two classes. One class involves use of Computation Fluid Dynamics (CFD). This approach has been utilised by several researchers. The other approach relies upon a lumped parameter approach as developed by Baker (1983). The former approach is restricted by the appropriateness of sub-models and numerical stability requirements inherent in the computational solution. The latter approach raises significant questions regarding the validity of the simplification involved in representing the complexities of a propagating explosion. This study was conducted to investigate and improve the Computational Fluid Dynamic (CFD) code EXPLODE which has been developed by Green et al., (1993) for use on practical gas explosion hazard assessments. The code employs a numerical method for solving partial differential equations by using finite volume techniques. Verification exercises, involving comparison with analytical solutions for the classical shock-tube and with experimental (small-scale, medium and large-scale) results, demonstrate the accuracy of the code and the new combustion models but also identify differences between predictions and the experimental results. The project has resulted in a developed version of the code (EXPLODE2) with new combustion models for simulating gas explosions. Additional features of this program include the physical models necessary to simulate the combustion process using alternative combustion models, improvement to the numerical accuracy and robustness of the code, and special input for simulation of different gas explosions. The present code has the capability of

  10. BP Oil Company's approach to risk management

    International Nuclear Information System (INIS)

    The oil and chemical industries face major challenges in deciding how to handle the numerous recommendations coming from various audits, reviews and studies conducted in the functional areas of personnel health and safety, loss prevention, and environmental protection. And, the number of recommendations continues to grow with time, as regulations and normal business requirements are met. BP Oil has developed a methodology for risk ranking the events leading to specific recommendations and then determining the cost-effectiveness of the recommendations in reducing the risk. The author completed successful pilot tests of this methodology at two of BP Oil's petroleum refineries, examining the recommendations from process hazards analyses and studies completed over the past few years. The methodology has since been implemented throughout their petroleum refining, distribution, transportation, and retail business streams

  11. Lidar Detection of Explosives Traces

    Directory of Open Access Journals (Sweden)

    Bobrovnikov Sergei M.

    2016-01-01

    Full Text Available The possibility of remote detection of traces of explosives using laser fragmentation/laser-induced fluorescence (LF/LIF is studied. Experimental data on the remote visualization of traces of trinitrotoluene (TNT, hexogen (RDX, trotyl-hexogen (Comp B, octogen (HMX, and tetryl with a scanning lidar detector of traces of nitrogen-containing explosives at a distance of 5 m are presented.

  12. Simulation Analysis of Indoor Gas Explosion Damage

    Institute of Scientific and Technical Information of China (English)

    钱新明; 陈林顺; 冯长根

    2003-01-01

    The influence factors and process of indoor gas explosion are studied with AutoReaGas explosion simulator. The result shows that venting pressure has great influence on the indoor gas explosion damage. The higher the venting pressure is, the more serious the hazard consequence will be. The ignition location has also evident effect on the gas explosion damage. The explosion static overpressure would not cause major injury to person and serious damage to structure in the case of low venting pressure (lower than 2 kPa). The high temperature combustion after the explosion is the major factor to person injury in indoor gas explosion accidents.

  13. Tagging of Explosives for Detection

    Directory of Open Access Journals (Sweden)

    J. S. Gharia

    2000-01-01

    Full Text Available This paper gives the results of a study on estimation of shelf life of2,3-dimethyI2,3-dinitrobutane (DMNB-tagged RDX and PETN expiosives by monitoring DMNB depletion by high performanceliquid chromatography and simultaneously recording the detectability of the tagged explosive composition using explosive vapoUf detector Model-97 HS. DMNB was incorporated in the explosive using methanol as solvent for DMNB and the explosive compositions were stored at 35,55 and 75 °C over a long period. Methods developed for preparing the homogeneously tagged composition with DMNB at 0.5 per cent level and for the analysis ofDMNB for ensuring homogeneity of DMNB in the composition are described. The results show no change in compatibility and sensitivity on the incorporation of DMNB in the explosive. Estimation of shelf life of DMNB in the explosive was done for a period of storage of 202-304 days at different temperatures.

  14. Short-term seismic quiescence immediately preceding explosions during the 2011 eruption of Telica Volcano, Nicaragua

    Science.gov (United States)

    Rodgers, M.; Roman, D. C.; Geirsson, H.; La Femina, P. C.; Muñoz, A.; Tenorio, V.

    2013-12-01

    Telica Volcano, Nicaragua, experienced a VEI 2 eruptive episode from March-June 2011. The eruption consisted of numerous small to moderate ash explosions, many of which were observed visually and recorded by a local broadband seismic network (the TESAND network). Seismicity at Telica during both background and eruptive periods is characterized by generally high and variable rates of low-magnitude volcano-seismic events. Explosions at Telica are also detected seismically and distinguished from volcanic earthquakes by the length of the seismic signal, their emergent nature and 'cigar-shaped' envelope, and broadband spectral content. During the month of May 2011, we identified 16 explosion events on a seismometer located 0.5 km from the crater vent, some of which correlate with visually observed explosions. From May 1-12, ten explosions are apparent in continuous seismic data. During this period, the rate of volcano-seismic events is relatively low (0-20 events/hour with an average of 4 events per hour). Prior to eight of the 10 explosions, there were no detected seismic events within one hour of the explosion. From May 13-31, seven explosions were identified in the continuous seismic data. During this period, the rate of volcano-seismic events is relatively high (0-48 events per hour, with an average of 18 events per hour). In the hour preceding all seven explosions, there were no detected volcano-seismic events. Visual inspection of the continuous seismic data confirms that a strong decrease in the number of volcano-seismic events immediately preceded most of the 2011 explosions at Telica Volcano. We suggest that the apparent short-term decrease in seismicity before explosions at Telica is related to a cycle of pressure buildup and release in the shallow magmatic-hydrothermal system, with an increase in pressure prior to the explosions both resulting from and reflecting constriction of gas pathways.

  15. The Value of a BP Determination Method Using a Novel Non-Invasive BP Device against the Invasive Catheter Measurement

    OpenAIRE

    Jinsong Xu; Yanqing Wu; Hai Su; Weitong Hu; Juxiang Li; Wenying Wang; Xin Liu; Xiaoshu Cheng

    2014-01-01

    OBJECTIVE: The aim of this study was to evaluate the accuracy of a new blood pressure (BP) measurement method (Pulse method). METHODS: This study enrolled 45 patients for selective percutaneous coronary intervention (PCI) via right radial artery. A BP device using either oscillometric (Microlife 3AC1-1) or Pulse method(RG-BP11)was used. At the beginning of each PCI, intra-radial BP was measured before Microlife BP or Pulse BP measurement as its own reference, respectively. At the end of PCI, ...

  16. Sediment Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  17. Air Monitoring Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  18. Waste Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  19. THE INFLUENCE OF BARRIERS ON FLAME AND EXPLOSION WAVE IN GAS EXPLOSION

    Institute of Scientific and Technical Information of China (English)

    林柏泉; 周世宁; 张仁贵

    1998-01-01

    This paper researches into the influence of barriers on flame and explosion wave in gasexplosion on the basis of experiment. The result shows that the barrier is very important to thetransmission of flame and explosion wave in gas explosion. When there are barriers, the speed oftransmission would be very fast and shock wave will appear in gas explosion, which would in-crease gas explosion power. The result of research is very important to prevent gas explosion anddecrease the power of it.

  20. Effects of laser pulse duration and intensity on Coulomb explosion of CO2: Signatures of charge-resonance enhanced ionization

    Science.gov (United States)

    Litvinyuk, Igor V.; Bocharova, Irina; Sanderson, Joseph; Kieffer, Jean-Claude; Légaré, François

    2009-11-01

    We studied laser-induced Coulomb explosion of CO2 by full triple-coincidence momentum resolved detection of resulting ion fragments. From the coincidence momentum data we can reconstruct molecular geometry immediately before explosion. We observe the dynamics of Coulomb explosion by comparing reconstructed CO2 geometries for different Ti:Sapphire laser pulse durations (at the same intensity) ranging from few cycles (7 fs) to 200 fs. We conclude that for longer pulse durations (>=100 fs) Coulomb explosion proceeds through the enhanced ionization mechanism taking place at the critical O-O distance of 8 a.u., similarly to well known charge-resonance enhanced ionization (CREI) in H2.

  1. Explosion limits for combustible gases

    Institute of Scientific and Technical Information of China (English)

    TONG Min-ming; WU Guo-qing; HAO Ji-fei; DAI Xin-lian

    2009-01-01

    Combustible gases in coal mines are composed of methane, hydrogen, some multi-carbon alkane gases and other gases. Based on a numerical calculation, the explosion limits of combustible gases were studied, showing that these limits are related to the concentrations of different components in the mixture. With an increase of C4H10 and C6H14, the Lower ExplosionLimit (LEL) and Upper Explosion-Limit (UEL) of a combustible gas mixture will decrease clearly. For every 0.1% increase in C4H10 and C6H14, the LEL decreases by about 0.19% and the UEL by about 0.3%. The results also prove that, by increasing the amount of H2, the UEL of a combustible gas mixture will increase considerably. If the level of H2 increases by 0.1%, the UEL will increase by about 0.3%. However, H2 has only a small effect on the LEL of the combustible gas mixture. Our study provides a theoretical foundation for judging the explosion risk of an explosive gas mixture in mines.

  2. AcEST: BP912001 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_H05 68 Adiantum capillus-veneris mRNA. clone: YMU001_000011_H05. BP912001 - Show BP9120... mRNA. clone: YMU001_000011_H05. Accession BP912001 Tissue type prothallium Developmental stage - Contig ID

  3. AcEST: BP920020 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_B05 91 Adiantum capillus-veneris mRNA. clone: YMU001_000132_B05. BP920020 - Show BP920020... mRNA. clone: YMU001_000132_B05. Accession BP920020 Tissue type prothallium Developmental stage - Contig ID

  4. AcEST: BP919947 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A11 35 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A11. BP919947 - Show BP91994... mRNA. clone: YMU001_000131_A11. Accession BP919947 Tissue type prothallium Developmental stage - Contig ID

  5. AcEST: BP917767 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_B11 76 Adiantum capillus-veneris mRNA. clone: YMU001_000105_B11. BP917767 - Show BP9177... mRNA. clone: YMU001_000105_B11. Accession BP917767 Tissue type prothallium Developmental stage - Contig ID

  6. AcEST: BP919848 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H02 84 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H02. BP919848 - Show BP91984... mRNA. clone: YMU001_000129_H02. Accession BP919848 Tissue type prothallium Developmental stage - Contig ID

  7. AcEST: BP916367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000086_H07 86 Adiantum capillus-veneris mRNA. clone: YMU001_000086_H07. BP916367 - Show BP916367... mRNA. clone: YMU001_000086_H07. Accession BP916367 Tissue type prothallium Developmental stage - Contig ID

  8. AcEST: BP914480 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_D05 74 Adiantum capillus-veneris mRNA. clone: YMU001_000059_D05. BP914480 - Show BP9144... mRNA. clone: YMU001_000059_D05. Accession BP914480 Tissue type prothallium Developmental stage - Contig ID

  9. AcEST: BP915916 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D12 73 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D12. BP915916 - Show BP91591... mRNA. clone: YMU001_000079_D12. Accession BP915916 Tissue type prothallium Developmental stage - Contig ID

  10. The Quiet Explosion

    Science.gov (United States)

    2008-07-01

    A European-led team of astronomers are providing hints that a recent supernova may not be as normal as initially thought. Instead, the star that exploded is now understood to have collapsed into a black hole, producing a weak jet, typical of much more violent events, the so-called gamma-ray bursts. The object, SN 2008D, is thus probably among the weakest explosions that produce very fast moving jets. This discovery represents a crucial milestone in the understanding of the most violent phenomena observed in the Universe. Black Hole ESO PR Photo 23a/08 A Galaxy and two Supernovae These striking results, partly based on observations with ESO's Very Large Telescope, will appear tomorrow in Science Express, the online version of Science. Stars that were at birth more massive than about 8 times the mass of our Sun end their relatively short life in a cosmic, cataclysmic firework lighting up the Universe. The outcome is the formation of the densest objects that exist, neutron stars and black holes. When exploding, some of the most massive stars emit a short cry of agony, in the form of a burst of very energetic light, X- or gamma-rays. In the early afternoon (in Europe) of 9 January 2008, the NASA/STFC/ASI Swift telescope discovered serendipitously a 5-minute long burst of X-rays coming from within the spiral galaxy NGC 2770, located 90 million light-years away towards the Lynx constellation. The Swift satellite was studying a supernova that had exploded the previous year in the same galaxy, but the burst of X-rays came from another location, and was soon shown to arise from a different supernova, named SN 2008D. Researchers at the Italian National Institute for Astrophysics (INAF), the Max-Planck Institute for Astrophysics (MPA), ESO, and at various other institutions have observed the supernova at great length. The team is led by Paolo Mazzali of INAF's Padova Observatory and MPA. "What made this event very interesting," says Mazzali, "is that the X-ray signal was very

  11. Coulomb explosion of "hot spot"

    CERN Document Server

    Oreshkin, V I; Chaikovsky, S A; Artyomov, A P

    2016-01-01

    The study presented in this paper has shown that the generation of hard x rays and high-energy ions, which are detected in pinch implosion experiments, may be associated with the Coulomb explosion of the hot spot that is formed due to the outflow of the material from the pinch cross point. During the process of material outflow, the temperature of the hot spot plasma increases, and conditions arise for the plasma electrons to become continuously accelerated. The runaway of electrons from the hot spot region results in the buildup of positive space charge in this region followed by a Coulomb explosion. The conditions for the hot spot plasma electrons to become continuously accelerated have been revealed and estimates have been obtained for the kinetic energy of the ions generated by the Coulomb explosion.

  12. Seismic coupling of nuclear explosions

    International Nuclear Information System (INIS)

    The new Giant Magnet Experimental Facility employing digital recording of explosion induced motion has been constructed and successfully tested. Particle velocity and piezoresistance gage responses can be measured simultaneously thus providing the capability for determining the multi-component stress-strain history in the test material. This capability provides the information necessary for validation of computer models used in simulation of nuclear underground testing, chemical explosion testing, dynamic structural response, earth penetration response, and etc. This report discusses fully coupled and cavity decoupled explosions of the same energy (0.622 kJ) were carried out as experiments to study wave propagation and attenuation in polymethylmethacrylate (PMMA). These experiments produced particle velocity time histories at strains from 2 x 10-3 to as low as 5.8 x 10-6. Other experiments in PMMA, reported recently by Stout and Larson8 provide additional particle velocity data to strains of 10-1

  13. Evidence for Nearby Supernova Explosions

    CERN Document Server

    Benítez, N; Canelles, M; Benitez, Narciso; Maiz-Apellaniz, Jesus; Canelles, Matilde

    2002-01-01

    Supernova explosions are one of the most energetic--and potentially lethal--phenomena in the Universe. Scientists have speculated for decades about the possible consequences for life on Earth of a nearby supernova, but plausible candidates for such an event were lacking. Here we show that the Scorpius-Centaurus OB association, a group of young stars currently located at~130 parsecs from the Sun, has generated 20 SN explosions during the last 11 Myr, some of them probably as close as 40 pc to our planet. We find that the deposition on Earth of 60Fe atoms produced by these explosions can explain the recent measurements of an excess of this isotope in deep ocean crust samples. We propose that ~2 Myr ago, one of the SNe exploded close enough to Earth to seriously damage the ozone layer, provoking or contributing to the Pliocene-Pleistocene boundary marine extinction.

  14. Optimal dynamic detection of explosives

    Energy Technology Data Exchange (ETDEWEB)

    Moore, David Steven [Los Alamos National Laboratory; Mcgrane, Shawn D [Los Alamos National Laboratory; Greenfield, Margo T [Los Alamos National Laboratory; Scharff, R J [Los Alamos National Laboratory; Rabitz, Herschel A [PRINCETON UNIV; Roslund, J [PRINCETON UNIV

    2009-01-01

    The detection of explosives is a notoriously difficult problem, especially at stand-off distances, due to their (generally) low vapor pressure, environmental and matrix interferences, and packaging. We are exploring optimal dynamic detection to exploit the best capabilities of recent advances in laser technology and recent discoveries in optimal shaping of laser pulses for control of molecular processes to significantly enhance the standoff detection of explosives. The core of the ODD-Ex technique is the introduction of optimally shaped laser pulses to simultaneously enhance sensitivity of explosives signatures while reducing the influence of noise and the signals from background interferents in the field (increase selectivity). These goals are being addressed by operating in an optimal nonlinear fashion, typically with a single shaped laser pulse inherently containing within it coherently locked control and probe sub-pulses. With sufficient bandwidth, the technique is capable of intrinsically providing orthogonal broad spectral information for data fusion, all from a single optimal pulse.

  15. AcEST: BP912094 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_A09 564 Adiantum capillus-veneris mRNA. clone: YMU001_000015_A09. BP9120...94 CL2967Contig1 Show BP912094 Clone id YMU001_000015_A09 Library YMU01 Length 564 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_A09. Accession BP912094 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912094|Adiantum c...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  16. AcEST: BP912003 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_H07 455 Adiantum capillus-veneris mRNA. clone: YMU001_000011_H07. BP9120...03 CL3942Contig1 Show BP912003 Clone id YMU001_000011_H07 Library YMU01 Length 455 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_H07. Accession BP912003 Tissue type prothallium Developmental stag..., Nucleic Acids Res. 25:3389-3402. Query= BP912003|Adiantum capillus-veneris mRNA...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  17. AcEST: BP912057 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E09 528 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E09. BP9120...57 CL1892Contig1 Show BP912057 Clone id YMU001_000012_E09 Library YMU01 Length 528 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_E09. Accession BP912057 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP912057|Adiantum capillus-veneris mRNA, clone: YMU001_000012_E09. (528 lett... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  18. AcEST: BP921209 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A04 535 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A04. BP921209 - Show BP92120...is mRNA. clone: YMU001_000147_A04. Accession BP921209 Tissue type prothallium Developmental stage - Contig I...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92120...grams, Nucleic Acids Res. 25:3389-3402. Query= BP921209|Adiantum capillus-veneris mRNA, clone: YMU001_000147

  19. AcEST: BP912061 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_F01 532 Adiantum capillus-veneris mRNA. clone: YMU001_000012_F01. BP912061 - Show BP9120...is mRNA. clone: YMU001_000012_F01. Accession BP912061 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  20. AcEST: BP912036 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_C09 555 Adiantum capillus-veneris mRNA. clone: YMU001_000012_C09. BP912036 - Show BP9120...is mRNA. clone: YMU001_000012_C09. Accession BP912036 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP912036|Adiantum capillus-veneris mRNA, clone: YMU001_000012_C0... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912036|Adiantum capillus-ven

  1. AcEST: BP912065 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_F05 374 Adiantum capillus-veneris mRNA. clone: YMU001_000012_F05. BP912065 - Show BP912065 Clone id YMU001_000012_F05 Library YMU01 Length 374 Definition Adiantum capillus-veneris mRNA. clone: YMU001_000012_F05. Accession BP912065 ...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912065|Adiantum capillus-veneris mRNA, clone: YMU...programs, Nucleic Acids Res. 25:3389-3402. Query= BP912065|Adiantum capillus-vene

  2. AcEST: BP912025 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_B09 484 Adiantum capillus-veneris mRNA. clone: YMU001_000012_B09. BP9120...25 CL1441Contig1 Show BP912025 Clone id YMU001_000012_B09 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_B09. Accession BP912025 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  3. AcEST: BP912042 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_D05 541 Adiantum capillus-veneris mRNA. clone: YMU001_000012_D05. BP912042 - Show BP9120...is mRNA. clone: YMU001_000012_D05. Accession BP912042 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP912042|Adiantum capillus-veneris mRNA, clone: YMU001_000012_D05. (541 le...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912042|Adiantum capil

  4. AcEST: BP921208 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A03 436 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A03. BP921208 - Show BP92120...is mRNA. clone: YMU001_000147_A03. Accession BP921208 Tissue type prothallium Developmental stage - Contig I..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92120... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921208|Adiantum c

  5. AcEST: BP912056 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E08 538 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E08. BP912056 - Show BP9120...is mRNA. clone: YMU001_000012_E08. Accession BP912056 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912056|Adiantum capillus-veneris mRNA, clone... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  6. AcEST: BP921120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000146_A02 427 Adiantum capillus-veneris mRNA. clone: YMU001_000146_A02. BP921120 - Show BP921120...is mRNA. clone: YMU001_000146_A02. Accession BP921120 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP921120|Adiantum capillus-veneris mRNA, clone: ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921120|Adian

  7. AcEST: BP912007 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A01 574 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A01. BP912007 - Show BP9120...is mRNA. clone: YMU001_000012_A01. Accession BP912007 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP912007|Adiantum capillus-veneris mRNA, clone: YMU001_000012_A...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912007|Adiantum capillus-veneris

  8. AcEST: BP912009 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A03 561 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A03. BP912009 - Show BP9120...is mRNA. clone: YMU001_000012_A03. Accession BP912009 Tissue type prothallium Developmental stage - Contig I...s, Nucleic Acids Res. 25:3389-3402. Query= BP912009|Adiantum capillus-veneris mRNA, clone: YMU001_000012_A03... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912009|Adian

  9. AcEST: BP912030 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_C03 525 Adiantum capillus-veneris mRNA. clone: YMU001_000012_C03. BP912030 - Show BP9120...is mRNA. clone: YMU001_000012_C03. Accession BP912030 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912030|Ad...cids Res. 25:3389-3402. Query= BP912030|Adiantum capillus-veneris mRNA, clone: YMU001_000012_C03. (513 lette

  10. AcEST: BP912050 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E01 544 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E01. BP912050 - Show BP9120...is mRNA. clone: YMU001_000012_E01. Accession BP912050 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912050|Adiantum capillus-veneris mRNA, c.... 25:3389-3402. Query= BP912050|Adiantum capillus-veneris mRNA, clone: YMU001_000

  11. AcEST: BP912074 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_G05 524 Adiantum capillus-veneris mRNA. clone: YMU001_000012_G05. BP912074 - Show BP9120...is mRNA. clone: YMU001_000012_G05. Accession BP912074 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...ength = 1129 Score = 48.9 bits (115), Expect = 2e-04 Identities = 28/120 (23%), Positives = 64/120 (53%) Fra

  12. AcEST: BP912012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP9120...12 CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  13. AcEST: BP917117 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000096_B11 125 Adiantum capillus-veneris mRNA. clone: YMU001_000096_B11. BP917117... CL2704Contig1 Show BP917117 Clone id YMU001_000096_B11 Library YMU01 Length 125 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000096_B11. Accession BP917117 Tissue type prothallium Developmental stag...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917117...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917117

  14. AcEST: BP917177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_C05 471 Adiantum capillus-veneris mRNA. clone: YMU001_000097_C05. BP917177 - Show BP91717...is mRNA. clone: YMU001_000097_C05. Accession BP917177 Tissue type prothallium Developmental stage - Contig I...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917177|Adiantum capillus-veneris mRNA, clone: YMU...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917

  15. AcEST: BP920166 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G12 149 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G12. BP920166 - Show BP92016...is mRNA. clone: YMU001_000133_G12. Accession BP920166 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920166|Adiantum capillus-veneris

  16. AcEST: BP920169 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H03. BP920169 - Show BP92016...is mRNA. clone: YMU001_000133_H03. Accession BP920169 Tissue type prothallium Developmental stage - Contig I...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920169|Adiantum cap

  17. AcEST: BP920164 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G09 447 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G09. BP920164 - Show BP92016...is mRNA. clone: YMU001_000133_G09. Accession BP920164 Tissue type prothallium Developmental stage - Contig I...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920164|A...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920164|Adiantum cap

  18. AcEST: BP920163 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G08 372 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G08. BP92016...3 CL2472Contig1 Show BP920163 Clone id YMU001_000133_G08 Library YMU01 Length 372 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_G08. Accession BP920163 Tissue type prothallium Developmental stag...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920163|Adiantum cap... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920163|Adiantum capillus-veneris mRNA, clone: YM

  19. AcEST: BP920161 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G06. BP920161 - Show BP92016...is mRNA. clone: YMU001_000133_G06. Accession BP920161 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016

  20. AcEST: BP912016 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A10 262 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A10. BP912016 - Show BP912016...is mRNA. clone: YMU001_000012_A10. Accession BP912016 Tissue type prothallium Developmental stage - Contig I...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912016|Adiantum capillus-veneris mRNA, clone:.... 25:3389-3402. Query= BP912016|Adiantum capillus-veneris mRNA, clone: YMU001_000012_A10. (262 letters) Data

  1. AcEST: BP920165 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G11 301 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G11. BP920165 - Show BP92016...is mRNA. clone: YMU001_000133_G11. Accession BP920165 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920165...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016

  2. AcEST: BP920168 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H02 390 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H02. BP920168 - Show BP92016...is mRNA. clone: YMU001_000133_H02. Accession BP920168 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920168|Adiantum capillus-veneris mRNA,...c Acids Res. 25:3389-3402. Query= BP920168|Adiantum capillus-veneris mRNA, clone: YMU001_000133_H02. (390 le

  3. AcEST: BP920167 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H01 152 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H01. BP920167 - Show BP92016...is mRNA. clone: YMU001_000133_H01. Accession BP920167 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP920167|Adiantum capillus-veneris mRNA, clone: YMU...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920167

  4. AcEST: BP919001 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000120_A02 410 Adiantum capillus-veneris mRNA. clone: YMU001_000120_A02. BP919001... CL1112Contig1 Show BP919001 Clone id YMU001_000120_A02 Library YMU01 Length 410 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000120_A02. Accession BP919001 Tissue type prothallium Developmental stag...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919001|Adiantum capillus...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919001|Adiantum capillus-veneris mRNA, clone: YMU00

  5. AcEST: BP919941 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_H09 463 Adiantum capillus-veneris mRNA. clone: YMU001_000130_H09. BP91994...1 CL396Contig1 Show BP919941 Clone id YMU001_000130_H09 Library YMU01 Length 463 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000130_H09. Accession BP919941 Tissue type prothallium Developmental stage...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919941|Adiantum capi...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91994

  6. AcEST: BP919946 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A10 457 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A10. BP919946 - Show BP91994...is mRNA. clone: YMU001_000131_A10. Accession BP919946 Tissue type prothallium Developmental stage - Contig I...s Res. 25:3389-3402. Query= BP919946|Adiantum capillus-veneris mRNA, clone: YMU00...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919946|A

  7. AcEST: BP911994 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_G08 559 Adiantum capillus-veneris mRNA. clone: YMU001_000011_G08. BP911994... CL4209Contig1 Show BP911994 Clone id YMU001_000011_G08 Library YMU01 Length 559 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_G08. Accession BP911994 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911994|Adiantum ... programs, Nucleic Acids Res. 25:3389-3402. Query= BP911994|Adiantum capillus-veneris mRNA, clone: YMU001_00

  8. AcEST: BP919948 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A12 489 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A12. BP919948 - Show BP91994...is mRNA. clone: YMU001_000131_A12. Accession BP919948 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919948|Adia...leic Acids Res. 25:3389-3402. Query= BP919948|Adiantum capillus-veneris mRNA, clone: YMU001_000131_A12. (489

  9. AcEST: BP919943 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_H11 517 Adiantum capillus-veneris mRNA. clone: YMU001_000130_H11. BP919943 - Show BP91994...is mRNA. clone: YMU001_000130_H11. Accession BP919943 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP919943|Adiantum capillus-veneris mRNA, clone: YMU001_000130_H11. (493 le... Res. 25:3389-3402. Query= BP919943|Adiantum capillus-veneris mRNA, clone: YMU001

  10. AcEST: BP919949 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_B01 318 Adiantum capillus-veneris mRNA. clone: YMU001_000131_B01. BP91994...9 CL2311Contig1 Show BP919949 Clone id YMU001_000131_B01 Library YMU01 Length 318 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_B01. Accession BP919949 Tissue type prothallium Developmental stag...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91994...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91994

  11. AcEST: BP914147 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_D12 534 Adiantum capillus-veneris mRNA. clone: YMU001_000042_D12. BP914147 - Show BP91414...is mRNA. clone: YMU001_000042_D12. Accession BP914147 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91414...niprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching......................................ids Res. 25:3389-3402. Query= BP914147|Adiantum capillus-veneris mRNA, clone: YMU001_000042_D12. (534 letter

  12. AcEST: BP917711 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E02. BP917711 - Show BP9177...is mRNA. clone: YMU001_000104_E02. Accession BP917711 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP917711|Adiantum capillus-veneris mRNA, clone: YMU001_000104_E02. (534 letters) Dat...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917711|Adiantum capillus-ve

  13. AcEST: BP917703 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_D05 340 Adiantum capillus-veneris mRNA. clone: YMU001_000104_D05. BP9177...03 CL1948Contig1 Show BP917703 Clone id YMU001_000104_D05 Library YMU01 Length 340 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_D05. Accession BP917703 Tissue type prothallium Developmental stag...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917703|Adiantum capillus-veneris mRNA, clone: YMU00...ic Acids Res. 25:3389-3402. Query= BP917703|Adiantum capillus-veneris mRNA, clone

  14. AcEST: BP917787 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D11 582 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D11. BP917787 - Show BP9177...is mRNA. clone: YMU001_000105_D11. Accession BP917787 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917787|Adiantum capillus-veneris mRNA,...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  15. AcEST: BP917732 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_G02 305 Adiantum capillus-veneris mRNA. clone: YMU001_000104_G02. BP917732 - Show BP9177...is mRNA. clone: YMU001_000104_G02. Accession BP917732 Tissue type prothallium Developmental stage - Contig I...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917732|Adiantum capillus-veneris mRNA...ds Res. 25:3389-3402. Query= BP917732|Adiantum capillus-veneris mRNA, clone: YMU001_000104_G02. (305 letters

  16. AcEST: BP917756 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A08 493 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A08. BP917756 - Show BP9177...is mRNA. clone: YMU001_000105_A08. Accession BP917756 Tissue type prothallium Developmental stage - Contig I...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917756|Adi...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP917756|Adiantum capillus-veneris mRNA, clone: YMU001_00010

  17. AcEST: BP917783 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D07 525 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D07. BP917783 - Show BP9177...is mRNA. clone: YMU001_000105_D07. Accession BP917783 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP917783|Adiantum capillus-veneris mRNA, clone: YMU001_000105_D07. (525 letter...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  18. AcEST: BP917763 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_B06 159 Adiantum capillus-veneris mRNA. clone: YMU001_000105_B06. BP917763 - Show BP9177...is mRNA. clone: YMU001_000105_B06. Accession BP917763 Tissue type prothallium Developmental stage - Contig I...leic Acids Res. 25:3389-3402. Query= BP917763|Adiantum capillus-veneris mRNA, clo...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  19. AcEST: BP917796 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_E10 461 Adiantum capillus-veneris mRNA. clone: YMU001_000105_E10. BP9177...96 CL2065Contig1 Show BP917796 Clone id YMU001_000105_E10 Library YMU01 Length 461 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_E10. Accession BP917796 Tissue type prothallium Developmental stag...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917796|Adiantum capillus-...ids Res. 25:3389-3402. Query= BP917796|Adiantum capillus-veneris mRNA, clone: YMU

  20. AcEST: BP911772 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_A06 326 Adiantum capillus-veneris mRNA. clone: YMU001_000009_A06. BP911772 - Show BP91177...is mRNA. clone: YMU001_000009_A06. Accession BP911772 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91177...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91177

  1. AcEST: BP917735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_G07 461 Adiantum capillus-veneris mRNA. clone: YMU001_000104_G07. BP917735 - Show BP9177...is mRNA. clone: YMU001_000104_G07. Accession BP917735 Tissue type prothallium Developmental stage - Contig I...eic Acids Res. 25:3389-3402. Query= BP917735|Adiantum capillus-veneris mRNA, clon...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917735|Adiantum cap

  2. AcEST: BP911771 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_A05 478 Adiantum capillus-veneris mRNA. clone: YMU001_000009_A05. BP911771 - Show BP91177...is mRNA. clone: YMU001_000009_A05. Accession BP911771 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP911771|Adiantum capillus-veneris mRNA, clone... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911771|Adiantum capillus-veneri

  3. AcEST: BP917727 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_F09 528 Adiantum capillus-veneris mRNA. clone: YMU001_000104_F09. BP917727 - Show BP9177...is mRNA. clone: YMU001_000104_F09. Accession BP917727 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP917727|Adiantum capillus-veneris mRNA, clone: YMU001_000104_F09. (528 letters) D...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  4. AcEST: BP917741 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_H02 445 Adiantum capillus-veneris mRNA. clone: YMU001_000104_H02. BP917741 - Show BP9177...is mRNA. clone: YMU001_000104_H02. Accession BP917741 Tissue type prothallium Developmental stage - Contig I... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  5. AcEST: BP917752 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A04 422 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A04. BP917752 - Show BP9177...is mRNA. clone: YMU001_000105_A04. Accession BP917752 Tissue type prothallium Developmental stage - Contig I...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917752|Adiantum capillus-...ncharacterized protein OS=Vitis vinifera GN=VITISV_008296 PE=4 SV=1 Length = 1027 Score = 72.8 bits (177

  6. AcEST: BP917740 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_G12 396 Adiantum capillus-veneris mRNA. clone: YMU001_000104_G12. BP917740 - Show BP9177...is mRNA. clone: YMU001_000104_G12. Accession BP917740 Tissue type prothallium Developmental stage - Contig I...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917740|Adiantum capillus-veneris mR...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917740|Adiantum ...: 4 DLLKAYVTEVDQRDQWKNHSPLVEYVYNYSTHTSTRKTLFKVTEERLKIRLIVKTLG--K 177 D+L+A V +D +

  7. AcEST: BP917700 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_D02 544 Adiantum capillus-veneris mRNA. clone: YMU001_000104_D02. BP9177...00 CL272Contig1 Show BP917700 Clone id YMU001_000104_D02 Library YMU01 Length 544 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000104_D02. Accession BP917700 Tissue type prothallium Developmental stage... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917700|Adiantum capillus-ven...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917700|Adiantum capillus-vener

  8. AcEST: BP917712 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E03 514 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E03. BP917712 - Show BP9177...is mRNA. clone: YMU001_000104_E03. Accession BP917712 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917712|Adia...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917712|Adiantu...073 PE=4 SV=1 Length = 146 Score = 34.7 bits (78), Expect = 2.5 Identities = 22/91 (24%), Positives = 38/91

  9. AcEST: BP917747 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_H10 483 Adiantum capillus-veneris mRNA. clone: YMU001_000104_H10. BP917747 - Show BP9177...is mRNA. clone: YMU001_000104_H10. Accession BP917747 Tissue type prothallium Developmental stage - Contig I...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...s. 25:3389-3402. Query= BP917747|Adiantum capillus-veneris mRNA, clone: YMU001_000104_H10. (483 letters) Dat

  10. AcEST: BP917743 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_H04 524 Adiantum capillus-veneris mRNA. clone: YMU001_000104_H04. BP917743 - Show BP9177...is mRNA. clone: YMU001_000104_H04. Accession BP917743 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917743|Adiantum capi...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917743|Adiantum capillus-veneris mRNA, clo

  11. AcEST: BP917775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_C08 544 Adiantum capillus-veneris mRNA. clone: YMU001_000105_C08. BP917775 - Show BP9177...is mRNA. clone: YMU001_000105_C08. Accession BP917775 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917775|Adiantum capill

  12. AcEST: BP917780 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D03. BP917780 - Show BP9177...is mRNA. clone: YMU001_000105_D03. Accession BP917780 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917780|Ad...) Frame = +1 Query: 229 TLGN*FDLFGPPIRRLPF-WIVLWSILGLA*GGAC 330 TLG D+F P ++LP W+ LWS LG GG C Sbjct: 177

  13. AcEST: BP911775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_A09 285 Adiantum capillus-veneris mRNA. clone: YMU001_000009_A09. BP91177...5 CL2064Contig1 Show BP911775 Clone id YMU001_000009_A09 Library YMU01 Length 285 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000009_A09. Accession BP911775 Tissue type prothallium Developmental stag...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911775...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911775|Adiantum capillus

  14. AcEST: BP917799 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_F02 443 Adiantum capillus-veneris mRNA. clone: YMU001_000105_F02. BP917799 - Show BP9177...is mRNA. clone: YMU001_000105_F02. Accession BP917799 Tissue type prothallium Developmental stage - Contig I...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91779...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917799|Adiantum capillus

  15. AcEST: BP917718 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E11 470 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E11. BP917718 - Show BP9177...is mRNA. clone: YMU001_000104_E11. Accession BP917718 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917718|Adiantum capillus-veneris mRNA, clone: YMU0...es. 25:3389-3402. Query= BP917718|Adiantum capillus-veneris mRNA, clone: YMU001_000104_E11. (470 letters) Da

  16. AcEST: BP917785 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D09 516 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D09. BP917785 - Show BP9177...is mRNA. clone: YMU001_000105_D09. Accession BP917785 Tissue type prothallium Developmental stage - Contig I...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917785|Adiantum capillus-veneris mRNA,

  17. AcEST: BP917736 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_G08 378 Adiantum capillus-veneris mRNA. clone: YMU001_000104_G08. BP917736 - Show BP9177...is mRNA. clone: YMU001_000104_G08. Accession BP917736 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917736|Adiantum capillus-veneris... programs, Nucleic Acids Res. 25:3389-3402. Query= BP917736|Adiantum capillus-veneris mRNA, clone: YMU001_00

  18. AcEST: BP917708 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_D11 459 Adiantum capillus-veneris mRNA. clone: YMU001_000104_D11. BP9177...08 CL668Contig1 Show BP917708 Clone id YMU001_000104_D11 Library YMU01 Length 459 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000104_D11. Accession BP917708 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP917708|Adiantum capillus-vener...cids Res. 25:3389-3402. Query= BP917708|Adiantum capillus-veneris mRNA, clone: YMU001_000104_D11. (459 lette

  19. AcEST: BP916177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_C01 435 Adiantum capillus-veneris mRNA. clone: YMU001_000084_C01. BP916177 - Show BP916177...is mRNA. clone: YMU001_000084_C01. Accession BP916177 Tissue type prothallium Developmental stage - Contig I...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916177...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916177

  20. AcEST: BP917716 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E09 452 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E09. BP9177...16 CL2904Contig1 Show BP917716 Clone id YMU001_000104_E09 Library YMU01 Length 452 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_E09. Accession BP917716 Tissue type prothallium Developmental stag...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917716|Adiant...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  1. AcEST: BP917771 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_C03 433 Adiantum capillus-veneris mRNA. clone: YMU001_000105_C03. BP917771 - Show BP9177...is mRNA. clone: YMU001_000105_C03. Accession BP917771 Tissue type prothallium Developmental stage - Contig I...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  2. AcEST: BP921773 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_A04 367 Adiantum capillus-veneris mRNA. clone: YMU001_000154_A04. BP921773 - Show BP92177...is mRNA. clone: YMU001_000154_A04. Accession BP921773 Tissue type prothallium Developmental stage - Contig I... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921773|Adiantum capillus-ven...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP921773|Adiantum capillus-veneris mRNA, clone: YMU001_00015

  3. AcEST: BP921177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000146_F04 542 Adiantum capillus-veneris mRNA. clone: YMU001_000146_F04. BP921177 - Show BP921177...is mRNA. clone: YMU001_000146_F04. Accession BP921177 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP921177|Adiantum capillus-veneris mRNA, clone: YMU001_000146_F04....T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921177|Ad

  4. AcEST: BP921778 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_A09 262 Adiantum capillus-veneris mRNA. clone: YMU001_000154_A09. BP921778 - Show BP92177...is mRNA. clone: YMU001_000154_A09. Accession BP921778 Tissue type prothallium Developmental stage - Contig I...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92177...s, Nucleic Acids Res. 25:3389-3402. Query= BP921778|Adiantum capillus-veneris mRNA, clone: YMU001_000154_A09

  5. AcEST: BP917751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A03 466 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A03. BP9177...51 CL2236Contig1 Show BP917751 Clone id YMU001_000105_A03 Library YMU01 Length 466 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_A03. Accession BP917751 Tissue type prothallium Developmental stag...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917751|Adiantum..., Nucleic Acids Res. 25:3389-3402. Query= BP917751|Adiantum capillus-veneris mRNA, clone: YMU001_000105_A03.

  6. AcEST: BP917768 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_B12 509 Adiantum capillus-veneris mRNA. clone: YMU001_000105_B12. BP917768 - Show BP9177...is mRNA. clone: YMU001_000105_B12. Accession BP917768 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...Res. 25:3389-3402. Query= BP917768|Adiantum capillus-veneris mRNA, clone: YMU001_000105_B12. (509 letters) D

  7. AcEST: BP917792 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_E06 308 Adiantum capillus-veneris mRNA. clone: YMU001_000105_E06. BP917792 - Show BP9177...is mRNA. clone: YMU001_000105_E06. Accession BP917792 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP917792|Adiantum capillus-veneris mRNA, clone: YMU001_000105_E06. (308 l...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  8. AcEST: BP920125 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C12 422 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C12. BP920125 - Show BP92012...is mRNA. clone: YMU001_000133_C12. Accession BP920125 Tissue type prothallium Developmental stage - Contig I...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92012...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92012

  9. AcEST: BP920120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C05 434 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C05. BP920120 - Show BP92012...is mRNA. clone: YMU001_000133_C05. Accession BP920120 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920120|Ad...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920120|

  10. AcEST: BP920124 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C09 380 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C09. BP920124 - Show BP92012...is mRNA. clone: YMU001_000133_C09. Accession BP920124 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920124|Adiantum capillus-veneris ...ic Acids Res. 25:3389-3402. Query= BP920124|Adiantum capillus-veneris mRNA, clone: YMU001_000133_C09. (380 l

  11. AcEST: BP920127 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_D02 541 Adiantum capillus-veneris mRNA. clone: YMU001_000133_D02. BP92012...7 CL3843Contig1 Show BP920127 Clone id YMU001_000133_D02 Library YMU01 Length 541 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_D02. Accession BP920127 Tissue type prothallium Developmental stag...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920127|Adiantum capillus-ve... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920127|Adian

  12. AcEST: BP920121 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C06. BP920121 - Show BP92012...is mRNA. clone: YMU001_000133_C06. Accession BP920121 Tissue type prothallium Developmental stage - Contig I...ds Res. 25:3389-3402. Query= BP920121|Adiantum capillus-veneris mRNA, clone: YMU001_000133_C06. (542 letters...Res. 25:3389-3402. Query= BP920121|Adiantum capillus-veneris mRNA, clone: YMU001_000133_C06. (542 letters) D

  13. AcEST: BP920157 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G01 550 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G01. BP92015...7 CL541Contig1 Show BP920157 Clone id YMU001_000133_G01 Library YMU01 Length 550 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_G01. Accession BP920157 Tissue type prothallium Developmental stage...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920157|Adiantum capillus-veneris mRNA,...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920157|Adiantum capillus-veneris

  14. AcEST: BP920158 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G02 530 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G02. BP92015...8 CL188Contig1 Show BP920158 Clone id YMU001_000133_G02 Library YMU01 Length 530 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_G02. Accession BP920158 Tissue type prothallium Developmental stage.... 25:3389-3402. Query= BP920158|Adiantum capillus-veneris mRNA, clone: YMU001_000133_G02. (530 letters) Data... programs, Nucleic Acids Res. 25:3389-3402. Query= BP920158|Adiantum capillus-ven

  15. AcEST: BP920152 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F06 457 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F06. BP920152 - Show BP92015...is mRNA. clone: YMU001_000133_F06. Accession BP920152 Tissue type prothallium Developmental stage - Contig I...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920152|Adiantu...Res. 25:3389-3402. Query= BP920152|Adiantum capillus-veneris mRNA, clone: YMU001_

  16. AcEST: BP920159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G03 420 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G03. BP920159 - Show BP92015...is mRNA. clone: YMU001_000133_G03. Accession BP920159 Tissue type prothallium Developmental stage - Contig I... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92015... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92015

  17. AcEST: BP920153 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F08 540 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F08. BP920153 - Show BP92015...is mRNA. clone: YMU001_000133_F08. Accession BP920153 Tissue type prothallium Developmental stage - Contig I...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920153|Adiantum capillus-veneris mRNA, clone: YMU...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920153|Adiantum capillus-ve

  18. AcEST: BP920156 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F12 587 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F12. BP92015...6 CL200Contig1 Show BP920156 Clone id YMU001_000133_F12 Library YMU01 Length 587 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_F12. Accession BP920156 Tissue type prothallium Developmental stage...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920156...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920156|Adiantum

  19. AcEST: BP920150 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F04 550 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F04. BP920150 - Show BP92015...is mRNA. clone: YMU001_000133_F04. Accession BP920150 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920150|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F04. (550 lette...c Acids Res. 25:3389-3402. Query= BP920150|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F04. (550 le

  20. AcEST: BP919843 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G09 473 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G09. BP91984...3 CL2697Contig1 Show BP919843 Clone id YMU001_000129_G09 Library YMU01 Length 473 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_G09. Accession BP919843 Tissue type prothallium Developmental stag...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919843|Ad...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919843|Adiantum capillus-veneris

  1. AcEST: BP919842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G07 567 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G07. BP919842 - Show BP91984...is mRNA. clone: YMU001_000129_G07. Accession BP919842 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris m...c Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G07. (567 le

  2. AcEST: BP911984 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_F07 566 Adiantum capillus-veneris mRNA. clone: YMU001_000011_F07. BP911984... CL2332Contig1 Show BP911984 Clone id YMU001_000011_F07 Library YMU01 Length 566 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_F07. Accession BP911984 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911984|Adiantum capillus-veneris mR...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911984

  3. AcEST: BP919840 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G05 476 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G05. BP919840 - Show BP91984...is mRNA. clone: YMU001_000129_G05. Accession BP919840 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP919840|Adiantum capillus-veneris mRNA, clone: YMU001_...es. 25:3389-3402. Query= BP919840|Adiantum capillus-veneris mRNA, clone: YMU001_0

  4. AcEST: BP919847 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H01 512 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H01. BP919847 - Show BP91984...is mRNA. clone: YMU001_000129_H01. Accession BP919847 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91984...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919847|Adiantum capillus-veneris mRNA, clone: YMU0

  5. AcEST: BP919845 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G11 376 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G11. BP919845 - Show BP91984...is mRNA. clone: YMU001_000129_G11. Accession BP919845 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP919845|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G1...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919845|Adiantum capillus

  6. AcEST: BP919849 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H04 454 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H04. BP919849 - Show BP91984...is mRNA. clone: YMU001_000129_H04. Accession BP919849 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP919849|Adiantum capillus-veneris mRNA, clone: YMU001_00...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP919849|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  7. AcEST: BP918100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_F01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000109_F01. BP918100... CL8Contig1 Show BP918100 Clone id YMU001_000109_F01 Library YMU01 Length 496 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000109_F01. Accession BP918100 Tissue type prothallium Developmental stage -...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918100... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918100|Adia

  8. AcEST: BP914100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_H03 542 Adiantum capillus-veneris mRNA. clone: YMU001_000039_H03. BP914100 - Show BP914100...is mRNA. clone: YMU001_000039_H03. Accession BP914100 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP914100|Adiantum capillus-veneris mRNA, clone: YMU001_000039_H...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914100

  9. AcEST: BP912100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_B06 447 Adiantum capillus-veneris mRNA. clone: YMU001_000015_B06. BP912100 - Show BP912100...is mRNA. clone: YMU001_000015_B06. Accession BP912100 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP912100|Adiantum capillus-veneris mRNA, clone: YMU001_00...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912100|Adiantum capi

  10. AcEST: BP916100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000083_B04 427 Adiantum capillus-veneris mRNA. clone: YMU001_000083_B04. BP916100... CL115Contig1 Show BP916100 Clone id YMU001_000083_B04 Library YMU01 Length 427 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000083_B04. Accession BP916100 Tissue type prothallium Developmental stage...s, Nucleic Acids Res. 25:3389-3402. Query= BP916100|Adiantum capillus-veneris mRN... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916100

  11. AcEST: BP921008 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E02 477 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E02. BP921008 - Show BP92100...is mRNA. clone: YMU001_000144_E02. Accession BP921008 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP921008|Adiantum capillus-veneris mRNA, clone:...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921008|Adiantum capillus-

  12. AcEST: BP914062 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D10 340 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D10. BP914062 - Show BP91406...is mRNA. clone: YMU001_000039_D10. Accession BP914062 Tissue type prothallium Developmental stage - Contig I...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406

  13. AcEST: BP914064 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D12 560 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D12. BP91406...4 CL532Contig1 Show BP914064 Clone id YMU001_000039_D12 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_D12. Accession BP914064 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adiantum capillus-vener...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adi

  14. AcEST: BP921406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000149_E02 542 Adiantum capillus-veneris mRNA. clone: YMU001_000149_E02. BP921406... CL4001Contig1 Show BP921406 Clone id YMU001_000149_E02 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000149_E02. Accession BP921406 Tissue type prothallium Developmental stag...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921406|Adiantum capillus-veneris mRNA, cl...s Res. 25:3389-3402. Query= BP921406|Adiantum capillus-veneris mRNA, clone: YMU00

  15. AcEST: BP912406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_F09 348 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F09. BP912406... CL1894Contig1 Show BP912406 Clone id YMU001_000018_F09 Library YMU01 Length 348 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_F09. Accession BP912406 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406|Adiantum capillus-veneris mRNA...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406

  16. AcEST: BP914067 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E03 508 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E03. BP91406...7 CL855Contig1 Show BP914067 Clone id YMU001_000039_E03 Library YMU01 Length 508 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_E03. Accession BP914067 Tissue type prothallium Developmental stage...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914067|Adiantum capillus-veneris mRNA, c

  17. AcEST: BP914061 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D09 599 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D09. BP91406...1 CL1730Contig1 Show BP914061 Clone id YMU001_000039_D09 Library YMU01 Length 599 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D09. Accession BP914061 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adia...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adiantum capillus-veneris mRNA, c

  18. AcEST: BP914406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_E09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E09. BP914406... CL513Contig1 Show BP914406 Clone id YMU001_000058_E09 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000058_E09. Accession BP914406 Tissue type prothallium Developmental stage...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406|Adiantum capillus...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406

  19. AcEST: BP920406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000136_G02 527 Adiantum capillus-veneris mRNA. clone: YMU001_000136_G02. BP920406 - Show BP920406...is mRNA. clone: YMU001_000136_G02. Accession BP920406 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920406|Adiantum capillus-veneris mRNA, clone...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920406|Adiantum capillus-veneris mRNA, c

  20. AcEST: BP914063 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D11 515 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D11. BP914063 - Show BP91406...is mRNA. clone: YMU001_000039_D11. Accession BP914063 Tissue type prothallium Developmental stage - Contig I...es. 25:3389-3402. Query= BP914063|Adiantum capillus-veneris mRNA, clone: YMU001_000039_D11. (515 letters) Da...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914063|Adiantum capillus-veneris mRN

  1. AcEST: BP916406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_D01 556 Adiantum capillus-veneris mRNA. clone: YMU001_000087_D01. BP916406... CL1913Contig1 Show BP916406 Clone id YMU001_000087_D01 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_D01. Accession BP916406 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capill...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capillus-veneris mRNA, c

  2. AcEST: BP914068 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E04 420 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E04. BP914068 - Show BP91406...is mRNA. clone: YMU001_000039_E04. Accession BP914068 Tissue type prothallium Developmental stage - Contig I...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914068|Adiantum capillus-veneris mRNA, clone:

  3. AcEST: BP913406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_H06 570 Adiantum capillus-veneris mRNA. clone: YMU001_000029_H06. BP913406 - Show BP913406...is mRNA. clone: YMU001_000029_H06. Accession BP913406 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capillus-veneris mRNA, clone: YMU00...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capil...LDVTRGLVNGARGVVVAFES--GKHG---------------LPH 406 Query: 387 VRFACNRAEIVIGPDRQTVESGGMQVARRIQVPLILAWALSVHKCQGM

  4. AcEST: BP915406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_B11 433 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B11. BP915406 - Show BP915406...is mRNA. clone: YMU001_000071_B11. Accession BP915406 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: Y...leic Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B11. (433

  5. AcEST: BP912343 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A05 305 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A05. BP912343 - Show BP91234...is mRNA. clone: YMU001_000018_A05. Accession BP912343 Tissue type prothallium Developmental stage - Contig I... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91234...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912343|Adiantum capill

  6. AcEST: BP912346 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A08 453 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A08. BP912346 - Show BP91234...is mRNA. clone: YMU001_000018_A08. Accession BP912346 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP912346|Adiantum capillus-veneris mRNA, clone...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91234

  7. AcEST: BP912344 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A06 486 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A06. BP91234...4 CL599Contig1 Show BP912344 Clone id YMU001_000018_A06 Library YMU01 Length 486 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000018_A06. Accession BP912344 Tissue type prothallium Developmental stage... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912344|Adiantum capil...leic Acids Res. 25:3389-3402. Query= BP912344|Adiantum capillus-veneris mRNA, clone: YMU001_000018_A06. (468

  8. AcEST: BP912340 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A02 465 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A02. BP91234...0 CL1330Contig1 Show BP912340 Clone id YMU001_000018_A02 Library YMU01 Length 465 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_A02. Accession BP912340 Tissue type prothallium Developmental stag...Nucleic Acids Res. 25:3389-3402. Query= BP912340|Adiantum capillus-veneris mRNA, ...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91234

  9. AcEST: BP912349 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A11 539 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A11. BP912349 - Show BP91234...is mRNA. clone: YMU001_000018_A11. Accession BP912349 Tissue type prothallium Developmental stage - Contig I... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91234...ucleic Acids Res. 25:3389-3402. Query= BP912349|Adiantum capillus-veneris mRNA, clone: YMU001_000018_A11. (5

  10. AcEST: BP912342 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A04 553 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A04. BP91234...2 CL2124Contig1 Show BP912342 Clone id YMU001_000018_A04 Library YMU01 Length 553 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_A04. Accession BP912342 Tissue type prothallium Developmental stag...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912342|Adiantum capillus-veneris mRNA, clone:...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912342|Adiantum capillus-

  11. AcEST: BP919367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_C07 523 Adiantum capillus-veneris mRNA. clone: YMU001_000124_C07. BP919367... CL601Contig1 Show BP919367 Clone id YMU001_000124_C07 Library YMU01 Length 523 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000124_C07. Accession BP919367 Tissue type prothallium Developmental stage...es. 25:3389-3402. Query= BP919367|Adiantum capillus-veneris mRNA, clone: YMU001_000124_C07. (523 letters) Da...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919367|Adiantum ca

  12. AcEST: BP914367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_B03 578 Adiantum capillus-veneris mRNA. clone: YMU001_000058_B03. BP914367 - Show BP914367...is mRNA. clone: YMU001_000058_B03. Accession BP914367 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914367|Adiantum ...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914367|

  13. AcEST: BP913671 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A02 620 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A02. BP913671 - Show BP91367...is mRNA. clone: YMU001_000033_A02. Accession BP913671 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP913671|Adiantum capillus-veneris mRNA, clone: YMU001_000033_A02. ...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913671|Adiantum capillus-veneris mRNA, c

  14. AcEST: BP913676 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A07 497 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A07. BP913676 - Show BP91367...is mRNA. clone: YMU001_000033_A07. Accession BP913676 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP913676|Adiantum capillus-ven...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913676|Adiantum capillus-veneris mRNA, clone:

  15. AcEST: BP913367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_E01 457 Adiantum capillus-veneris mRNA. clone: YMU001_000029_E01. BP913367 - Show BP913367...is mRNA. clone: YMU001_000029_E01. Accession BP913367 Tissue type prothallium Developmental stage - Contig I...leic Acids Res. 25:3389-3402. Query= BP913367|Adiantum capillus-veneris mRNA, clo...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913367

  16. AcEST: BP913675 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A06 440 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A06. BP913675 - Show BP91367...is mRNA. clone: YMU001_000033_A06. Accession BP913675 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP913675|Adiantum capillus-veneris mRNA,...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91367

  17. AcEST: BP913677 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A08 517 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A08. BP913677 - Show BP91367...is mRNA. clone: YMU001_000033_A08. Accession BP913677 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91367...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91367

  18. AcEST: BP913679 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A11 505 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A11. BP91367...9 CL11Contig1 Show BP913679 Clone id YMU001_000033_A11 Library YMU01 Length 505 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000033_A11. Accession BP913679 Tissue type prothallium Developmental stage ...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91367...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913679|Adiantum cap

  19. AcEST: BP920367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000136_C07 537 Adiantum capillus-veneris mRNA. clone: YMU001_000136_C07. BP920367 - Show BP920367...is mRNA. clone: YMU001_000136_C07. Accession BP920367 Tissue type prothallium Developmental stage - Contig I...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920367...grams, Nucleic Acids Res. 25:3389-3402. Query= BP920367|Adiantum capillus-veneris mRNA, clone: YMU001_000136

  20. AcEST: BP913674 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A05 472 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A05. BP913674 - Show BP91367...is mRNA. clone: YMU001_000033_A05. Accession BP913674 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP913674|Adiantum capillus-veneris mRNA, cl...rams, Nucleic Acids Res. 25:3389-3402. Query= BP913674|Adiantum capillus-veneris mRNA, clone: YMU001_000033_

  1. AcEST: BP913672 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A03 488 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A03. BP913672 - Show BP91367...is mRNA. clone: YMU001_000033_A03. Accession BP913672 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913672|Adiantum cap...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913672|Adiantum capillus-

  2. AcEST: BP913678 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A10 511 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A10. BP913678 - Show BP91367...is mRNA. clone: YMU001_000033_A10. Accession BP913678 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP913678|Adiantum capillus-veneris mRNA, clone: YMU001_000033_A10. (511 l...s Res. 25:3389-3402. Query= BP913678|Adiantum capillus-veneris mRNA, clone: YMU001_000033_A10. (511 letters)

  3. AcEST: BP918367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_F09 563 Adiantum capillus-veneris mRNA. clone: YMU001_000112_F09. BP918367 - Show BP918367...is mRNA. clone: YMU001_000112_F09. Accession BP918367 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP918367|Adiantum capillus-veneris mRNA, clone: YMU001_000112_F09. (5...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918367|Adiantum capillus-veneris

  4. AcEST: BP919775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_A08 507 Adiantum capillus-veneris mRNA. clone: YMU001_000129_A08. BP919775 - Show BP919775...is mRNA. clone: YMU001_000129_A08. Accession BP919775 Tissue type prothallium Developmental stage - Contig I...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP919775|Adiantum capillus-ve... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919775|Adiantum capillus-veneris mRNA,

  5. AcEST: BP916775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000091_D11 369 Adiantum capillus-veneris mRNA. clone: YMU001_000091_D11. BP916775 - Show BP916775...is mRNA. clone: YMU001_000091_D11. Accession BP916775 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP916775|Adiantum capillus-veneris mRNA, clone: YMU001_000091_...programs, Nucleic Acids Res. 25:3389-3402. Query= BP916775|Adiantum capillus-veneris mRNA, clone: YMU001_000

  6. AcEST: BP917753 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A05 482 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A05. BP91775...3 CL2810Contig1 Show BP917753 Clone id YMU001_000105_A05 Library YMU01 Length 482 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_A05. Accession BP917753 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917753|Adiant...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917753|Adiantum capillus

  7. AcEST: BP914775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000062_G03 488 Adiantum capillus-veneris mRNA. clone: YMU001_000062_G03. BP914775... CL4173Contig1 Show BP914775 Clone id YMU001_000062_G03 Library YMU01 Length 488 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000062_G03. Accession BP914775 Tissue type prothallium Developmental stag...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914775...leic Acids Res. 25:3389-3402. Query= BP914775|Adiantum capillus-veneris mRNA, clo

  8. AcEST: BP920775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000141_D06 589 Adiantum capillus-veneris mRNA. clone: YMU001_000141_D06. BP920775 - Show BP920775...is mRNA. clone: YMU001_000141_D06. Accession BP920775 Tissue type prothallium Developmental stage - Contig I...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920775|Adi...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920775|Adiantum capillus-veneris mRNA, clone: YMU001_000141_D0

  9. AcEST: BP917750 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A02 462 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A02. BP91775...0 CL3417Contig1 Show BP917750 Clone id YMU001_000105_A02 Library YMU01 Length 462 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_A02. Accession BP917750 Tissue type prothallium Developmental stag...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917750|Adiantu...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917750|Adiantum capillus-veneris mRNA, clone

  10. AcEST: BP915775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000076_F10 565 Adiantum capillus-veneris mRNA. clone: YMU001_000076_F10. BP915775 - Show BP915775...is mRNA. clone: YMU001_000076_F10. Accession BP915775 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915775|Adiantum capillus-veneris mRNA,...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915775|Adiantum capi

  11. AcEST: BP913775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000035_B05 311 Adiantum capillus-veneris mRNA. clone: YMU001_000035_B05. BP913775 - Show BP913775...is mRNA. clone: YMU001_000035_B05. Accession BP913775 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913775|Adiantum capillus...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913775

  12. AcEST: BP917758 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A12 315 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A12. BP91775...8 CL2869Contig1 Show BP917758 Clone id YMU001_000105_A12 Library YMU01 Length 315 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_A12. Accession BP917758 Tissue type prothallium Developmental stag... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91775...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP917758|Adiantum capillus-vener

  13. AcEST: BP919802 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C12. BP919802 - Show BP91980...is mRNA. clone: YMU001_000129_C12. Accession BP919802 Tissue type prothallium Developmental stage - Contig I...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP919802|Adiantum capillus-ve...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91980

  14. AcEST: BP919804 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_D02 242 Adiantum capillus-veneris mRNA. clone: YMU001_000129_D02. BP91980...4 CL1786Contig1 Show BP919804 Clone id YMU001_000129_D02 Library YMU01 Length 242 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_D02. Accession BP919804 Tissue type prothallium Developmental stag...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919804|Adiantum capillus-veneris m...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919804|Adiantum capillus-veneris m

  15. AcEST: BP919807 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_D05 485 Adiantum capillus-veneris mRNA. clone: YMU001_000129_D05. BP91980...7 CL2558Contig1 Show BP919807 Clone id YMU001_000129_D05 Library YMU01 Length 485 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_D05. Accession BP919807 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91980...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919807|Adiantum

  16. AcEST: BP919805 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_D03 530 Adiantum capillus-veneris mRNA. clone: YMU001_000129_D03. BP919805 - Show BP91980...is mRNA. clone: YMU001_000129_D03. Accession BP919805 Tissue type prothallium Developmental stage - Contig I...s Res. 25:3389-3402. Query= BP919805|Adiantum capillus-veneris mRNA, clone: YMU001_000129_D03. (530 letters)...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919805|Adi

  17. AcEST: BP919803 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_D01 477 Adiantum capillus-veneris mRNA. clone: YMU001_000129_D01. BP91980...3 CL2549Contig1 Show BP919803 Clone id YMU001_000129_D01 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_D01. Accession BP919803 Tissue type prothallium Developmental stag...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91980...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91980

  18. AcEST: BP919808 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_D06 483 Adiantum capillus-veneris mRNA. clone: YMU001_000129_D06. BP919808 - Show BP91980...is mRNA. clone: YMU001_000129_D06. Accession BP919808 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919808|Adiantum capi...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91980

  19. AcEST: BP919809 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_D07 283 Adiantum capillus-veneris mRNA. clone: YMU001_000129_D07. BP919809 - Show BP91980...is mRNA. clone: YMU001_000129_D07. Accession BP919809 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919809|Adiantum capillus...rams, Nucleic Acids Res. 25:3389-3402. Query= BP919809|Adiantum capillus-veneris mRNA, clone: YMU001_000129_

  20. AcEST: BP919806 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_D04 576 Adiantum capillus-veneris mRNA. clone: YMU001_000129_D04. BP919806 - Show BP91980...is mRNA. clone: YMU001_000129_D04. Accession BP919806 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP919806|Adiantum capillus-veneris mRNA, clone: YMU001_000129_D04....ms, Nucleic Acids Res. 25:3389-3402. Query= BP919806|Adiantum capillus-veneris mR

  1. AcEST: BP919800 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C10 406 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C10. BP919800 - Show BP91980...is mRNA. clone: YMU001_000129_C10. Accession BP919800 Tissue type prothallium Developmental stage - Contig I... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919800|Adiantum capillus-veneri...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919800|Adiantum capillus-veneris mRNA, clon

  2. AcEST: BP921010 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E04 526 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E04. BP921010 - Show BP921010...is mRNA. clone: YMU001_000144_E04. Accession BP921010 Tissue type prothallium Developmental stage - Contig I...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921010|Adiantum capillus-veneris mRNA...programs, Nucleic Acids Res. 25:3389-3402. Query= BP921010|Adiantum capillus-veneris mRNA, clone: YMU001_000...002030-PA (Fragment) OS=Anopheles gambiae GN=AGAP002030 PE=4 SV=4 Length = 2210 S

  3. AcEST: BP913000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_C05 322 Adiantum capillus-veneris mRNA. clone: YMU001_000025_C05. BP913000... CL1177Contig1 Show BP913000 Clone id YMU001_000025_C05 Library YMU01 Length 322 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000025_C05. Accession BP913000 Tissue type prothallium Developmental stag.... 25:3389-3402. Query= BP913000|Adiantum capillus-veneris mRNA, clone: YMU001_000025_C05. (322 letters) Data...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913000|Adiantum capill

  4. AcEST: BP921016 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E10 528 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E10. BP92101...6 CL35Contig1 Show BP921016 Clone id YMU001_000144_E10 Library YMU01 Length 528 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_E10. Accession BP921016 Tissue type prothallium Developmental stage ... Res. 25:3389-3402. Query= BP921016|Adiantum capillus-veneris mRNA, clone: YMU001... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921016|Adia

  5. AcEST: BP919713 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C09 384 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C09. BP919713 - Show BP91971...is mRNA. clone: YMU001_000128_C09. Accession BP919713 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919713|Adiantum capillus-veneris mRNA, c...rams, Nucleic Acids Res. 25:3389-3402. Query= BP919713|Adiantum capillus-veneris

  6. AcEST: BP911971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_E04 469 Adiantum capillus-veneris mRNA. clone: YMU001_000011_E04. BP911971... CL204Contig1 Show BP911971 Clone id YMU001_000011_E04 Library YMU01 Length 469 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000011_E04. Accession BP911971 Tissue type prothallium Developmental stage..., Nucleic Acids Res. 25:3389-3402. Query= BP911971|Adiantum capillus-veneris mRNA...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911971|Adiantum capillus-veneris mRNA,

  7. AcEST: BP919715 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C11 494 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C11. BP91971...5 CL3828Contig1 Show BP919715 Clone id YMU001_000128_C11 Library YMU01 Length 494 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_C11. Accession BP919715 Tissue type prothallium Developmental stag...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91971... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919715|Adia

  8. AcEST: BP919717 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_D01 387 Adiantum capillus-veneris mRNA. clone: YMU001_000128_D01. BP919717 - Show BP91971...is mRNA. clone: YMU001_000128_D01. Accession BP919717 Tissue type prothallium Developmental stage - Contig I...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919717|Adiantum capill... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919717|Adiantum capillus-veneris mRNA, clone: YMU001_00

  9. AcEST: BP919711 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C07 523 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C07. BP919711 - Show BP91971...is mRNA. clone: YMU001_000128_C07. Accession BP919711 Tissue type prothallium Developmental stage - Contig I...eic Acids Res. 25:3389-3402. Query= BP919711|Adiantum capillus-veneris mRNA, clone: YMU001_000128_C07. (523 ... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919711|Adiantum capillus-ven

  10. AcEST: BP914460 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_B08 541 Adiantum capillus-veneris mRNA. clone: YMU001_000059_B08. BP914460 - Show BP9144...is mRNA. clone: YMU001_000059_B08. Accession BP914460 Tissue type prothallium Developmental stage - Contig I...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914460|Adiantum capil...VVFASKVPNDRMSLFSIECKEQGNLHQRDEFFLKSDDANC 143 Query: 383 LLLFPMRTSHLASPFQETTSCS 448 L H P+ +CS Sbjct: 144 YLY

  11. AcEST: BP914403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_E06 616 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E06. BP914403 - Show BP9144...is mRNA. clone: YMU001_000058_E06. Accession BP914403 Tissue type prothallium Developmental stage - Contig I...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91440... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914403|Adiantum capillus-veneris mRNA, clone: YM

  12. AcEST: BP914472 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_C09 554 Adiantum capillus-veneris mRNA. clone: YMU001_000059_C09. BP9144...72 CL1425Contig1 Show BP914472 Clone id YMU001_000059_C09 Library YMU01 Length 554 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_C09. Accession BP914472 Tissue type prothallium Developmental stag...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914472|Adiantum capillus-ve...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144

  13. AcEST: BP914492 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_E05 529 Adiantum capillus-veneris mRNA. clone: YMU001_000059_E05. BP914492 - Show BP9144...is mRNA. clone: YMU001_000059_E05. Accession BP914492 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914492|Adiantum capillus-ven

  14. AcEST: BP914495 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_E08 565 Adiantum capillus-veneris mRNA. clone: YMU001_000059_E08. BP914495 - Show BP9144...is mRNA. clone: YMU001_000059_E08. Accession BP914495 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914495|Adiantum capillus-veneris mRNA, clone: YMU001_...VAAEAKDDELKANIQDVE-------KDEDGKEHKDT 144 Query: 394 SFRLYDGKSEPESLQSSDQDSFKKPTEIS...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914495|Adiantum capillus-ve

  15. AcEST: BP914410 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_F01 608 Adiantum capillus-veneris mRNA. clone: YMU001_000058_F01. BP914410 - Show BP9144...is mRNA. clone: YMU001_000058_F01. Accession BP914410 Tissue type prothallium Developmental stage - Contig I...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144

  16. AcEST: BP918144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_A12 555 Adiantum capillus-veneris mRNA. clone: YMU001_000110_A12. BP918144 - Show BP918144...is mRNA. clone: YMU001_000110_A12. Accession BP918144 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP918144|Adiantum capillus-veneris mRNA, clone: YMU001_000110_... Nucleic Acids Res. 25:3389-3402. Query= BP918144|Adiantum capillus-veneris mRNA, clone: YMU001_000110_A12.

  17. AcEST: BP914423 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_G03 431 Adiantum capillus-veneris mRNA. clone: YMU001_000058_G03. BP914423 - Show BP9144...is mRNA. clone: YMU001_000058_G03. Accession BP914423 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP914423|Adiantum capillus-veneris mRNA, clone: YM... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914423|Adiantum capillus-veneris mRNA,

  18. AcEST: BP921144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000146_C05 517 Adiantum capillus-veneris mRNA. clone: YMU001_000146_C05. BP921144 - Show BP921144...is mRNA. clone: YMU001_000146_C05. Accession BP921144 Tissue type prothallium Developmental stage - Contig I...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921144... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921144|Adiant

  19. AcEST: BP914464 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_B12 450 Adiantum capillus-veneris mRNA. clone: YMU001_000059_B12. BP914464 - Show BP9144...is mRNA. clone: YMU001_000059_B12. Accession BP914464 Tissue type prothallium Developmental stage - Contig I...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...Nucleic Acids Res. 25:3389-3402. Query= BP914464|Adiantum capillus-veneris mRNA, clone: YMU001_000059_B12. (

  20. AcEST: BP914427 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_G07 481 Adiantum capillus-veneris mRNA. clone: YMU001_000058_G07. BP914427 - Show BP9144...is mRNA. clone: YMU001_000058_G07. Accession BP914427 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...CVPADI 473 Query: 284 AEPGKLDEMFERMDTNNDGRVSFEEFKDAMQLDQSLRKAVLSPLERV 144 EPGKLDE+F++MD N+DG V+F+EFK AMQ D S...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914427|Adiantum ca

  1. AcEST: BP914463 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_B11 587 Adiantum capillus-veneris mRNA. clone: YMU001_000059_B11. BP9144...63 CL3104Contig1 Show BP914463 Clone id YMU001_000059_B11 Library YMU01 Length 587 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_B11. Accession BP914463 Tissue type prothallium Developmental stag...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914463|Adiantu...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914463|Adiantum capillus-veneris

  2. AcEST: BP914450 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_A10 499 Adiantum capillus-veneris mRNA. clone: YMU001_000059_A10. BP9144...50 CL3143Contig1 Show BP914450 Clone id YMU001_000059_A10 Library YMU01 Length 499 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_A10. Accession BP914450 Tissue type prothallium Developmental stag...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144

  3. AcEST: BP914476 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_D01 391 Adiantum capillus-veneris mRNA. clone: YMU001_000059_D01. BP9144...76 CL2162Contig1 Show BP914476 Clone id YMU001_000059_D01 Library YMU01 Length 391 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_D01. Accession BP914476 Tissue type prothallium Developmental stag...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914476|Adiantu...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914476

  4. AcEST: BP916144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000083_F08 124 Adiantum capillus-veneris mRNA. clone: YMU001_000083_F08. BP916144... CL2703Contig1 Show BP916144 Clone id YMU001_000083_F08 Library YMU01 Length 124 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000083_F08. Accession BP916144 Tissue type prothallium Developmental stag...Res. 25:3389-3402. Query= BP916144|Adiantum capillus-veneris mRNA, clone: YMU001_...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916144|Adi

  5. AcEST: BP915144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_A07 184 Adiantum capillus-veneris mRNA. clone: YMU001_000067_A07. BP915144... CL2423Contig1 Show BP915144 Clone id YMU001_000067_A07 Library YMU01 Length 184 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000067_A07. Accession BP915144 Tissue type prothallium Developmental stag...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915144...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915144|Adiantum capillus

  6. AcEST: BP914486 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_D11 638 Adiantum capillus-veneris mRNA. clone: YMU001_000059_D11. BP914486 - Show BP9144...is mRNA. clone: YMU001_000059_D11. Accession BP914486 Tissue type prothallium Developmental stage - Contig I...leic Acids Res. 25:3389-3402. Query= BP914486|Adiantum capillus-veneris mRNA, clone: YMU001_000059_D11. (613...ms, Nucleic Acids Res. 25:3389-3402. Query= BP914486|Adiantum capillus-veneris mRNA, clone: YMU001_000059_D1

  7. AcEST: BP914467 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_C03 510 Adiantum capillus-veneris mRNA. clone: YMU001_000059_C03. BP914467 - Show BP9144...is mRNA. clone: YMU001_000059_C03. Accession BP914467 Tissue type prothallium Developmental stage - Contig I... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...Res. 25:3389-3402. Query= BP914467|Adiantum capillus-veneris mRNA, clone: YMU001_

  8. AcEST: BP911440 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000005_A06 228 Adiantum capillus-veneris mRNA. clone: YMU001_000005_A06. BP911440 - Show BP91144...is mRNA. clone: YMU001_000005_A06. Accession BP911440 Tissue type prothallium Developmental stage - Contig I...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91144...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91144

  9. AcEST: BP914466 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_C02 620 Adiantum capillus-veneris mRNA. clone: YMU001_000059_C02. BP914466 - Show BP9144...is mRNA. clone: YMU001_000059_C02. Accession BP914466 Tissue type prothallium Developmental stage - Contig I...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914466|Adiantum capillus-vener... Acids Res. 25:3389-3402. Query= BP914466|Adiantum capillus-veneris mRNA, clone:

  10. AcEST: BP914462 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_B10 524 Adiantum capillus-veneris mRNA. clone: YMU001_000059_B10. BP914462 - Show BP9144...is mRNA. clone: YMU001_000059_B10. Accession BP914462 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144

  11. AcEST: BP914474 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_C11 492 Adiantum capillus-veneris mRNA. clone: YMU001_000059_C11. BP9144...74 CL2234Contig1 Show BP914474 Clone id YMU001_000059_C11 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_C11. Accession BP914474 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914474|Adiantum capillus-veneris mRNA, cl

  12. AcEST: BP914456 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_B04 299 Adiantum capillus-veneris mRNA. clone: YMU001_000059_B04. BP9144...56 CL787Contig1 Show BP914456 Clone id YMU001_000059_B04 Library YMU01 Length 299 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000059_B04. Accession BP914456 Tissue type prothallium Developmental stage... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914456|Adiantum capillus-ven

  13. AcEST: BP914452 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_A12 535 Adiantum capillus-veneris mRNA. clone: YMU001_000059_A12. BP914452 - Show BP9144...is mRNA. clone: YMU001_000059_A12. Accession BP914452 Tissue type prothallium Developmental stage - Contig I...leic Acids Res. 25:3389-3402. Query= BP914452|Adiantum capillus-veneris mRNA, clone: YMU001_000059_A12. (535...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914452|Adiantum ca

  14. AcEST: BP914444 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_A03 493 Adiantum capillus-veneris mRNA. clone: YMU001_000059_A03. BP9144...44 CL1628Contig1 Show BP914444 Clone id YMU001_000059_A03 Library YMU01 Length 493 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_A03. Accession BP914444 Tissue type prothallium Developmental stag...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914444|Adiantum capillus-veneri

  15. AcEST: BP914454 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_B02 618 Adiantum capillus-veneris mRNA. clone: YMU001_000059_B02. BP914454 - Show BP9144...is mRNA. clone: YMU001_000059_B02. Accession BP914454 Tissue type prothallium Developmental stage - Contig I...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...ms, Nucleic Acids Res. 25:3389-3402. Query= BP914454|Adiantum capillus-veneris mR

  16. AcEST: BP914488 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_E01 492 Adiantum capillus-veneris mRNA. clone: YMU001_000059_E01. BP9144...88 CL2008Contig1 Show BP914488 Clone id YMU001_000059_E01 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_E01. Accession BP914488 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914488|Ad

  17. AcEST: BP914487 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_D12 521 Adiantum capillus-veneris mRNA. clone: YMU001_000059_D12. BP914487 - Show BP9144...is mRNA. clone: YMU001_000059_D12. Accession BP914487 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914487|...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144

  18. AcEST: BP914496 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_E09 561 Adiantum capillus-veneris mRNA. clone: YMU001_000059_E09. BP9144...96 CL1745Contig1 Show BP914496 Clone id YMU001_000059_E09 Library YMU01 Length 561 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_E09. Accession BP914496 Tissue type prothallium Developmental stag...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914496|Adiantu...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914496|Adiantum capillus-veneris

  19. AcEST: BP914443 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_A02 529 Adiantum capillus-veneris mRNA. clone: YMU001_000059_A02. BP9144...43 CL1901Contig1 Show BP914443 Clone id YMU001_000059_A02 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_A02. Accession BP914443 Tissue type prothallium Developmental stag...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144

  20. AcEST: BP912219 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_E07 496 Adiantum capillus-veneris mRNA. clone: YMU001_000016_E07. BP912219 - Show BP912219...is mRNA. clone: YMU001_000016_E07. Accession BP912219 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912219...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912219|Adiantum capillus-veneris mRNA, clone: Y

  1. AcEST: BP917432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_G02 450 Adiantum capillus-veneris mRNA. clone: YMU001_000100_G02. BP917432... CL1686Contig1 Show BP917432 Clone id YMU001_000100_G02 Library YMU01 Length 450 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_G02. Accession BP917432 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP917432|Adiantum capillus-veneris mRNA, clone: Y...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917432|Adiantum capillu

  2. AcEST: BP914326 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F07 599 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F07. BP91432...6 CL274Contig1 Show BP914326 Clone id YMU001_000057_F07 Library YMU01 Length 599 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000057_F07. Accession BP914326 Tissue type prothallium Developmental stage...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914326...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  3. AcEST: BP914321 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F02. BP914321 - Show BP91432...is mRNA. clone: YMU001_000057_F02. Accession BP914321 Tissue type prothallium Developmental stage - Contig I... 25:3389-3402. Query= BP914321|Adiantum capillus-veneris mRNA, clone: YMU001_000057_F02. (534 letters) Datab...leic Acids Res. 25:3389-3402. Query= BP914321|Adiantum capillus-veneris mRNA, clone: YMU001_000057_F02. (534

  4. AcEST: BP914432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_G12 488 Adiantum capillus-veneris mRNA. clone: YMU001_000058_G12. BP914432... CL2573Contig1 Show BP914432 Clone id YMU001_000058_G12 Library YMU01 Length 488 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000058_G12. Accession BP914432 Tissue type prothallium Developmental stag...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914432|...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914432|Adiantum ca

  5. AcEST: BP914324 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F05 457 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F05. BP91432...4 CL2609Contig1 Show BP914324 Clone id YMU001_000057_F05 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000057_F05. Accession BP914324 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914324|Adiantum capillus-vener...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  6. AcEST: BP913432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000030_B10 512 Adiantum capillus-veneris mRNA. clone: YMU001_000030_B10. BP913432 - Show BP913432...is mRNA. clone: YMU001_000030_B10. Accession BP913432 Tissue type prothallium Developmental stage - Contig I...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913432|Adiantum ... TY A +T+C Sbjct: 1417 TTVSPKTYTTATVTQC 1432 >sp|Q6ZRP5|YD019_HUMAN Putative uncharacterized protein FLJ4620...ucleic Acids Res. 25:3389-3402. Query= BP913432|Adiantum capillus-veneris mRNA, clone: YMU001_000030_B10. (5

  7. AcEST: BP914328 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F09 454 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F09. BP914328 - Show BP91432...is mRNA. clone: YMU001_000057_F09. Accession BP914328 Tissue type prothallium Developmental stage - Contig I...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  8. AcEST: BP914320 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F01 393 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F01. BP914320 - Show BP91432...is mRNA. clone: YMU001_000057_F01. Accession BP914320 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914320|Adiantum capillus-veneris mRNA, clone: Y...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  9. AcEST: BP920432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000137_A06 513 Adiantum capillus-veneris mRNA. clone: YMU001_000137_A06. BP920432 - Show BP920432...is mRNA. clone: YMU001_000137_A06. Accession BP920432 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920432...eic Acids Res. 25:3389-3402. Query= BP920432|Adiantum capillus-veneris mRNA, clone: YMU001_000137_A06. (513

  10. AcEST: BP918432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D10 502 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D10. BP918432... CL2516Contig1 Show BP918432 Clone id YMU001_000113_D10 Library YMU01 Length 502 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_D10. Accession BP918432 Tissue type prothallium Developmental stag...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918432...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918432|

  11. AcEST: BP921521 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000150_H10 495 Adiantum capillus-veneris mRNA. clone: YMU001_000150_H10. BP921521... CL1722Contig1 Show BP921521 Clone id YMU001_000150_H10 Library YMU01 Length 495 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000150_H10. Accession BP921521 Tissue type prothallium Developmental stag... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921521...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921521|Adia

  12. AcEST: BP921821 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_E10 497 Adiantum capillus-veneris mRNA. clone: YMU001_000154_E10. BP921821 - Show BP921821...is mRNA. clone: YMU001_000154_E10. Accession BP921821 Tissue type prothallium Developmental stage - Contig I...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921821|Adiantum capill...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921821|Adiantum capillus-veneris mRNA, clone: Y...ct: 159 PTSLIQPSIVTSKKEETGIDEIIRGMRDLQIKFAKLEEKGQSPRISTKQKPRLMEGVVHR 218 Query: 237 CIWCDSTDHGRRDC 196 C+WCD+ DH RR+C Sbjct: 21

  13. AcEST: BP921211 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A08 189 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A08. BP921211 - Show BP92121...is mRNA. clone: YMU001_000147_A08. Accession BP921211 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921211|Adiantum capillus-veneris... 25:3389-3402. Query= BP921211|Adiantum capillus-veneris mRNA, clone: YMU001_000147_A08. (189 letters) Datab

  14. AcEST: BP921219 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B05 600 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B05. BP92121...9 CL3191Contig1 Show BP921219 Clone id YMU001_000147_B05 Library YMU01 Length 600 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000147_B05. Accession BP921219 Tissue type prothallium Developmental stag...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921219|Adiantum capillus-...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92121

  15. AcEST: BP921021 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_F03 449 Adiantum capillus-veneris mRNA. clone: YMU001_000144_F03. BP921021... CL4025Contig1 Show BP921021 Clone id YMU001_000144_F03 Library YMU01 Length 449 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_F03. Accession BP921021 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP921021|Adiantum capillus-veneris mRNA, clone: Y...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921021|Adiantum capillus-veneris mRN

  16. AcEST: BP921216 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B01 347 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B01. BP921216 - Show BP92121...is mRNA. clone: YMU001_000147_B01. Accession BP921216 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP921216|Adiantum capillus-veneris mRNA, clone: YMU001_00...tities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 116 LLQTLIVTGYISFDEHLHNPHLSKHSALHITK 21 L LI...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92121

  17. AcEST: BP917474 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_C07 287 Adiantum capillus-veneris mRNA. clone: YMU001_000101_C07. BP917474... CL2332Contig1 Show BP917474 Clone id YMU001_000101_C07 Library YMU01 Length 287 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000101_C07. Accession BP917474 Tissue type prothallium Developmental stag...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917474|Adiantum capil...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917474|Adiantum capillus-veneris mRNA, clone: YMU001_

  18. AcEST: BP915910 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D05 543 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D05. BP915910 - Show BP91591...is mRNA. clone: YMU001_000079_D05. Accession BP915910 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP915910|Adiantum capillus-veneris mRNA, clone: YMU001_000079_D05. (543 letters) Data...s Res. 25:3389-3402. Query= BP915910|Adiantum capillus-veneris mRNA, clone: YMU00

  19. AcEST: BP915915 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D11 468 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D11. BP915915 - Show BP91591...is mRNA. clone: YMU001_000079_D11. Accession BP915915 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP915915|Adiantum capillus-ven...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91591

  20. AcEST: BP915919 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_E03 400 Adiantum capillus-veneris mRNA. clone: YMU001_000079_E03. BP91591...9 CL3486Contig1 Show BP915919 Clone id YMU001_000079_E03 Library YMU01 Length 400 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000079_E03. Accession BP915919 Tissue type prothallium Developmental stag...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91591...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915919|Adiant

  1. AcEST: BP921591 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000151_H01 458 Adiantum capillus-veneris mRNA. clone: YMU001_000151_H01. BP921591 - Show BP921591...is mRNA. clone: YMU001_000151_H01. Accession BP921591 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP921591|Adiantum capillus-veneris mRNA, clone: YMU001_000151_H0...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921591

  2. AcEST: BP915913 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D08 427 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D08. BP915913 - Show BP91591...is mRNA. clone: YMU001_000079_D08. Accession BP915913 Tissue type prothallium Developmental stage - Contig I...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91591...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91591

  3. AcEST: BP915917 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_E01 288 Adiantum capillus-veneris mRNA. clone: YMU001_000079_E01. BP915917 - Show BP91591...is mRNA. clone: YMU001_000079_E01. Accession BP915917 Tissue type prothallium Developmental stage - Contig I...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915917|Adiantum capillus-veneris mR...s Res. 25:3389-3402. Query= BP915917|Adiantum capillus-veneris mRNA, clone: YMU00

  4. AcEST: BP915911 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D06 571 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D06. BP91591...1 CL46Contig1 Show BP915911 Clone id YMU001_000079_D06 Library YMU01 Length 571 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000079_D06. Accession BP915911 Tissue type prothallium Developmental stage ...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915911|Adi... Res. 25:3389-3402. Query= BP915911|Adiantum capillus-veneris mRNA, clone: YMU001

  5. AcEST: BP915912 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D07 482 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D07. BP915912 - Show BP91591...is mRNA. clone: YMU001_000079_D07. Accession BP915912 Tissue type prothallium Developmental stage - Contig I...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915912|Adiantum capillus-veneris mR...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2...5:3389-3402. Query= BP915912|Adiantum capillus-veneris mRNA, clone: YMU001_000079_D07. (482 letters) Databas

  6. AcEST: BP911591 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000006_G06 296 Adiantum capillus-veneris mRNA. clone: YMU001_000006_G06. BP911591 - Show BP911591...is mRNA. clone: YMU001_000006_G06. Accession BP911591 Tissue type prothallium Developmental stage - Contig I...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911591|Adiantum capil...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911591|Adiantum capillus-vene

  7. AcEST: BP919218 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E11 400 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E11. BP919218 - Show BP91921...is mRNA. clone: YMU001_000122_E11. Accession BP919218 Tissue type prothallium Developmental stage - Contig I... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919218|Adiantum capillus-ven...leic Acids Res. 25:3389-3402. Query= BP919218|Adiantum capillus-veneris mRNA, clo

  8. AcEST: BP919216 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E09 388 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E09. BP919216 - Show BP91921...is mRNA. clone: YMU001_000122_E09. Accession BP919216 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919216|Adiantum cap...rams, Nucleic Acids Res. 25:3389-3402. Query= BP919216|Adiantum capillus-veneris

  9. AcEST: BP919213 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E06 293 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E06. BP919213 - Show BP91921...is mRNA. clone: YMU001_000122_E06. Accession BP919213 Tissue type prothallium Developmental stage - Contig I...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919213|Adiantu...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91921

  10. AcEST: BP919211 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E04 158 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E04. BP919211 - Show BP91921...is mRNA. clone: YMU001_000122_E04. Accession BP919211 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP919211|Adiantum capillus-veneris mRNA, clone: YMU001_000122_E04. (1...Nucleic Acids Res. 25:3389-3402. Query= BP919211|Adiantum capillus-veneris mRNA, clone: YMU001_000122_E04. (

  11. AcEST: BP919214 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E07 486 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E07. BP919214 - Show BP91921...is mRNA. clone: YMU001_000122_E07. Accession BP919214 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919214|Adiantum c...Nucleic Acids Res. 25:3389-3402. Query= BP919214|Adiantum capillus-veneris mRNA, clone: YMU001_000122_E07. (

  12. AcEST: BP919215 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E08 525 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E08. BP919215 - Show BP91921...is mRNA. clone: YMU001_000122_E08. Accession BP919215 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP919215|Adiantum capillus-veneris mRNA, clone: YMU001_000122_E08. (...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91921

  13. AcEST: BP919217 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E10 547 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E10. BP91921...7 CL1907Contig1 Show BP919217 Clone id YMU001_000122_E10 Library YMU01 Length 547 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000122_E10. Accession BP919217 Tissue type prothallium Developmental stag... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919217|Adiantum capillus-ven...ds Res. 25:3389-3402. Query= BP919217|Adiantum capillus-veneris mRNA, clone: YMU001_000122_E10. (547 letters

  14. AcEST: BP921220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B06 550 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B06. BP921220 - Show BP921220...is mRNA. clone: YMU001_000147_B06. Accession BP921220 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921220|Adiantum capillus-veneris mRNA, clone...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921220|Adiantum capillus-veneris mRNA, c

  15. AcEST: BP913220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_G12 489 Adiantum capillus-veneris mRNA. clone: YMU001_000027_G12. BP913220 - Show BP913220...is mRNA. clone: YMU001_000027_G12. Accession BP913220 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP913220|Adiantum capillus-veneris...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913220

  16. AcEST: BP915220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_H10 510 Adiantum capillus-veneris mRNA. clone: YMU001_000067_H10. BP915220 - Show BP915220...is mRNA. clone: YMU001_000067_H10. Accession BP915220 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915220...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915220|Adiantum capillus-veneris mRNA, clone: YMU

  17. AcEST: BP912220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_E08 357 Adiantum capillus-veneris mRNA. clone: YMU001_000016_E08. BP912220 - Show BP912220...is mRNA. clone: YMU001_000016_E08. Accession BP912220 Tissue type prothallium Developmental stage - Contig I...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912220...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912220

  18. AcEST: BP912209 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D06 540 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D06. BP912209 - Show BP91220...is mRNA. clone: YMU001_000016_D06. Accession BP912209 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912209|Adiantum capillus-veneris... programs, Nucleic Acids Res. 25:3389-3402. Query= BP912209|Adiantum capillus-veneris mRNA, clone: YMU001_00

  19. AcEST: BP912206 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D03 484 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D03. BP912206 - Show BP91220...is mRNA. clone: YMU001_000016_D03. Accession BP912206 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912206|Adiantum capi...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91220

  20. AcEST: BP917220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_G09 125 Adiantum capillus-veneris mRNA. clone: YMU001_000097_G09. BP917220 - Show BP917220...is mRNA. clone: YMU001_000097_G09. Accession BP917220 Tissue type prothallium Developmental stage - Contig I...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917220...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917220|Adiantum capillus-veneris

  1. AcEST: BP912207 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D04 249 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D04. BP912207 - Show BP91220...is mRNA. clone: YMU001_000016_D04. Accession BP912207 Tissue type prothallium Developmental stage - Contig I...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91220...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91220

  2. AcEST: BP912200 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_C08 572 Adiantum capillus-veneris mRNA. clone: YMU001_000016_C08. BP91220...0 CL3270Contig1 Show BP912200 Clone id YMU001_000016_C08 Library YMU01 Length 572 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_C08. Accession BP912200 Tissue type prothallium Developmental stag...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912200|Adiantum capillus-veneris mRNA, clo...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP912200|Adiantum capillus-vener

  3. AcEST: BP919411 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G09 152 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G09. BP919411 - Show BP91941...is mRNA. clone: YMU001_000124_G09. Accession BP919411 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP919411|Adiantum capillus-veneris mRNA, clone: YMU...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919411

  4. AcEST: BP919412 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G10 434 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G10. BP91941...2 CL2856Contig1 Show BP919412 Clone id YMU001_000124_G10 Library YMU01 Length 434 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000124_G10. Accession BP919412 Tissue type prothallium Developmental stag...ids Res. 25:3389-3402. Query= BP919412|Adiantum capillus-veneris mRNA, clone: YMU... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919412|Adiant

  5. AcEST: BP919415 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_H01 568 Adiantum capillus-veneris mRNA. clone: YMU001_000124_H01. BP919415 - Show BP91941...is mRNA. clone: YMU001_000124_H01. Accession BP919415 Tissue type prothallium Developmental stage - Contig I...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP919415|Adiantum capillus-veneris mRNA, clone: YMU001_00012...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91941

  6. AcEST: BP919416 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_H02 461 Adiantum capillus-veneris mRNA. clone: YMU001_000124_H02. BP91941...6 CL1302Contig1 Show BP919416 Clone id YMU001_000124_H02 Library YMU01 Length 461 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000124_H02. Accession BP919416 Tissue type prothallium Developmental stag... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919416|Adiantum capillus-ven...leic Acids Res. 25:3389-3402. Query= BP919416|Adiantum capillus-veneris mRNA, clo

  7. AcEST: BP919418 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_H05 528 Adiantum capillus-veneris mRNA. clone: YMU001_000124_H05. BP919418 - Show BP91941...is mRNA. clone: YMU001_000124_H05. Accession BP919418 Tissue type prothallium Developmental stage - Contig I...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91941...Acids Res. 25:3389-3402. Query= BP919418|Adiantum capillus-veneris mRNA, clone: Y

  8. AcEST: BP919417 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_H03 445 Adiantum capillus-veneris mRNA. clone: YMU001_000124_H03. BP919417 - Show BP91941...is mRNA. clone: YMU001_000124_H03. Accession BP919417 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP919417|Adiantum capillus-veneris mRNA, clone: YMU001_00.... 25:3389-3402. Query= BP919417|Adiantum capillus-veneris mRNA, clone: YMU001_000124_H03. (445 letters) Data

  9. AcEST: BP919413 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G11 518 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G11. BP919413 - Show BP91941...is mRNA. clone: YMU001_000124_G11. Accession BP919413 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919413|Adiantum capillu...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91941

  10. AcEST: BP920041 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_D04 403 Adiantum capillus-veneris mRNA. clone: YMU001_000132_D04. BP920041 - Show BP92004...is mRNA. clone: YMU001_000132_D04. Accession BP920041 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92004...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920041|Adiantum capillus

  11. AcEST: BP920048 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_D11 495 Adiantum capillus-veneris mRNA. clone: YMU001_000132_D11. BP920048 - Show BP92004...is mRNA. clone: YMU001_000132_D11. Accession BP920048 Tissue type prothallium Developmental stage - Contig I...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92004... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920048|Adia

  12. AcEST: BP920040 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_D03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000132_D03. BP920040 - Show BP92004...is mRNA. clone: YMU001_000132_D03. Accession BP920040 Tissue type prothallium Developmental stage - Contig I...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920040|Adiantum...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920040|Adiantum capillus-veneris

  13. AcEST: BP920046 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_D09 477 Adiantum capillus-veneris mRNA. clone: YMU001_000132_D09. BP92004...6 CL809Contig1 Show BP920046 Clone id YMU001_000132_D09 Library YMU01 Length 477 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000132_D09. Accession BP920046 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920046|Adiantum capillus-vener... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92004

  14. AcEST: BP920049 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_D12 529 Adiantum capillus-veneris mRNA. clone: YMU001_000132_D12. BP92004...9 CL2156Contig1 Show BP920049 Clone id YMU001_000132_D12 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000132_D12. Accession BP920049 Tissue type prothallium Developmental stag...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920049|Adiantum capillus-veneris mRNA, clone: ...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920049|Adiantum ca

  15. AcEST: BP920042 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_D05 442 Adiantum capillus-veneris mRNA. clone: YMU001_000132_D05. BP920042 - Show BP92004...is mRNA. clone: YMU001_000132_D05. Accession BP920042 Tissue type prothallium Developmental stage - Contig I...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92004...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9200

  16. AcEST: BP920044 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_D07 191 Adiantum capillus-veneris mRNA. clone: YMU001_000132_D07. BP920044 - Show BP92004...is mRNA. clone: YMU001_000132_D07. Accession BP920044 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920044|Ad...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920044|Adiantum capillus-veneris mRNA, clone: YMU001_

  17. AcEST: BP920043 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_D06 452 Adiantum capillus-veneris mRNA. clone: YMU001_000132_D06. BP920043 - Show BP92004...is mRNA. clone: YMU001_000132_D06. Accession BP920043 Tissue type prothallium Developmental stage - Contig I..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92004...25:3389-3402. Query= BP920043|Adiantum capillus-veneris mRNA, clone: YMU001_00013...1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res.

  18. AcEST: BP912004 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_H08 340 Adiantum capillus-veneris mRNA. clone: YMU001_000011_H08. BP912004... CL875Contig1 Show BP912004 Clone id YMU001_000011_H08 Library YMU01 Length 340 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000011_H08. Accession BP912004 Tissue type prothallium Developmental stage... Nucleic Acids Res. 25:3389-3402. Query= BP912004|Adiantum capillus-veneris mRNA, clone: YMU001_000011_H08. ...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912004|Adiantum capi

  19. AcEST: BP918818 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000117_G09 538 Adiantum capillus-veneris mRNA. clone: YMU001_000117_G09. BP918818 - Show BP918818...is mRNA. clone: YMU001_000117_G09. Accession BP918818 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP918818|Adiantum capillus-veneris mRNA, clone: YMU001_000117_G09. (525 letters) Dat...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918818|Adiantum capillus-veneris mRNA, clon

  20. Dicty_cDB: FC-BP14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BP14 (Link to dictyBase) - - - Contig-U15220-1 FC-BP14P (Li...nk to Original site) FC-BP14F 507 FC-BP14Z 675 FC-BP14P 1182 - - Show FC-BP14 Library FC (Link to library) Clone ID FC-BP1...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BP/FC-BP14Q.Seq.d/ Repr...esentative seq. ID FC-BP14P (Link to Original site) Representative DNA sequence >FC-BP14 (FC-BP14Q) /CSM/FC/FC-BP/FC-BP1... CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-BP14 (FC-BP14Q) /CSM/FC/FC-BP/FC-BP1

  1. Land surface temperature changes in Northern Iberia since 4000 yr BP, based on δ13C of speleothems

    Science.gov (United States)

    Martín-Chivelet, Javier; Muñoz-García, M. Belén; Edwards, R. Lawrence; Turrero, María J.; Ortega, Ana I.

    2011-05-01

    The surface temperature changes for the last 4000 years in northern inland Iberia (an area particularly sensitive to climate change) are determined by a high resolution study of carbon stable isotope records of stalagmites from three caves (Kaite, Cueva del Cobre, and Cueva Mayor) separated several tens of kilometers away in N Spain. Despite the local conditions of each cave, the isotopic series show a good overall coherence, and resulted to be strongly sensitive to surface temperature changes. The record reflects alternating warmer and colder intervals, always within a temperature range of 1.6 °C. The timing and duration of the intervals were provided by 43 230Th- 234U (ICP-MS) ages. Main climatic recognized periods are: (1) 3950-3000 yr BP: warm period punctuated by cool events around ~ 3950, 3550 and 3250 yr BP; (2) 2850-2500 yr BP cold interval (Iron Age Cold Period); (3) 2500-1650 yr BP moderate warm period (Roman Warm Period), with maximum temperatures between 2150 and 1750 yr BP; (4) 1650-1350 yr BP cold interval (Dark Ages Cold Period), with a thermal minimum at ~ 1500 yr BP; (5) 1350-750 yr BP warm period (Medieval Warm Period) punctuated by two cooler events at ~ 1250 and ~ 850 yr BP; (6) 750-100 yr BP cold period (Little Ice Age) with extremes occurring at 600-500 yr BP, 350-300 yr BP, and 150-100 yr BP; and (7) the last 150 years, characterized by rapid but no linear warming (Modern Warming). Remarkably, the presented records allow direct comparison of recent warming with former warm intervals such as the Roman or the Medieval periods. That comparison reveals the 20th century as the time with highest surface temperatures of the last 4000 years for the studied area. Spectral analysis of the time series shows consistent climatic cycles of ~ 400, ~ 900 and ~ 1300 yr, comparable with those recognized in the North Atlantic marine record, the Greenland ice cores, and other terrestrial records for the middle-late Holocene, suggesting common climate forcing

  2. Lead-free primary explosives

    Science.gov (United States)

    Huynh, My Hang V.

    2010-06-22

    Lead-free primary explosives of the formula (cat).sub.Y[M.sup.II(T).sub.X(H.sub.2O).sub.6-X].sub.Z, where T is 5-nitrotetrazolate, and syntheses thereof are described. Substantially stoichiometric equivalents of the reactants lead to high yields of pure compositions thereby avoiding dangerous purification steps.

  3. Explosion mitigation by water mist

    NARCIS (Netherlands)

    Wal, R. van der; Cargill, S.; Longbottom, A.; Rhijnsburger, M.P.M.; Erkel, A.G. van

    2010-01-01

    The internal explosion of an anti-ship missile or stored ammunition is a potentially catastrophic threat for a navy vessel. These events generally cause heavy blast loading and fragments to perforate the ship structure. As a solution to reduce the blast loading, the compartment can be filled with wa

  4. Turbulent Combustion in SDF Explosions

    Energy Technology Data Exchange (ETDEWEB)

    Kuhl, A L; Bell, J B; Beckner, V E

    2009-11-12

    A heterogeneous continuum model is proposed to describe the dispersion and combustion of an aluminum particle cloud in an explosion. It combines the gas-dynamic conservation laws for the gas phase with a continuum model for the dispersed phase, as formulated by Nigmatulin. Inter-phase mass, momentum and energy exchange are prescribed by phenomenological models. It incorporates a combustion model based on the mass conservation laws for fuel, air and products; source/sink terms are treated in the fast-chemistry limit appropriate for such gasdynamic fields, along with a model for mass transfer from the particle phase to the gas. The model takes into account both the afterburning of the detonation products of the C-4 booster with air, and the combustion of the Al particles with air. The model equations were integrated by high-order Godunov schemes for both the gas and particle phases. Numerical simulations of the explosion fields from 1.5-g Shock-Dispersed-Fuel (SDF) charge in a 6.6 liter calorimeter were used to validate the combustion model. Then the model was applied to 10-kg Al-SDF explosions in a an unconfined height-of-burst explosion. Computed pressure histories are compared with measured waveforms. Differences are caused by physical-chemical kinetic effects of particle combustion which induce ignition delays in the initial reactive blast wave and quenching of reactions at late times. Current simulations give initial insights into such modeling issues.

  5. Episodic Explosions in Interstellar Ices

    CERN Document Server

    Rawlings, J M C; Viti, S; Cecchi-Pestellini, C

    2013-01-01

    We present a model for the formation of large organic molecules in dark clouds. The molecules are produced in the high density gas-phase that exists immediately after ice mantles are explosively sublimated. The explosions are initiated by the catastrophic recombination of trapped atomic hydrogen. We propose that, in molecular clouds, the processes of freeze-out onto ice mantles, accumulation of radicals, explosion and then rapid (three-body) gas-phase chemistry occurs in a cyclic fashion. This can lead to a cumulative molecular enrichment of the interstellar medium. A model of the time-dependent chemistries, based on this hypothesis, shows that significant abundances of large molecular species can be formed, although the complexity of the species is limited by the short expansion timescale in the gas, immediately following mantle explosion. We find that this mechanism may be an important source of smaller organic species, such as methanol and formaldehyde, as well as precursors to bio-molecule formation. Most...

  6. Explosive micro-bubble actuator

    NARCIS (Netherlands)

    Broek, van den D.M.; Elwenspoek, M.

    2008-01-01

    Explosive evaporation occurs when a liquid is exposed to extremely high heat-fluxes. Within a few microseconds a bubble in the form vapour film is generated, followed by rapid growth due to the pressure impulse and finally the bubbles collapse. This effect, which already has proven its use in curren

  7. Explosive micro-bubble actuator

    NARCIS (Netherlands)

    Broek, van den D.M.; Elwenspoek, M.C.

    2007-01-01

    Explosive evaporation occurs when a thin layer of liquid reaches a very high temperature in a very short time. At these temperatures homogeneous nucleation takes place. The nucleated bubbles almost instantly coalesce forming a vapour film followed by rapid growth due to the pressure impulse and fina

  8. Statistical estimation of loads from gas explosions

    OpenAIRE

    Høiset, Stian

    1998-01-01

    In the design of structures in the offshore and process industries, the possibility of a gas explosion must always be considered. This is usually incorporated by performing explosion simulations. However, estimations based on such calculations introduce uncertainties in the design process. The main uncertainties in explosion simulations are the assumption of the gas cloud,the location of the ignition point and the properties of the explosion simulator itself. In this thesis, we try to investi...

  9. 30 CFR 77.1301 - Explosives; magazines.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Explosives; magazines. 77.1301 Section 77.1301... and Blasting § 77.1301 Explosives; magazines. (a) Detonators and explosives other than blasting agents shall be stored in magazines. (b) Detonators shall not be stored in the same magazine with...

  10. 77 FR 55108 - Explosive Siting Requirements

    Science.gov (United States)

    2012-09-07

    ... where solid propellants, energetic liquids, or other explosives are located to prepare launch vehicles... locations and facilities at a launch site where solid propellants, liquid propellants or other explosives... a launch site where solid propellants, energetic liquids, or other explosives are stored or...

  11. 14 CFR 420.63 - Explosive siting.

    Science.gov (United States)

    2010-01-01

    ... launch site boundary; (2) A listing of the maximum quantities of liquid and solid propellants and other explosives to be located at each explosive hazard facility, including the class and division for each solid explosive and the hazard and compatibility group for each liquid propellant; and (3) A description of...

  12. Numerical computation algorithm of explosion equations and thermodynamics parameters of mine explosives

    Institute of Scientific and Technical Information of China (English)

    李守巨; 刘迎曦; 何翔; 周圆π

    2001-01-01

    A new numerical algorithm is presented to simulate the explosion reaction process of mine explosives based on the equation of state, the equation of mass conservation and thermodynamics balance equation of explosion products. With the affection of reversible reaction of explosion products to explosion reaction equations and thermodynamics parameters considered, the computer program has been developed. The computation values show that computer simulation results are identical with the testinq ones.

  13. Numerical computation algorithm of explosion equations and thermodynamics parameters of mine explosives

    Institute of Scientific and Technical Information of China (English)

    LI Shou-ju; LIU Ying-xi; HE Xiang; ZHOU Y uan-pai

    2001-01-01

    A new numerical algorithm is presented to simulate the explosion reacti on process of mine explosives based on the equation of state, the equation of ma ss conservation and thermodynamics balance equation of explosion products. With the affection of reversible reaction of explosion products to explosion reaction equations and thermodynamics parameters considered, the computer program has be en developed. The computation values show that computer simulation results are i dentical with the testing ones.

  14. MOF phosphorylation by ATM regulates 53BP1-mediated DSB repair pathway choice

    Science.gov (United States)

    Gupta, Arun; Hunt, Clayton R.; Hegdec, Muralidhar L.; Chakraborty, Sharmistha; Udayakumar, Durga; Horikoshi, Nobuo; Singh1, Mayank; Ramnarain, Deepti B.; Hittelman, Walter N.; Namjoshi, Sarita; Asaithamby, Aroumougame; Hazra, Tapas K.; Ludwig, Thomas; Pandita, Raj K.; Tyler, Jessica K.; Pandita, Tej K.

    2014-01-01

    Cell cycle phase is a critical determinant of the choice between DNA damage repair by non-homologous end joining (NHEJ) or homologous recombination (HR). Here we report that DSBs induce ATM-dependent MOF (a histone H4 acetyl-transferase) phosphorylation (p-T392-MOF) and that phosphorylated MOF co-localizes with γ-H2AX, ATM, and 53BP1 foci. Mutation of the phosphorylation site (MOF-T392A) impedes DNA repair in S- and G2-phase but not G1-phase cells. Expression of MOF-T392A also reverses the reduction in DSB associated 53BP1 seen in wild type S/G2-phase cells, resulting in enhanced 53BP1 and reduced BRCA1 association. Decreased BRCA1 levels at DSB sites correlates with defective repairosome formation, reduced HR repair and decreased cell survival following irradiation. These data support a model whereby ATM mediated MOF-T392 phosphorylation modulates 53BP1 function to facilitate the subsequent recruitment of HR repair proteins, uncovering a regulatory role for MOF in DSB repair pathway choice during S/G2-phase. PMID:24953651

  15. MOF Phosphorylation by ATM Regulates 53BP1-Mediated Double-Strand Break Repair Pathway Choice

    Directory of Open Access Journals (Sweden)

    Arun Gupta

    2014-07-01

    Full Text Available Cell-cycle phase is a critical determinant of the choice between DNA damage repair by nonhomologous end-joining (NHEJ or homologous recombination (HR. Here, we report that double-strand breaks (DSBs induce ATM-dependent MOF (a histone H4 acetyl-transferase phosphorylation (p-T392-MOF and that phosphorylated MOF colocalizes with γ-H2AX, ATM, and 53BP1 foci. Mutation of the phosphorylation site (MOF-T392A impedes DNA repair in S and G2 phase but not G1 phase cells. Expression of MOF-T392A also blocks the reduction in DSB-associated 53BP1 seen in wild-type S/G2 phase cells, resulting in enhanced 53BP1 and reduced BRCA1 association. Decreased BRCA1 levels at DSB sites correlates with defective repairosome formation, reduced HR repair, and decreased cell survival following irradiation. These data support a model whereby ATM-mediated MOF-T392 phosphorylation modulates 53BP1 function to facilitate the subsequent recruitment of HR repair proteins, uncovering a regulatory role for MOF in DSB repair pathway choice during S/G2 phase.

  16. Forensic recovery of transient eruption parameters for the 2360 BP fall deposit, Mount Meager, British Columbia

    Science.gov (United States)

    Campbell, Michelle E.; Porritt, Lucy; Russell, J. K.

    2016-02-01

    The 2360 BP eruption of Mount Meager, Canada featured an explosive subplinian onset resulting in dacitic fallout tephra and associated pumiceous pyroclastic flow deposits, followed by the effusion of dacite lava and the deposition of a thick sequence of block and ash flow deposits. Fall deposits are distributed to the NE of the vent onto a rugged, deeply incised landscape. The central axis of deposition is ~ 063° Az; the lateral margins of the fall deposit are massive to unbedded whereas deposits underlying the plume axis feature complex bedding relationships. We present componentry and granulometry data for eight outcroppings of the fall deposit (four on plume axis and four off plume axis). Vertical cross-sections, based on surface outcrops and drill core logs from local commercial drilling programs, are used to relate the accessory lithics to their source depth in the underlying subvolcanic basement. These combined datasets inform on the dynamics of this explosive phase of the eruption including variations in column height, eruption intensity, atmospheric conditions, and depth to fragmentation front. The lateral variations within the fall strata reflect the effects of the prevailing atmospheric conditions on the form and dispersal pattern of the subplinian plume. Vertical variations in granulometry and componentry of the fall deposits are used to track temporal changes in eruption intensity and column height and the transient influence of the jetstream on the dispersal pattern of the plume. Lastly, vertical variations in lithic componentry, combined with our knowledge of the subsurface geology, are used to quantitatively track the deepening of the fragmentation front. Our computed results show that the fragmentation front migrated from ~ 640 m to ~ 1160 m below the vent over the course of the 2360 BP Mount Meager eruption.

  17. Congenital Arthrogryposis: An Extension of the 15q11.2 BP1-BP2 Microdeletion Syndrome?

    Directory of Open Access Journals (Sweden)

    K. M. Usrey

    2014-01-01

    Full Text Available The proximal 15q11–q13 region contains 5 breakpoints (BP1–BP5. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes. The genes in this region are known to play a role in central nervous system development and/or function. Microdeletions within the 15q11.2 BP1-BP2 region have been reported in patients with neurological dysfunction, developmental delays, behavioral problems, and dysmorphic features. We report two unrelated subjects with the 15q11.2 BP1-BP2 microdeletion and presenting with congenital arthrogryposis, a feature which has not been previously reported as part of this newly recognized microdeletion syndrome. While arthrogryposis seen in these two subjects may be coincidental, we propose that congenital arthrogryposis may result from neurological dysfunction and involvement of the microdeletion of the 15q11.2 BP1-BP2 region, further expanding the phenotype of this microdeletion syndrome. We encourage others to report patients with this chromosome microdeletion and neurological findings to further characterize the clinical phenotype.

  18. Damage Effects of Shelled Explosive Explosion in Concrete

    Directory of Open Access Journals (Sweden)

    Liu Yan

    2010-10-01

    Full Text Available The damage of concrete subjected to explosion loading is an important issue in defense engineering. The damage degree of concrete is related to many factors, such as the type of explosive charge, the depth of burial and the parameters of concrete. In this paper, three factors are considered for experiments of shelled explosives in concrete targets, which are the filling coefficient, length-to-diameter ratio and the depth of burial. The filling coefficient is from 0.1 to 1 by changing thickness of shell, and length-to-diameter ratio is from 2.5 to 10. The unconfined compressive strength of concrete target for test is 35MPa. The experimental results showed that the sizes of craters of concretes are varied as the filling coefficient, length-to-diameter ratio and the depth of burial. The optimal values of filling coefficient, length-to-diameter ratio and the depth of burial of shelled charges were obtained to get largest damage regions of concrete targets. This work provides a base for evaluating the damage of concrete and designing the penetrating warhead.Defence Science Journal, 2010, 60(6, pp.672-677, DOI:http://dx.doi.org/10.14429/dsj.60.434

  19. AcEST: BP921774 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_A05 442 Adiantum capillus-veneris mRNA. clone: YMU001_000154_A05. BP921774 - Show BP92177...is mRNA. clone: YMU001_000154_A05. Accession BP921774 Tissue type prothallium Developmental stage - Contig I...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25...: 414 TDILNAQTVSLSNDTIAIKDKADEKIIFLFEASTGKPLGDGKLLSHKNEISEVALDQKGL 473 Query: 177 IADRMLIFIDSNNDLYIACIVK----...bjct: 414 TDILNAQTVSLSNDTIAIKDKADEKIIFLFEASTGKPLGDGKLLSHKNEISEIALDQKGL 473 Query: 177 IADRMLIFIDSNNDLYIACIVK

  20. Hazards of explosives dusts: Particle size effects

    Energy Technology Data Exchange (ETDEWEB)

    Cashdollar, K L; Hertzberg, M; Green, G M

    1992-02-01

    At the request of the Department of Energy, the Bureau of Mines has investigated the hazards of military explosives dispersed as dust clouds in a 20-L test chamber. In this report, the effect of particle size for HMX, HNS, RDX, TATB, and TNT explosives dusts is studied in detail. The explosibility data for these dusts are also compared to those for pure fuel dusts. The data show that all of the sizes of the explosives dusts that were studied were capable of sustaining explosions as dust clouds dispersed in air. The finest sizes (<10 [mu]m) of explosives dusts were less reactive than the intermediate sizes (20 to 60 [mu]m); this is opposite to the particle size effect observed previously for the pure fuel dusts. At the largest sizes studied, the explosives dusts become somewhat less reactive as dispersed dust clouds. The six sizes of the HMX dust were also studied as dust clouds dispersed in nitrogen.

  1. AcEST: BP912073 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_G04 498 Adiantum capillus-veneris mRNA. clone: YMU001_000012_G04. BP9120...73 CL1947Contig1 Show BP912073 Clone id YMU001_000012_G04 Library YMU01 Length 498 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_G04. Accession BP912073 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2

  2. AcEST: BP912049 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_D12 483 Adiantum capillus-veneris mRNA. clone: YMU001_000012_D12. BP9120...49 CL4160Contig1 Show BP912049 Clone id YMU001_000012_D12 Library YMU01 Length 483 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_D12. Accession BP912049 Tissue type prothallium Developmental stag... Acids Res. 25:3389-3402. Query= BP912049|Adiantum capillus-veneris mRNA, clone: YMU001_000012_D12. (483 let...ILGGGAG RLYPLTKKRAKPAVPLGAN Sbjct: 61 RRNPIIVSPKAVSDSQNSQTCLDPDASSSVLGIILGGGAGTRLYPLTKKRAKPAVPLGAN 120 Query

  3. AcEST: BP912069 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_F12 581 Adiantum capillus-veneris mRNA. clone: YMU001_000012_F12. BP912069 - Show BP9120...is mRNA. clone: YMU001_000012_F12. Accession BP912069 Tissue type prothallium Developmental stage - Contig I... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912069|Adiantum capillus-veneris mRNA, ...= 25/38 (65%), Positives = 28/38 (73%) Frame = -3 Query: 120 LIHGPPGTGKTVTVVEAILQ...= 50.1 bits (118), Expect = 8e-06 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = -3 Query: 120 LI

  4. AcEST: BP912070 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_G01 565 Adiantum capillus-veneris mRNA. clone: YMU001_000012_G01. BP9120...70 CL211Contig1 Show BP912070 Clone id YMU001_000012_G01 Library YMU01 Length 565 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000012_G01. Accession BP912070 Tissue type prothallium Developmental stage...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912070|Adiantum capillus-veneris mRNA...Sbjct: 1060 AISNQLYEEAFAIFKKFDVNTSAIQVLIDQVNNLERANEFAERCNEPAVWSQLAKAQLQQ 1119 Query: 25 GLVSDAIE 2 GLV +AI+ Sbjct: 1120

  5. AcEST: BP912090 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_A03 514 Adiantum capillus-veneris mRNA. clone: YMU001_000015_A03. BP9120...90 CL2391Contig1 Show BP912090 Clone id YMU001_000015_A03 Library YMU01 Length 514 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_A03. Accession BP912090 Tissue type prothallium Developmental stag...programs, Nucleic Acids Res. 25:3389-3402. Query= BP912090|Adiantum capillus-veneris mRNA, clone: YMU001_000...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2

  6. AcEST: BP912123 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D05 496 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D05. BP91212...3 CL498Contig1 Show BP912123 Clone id YMU001_000015_D05 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D05. Accession BP912123 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...3|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D05. (478 letters) Database: uniprot_sprot.fasta 412

  7. AcEST: BP912126 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa

  8. AcEST: BP912912 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000024_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000024_C05. BP912912... CL1433Contig1 Show BP912912 Clone id YMU001_000024_C05 Library YMU01 Length 413 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000024_C05. Accession BP912912 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912912|Adiantum capillus-ven...eris mRNA, clone: YMU001_000024_C05. (413 letters) Database: uniprot_sprot.fasta 412

  9. AcEST: BP912712 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show BP912712...is mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, cl...one: YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI

  10. AcEST: BP912212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D11 457 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D11. BP912212... CL1085Contig1 Show BP912212 Clone id YMU001_000016_D11 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D11. Accession BP912212 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912212...|Adiantum capillus-veneris mRNA, clone: YMU001_000016_D11. (457 letters) Database: uniprot_sprot.fasta 412

  11. AcEST: BP912312 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000017_F01 489 Adiantum capillus-veneris mRNA. clone: YMU001_000017_F01. BP912312... CL1779Contig1 Show BP912312 Clone id YMU001_000017_F01 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000017_F01. Accession BP912312 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912312...|Adiantum capillus-veneris mRNA, clone: YMU001_000017_F01. (489 letters) Database: uniprot_sprot.fasta 412

  12. AcEST: BP912612 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H07. BP912612 - Show BP912612... Clone id YMU001_000020_H07 Library YMU01 Length 512 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000020_H07. Accession BP912612 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912612|Adiantum cap...illus-veneris mRNA, clone: YMU001_000020_H07. (512 letters) Database: uniprot_sprot.fasta 412,525 sequences;

  13. AcEST: BP912128 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D10 477 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D10. BP91212...8 CL2328Contig1 Show BP912128 Clone id YMU001_000015_D10 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D10. Accession BP912128 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...8|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D10. (461 letters) Database: uniprot_sprot.fasta 412

  14. AcEST: BP917417 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_E10 489 Adiantum capillus-veneris mRNA. clone: YMU001_000100_E10. BP917417... CL856Contig1 Show BP917417 Clone id YMU001_000100_E10 Library YMU01 Length 489 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000100_E10. Accession BP917417 Tissue type prothallium Developmental stage...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917417...Positives = 30/52 (57%) Frame = -2 Query: 176 MLDRSKRPKVESKLLQKRPVCKVFLLALEAPVRKAREEYDQIMLAGKAALGE 21 ++DR+

  15. AcEST: BP917517 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_G11 472 Adiantum capillus-veneris mRNA. clone: YMU001_000101_G11. BP917517... CL2571Contig1 Show BP917517 Clone id YMU001_000101_G11 Library YMU01 Length 472 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000101_G11. Accession BP917517 Tissue type prothallium Developmental stag...ams, Nucleic Acids Res. 25:3389-3402. Query= BP917517|Adiantum capillus-veneris m...= +3 Query: 81 CAGCDLWACLCTM*NVLRRRREKLSLRPGNA 173 C GC W + + N+ R+RR+ + LRPG A S

  16. AcEST: BP917173 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_B11 482 Adiantum capillus-veneris mRNA. clone: YMU001_000097_B11. BP91717...3 CL2027Contig1 Show BP917173 Clone id YMU001_000097_B11 Library YMU01 Length 482 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000097_B11. Accession BP917173 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91717...GVYGIIMAGWASNS 144 >sp|Q2RU33|NUOH_RHORT NADH-quinone oxidoreductase subunit H OS=Rhodospirillum rubrum (strain ATCC 1117

  17. AcEST: BP917172 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_B10 520 Adiantum capillus-veneris mRNA. clone: YMU001_000097_B10. BP917172 - Show BP91717...is mRNA. clone: YMU001_000097_B10. Accession BP917172 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91717...a GN=At2g31440 PE=2 SV=2 Length = 250 Score = 30.8 bits (68), Expect = 4.0 Identities = 17/50 (34%), Positiv...169 G H FFC SL + T +V +VP+FLI ++A+ F+ I + Sbjct: 123 GHGVAHAVFFCLSLLTPAFGPATFYVERCSKVPFFLISAIIALAFVTIHT 172

  18. AcEST: BP917017 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000094_G05 462 Adiantum capillus-veneris mRNA. clone: YMU001_000094_G05. BP917017 - Show BP917017...is mRNA. clone: YMU001_000094_G05. Accession BP917017 Tissue type prothallium Developmental stage - Contig I...ds Res. 25:3389-3402. Query= BP917017|Adiantum capillus-veneris mRNA, clone: YMU0... Sbjct: 182 SALFGSPVYQNYGTIMAEQKFEPAGFKMSLGLKDTNLALAAAKRVSANLPLAELAKSHFE 241 Query: 226 MMIEKGDVEEDMEELLNC 17...AKGVLRSKVGAGTGVKFTPSLAFVLDKVPDAAREME 110 Query: 187 ELL 179 ELL Sbjct: 111 ELL 11

  19. AcEST: BP921717 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000153_C10 427 Adiantum capillus-veneris mRNA. clone: YMU001_000153_C10. BP921717... CL2111Contig1 Show BP921717 Clone id YMU001_000153_C10 Library YMU01 Length 427 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000153_C10. Accession BP921717 Tissue type prothallium Developmental stag.... 25:3389-3402. Query= BP921717|Adiantum capillus-veneris mRNA, clone: YMU001_000... Expect = 4.1 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -1 Query: 172 LERRWKILILQHKVNQQTIRGW

  20. AcEST: BP920720 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000140_F08 378 Adiantum capillus-veneris mRNA. clone: YMU001_000140_F08. BP920720... CL2798Contig1 Show BP920720 Clone id YMU001_000140_F08 Library YMU01 Length 378 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000140_F08. Accession BP920720 Tissue type prothallium Developmental stag...ort BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Ji...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920720|Adiantum capillus-

  1. AcEST: BP920620 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000139_D03 185 Adiantum capillus-veneris mRNA. clone: YMU001_000139_D03. BP920620 - Show BP920620...is mRNA. clone: YMU001_000139_D03. Accession BP920620 Tissue type prothallium Developmental stage - Contig I...hit_id - Definition - Align length - Score (bit) - E-value - Report BLASTX 2.2.19 [Nov-02-20...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920620|Adiantum...core (bit) - E-value - Report BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, St

  2. AcEST: BP920204 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_C07 410 Adiantum capillus-veneris mRNA. clone: YMU001_000134_C07. BP92020...4 CL2814Contig1 Show BP920204 Clone id YMU001_000134_C07 Library YMU01 Length 410 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000134_C07. Accession BP920204 Tissue type prothallium Developmental stag...port BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, J...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920204|Adiantum capillus

  3. AcEST: BP914814 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000063_B08 487 Adiantum capillus-veneris mRNA. clone: YMU001_000063_B08. BP914814 - Show BP914814...is mRNA. clone: YMU001_000063_B08. Accession BP914814 Tissue type prothallium Developmental stage - Contig I...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914814...|Adiantum capillus-veneris mRNA, clone: YMU001_000063_B08. (487 letters) Database: uniprot_sprot.f...-trehalose-phosphate sy... 60 7e-15 sp|O14081|TPSX_SCHPO Putative alpha,alpha-trehalose-phosphate sy... 79 1e-14

  4. AcEST: BP914149 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_E02 350 Adiantum capillus-veneris mRNA. clone: YMU001_000042_E02. BP914149 - Show BP91414...is mRNA. clone: YMU001_000042_E02. Accession BP914149 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP914149|Adiantum capillus-veneris mRNA, clone: YMU001_000042_E02. (350 letters) Dat...abase: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching...9), Expect = 1.7 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Que

  5. AcEST: BP914014 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_H06 438 Adiantum capillus-veneris mRNA. clone: YMU001_000038_H06. BP914014 - Show BP914014...is mRNA. clone: YMU001_000038_H06. Accession BP914014 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914014|Adiantum ...sprot.fasta 412,525 sequences; 148,809,765 total letters Searching.............................................ed protein C17orf74 OS=Homo s... 32 0.76 sp|O14255|GCS1_SCHPO Probable mannosyl-oligosaccharide glucosida...

  6. AcEST: BP914114 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_A08 473 Adiantum capillus-veneris mRNA. clone: YMU001_000042_A08. BP914114... CL737Contig1 Show BP914114 Clone id YMU001_000042_A08 Library YMU01 Length 473 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000042_A08. Accession BP914114 Tissue type prothallium Developmental stage... programs, Nucleic Acids Res. 25:3389-3402. Query= BP914114|Adiantum capillus-ven...eris mRNA, clone: YMU001_000042_A08. (473 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,

  7. AcEST: BP914145 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_D08 359 Adiantum capillus-veneris mRNA. clone: YMU001_000042_D08. BP91414...5 CL2779Contig1 Show BP914145 Clone id YMU001_000042_D08 Library YMU01 Length 359 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000042_D08. Accession BP914145 Tissue type prothallium Developmental stag...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914145|Adiantum capillus-veneris mRNA, clone...: YMU001_000042_D08. (359 letters) Database: uniprot_sprot.fasta 412,525 sequences; 14

  8. AcEST: BP914914 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000064_C12 612 Adiantum capillus-veneris mRNA. clone: YMU001_000064_C12. BP914914... CL739Contig1 Show BP914914 Clone id YMU001_000064_C12 Library YMU01 Length 612 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000064_C12. Accession BP914914 Tissue type prothallium Developmental stage... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914914...prot.fasta 412,525 sequences; 148,809,765 total letters Searching................

  9. AcEST: BP921414 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000149_E11 396 Adiantum capillus-veneris mRNA. clone: YMU001_000149_E11. BP921414 - Show BP921414... Clone id YMU001_000149_E11 Library YMU01 Length 396 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000149_E11. Accession BP921414 Tissue type prothallium Developmental stage - Contig I... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921414|Adiantum capillus-ven...eris mRNA, clone: YMU001_000149_E11. (396 letters) Database: uniprot_sprot.fasta 412,525 sequences; 14

  10. AcEST: BP914614 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000061_A04 563 Adiantum capillus-veneris mRNA. clone: YMU001_000061_A04. BP914614 - Show BP914614...is mRNA. clone: YMU001_000061_A04. Accession BP914614 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP914614|Adiantum capillus-veneris mRNA, clone: YMU001_000061_A04. ...(550 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching.............79/185 (42%), Gaps = 27/185 (14%) Frame = -3 Query: 536 SQLRAVVRTLGHQNEECETKL----------KEAFELELRKRTDEAAQKVAT

  11. AcEST: BP914144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_D07 330 Adiantum capillus-veneris mRNA. clone: YMU001_000042_D07. BP914144 - Show BP91414...is mRNA. clone: YMU001_000042_D07. Accession BP914144 Tissue type prothallium Developmental stage - Contig I...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91414...rot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching..............KEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPS 149 Query: 240 TGSTSKPGKFLCKLW

  12. PetroChina and BP Launch Retail Venture in Guangdong

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    @@ PetroChina and BP launched a gas station business joint venture in South China's Guangdong Province on November 18, marking a further move in BP's foray into China's booming oil fuel retail market. The joint venture will operate a retail network of 500 petrol stations in the province. Called "PetroChina-BP Petroleum Co Ltd" and registered in Jiangmen City of Guangdong Province, the venture is set up as a result of a memorandum of understanding reached with BP's acquisition of 20 percent of the listed shares from PetroChina's global initial public offering as the sole strategic investor in 2000.

  13. AcEST: BP917704 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_D07 615 Adiantum capillus-veneris mRNA. clone: YMU001_000104_D07. BP9177...04 CL3815Contig1 Show BP917704 Clone id YMU001_000104_D07 Library YMU01 Length 615 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_D07. Accession BP917704 Tissue type prothallium Developmental stag... 25:3389-3402. Query= BP917704|Adiantum capillus-veneris mRNA, clone: YMU001_000104_D07. (568 letters) Datab...C---SICKGYLIDATTITECLHTFCKSCIVRHFY--YSNRCPKCNIVV 177 Query: 374 GGS-PLEKLRADRQLDEVCAKI 312 + PL +R DRQL ++ K

  14. AcEST: BP917755 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A07 465 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A07. BP9177...55 CL1516Contig1 Show BP917755 Clone id YMU001_000105_A07 Library YMU01 Length 465 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_A07. Accession BP917755 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917755|Adia...K+ L+ + +R+ +EC+ ++A LI +D R G + T Sbjct: 129 IEGEGSQKKKLRLISSLF---LRASPIECR--------YLARLILEDMRIGMNVPTILDA 177

  15. AcEST: BP914177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_H06 551 Adiantum capillus-veneris mRNA. clone: YMU001_000042_H06. BP914177... CL2231Contig1 Show BP914177 Clone id YMU001_000042_H06 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000042_H06. Accession BP914177 Tissue type prothallium Developmental stag...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914177...+H AAA GH + + LL R E+D +PLH AA NGH Q E L+ Sbjct: 531 EGYNSIHYAAAYGHRQCLELLLERTNTGFEESDGGALKSPLHLAAYNGHHQALEVLLQSL 590 Query: 177

  16. AcEST: BP917707 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_D10 539 Adiantum capillus-veneris mRNA. clone: YMU001_000104_D10. BP9177...07 CL598Contig1 Show BP917707 Clone id YMU001_000104_D10 Library YMU01 Length 539 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000104_D10. Accession BP917707 Tissue type prothallium Developmental stage...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917707|Adiantum capillus-...AEEFILNMPIKPDDVIWKALL 450 Query: 332 GACRLHCHVELAEYAFEQIMKFQPQWAAPYVLMSNMYADKLQNFAELAELHI 177 GACR+ +VE+ + +

  17. AcEST: BP917714 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E06 519 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E06. BP9177...14 CL2848Contig1 Show BP917714 Clone id YMU001_000104_E06 Library YMU01 Length 519 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_E06. Accession BP917714 Tissue type prothallium Developmental stag...s, Nucleic Acids Res. 25:3389-3402. Query= BP917714|Adiantum capillus-veneris mRNA, clone: YMU001_000104_E06...+ Q+ P Sbjct: 79 ELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEDVRQSVTP 138 Query: 177

  18. AcEST: BP917791 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_E05 415 Adiantum capillus-veneris mRNA. clone: YMU001_000105_E05. BP9177...91 CL2548Contig1 Show BP917791 Clone id YMU001_000105_E05 Library YMU01 Length 415 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_E05. Accession BP917791 Tissue type prothallium Developmental stag...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917791|Adian....9 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 242 QPKEILACFLAGCLPPTSGSFS 177 Q KEI+

  19. AcEST: BP921777 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_A08 476 Adiantum capillus-veneris mRNA. clone: YMU001_000154_A08. BP921777 - Show BP92177...is mRNA. clone: YMU001_000154_A08. Accession BP921777 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921777|Adia...= +1 Query: 37 HYPDQHPKWAHTPTSHLDTKTTHQMEERRHRPKCQHACHRQHNQNHPKVNNSSRQSSTSP 216 H P QHP H P + + H H H H+ +HP V ++ + P Sbjct: 177... +P HP +H+ + +H TT Q ++++ H H H QH+ + Sbjct: 720 HSHPQHPHSHPHQSHSHSHAHSQPTTTVQPQQQQQHSLSTVVHPHNATPSHHHHHQHSHS 779 Query: 172 HP 177

  20. AcEST: BP913673 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A04 543 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A04. BP91367...3 CL2745Contig1 Show BP913673 Clone id YMU001_000033_A04 Library YMU01 Length 543 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000033_A04. Accession BP913673 Tissue type prothallium Developmental stag...s, Nucleic Acids Res. 25:3389-3402. Query= BP913673|Adiantum capillus-veneris mRNA, clone: YMU001_000033_A04... +VKL +++KL + A F+ + I F + + D ++ W+ + ++ FW Sbjct: 367 QRQIVKLNMYKKLLYIIYASFLSVLAGSIVSSFIYVGMNTIDMIEKNWRSRF

  1. AcEST: BP917754 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A06 425 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A06. BP91775...4 CL28Contig1 Show BP917754 Clone id YMU001_000105_A06 Library YMU01 Length 425 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000105_A06. Accession BP917754 Tissue type prothallium Developmental stage ...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91775...H R H + S SERR + Sbjct: 1722 ARRSHRSPSERSHHSPSERSHHSPSERRHHSPSERSHCSPSERSHCSPSERRHR 1775 >sp|Q9JIG7|CCD22_MO

  2. AcEST: BP918101 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_F02 520 Adiantum capillus-veneris mRNA. clone: YMU001_000109_F02. BP918101 - Show BP918101...is mRNA. clone: YMU001_000109_F02. Accession BP918101 Tissue type prothallium Developmental stage - Contig I...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918101...(329), Expect = 2e-30 Identities = 65/161 (40%), Positives = 101/161 (62%), Gaps = 3/161 (1%) Frame = -3 Que...s = 64/161 (39%), Positives = 101/161 (62%), Gaps = 3/161 (1%) Frame = -3 Query:

  3. AcEST: BP917144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000096_F07 514 Adiantum capillus-veneris mRNA. clone: YMU001_000096_F07. BP917144... CL773Contig1 Show BP917144 Clone id YMU001_000096_F07 Library YMU01 Length 514 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000096_F07. Accession BP917144 Tissue type prothallium Developmental stage...rams, Nucleic Acids Res. 25:3389-3402. Query= BP917144|Adiantum capillus-veneris mRNA, clone: YMU001_000096_...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25

  4. AcEST: BP914491 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_E04 548 Adiantum capillus-veneris mRNA. clone: YMU001_000059_E04. BP9144...91 CL83Contig1 Show BP914491 Clone id YMU001_000059_E04 Library YMU01 Length 548 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000059_E04. Accession BP914491 Tissue type prothallium Developmental stage ...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914491|Adiantum capillus-vene...VVLMG E Sbjct: 86 FPEILSKN-GVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVE 144 Query: 346 GYRINGLSGVGEGG

  5. AcEST: BP913144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_A03 161 Adiantum capillus-veneris mRNA. clone: YMU001_000027_A03. BP913144... CL619Contig1 Show BP913144 Clone id YMU001_000027_A03 Library YMU01 Length 161 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000027_A03. Accession BP913144 Tissue type prothallium Developmental stage...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913144|Adiantum capillus-v...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25

  6. AcEST: BP914451 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_A11 386 Adiantum capillus-veneris mRNA. clone: YMU001_000059_A11. BP914451 - Show BP9144...is mRNA. clone: YMU001_000059_A11. Accession BP914451 Tissue type prothallium Developmental stage - Contig I...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914451|Adiantum capill...jct: 88 MYSKLGDFPSAVAVYGRMRKKNYMSSNILINGYVRAGDLVNARKVFDEMPDRKLTTW 144 Score = 30....HFFKVAPVRGVVAW 220 >sp|Q9M9R6|PPR43_ARATH Pentatricopeptide repeat-containing protein At1g14470 OS=Arabidops

  7. AcEST: BP914323 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F04 535 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F04. BP91432...3 CL2361Contig1 Show BP914323 Clone id YMU001_000057_F04 Library YMU01 Length 535 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000057_F04. Accession BP914323 Tissue type prothallium Developmental stag...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914323|Adiantum capillus-veneris mRNA, cl...IEKGKCAFTLGNEEVGPKNGVT----SVAMSPDGRLVAA 432 Query: 182 GDSSGSTQFWDGKQGTLLQAHRGHTADVLALAAAPSHRSVFAAGADGLVVQYQ

  8. AcEST: BP921217 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B03 574 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B03. BP921217 - Show BP92121...is mRNA. clone: YMU001_000147_B03. Accession BP921217 Tissue type prothallium Developmental stage - Contig I...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92121...containing protei... 100 5e-21 sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-con...... 89 2e-17 sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protei...

  9. AcEST: BP912121 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D03 516 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D03. BP912121 - Show BP912121...is mRNA. clone: YMU001_000015_D03. Accession BP912121 Tissue type prothallium Developmental stage - Contig I...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912121...ine proteinase inhibitor 6 OS=Arabidopsis thaliana GN=CYS6 PE=1 SV=2 Length = 234 Score = 85.5 bits (210), E...WQHFKSLEEFK---EKGSTQPSHMEPNSGEAGSAQQLSP-NDAGVHEAAEQALKTLQQ 221 KPW +FK L+EFK + + S + GE S + P +D V AEQA+KT+Q

  10. AcEST: BP921721 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000153_D02 435 Adiantum capillus-veneris mRNA. clone: YMU001_000153_D02. BP921721... CL638Contig1 Show BP921721 Clone id YMU001_000153_D02 Library YMU01 Length 435 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000153_D02. Accession BP921721 Tissue type prothallium Developmental stage...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP921721|Adiantum capillus-ve...us GN=Papss2 PE=1 SV=1 Length = 621 Score = 112 bits (279), Expect = 9e-25 Identities = 55/119 (46%), Positi

  11. AcEST: BP912205 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D02 475 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D02. BP91220...5 CL3776Contig1 Show BP912205 Clone id YMU001_000016_D02 Library YMU01 Length 475 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D02. Accession BP912205 Tissue type prothallium Developmental stag...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912205|Adiantum capi...peat-containing protein 3 OS=Homo sapi... 38 0.020 sp|Q12220|UTP12_YEAST U3 small

  12. AcEST: BP912208 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D05 388 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D05. BP91220...8 CL129Contig1 Show BP912208 Clone id YMU001_000016_D05 Library YMU01 Length 388 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000016_D05. Accession BP912208 Tissue type prothallium Developmental stage...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912208|Adiantu...EFDVVLEEVPADKKIAVLKVVRGITGLGLKEAKDLVEAAPKPIKEGVSKDDAEAAK 115 Query: 182 KQLEAAGAKCSVK 220 K+LE AGAK SVK Sbjc

  13. AcEST: BP921818 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_E07 485 Adiantum capillus-veneris mRNA. clone: YMU001_000154_E07. BP921818 - Show BP921818...is mRNA. clone: YMU001_000154_E07. Accession BP921818 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP921818|Adiantum capillus-ven...IM domain-containing protein A OS=Dictyostelium discoideum GN=limA PE=2 SV=1 Length = 1183 Score = 31.2 bits...CLLTICENRWLEWHHYYEFSFSIQNVRTSPLEL*LLSAQ 218 E + PIL +L I +N W+H+ + F + +V T + L LLS Q Sbjct: 58 ETYRYTPILAIL

  14. AcEST: BP918118 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_G07 522 Adiantum capillus-veneris mRNA. clone: YMU001_000109_G07. BP918118... CL74Contig1 Show BP918118 Clone id YMU001_000109_G07 Library YMU01 Length 522 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000109_G07. Accession BP918118 Tissue type prothallium Developmental stage ... Res. 25:3389-3402. Query= BP918118|Adiantum capillus-veneris mRNA, clone: YMU001_000109_G07. (522 letters) ...P-RRSGAVLSWNARFQ 470 Query: 170 VALGTARGLAYLHEECPKPILHFDVKPQNILLDGNLDAKLADFGLAKLVAR 18

  15. AcEST: BP918182 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E03. BP918182 - Show BP91818...is mRNA. clone: YMU001_000110_E03. Accession BP918182 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918... protei... 140 4e-33 sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protei... 139 6e-33 sp|P93011|PP18...RPTDARRVFDEMDVRDSVSYNT 278 Query: 314 IIXXXXXXXXXXXALQLFHEMQKKCVKPDEVTYITVLNACSH 18

  16. AcEST: BP918188 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E09 493 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E09. BP91818...8 CL1036Contig1 Show BP918188 Clone id YMU001_000110_E09 Library YMU01 Length 493 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000110_E09. Accession BP918188 Tissue type prothallium Developmental stag...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP918188|Adiantum capillus-veneris mRNA, clone: YMU001_000110_E09. (493 letters) Databa

  17. AcEST: BP918418 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C06 558 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C06. BP918418... CL2832Contig1 Show BP918418 Clone id YMU001_000113_C06 Library YMU01 Length 558 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_C06. Accession BP918418 Tissue type prothallium Developmental stag...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918418|Adiantum capillus-veneris mRNA, clone:...2 Length = 1243 Score = 30.4 bits (67), Expect = 6.1 Identities = 18/58 (31%), Po

  18. AcEST: BP918189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E11 450 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E11. BP91818...9 CL495Contig1 Show BP918189 Clone id YMU001_000110_E11 Library YMU01 Length 450 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000110_E11. Accession BP918189 Tissue type prothallium Developmental stage...cleic Acids Res. 25:3389-3402. Query= BP918189|Adiantum capillus-veneris mRNA, cl...QQPMEQSRKEKIKSILRLLRGVIP 186 YG+ T + C ++++ NN + Q S + ++K+K ++ +LR ++P Sbjct: 158 YGNTTAESCCSSYGYNNNNNNNSRK

  19. AcEST: BP918318 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B03 534 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B03. BP918318 - Show BP918318...is mRNA. clone: YMU001_000112_B03. Accession BP918318 Tissue type prothallium Developmental stage - Contig I...leic Acids Res. 25:3389-3402. Query= BP918318|Adiantum capillus-veneris mRNA, clone: YMU001_000112_B03. (534... protein 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL 181) GN=dc... + N++K + D S ++ Sbjct: 138 QLVFHK-------GKILVLLPGPPQELEPMLNNAL----NEIKPQPDLSTLSMLFFSIPE 186 Query: 459 LFLD

  20. AcEST: BP918518 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000114_D11 586 Adiantum capillus-veneris mRNA. clone: YMU001_000114_D11. BP918518... CL3738Contig1 Show BP918518 Clone id YMU001_000114_D11 Library YMU01 Length 586 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000114_D11. Accession BP918518 Tissue type prothallium Developmental stag...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918518|Adian..._YEAST Nucleolar protein NET1 OS=Saccharomyces cerevisiae GN=NET1 PE=1 SV=1 Length = 118

  1. AcEST: BP911818 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_E07 537 Adiantum capillus-veneris mRNA. clone: YMU001_000009_E07. BP911818... CL3769Contig1 Show BP911818 Clone id YMU001_000009_E07 Library YMU01 Length 537 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000009_E07. Accession BP911818 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911818|Adiantum c...MQ1|PP376_ARATH Pentatricopeptide repeat-containing protei... 47 6e-05 sp|Q9SFV9|PP218_ARATH Pentatricopepti

  2. AcEST: BP918186 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E07 514 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E07. BP918186 - Show BP91818...is mRNA. clone: YMU001_000110_E07. Accession BP918186 Tissue type prothallium Developmental stage - Contig I... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91818...s (75), Expect = 0.60 Identities = 21/69 (30%), Positives = 31/69 (44%) Frame = +2 Query: 185 TAEEGEPASVVLGL.../59 (33%), Positives = 31/59 (52%) Frame = -2 Query: 363 SKTSS*PSKAPCQIQFPSMPSGSFIFTAASPSSHFARGLPFVNLQSSPSTTDAGSPSSA 18

  3. AcEST: BP918187 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E08 530 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E08. BP91818...7 CL1163Contig1 Show BP918187 Clone id YMU001_000110_E08 Library YMU01 Length 530 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000110_E08. Accession BP918187 Tissue type prothallium Developmental stag...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91818...jct: 486 DSRTQIVENLLRGTRHEITDHNLEKIRRLTDGY 518 Score = 27.3 bits (59), Expect(2) = 5e-34 Identities = 10/21

  4. Underwater explosions and cavitation phenomena

    International Nuclear Information System (INIS)

    Some aspects of underwater explosions and cavitation phenomena have been studied by using a thermodynamic equation of state for water and a one-dimensional Lagrangian hydrocode. The study showed that surface cavitation is caused by the main blast wave and a bubble pulse from rebound of a release wave moving toward the center of the exploding bubble. Gravity has little effect on the surface cavitation. In nuclear explosions the bubble is bounded by a two-phase region rather than a gas-water interface. The two-phase region cavitates as the bubble expands, changing the optical absorption coefficient by many orders of magnitude and significantly affecting the optical signature. In assessing cavitation damage, it is concluded that a water jet of unstable bubble collapse erodes solid walls. The study leads to suggestions for future research

  5. RANCHERO explosive pulsed power experiments

    CERN Document Server

    Goforth, J H; Armijo, E V; Atchison, W L; Bartos, Yu; Clark, D A; Day, R D; Deninger, W J; Faehl, R J; Fowler, C M; García, F P; García, O F; Herrera, D H; Herrera, T J; Keinigs, R K; King, J C; Lindemuth, I R; López, E; Martínez, E C; Martínez, D; McGuire, J A; Morgan, D; Oona, H; Oro, D M; Parker, J V; Randolph, R B; Reinovsky, R E; Rodríguez, G; Stokes, J L; Sena, F C; Tabaka, L J; Tasker, D G; Taylor, A J; Torres, D T; Anderson, H D; Broste, W B; Johnson, J B; Kirbie, H C

    1999-01-01

    The authors are developing the RANCHERO high explosive pulsed power (HEPP) system to power cylindrically imploding solid-density liners for hydrodynamics experiments. Their near-term goal is to conduct experiments in the regime pertinent to the Atlas capacitor bank. That is, they will attempt to implode liners of ~50 g mass at velocities approaching 15 km/sec. The basic building block of the HEPP system is a coaxial generator with a 304.8 mm diameter stator, and an initial armature diameter of 152 mm. The armature is expanded by a high explosive (HE) charge detonated simultaneously along its axis. The authors have reported a variety of experiments conducted with generator modules 43 cm long and have presented an initial design for hydrodynamic liner experiments. In this paper, they give a synopsis of their first system test, and a status report on the development of a generator module that is 1.4 m long. (6 refs).

  6. Waves from an underground explosion

    Science.gov (United States)

    Krymskii, A. V.; Lyakhov, G. M.

    1984-05-01

    The problem of the propagation of a spherical detonation wave in water-saturated soil was solved in [1, 2] by using a model of a liquid porous multicomponent medium with bulk viscosity. Experiments show that soils which are not water saturated are solid porous multicomponent media having a viscosity, nonlinear bulk compression limit diagrams, and irreversible deformations. Taking account of these properties, and using the model in [2], we have solved the problem of the propagation of a spherical detonation wave from an underground explosion. The solution was obtained by computer, using the finite difference method [3]. The basic wave parameters were determined at various distances from the site of the explosion. The values obtained are in good agreement with experiment. Models of soils as viscous media which take account of the dependence of deformations on the rate of loading were proposed in [4 7] also. In [8] a model was proposed corresponding to a liquid multicomponent medium with a variable viscosity.

  7. EXPLOSION RISK ASSESSMENTS FOR FACILITIES

    Directory of Open Access Journals (Sweden)

    Martin KULICH

    2015-12-01

    Full Text Available In the first part of the article we discuss the possibilities and analytical tools that can deal with the classification of space into zones with danger of explosion for devices with the presence of compressed flammable gases. Then we continue with specifications of possibilities for practical utilization linked to variables such as ventilation degree, hypothetical volume etc., including the examples. At the end we also give a brief overview of software for modelling gas leak, including examples of an outcome.

  8. Explosive Formulation Code Naming SOP

    Energy Technology Data Exchange (ETDEWEB)

    Martz, H. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2014-09-19

    The purpose of this SOP is to provide a procedure for giving individual HME formulations code names. A code name for an individual HME formulation consists of an explosive family code, given by the classified guide, followed by a dash, -, and a number. If the formulation requires preparation such as packing or aging, these add additional groups of symbols to the X-ray specimen name.

  9. Causes of the Cambrian Explosion.

    OpenAIRE

    Smith, M P; Harper, D.A.T.

    2013-01-01

    In the last decade, at least thirty individual hypotheses have been invoked to explain the Cambrian Explosion, ranging from starbursts in the Milky Way to intrinsic genomic reorganization and developmental patterning. It has been noted (1) that recent hypotheses fall into three categories: a) developmental/genetic, b) ecologic and c) abiotic environmental, with geochemical hypotheses forming an abundant and distinctive subset of the last. With a few notable exceptions, a significant majority ...

  10. Nuclear Explosions 1945-1998

    International Nuclear Information System (INIS)

    The main part of this report is a list of nuclear explosions conducted by the United States, the Soviet Union, the United Kingdom, France, China, India and Pakistan in 1945-98. The list includes all known nuclear test explosions and is compiled from a variety of sources including officially published information from the USA, Russia and France. The details given for each explosion (date, origin time, location, yield, type, etc.) are often compiled from more than one source because the individual sources do not give complete information. The report includes a short background to nuclear testing and provides brief information on the Comprehensive Nuclear-Test-Ban Treaty and the verification regime now being established to verify compliance with the treaty. It also summarizes nuclear testing country by country. The list should be used with some caution because its compilation from a variety of sources means that some of the data could be incorrect. This report is the result of cooperation between the Defence Research Establishment (FOA) and the Stockholm International Peace Research Institute (SIPRI)

  11. Nuclear Explosions 1945-1998

    Energy Technology Data Exchange (ETDEWEB)

    Bergkvist, Nils-Olov; Ferm, Ragnhild

    2000-07-01

    The main part of this report is a list of nuclear explosions conducted by the United States, the Soviet Union, the United Kingdom, France, China, India and Pakistan in 1945-98. The list includes all known nuclear test explosions and is compiled from a variety of sources including officially published information from the USA, Russia and France. The details given for each explosion (date, origin time, location, yield, type, etc.) are often compiled from more than one source because the individual sources do not give complete information. The report includes a short background to nuclear testing and provides brief information on the Comprehensive Nuclear-Test-Ban Treaty and the verification regime now being established to verify compliance with the treaty. It also summarizes nuclear testing country by country. The list should be used with some caution because its compilation from a variety of sources means that some of the data could be incorrect. This report is the result of cooperation between the Defence Research Establishment (FOA) and the Stockholm International Peace Research Institute (SIPRI)

  12. Thermodynamic States in Explosion Fields

    Energy Technology Data Exchange (ETDEWEB)

    Kuhl, A L

    2010-03-12

    We investigate the thermodynamic states occurring in explosion fields from condensed explosive charges. These states are often modeled with a Jones-Wilkins-Lee (JWL) function. However, the JWL function is not a Fundamental Equation of Thermodynamics, and therefore cannot give a complete specification of such states. We use the Cheetah code of Fried to study the loci of states of the expanded detonation products gases from C-4 charges, and their combustion products air. In the Le Chatelier Plane of specific-internal-energy versus temperature, these loci are fit with a Quadratic Model function u(T), which has been shown to be valid for T < 3,000 K and p < 1k-bar. This model is used to derive a Fundamental Equation u(v,s) for C-4. Given u(v,s), one can use Maxwell's Relations to derive all other thermodynamic functions, such as temperature: T(v,s), pressure: p(v,s), enthalpy: h(v,s), Gibbs free energy: g(v,s) and Helmholz free energy: f(v,s); these loci are displayed in figures for C-4. Such complete equations of state are needed for numerical simulations of blast waves from explosive charges, and their reflections from surfaces.

  13. Determination of Nanogram Microparticles from Explosives after Real Open-Air Explosions by Confocal Raman Microscopy.

    Science.gov (United States)

    Zapata, Félix; García-Ruiz, Carmen

    2016-07-01

    Explosives are increasingly being used for terrorist attacks to cause devastating explosions. The detection of their postblast residues after an explosion is a high challenge, which has been barely investigated, particularly using spectroscopic techniques. In this research, a novel methodology using confocal Raman microscopy has been developed for the analysis of postblast residues from 10 open-air explosions caused by 10 different explosives (TNT, RDX, PETN, TATP, HMTD, dynamite, black powder, ANFO, chloratite, and ammonal) commonly used in improvised explosive devices. The methodology for the determination of postblast particles from explosives consisted of examining the samples surfaces with both the naked eye, first, and microscopically (10× and 50×), immediately afterward; and finally, analyzing the selected residues by confocal Raman spectroscopy in order to identify the postblast particles from explosives. Interestingly, confocal Raman microscopy has demonstrated to be highly suitable to rapidly, selectively, and noninvasively analyze postblast microscopic particles from explosives up to the nanogram range.

  14. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    Energy Technology Data Exchange (ETDEWEB)

    Gago-Ferrero, Pablo, E-mail: pablo.gago@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Badia-Fabregat, Marina, E-mail: marina.badia@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Olivares, Alba, E-mail: esalba.olivares@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Pina, Benjamin, E-mail: benjami.pina@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Blanquez, Paqui, E-mail: paqui.blanquez@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Vicent, Teresa, E-mail: teresa.vicent@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Caminal, Gloria, E-mail: gloria.caminal@uab.cat [Unitat de Biocatalisi Aplicada associada al IQAC (CSIC-UAB). Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Diaz-Cruz, M. Silvia, E-mail: silvia.diaz@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); and others

    2012-06-15

    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: Black-Right-Pointing-Pointer Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. Black-Right-Pointing-Pointer BP3 is not degraded under simulated sunlight. Black-Right-Pointing-Pointer Glycoconjugates have been identified as the main intermediate metabolites. Black-Right-Pointing-Pointer Decrease in endocrine activity

  15. The impact of arithmetic representation on implementing MLP-BP on FPGAs: a study.

    Science.gov (United States)

    Savich, Antony W; Moussa, Medhat; Areibi, Shawki

    2007-01-01

    In this paper, arithmetic representations for implementing multilayer perceptrons trained using the error backpropagation algorithm (MLP-BP) neural networks on field-programmable gate arrays (FPGAs) are examined in detail. Both floating-point (FLP) and fixed-point (FXP) formats are studied and the effect of precision of representation and FPGA area requirements are considered. A generic very high-speed integrated circuit hardware description language (VHDL) program was developed to help experiment with a large number of formats and designs. The results show that an MLP-BP network uses less clock cycles and consumes less real estate when compiled in an FXP format, compared with a larger and slower functioning compilation in an FLP format with similar data representation width, in bits, or a similar precision and range. PMID:17278475

  16. Data base of chemical explosions in Kazakhstan

    Energy Technology Data Exchange (ETDEWEB)

    Demin, V.N. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Malahova, M.N. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Martysevich, P.N. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Mihaylova, N.N. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Nurmagambetov, A. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Kopnichev, Yu.F. D. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Edomin, V.I. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan)

    1996-12-01

    Within the bounds of this report, the following works were done: (1) Information about explosion quarries, located in Southern, Eastern and Northern Kasakstan was summarized. (2) The general information about seismicity of areas of location of explosion quarries was adduced. (3) The system of observation and seismic apparatus, recording the local earthquakes and quarry explosions at the territory of Kazakstan were described. (4) Data base of quarry explosions, that were carried out in Southern, Eastern and Northern Kazakstan during 1995 and first half of 1996 year was adduced. (5) Upon the data of registration of explosions in Southern Kazakstan the correlative dependences between power class of explosions and summary weight of charge were constructed. (6) Seismic records of quarry explosions were adduced. It is necessary to note, that the collection of data about quarry explosions in Kazakstan in present time is very difficult task. Organizations, that makes these explosions, are always suffering reorganizations and sometimes it is actually impossible to receive all the necessary information. Some quarries are situated in remote, almost inaccessible regions, and within the bounds of supplier financing not the every quarry was in success to visit. So the present data base upon the chemical explosions for 1995 is not full and in further it`s expansion is possible.

  17. EST Table: BP120153 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP120153 ceN-1898 11/12/09 GO hit GO:0005509(calcium ion binding)|GO:0007156(homoph...A 10/09/10 46 %/228 aa gi|189237687|ref|XP_969192.2| PREDICTED: similar to Neural-cadherin precursor (Cadherin-N protein) (DN-cadherin) [Tribolium castaneum] BP120153 ceN- ...

  18. EST Table: BP116696 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available f|XP_971592.1| PREDICTED: similar to pre-mRNA-splicing factor prp1 [Tribolium castaneum] BP116696 brS- ... ...BP116696 brS-0450 11/12/09 GO hit GO:0005622(intracellular)|GO:0006396(RNA processi

  19. EST Table: BP128000 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available a gi|91085759|ref|XP_974103.1| PREDICTED: similar to smap1 [Tribolium castaneum] BP128000 tesV ... ...BP128000 tesV0058 11/12/09 GO hit GO:0008060(ARF GTPase activator activity)|GO:0008

  20. EST Table: BP124713 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available mel|GB10445-PA 10/09/10 60 %/125 aa gi|91088399|ref|XP_972896.1| PREDICTED: similar to Rapgap1 CG34374-PF [Tribolium castaneum] BP124713 fbS2 ... ...BP124713 fbS20190 11/12/09 GO hit GO:0005096(GTPase activator activity)|GO:0005622(