WorldWideScience

Sample records for bp explosive cycle

  1. Application of genetic BP network to discriminating earthquakes and explosions

    Institute of Scientific and Technical Information of China (English)

    边银菊

    2002-01-01

    In this paper, we develop GA-BP algorithm by combining genetic algorithm (GA) with back propagation (BP) algorithm and establish genetic BP neural network. We also applied BP neural network based on BP algorithm and genetic BP neural network based on GA-BP algorithm to discriminate earthquakes and explosions. The obtained result shows that the discriminating performance of genetic BP network is slightly better than that of BP network.

  2. Research on safety assessment of gas explosion hazard in heading face based on BP neural network

    Institute of Scientific and Technical Information of China (English)

    TIAN Shui-cheng; ZHU Li-jun; CHEN Yong-gang; WANG Li

    2005-01-01

    According to hazard theory and the principle of selecting assessment index,combining the causes and mechanism of gas explosion, established assessment index system of gas explosion in heading face. Based on the method of gray clustering, principle of BP neural network and characters of gas explosion in heading face, safety assessment procedural diagram of BP neural network on gas explosion hazard in heading face is designed. Meanwhile, concrete heading face of the gas explosion hazard is assessed by safety assessment method of BP neural network and grades of comprehensive safety assessment are got. The static and dynamic safety assessment can be achieved by this method. It is practical to improve safety management and to develop safety assessment technology in coalmine.

  3. The risk evaluation of mine coal-dust explosion based on BP neural network

    Institute of Scientific and Technical Information of China (English)

    CHEN Lian-jun; CHENG Wei-min

    2007-01-01

    Introduced the theory of three types of hazardous sources, and it recognized and analysed such three types of hazardous sources as the factor of inherent hazardous source, factor of inducing hazardous source and factor of men, which affect the safety and reliability of coal-dust explosion risk system and then builds up the risk factor indices of coal-dust explosion according to analysis of conditions inducing the coal-dust explosion. It fixes the risk degree of coal-dust explosion risk system by analyzing loss probability and loss scope of risk system and by means of the probabilistic hazard evaluation method and risk matrix method, etc.. According to the feature of strong capability of nonlinear approximation of BP neural network, the paper designed the structure of BP neural network for the risk evaluation of the mine coal-dust explosion with BP neural network. And the weight of the network was finally determined by training the given samples so that the risk degree of samples to be measured could be exactly evaluated and the risk of mine coal-dust explosion could be alarmed in good time.

  4. Evidence of magma-water interaction during the 13,800 years BP explosive cycle of the Licán Ignimbrite, Villarrica volcano (southern Chile) Evidencias de interacción magma-agua durante el ciclo eruptivo explosivo de la Ignimbrita Licán (13.800 años AP), volcán Villarrica (sur de Chile)

    OpenAIRE

    Silke Lohmar; Claude Robin; Alain Gourgaud; Jorge Clavero; Miguel Ángel Parada; Hugo Moreno; Orkun Ersoy; Leopoldo LópeZ-Escobar; José Antonio Naranjo

    2007-01-01

    Villarrica is an active stratovolcano located in the Southern Andean Volcanic Zone. About 13,800 years BP (conventional radiocarbon ages), this volcano experienced major explosive eruptions which resulted in the emission of a sequence of pyroclastic flows, known as the 'Licán Ignimbrite', the bulk volume of which is estimated in -10 km³ (non-DRE, Dense Rock Equivalent). The deposits mainly consist of massive pyroclastic flows and stratified pyroclastic surges. Typical flow fades showscoriaceo...

  5. The 5,660 yBP Boquerón explosive eruption, Teide-Pico Viejo complex, Tenerife

    Science.gov (United States)

    García, Olaya; Bonadonna, Costanza; Martí, Joan; Pioli, Laura

    2012-11-01

    Quantitative hazard assessments of active volcanoes require an accurate knowledge of the past eruptive activity in terms of eruption dynamics and the stratified products of eruption. Teide-Pico Viejo (TPV) is one of the largest volcanic complexes in Europe, but the associated eruptive history has only been constrained based on very general stratigraphic and geochronological data. In particular, recent studies have shown that explosive activity has been significantly more frequently common than previously thought. Our study contributes to characterization of explosive activity of TPV by describing for the first time the subplinian eruption of El Boquerón (5,660 yBP), a satellite dome located on the northern slope of the Pico Viejo stratovolcano. Stratigraphic data suggest complex shifting from effusive phases with lava flows to highly explosive phase that generated a relatively thick and widespread pumice fallout deposit. This explosive phase is classified as a subplinian eruption of VEI 3 that lasted for about 9-15 h and produced a plume with a height of up to 9 km above sea level (i.e. 7 km above the vent; MER of 6.9-8.2 × 105 kg/s). The tephra deposit (minimum bulk volume of 4-6 × 107 m3) was dispersed to the NE by up to 10 m/s winds. A similar eruption today would significantly impact the economy of Tenerife (e.g. tourism and aviation), with major consequences mainly for the communities around the Icod Valley, and to a minor extent, the Orotava Valley. This vulnerability shows that a better knowledge of the past explosive history of TPV and an accurate estimate of future potentials to generate violent eruptions is required in order to quantify and mitigate the associated volcanic risk.

  6. Initial concepts on energetics and mass releases during nonnuclear explosive events in fuel cycle facilities

    International Nuclear Information System (INIS)

    Non-nuclear explosions are one of the initiating events (accidents) considered in the US Nuclear Regulatory Commission study of formal methods for estimating the airborne release of radionuclides from fuel cycle facilities. Methods currently available to estimate the energetics and mass airborne release from the four types of non-nuclear explosive events (fast and slow physical explosions and fast and slow chemical explosions) are reviewed. The likelihood that fast physical explosions will occur in fuel cycle facilities appears to be remote and this type of explosion is not considered. Methods to estimate the consequences of slow physical and fast chemical explosions are available. Methods to estimate the consequences of slow chemical explosions are less well defined

  7. Evidence of magma-water interaction during the 13,800 years BP explosive cycle of the Licán Ignimbrite, Villarrica volcano (southern Chile Evidencias de interacción magma-agua durante el ciclo eruptivo explosivo de la Ignimbrita Licán (13.800 años AP, volcán Villarrica (sur de Chile

    Directory of Open Access Journals (Sweden)

    Silke Lohmar

    2007-07-01

    Full Text Available Villarrica is an active stratovolcano located in the Southern Andean Volcanic Zone. About 13,800 years BP (conventional radiocarbon ages, this volcano experienced major explosive eruptions which resulted in the emission of a sequence of pyroclastic flows, known as the 'Licán Ignimbrite', the bulk volume of which is estimated in -10 km³ (non-DRE, Dense Rock Equivalent. The deposits mainly consist of massive pyroclastic flows and stratified pyroclastic surges. Typical flow fades showscoriaceous bombs, dense juvenile blocks, lithics and scoria lapilli immersed in a dark-grey to brownish matrix, whereas surges expose lapilli-sized scoria in a fine, light-brown or yellow-green matrix. Juvenile clasts range from 55 to 58 wt% Si0(2 in composition. This paper describes the general architecture of the Licán Ignimbrite deposits and, based on SEM (Scanning Electron Microscope observations and lithologic data, emphasizes the role of fragmentation due to magma-water interaction during the eruption. The results indicate that gas expansion was an important process. However, field characteristics, surface textures of ashes, enrichment of lithics towards the top of the sequence and variable palagonitization of matrix glass show the intervention of water since the initial stages of the eruption and its increasing influence during the later phasesEl Villarrica es un estratovolcán activo, situado en la Zona Volcánica de los Andes del Sur. Hace aproximadamente 13.800 años AP (edades 14C no calibradas, este volcán sufrió un evento explosivo importante que dio lugar a la emisión de una secuencia de flujos piroclásticos, conocida como la 'Ignimbrita Licán', cuyo volumen ha sido estimado en -10 km³ (no-ERD, Equivalente de Roca Densa. Los depósitos consisten, principalmente, en flujos piroclásticos macizos y oleadas piroclásticas estratificadas. Las facies típicas que resultan de los flujos presentan bombas escoriáceas, bloques juveniles densos

  8. Grain-size cycles in Salawusu River valley since 150 ka BP

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The palaeo-mobile dune sands and fluvio-lacustrine facies with palaeosols in Milanggouwan stratigraphic section of the Salawusu River valley situated at the southeast of the Mu Us Desert experienced abundant remarkable alternative changes of coarse and fine rhythms in grainsize since 150 ka BP, and the grain-size parameters - Mz, σ, Sk, Kg and SC/I also respond to the situation of multi-fluctuational alternations between peak and valley values. Simultaneity the grainsize eigenvalues - Ф5, Ф16, P25, Ф50, Ф75, Ф84 and Ф95 are respondingly manifested as greatly cadent jumpiness. Hereby, the Milanggouwan section can be divided into 27 grain-size coarse and fine sedimentary cycles, which can be regarded as a real and integreted record of climate-geological process of desert vicissitude resulted from the alternative evolvement of the ancient winter and summer monsoons of East Asia since 150 ka BP.

  9. Explosion of limit cycles and chaotic waves in a simple nonlinear chemical system

    DEFF Research Database (Denmark)

    Brøns, Morten; Sturis, Jeppe

    2001-01-01

    A model of an autocatalytic chemical reaction was employed to study the explosion of limit cycles and chaotic waves in a nonlinear chemical system. The bifurcation point was determined using asymptotic analysis and perturbations. Scaling laws for amplitude and period were derived. A strong...

  10. The latest explosive eruptions of Ciomadul (Csomád) volcano, East Carpathians - A tephrostratigraphic approach for the 51-29 ka BP time interval

    Science.gov (United States)

    Karátson, D.; Wulf, S.; Veres, D.; Magyari, E. K.; Gertisser, R.; Timar-Gabor, A.; Novothny, Á.; Telbisz, T.; Szalai, Z.; Anechitei-Deacu, V.; Appelt, O.; Bormann, M.; Jánosi, Cs.; Hubay, K.; Schäbitz, F.

    2016-06-01

    The most recent, mainly explosive eruptions of Ciomadul, the youngest volcano in the Carpatho-Pannonian Region, have been constrained by detailed field volcanological studies, major element pumice glass geochemistry, luminescence and radiocarbon dating, and a critical evaluation of available geochronological data. These investigations were complemented by the first tephrostratigraphic studies of the lacustrine infill of Ciomadul's twin craters (St. Ana and Mohoş) that received tephra deposition during the last eruptions of the volcano. Our analysis shows that significant explosive activity, collectively called EPPA (Early Phreatomagmatic and Plinian Activity), started at Ciomadul in or around the present-day Mohoş, the older crater, at ≥ 51 ka BP. These eruptions resulted in a thick succession of pyroclastic-fall deposits found in both proximal and medial/distal localities around the volcano, characterized by highly silicic (rhyolitic) glass chemical compositions (ca. 75.2-79.8 wt.% SiO2). The EPPA stage was terminated by a subplinian/plinian eruption at ≥ 43 ka BP, producing pumiceous pyroclastic-fall and -flow deposits of similar glass composition, probably from a "Proto-St. Ana" vent located at or around the younger crater hosting the present-day Lake St. Ana. After a quiescent period with a proposed lava dome growth in the St. Ana crater, a new explosive stage began, defined as MPA (Middle Plinian Activity). In particular, a significant two-phase eruption occurred at ~ 31.5 ka BP, producing pyroclastic flows from vulcanian explosions disrupting the preexisting lava dome of Sf. Ana, and followed by pumiceous fallout from a plinian eruption column. Related pyroclastic deposits show a characteristic, less evolved rhyolitic glass composition (ca. 70.2-74.5 wt.% SiO2) and occur both in proximal and medial/distal localities up to 21 km from source. The MPA eruptions, that may have pre-shaped a crater similar to, but possibly smaller than, the present-day St

  11. Canard explosion of limit cycles in templator models of self-replication mechanisms

    DEFF Research Database (Denmark)

    Brøns, Morten

    2011-01-01

    Templators are differential equation models for self-replicating chemical systems. Beutel and Peacock-López [J. Chem. Phys. 126, 125104 (2007)]10.1063/1.2716396 have numerically analyzed a model for a cross-catalytic self-replicating system and found two cases of canard explosion, that is, a...... substantial change of amplitude of a limit cycle over a very short parameter interval. We show how the model can be reduced to a two-dimensional system and how canard theory for slow-fast equations can be applied to yield analytic information about the canard explosion. In particular, simple expressions for...... the parameter value where the canard explosion occurs are obtained. The connection to mixed-mode oscillations also observed in the model is briefly discussed. © 2011 American Institute of Physics....

  12. Viability of the 11B(p, α) 2α cycle

    International Nuclear Information System (INIS)

    The authors evaluated the energetics of the proton11boron advanced fuel fusion cycle and found that the enhancement of reactivity obtained from non-thermal mechanisms is significantly less than the enhancement required for ignition or high gain operation. Based on a detailed calculation of synchrotron radiation losses, at least 135% enhancement of the reactivity is needed for ignition. The direct and induced radioactivity associated with the cycle, while being orders of magnitude lower than that of D-T, is not negligible and requires serious attention in the design. Thus, it is concluded that, using present physics knowledge, the p-11B cycle is not viable for commercial fusion power

  13. C-terminal binding protein (CtBP activates the expression of E-box clock genes with CLOCK/CYCLE in Drosophila.

    Directory of Open Access Journals (Sweden)

    Taichi Q Itoh

    Full Text Available In Drosophila, CLOCK/CYCLE heterodimer (CLK/CYC is the primary activator of circadian clock genes that contain the E-box sequence in their promoter regions (hereafter referred to as "E-box clock genes". Although extensive studies have investigated the feedback regulation of clock genes, little is known regarding other factors acting with CLK/CYC. Here we show that Drosophila C-terminal binding protein (dCtBP, a transcriptional co-factor, is involved in the regulation of the E-box clock genes. In vivo overexpression of dCtBP in clock cells lengthened or abolished circadian locomotor rhythm with up-regulation of a subset of the E-box clock genes, period (per, vrille (vri, and PAR domain protein 1ε (Pdp1ε. Co-expression of dCtBP with CLK in vitro also increased the promoter activity of per, vri, Pdp1ε and cwo depending on the amount of dCtBP expression, whereas no effect was observed without CLK. The activation of these clock genes in vitro was not observed when we used mutated dCtBP which carries amino acid substitutions in NAD+ domain. These results suggest that dCtBP generally acts as a putative co-activator of CLK/CYC through the E-box sequence.

  14. Cycles of explosive and effusive eruptions at Kīlauea Volcano, Hawai‘i

    Science.gov (United States)

    Swanson, Don; Rose, Timothy R.; Mucek, Adonara E; Garcia, Michael O.; Fiske, Richard S.; Mastin, Larry G.

    2014-01-01

    The subaerial eruptive activity at Kīlauea Volcano (Hawai‘i) for the past 2500 yr can be divided into 3 dominantly effusive and 2 dominantly explosive periods, each lasting several centuries. The prevailing style of eruption for 60% of this time was explosive, manifested by repeated phreatic and phreatomagmatic activity in a deep summit caldera. During dominantly explosive periods, the magma supply rate to the shallow storage volume beneath the summit dropped to only a few percent of that during mainly effusive periods. The frequency and duration of explosive activity are contrary to the popular impression that Kīlauea is almost unceasingly effusive. Explosive activity apparently correlates with the presence of a caldera intersecting the water table. The decrease in magma supply rate may result in caldera collapse, because erupted or intruded magma is not replaced. Glasses with unusually high MgO, TiO2, and K2O compositions occur only in explosive tephra (and one related lava flow) and are consistent with disruption of the shallow reservoir complex during caldera formation. Kīlauea is a complex, modulated system in which melting rate, supply rate, conduit stability (in both mantle and crust), reservoir geometry, water table, and many other factors interact with one another. The hazards associated with explosive activity at Kīlauea’s summit would have major impact on local society if a future dominantly explosive period were to last several centuries. The association of lowered magma supply, caldera formation, and explosive activity might characterize other basaltic volcanoes, but has not been recognized.

  15. Integration of BpMADS4 on various linkage groups improves the utilization of the rapid cycle breeding system in apple.

    Science.gov (United States)

    Weigl, Kathleen; Wenzel, Stephanie; Flachowsky, Henryk; Peil, Andreas; Hanke, Magda-Viola

    2015-02-01

    Rapid cycle breeding in apple is a new approach for the rapid introgression of agronomically relevant traits (e.g. disease resistances) from wild apple species into domestic apple cultivars (Malus × domestica Borkh.). This technique drastically shortens the long-lasting juvenile phase of apple. The utilization of early-flowering apple lines overexpressing the BpMADS4 gene of the European silver birch (Betula pendula Roth.) in hybridization resulted in one breeding cycle per year. Aiming for the selection of non-transgenic null segregants at the end of the breeding process, the flower-inducing transgene and the gene of interest (e.g. resistance gene) that will be introgressed by hybridization need to be located on different chromosomes. To improve the flexibility of the existing approach in apple, this study was focused on the development and characterization of eleven additional BpMADS4 overexpressing lines of four different apple cultivars. In nine lines, the flowering gene was mapped to different linkage groups. The differences in introgressed T-DNA sequences and plant genome deletions post-transformation highlighted the unique molecular character of each line. However, transgenic lines demonstrated no significant differences in flower organ development and pollen functionality compared with non-transgenic plants. Hybridization studies using pollen from the fire blight-resistant wild species accession Malus fusca MAL0045 and the apple scab-resistant cultivar 'Regia' indicated that BpMADS4 introgression had no significant effect on the breeding value of each transgenic line. PMID:25370729

  16. TopBP1和ATR-ATRIP在细胞周期中的作用及联系%Role and Relationship of TopBP1 and ATR-ATRIP in the Cell Life Cycle

    Institute of Scientific and Technical Information of China (English)

    黄神安; 熊高飞; 张吉翔

    2006-01-01

    TopBP1(topoisomerase Ⅱ beta-binding protein 1)和ATR(ataxia-telangiectasia mutated-and rad3-related)-ATRIP(ATR-interacting protein)通过调节一些因子在DNA损伤检控点(DNA damage checkpoint)中起着关键的作用,其中TopBP1可以激活ATR-ATRIP的复合体.文章着重阐述了TopBP1和ATR-ATRIP如何调控细胞周期并发挥其维护基因组完整性的作用.

  17. Primary explosives

    Energy Technology Data Exchange (ETDEWEB)

    Matyas, Robert; Pachman, Jiri [Pardubice Univ. (Czech Republic). Faculty of Chemical Technology

    2013-06-01

    The first chapter provides background such as the basics of initiation and differences between requirements on primary explosives used in detonators and igniters. The authors then clarify the influence of physical characteristics on explosive properties, focusing on those properties required for primary explosives. Furthermore, the issue of sensitivity is discussed. All the chapters on particular groups of primary explosives are structured in the same way, including introduction, physical and chemical properties, explosive properties, preparation and documented use.

  18. Tracing the Cycling and Fate of the Explosive 2,4,6-Trinitrotoluene in Coastal Marine Systems with a Stable Isotopic Tracer, (15)N-[TNT].

    Science.gov (United States)

    Smith, Richard W; Vlahos, Penny; Böhlke, J K; Ariyarathna, Thivanka; Ballentine, Mark; Cooper, Christopher; Fallis, Stephen; Groshens, Thomas J; Tobias, Craig

    2015-10-20

    2,4,6-Trinitrotoluene (TNT) has been used as a military explosive for over a hundred years. Contamination concerns have arisen as a result of manufacturing and use on a large scale; however, despite decades of work addressing TNT contamination in the environment, its fate in marine ecosystems is not fully resolved. Here we examine the cycling and fate of TNT in the coastal marine systems by spiking a marine mesocosm containing seawater, sediments, and macrobiota with isotopically labeled TNT ((15)N-[TNT]), simultaneously monitoring removal, transformation, mineralization, sorption, and biological uptake over a period of 16 days. TNT degradation was rapid, and we observed accumulation of reduced transformation products dissolved in the water column and in pore waters, sorbed to sediments and suspended particulate matter (SPM), and in the tissues of macrobiota. Bulk δ(15)N analysis of sediments, SPM, and tissues revealed large quantities of (15)N beyond that accounted for in identifiable derivatives. TNT-derived N was also found in the dissolved inorganic N (DIN) pool. Using multivariate statistical analysis and a (15)N mass balance approach, we identify the major transformation pathways of TNT, including the deamination of reduced TNT derivatives, potentially promoted by sorption to SPM and oxic surface sediments. PMID:26375037

  19. BP's emissions trading system

    International Nuclear Information System (INIS)

    Between 1998 and 2001, BP reduced its emissions of greenhouse gases by more than 10%. BP's success in cutting emissions is often equated with its use of an apparently market-based emissions trading program. However no independent study has ever examined the rules and operation of BP's system and the incentives acting on managers to reduce emissions. We use interviews with key managers and with traders in several critical business units to explore the bound of BP's success with emissions trading. No money actually changed hands when permits were traded, and the main effect of the program was to create awareness of money-saving emission controls rather than strong price incentives. We show that the trading system did not operate like a 'textbook' cap and trade scheme. Rather, the BP system operated much like a 'safety valve' trading system, where managers let the market function until the cost of doing so surpassed what the company was willing to tolerate

  20. Explosive laser

    Science.gov (United States)

    Robinson, C.P.; Jensen, R.J.; Davis, W.C.; Sullivan, J.A.

    1975-09-01

    This patent relates to a laser system wherein reaction products from the detonation of a condensed explosive expand to form a gaseous medium with low translational temperature but high vibration population. Thermal pumping of the upper laser level and de-excitation of the lower laser level occur during the expansion, resulting in a population inversion. The expansion may be free or through a nozzle as in a gas-dynamic configuration. In one preferred embodiment, the explosive is such that its reaction products are CO$sub 2$ and other species that are beneficial or at least benign to CO$sub 2$ lasing. (auth)

  1. Explosive laser

    International Nuclear Information System (INIS)

    This patent relates to a laser system wherein reaction products from the detonation of a condensed explosive expand to form a gaseous medium with low translational temperature but high vibration population. Thermal pumping of the upper laser level and de-excitation of the lower laser level occur during the expansion, resulting in a population inversion. The expansion may be free or through a nozzle as in a gas-dynamic configuration. In one preferred embodiment, the explosive is such that its reaction products are CO2 and other species that are beneficial or at least benign to CO2 lasing

  2. Explosive complexes

    Science.gov (United States)

    Huynh, My Hang V.

    2009-09-22

    Lead-free primary explosives of the formula [M.sup.II(A).sub.R(B.sup.X).sub.S](C.sup.Y).sub.T, where A is 1,5-diaminotetrazole, and syntheses thereof are described. Substantially stoichiometric equivalents of the reactants lead to high yields of pure compositions thereby avoiding dangerous purification steps.

  3. 78 FR 60270 - BP America Inc., BP Corporation North America Inc., BP America Production Company, and BP Energy...

    Science.gov (United States)

    2013-10-01

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission BP America Inc., BP Corporation North America Inc., BP America Production Company, and BP Energy Company; Notice of Designation of Commission Staff as Non-Decisional With...

  4. Virkelighed under konstruktion - en analyse af BP's kommunikation under krisen i Den Mexicanske Golf

    OpenAIRE

    Kirchhoff, Daniel Pilpel

    2011-01-01

    In 2010 the oil company British Petroleum (BP) attracted the medias attention, when an explosion and subsequent oil leak from the Deepwater Horizon drilling rig caused what has been labeled the greatest environmental disaster in the history of the United States. This caused BP to defend its image and respond to the reality of the crisis that was presented in the media. The aim of this study is to examine how BP constructs the reality of the oil spill in the Golf ...

  5. Explosive Joining

    Science.gov (United States)

    1989-01-01

    Laurence J. Bement of Langley Research Center invented a technique to permit metal joining operations under hazardous or inaccessible conditions. The process, which provides a joint with double the strength of the parent metal, involves the use of very small quantities of ribbon explosive to create hermetically sealed joints. When the metal plates are slammed together by the explosion's force, joining is accomplished. The collision causes a skin deep melt and ejection of oxide films on the surfaces, allowing a linkup of electrons that produce superstrong, uniform joints. The technique can be used to join metals that otherwise would not join and offers advantages over mechanical fasteners and adhesives. With Langley assistance, Demex International Ltd. refined and commercialized the technology. Applications include plugging leaking tubes in feedwater heaters. Demex produces the small plugs, associated sleeves and detonators. The technology allows faster plugging, reduces downtime, cuts plugging costs and increases reliability.

  6. Explosive simulants for testing explosive detection systems

    Science.gov (United States)

    Kury, John W.; Anderson, Brian L.

    1999-09-28

    Explosives simulants that include non-explosive components are disclosed that facilitate testing of equipment designed to remotely detect explosives. The simulants are non-explosive, non-hazardous materials that can be safely handled without any significant precautions. The simulants imitate real explosives in terms of mass density, effective atomic number, x-ray transmission properties, and physical form, including moldable plastics and emulsions/gels.

  7. Explosive hydrogen burning

    International Nuclear Information System (INIS)

    Although an impressive quantity of work has been devoted to understanding nucleosynthesis during explosive hydrogen burning, much work remain to be done. Reactions which occur in novae, x-ray bursts, and supernovae are discussed. Much attention is given to the reactions of hot CNO cycles and of reactions in the rp-process. The many reactions described in this review are not all of the reactions which may be of interest to nuclear physicists, although the rates of those reactions not discussed are essentially unknown. 123 refs., 9 figs

  8. Leidenfrost explosions

    CERN Document Server

    Moreau, F; Dorbolo, S

    2012-01-01

    We present a fluid dynamics video showing the behavior of Leidenfrost droplets composed by a mixture of water and surfactant (SDS, Sodium Dodecyl sulfate). When a droplet is released on a plate heated above a given temperature a thin layer of vapor isolates the droplet from the plate. The droplet levitates over the plate. This is called the Leidenfrost effect. In this work we study the influence of the addition of a surfactant on the Leidenfrost phenomenon. As the droplet evaporates the concentration of SDS rises up to two orders of magnitude over the Critical Micelle Concentration (CMC). An unexpected and violent explosive behavior is observed. The video presents several explosions taken with a high speed camera (IDT-N4 at 30000 fps). All the presented experiments were performed on a plate heated at 300{\\deg}C. On the other hand, the initial quantity of SDS was tuned in two ways: (i) by varying the initial concentration of SDS and (ii) by varying the initial size of the droplet. By measuring the volume of th...

  9. Microbial remediation of explosive waste.

    Science.gov (United States)

    Singh, Baljinder; Kaur, Jagdeep; Singh, Kashmir

    2012-05-01

    Explosives are synthesized globally mainly for military munitions. Nitrate esters, such as GTN and PETN, nitroaromatics like TNP and TNT and nitramines with RDX, HMX and CL20, are the main class of explosives used. Their use has resulted in severe contamination of environment and strategies are now being developed to clean these substances in an economical and eco-friendly manner. The incredible versatility inherited in microbes has rendered these explosives as a part of the biogeochemical cycle. Several microbes catalyze mineralization and/or nonspecific transformation of explosive waste either by aerobic or anaerobic processes. It is likely that ongoing genetic adaptation, with the recruitment of silent sequences into functional catabolic routes and evolution of substrate range by mutations in structural genes, will further enhance the catabolic potential of bacteria toward explosives and ultimately contribute to cleansing the environment of these toxic and recalcitrant chemicals. This review summarizes information on the biodegradation and biotransformation pathways of several important explosives. Isolation, characterization, utilization and manipulation of the major detoxifying enzymes and the molecular basis of degradation are also discussed. This may be useful in developing safer and economic microbiological methods for clean up of soil and water contaminated with such compounds. The necessity of further investigations concerning the microbial metabolism of these substances is also discussed. PMID:22497284

  10. Un fusible de méthane pour l'explosion cambrienne : les cycles du carbone et dérive des pôles

    Science.gov (United States)

    Kirschvink, Joseph L.; Raub, Timothy D.

    2003-01-01

    The dramatic diversification of animal groups known as the Cambrian Explosion (evolution's 'Big Bang') remains an unsolved puzzle in Earth Science. The Vendian-Cambrian interval is characterized by anomalously high rates of apparent plate motion, interpreted as True Polar Wander (TPW), and by more than a dozen large, high-frequency perturbations in carbon isotopes that dwarf all others observed through the past 65 million years. We suggest that these biological, tectonic, and geochemical events are intimately related in the following fashion. First, tropical continental margins and shelf-slopes which formed during fragmentation of the supercontinent Rodinia accumulated massive quantities of isotopically-light organic carbon during Late Neoproterozoic time, as indicated by strikingly heavy isotope ratios in inorganic carbon during interglacial intervals. Second, an initial phase of Vendian TPW moved these organic-rich deposits to high latitude, where conditions favored trapping biogenic methane in layers of gas hydrate and perhaps permafrost. Continued sedimentation during Late Vendian time added additional hydrate/gas storage volume and stabilized underlying units until the geothermal gradient moved them out of the clathrate stability field, building up deep reservoirs of highly pressurized methane. Finally, a burst of TPW brought these deposits back to the Tropics, where they gradually warmed and were subjected to regional-scale thermohaline eddy variation and related sedimentation regime changes. Responding to the stochastic character of such changes, each reservoir reached a critical failure point independently at times throughout the Cambrian. By analogy with the Late Paleocene Thermal Maximum event, these methane deposits yield transient, greenhouse-induced pulses of global warming when they erupt. Temperature correlates powerfully with biodiversity; the biochemical kinetics of metabolism at higher temperature decrease generation time and maintain relatively

  11. Chaotic Explosions

    CERN Document Server

    Altmann, Eduardo G; Tél, Tamás

    2015-01-01

    We investigate chaotic dynamical systems for which the intensity of trajectories might grow unlimited in time. We show that (i) the intensity grows exponentially in time and is distributed spatially according to a fractal measure with an information dimension smaller than that of the phase space,(ii) such exploding cases can be described by an operator formalism similar to the one applied to chaotic systems with absorption (decaying intensities), but (iii) the invariant quantities characterizing explosion and absorption are typically not directly related to each other, e.g., the decay rate and fractal dimensions of absorbing maps typically differ from the ones computed in the corresponding inverse (exploding) maps. We illustrate our general results through numerical simulation in the cardioid billiard mimicking a lasing optical cavity, and through analytical calculations in the baker map.

  12. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    Energy Technology Data Exchange (ETDEWEB)

    Kanginakudru, Sriramana, E-mail: skangina@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); DeSmet, Marsha, E-mail: mdesmet@iupui.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Thomas, Yanique, E-mail: ysthomas@umail.iu.edu [Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States); Morgan, Iain M., E-mail: immorgan@vcu.edu [VCU Philips Institute for Oral Health Research, Virginia Commonwealth University, Richmond, Virginia (United States); Androphy, Elliot J., E-mail: eandro@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States)

    2015-04-15

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication.

  13. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    International Nuclear Information System (INIS)

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication

  14. Extrusion cast explosive

    Science.gov (United States)

    Scribner, Kenneth J.

    1985-01-01

    Improved, multiphase, high performance, high energy, extrusion cast explosive compositions, comprising, a crystalline explosive material; an energetic liquid plasticizer; a urethane prepolymer, comprising a blend of polyvinyl formal, and polycaprolactone; a polyfunctional isocyanate; and a catalyst are disclosed. These new explosive compositions exhibit higher explosive content, a smooth detonation front, excellent stability over long periods of storage, and lower sensitivity to mechanical stimulants.

  15. Pulse-Length Dependence of the Anisotropy of Laser-Driven Cluster Explosions: Transition to the Impulsive Regime for Pulses Approaching the Few-Cycle Limit

    International Nuclear Information System (INIS)

    We have experimentally observed anisotropic ion emission from Xe and Ar clusters under intense ultrashort (∼30 fs) laser irradiation, with up to 1.8 times more energetic ions emitted in the direction perpendicular to the laser polarization than in the parallel direction. As the pulse length was varied in the range of 8-160 fs, we found this anisotropy to first grow and then diminish. Treating electrons inside the unexpanded cluster as a harmonic oscillator qualitatively demonstrates how intracluster electric field can result in an ion emission anisotropy of this kind. Our observations give direct access to the initial charging dynamics present in the first few cycles of an intense laser field interacting with any nanoscale dielectric.

  16. Understanding vented gas explosions

    Energy Technology Data Exchange (ETDEWEB)

    Lautkaski, R. [VTT Energy, Espoo (Finland). Energy Systems

    1997-12-31

    The report is an introduction to vented gas explosions for nonspecialists, particularly designers of plants for flammable gases and liquids. The phenomena leading to pressure generation in vented gas explosions in empty and congested rooms are reviewed. The four peak model of vented gas explosions is presented with simple methods to predict the values of the individual peaks. Experimental data on the external explosion of dust and gas explosions is discussed. The empirical equation relating the internal and external peak pressures in vented dust explosions is shown to be valid for gas explosion tests in 30 m{sup 3} and 550 m{sup 3} chambers. However, the difficulty of predicting the internal peak pressure in large chambers remains. Methods of explosion relief panel design and principles of vent and equipment layout to reduce explosion overpressures are reviewed. (orig.) 65 refs.

  17. Convergence of BP Algorithm for Training MLP with Linear Output

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The capability of multilayer perceptrons (MLPs) for approximating continuous functions with arbitrary accuracy has been demonstrated in the past decades. Back propagation (BP) algorithm is the most popular learning algorithm for training of MLPs. In this paper, a simple iteration formula is used to select the learning rate for each cycle of training procedure, and a convergence result is presented for the BP algorithm for training MLP with a hidden layer and a linear output unit. The monotonicity of the error function is also guaranteed during the training iteration.

  18. Explosives tester with heater

    Science.gov (United States)

    Del Eckels, Joel; Nunes, Peter J.; Simpson, Randall L.; Whipple, Richard E.; Carter, J. Chance; Reynolds, John G.

    2010-08-10

    An inspection tester system for testing for explosives. The tester includes a body and a swab unit adapted to be removeably connected to the body. At least one reagent holder and dispenser is operatively connected to the body. The reagent holder and dispenser contains an explosives detecting reagent and is positioned to deliver the explosives detecting reagent to the swab unit. A heater is operatively connected to the body and the swab unit is adapted to be operatively connected to the heater.

  19. Dynamics of explosive instability

    International Nuclear Information System (INIS)

    It was shown that in general case explosive instability dynamics should be described as four wave interaction. The main difference from three wave interaction is that this dynamics may not contain explosive instability. Besides it may by irregular. If the characteristics of one of the wave is closed to one of the interacting wave and they are connected linearly then explosive instability may be suppressed.

  20. Intermittent Explosive Disorder

    OpenAIRE

    Lut Tamam; Meliha Zengin Eroglu; Ozlem Paltaci

    2011-01-01

    Intermittent explosive disorder is an impulse control disorder characterized by the occurrence of discrete episodes of failure to resist aggressive impulses that result in violent assault or destruction of property. Though the prevalence intermittent explosive disorder has been reported to be relatively rare in frontier studies on the field, it is now common opinion that intermittent explosive disorder is far more common than previously thought especially in clinical psychiatry settings. Etio...

  1. Fault tree analysis for red oil explosion in reprocessing facility

    International Nuclear Information System (INIS)

    Almost all spent fuel reprocessing facilities have adopted Purex process. The red oil explosion is a great concern in safety study of spent fuel reprocessing facilities adopting Purex process. The event tree and fault tree analysis was performed for the red oil explosion of a medium level radioactive waste liquid evaporator for the collective decontamination and separation cycle segment in a representative reprocessing facility in this paper. The results show that the occurrence frequency of a red oil explosion is extremely low, and human errors and common cause failures are major causes to a red oil explosion. Therefore, some relevant measures should be taken to prevent such accidents. (authors)

  2. Explosive Technology Group

    Data.gov (United States)

    Federal Laboratory Consortium — The Explosive Technology Group (ETG) provides diverse technical expertise and an agile, integrated approach to solve complex challenges for all classes of energetic...

  3. Explosive pulsed power

    CERN Document Server

    Altgilbers, Larry L; Freeman, Bruce L

    2010-01-01

    Explosive pulsed power generators are devices that either convert the chemical energy stored in explosives into electrical energy or use the shock waves generated by explosives to release energy stored in ferroelectric and ferromagnetic materials. The objective of this book is to acquaint the reader with the principles of operation of explosive generators and to provide details on how to design, build, and test three types of generators: flux compression, ferroelectric, and ferromagnetic generators, which are the most developed and the most near term for practical applications. Containing a co

  4. TopBP1 is required at mitosis to reduce transmission of DNA damage to G1 daughter cells

    DEFF Research Database (Denmark)

    Pedersen, Rune Troelsgaard; Kruse, Thomas; Nilsson, Jakob;

    2015-01-01

    mitotic entry. In early mitosis, TopBP1 marks sites of and promotes unscheduled DNA synthesis. Moreover, TopBP1 is required for focus formation of the structure-selective nuclease and scaffold protein SLX4 in mitosis. Persistent TopBP1 foci transition into 53BP1 nuclear bodies (NBs) in G1 and precise...... temporal depletion of TopBP1 just before mitotic entry induced formation of 53BP1 NBs in the next cell cycle, showing that TopBP1 acts to reduce transmission of DNA damage to G1 daughter cells. Based on these results, we propose that TopBP1 maintains genome integrity in mitosis by controlling chromatin...

  5. Steam explosion studies review

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, Moon Kyu; Kim, Hee Dong

    1999-03-01

    When a cold liquid is brought into contact with a molten material with a temperature significantly higher than the liquid boiling point, an explosive interaction due to sudden fragmentation of the melt and rapid evaporation of the liquid may take place. This phenomenon is referred to as a steam explosion or vapor explosion. Depending upon the amount of the melt and the liquid involved, the mechanical energy released during a vapor explosion can be large enough to cause serious destruction. In hypothetical severe accidents which involve fuel melt down, subsequent interactions between the molten fuel and coolant may cause steam explosion. This process has been studied by many investigators in an effort to assess the likelihood of containment failure which leads to large scale release of radioactive materials to the environment. In an effort to understand the phenomenology of steam explosion, extensive studies has been performed so far. The report presents both experimental and analytical studies on steam explosion. As for the experimental studies, both small scale tests which involve usually less than 20 g of high temperature melt and medium/large scale tests which more than 1 kg of melt is used are reviewed. For the modelling part of steam explosions, mechanistic modelling as well as thermodynamic modelling is reviewed. (author)

  6. Explosions and static electricity

    DEFF Research Database (Denmark)

    Jonassen, Niels M

    1995-01-01

    The paper deals with the problem of electrostatic discharges as causes of ignition of vapor/gas and dust/gas mixtures. A series of examples of static-caused explosions will be discussed. The concepts of explosion limits, the incendiveness of various discharge types and safe voltages are explained...

  7. Steam explosion studies review

    International Nuclear Information System (INIS)

    When a cold liquid is brought into contact with a molten material with a temperature significantly higher than the liquid boiling point, an explosive interaction due to sudden fragmentation of the melt and rapid evaporation of the liquid may take place. This phenomenon is referred to as a steam explosion or vapor explosion. Depending upon the amount of the melt and the liquid involved, the mechanical energy released during a vapor explosion can be large enough to cause serious destruction. In hypothetical severe accidents which involve fuel melt down, subsequent interactions between the molten fuel and coolant may cause steam explosion. This process has been studied by many investigators in an effort to assess the likelihood of containment failure which leads to large scale release of radioactive materials to the environment. In an effort to understand the phenomenology of steam explosion, extensive studies has been performed so far. The report presents both experimental and analytical studies on steam explosion. As for the experimental studies, both small scale tests which involve usually less than 20 g of high temperature melt and medium/large scale tests which more than 1 kg of melt is used are reviewed. For the modelling part of steam explosions, mechanistic modelling as well as thermodynamic modelling is reviewed. (author)

  8. Lake-expanding events in the Tibetan Plateau since 40 kaBP

    Institute of Scientific and Technical Information of China (English)

    贾玉连; 施雅风; 王苏民; 蒋雪中; 李世杰; 王爱军; 李徐生

    2001-01-01

    Since 40 kaBP, the current endorheism on the Tibetan Plateau had experienced at least four lake-expanding events, at 40-28 kaBP, 19-15 kaBP, 13-11 kaBP, 9.0-5.0 kaBP, respectively. The 40-28 kaBP and 9.0-5.0 kaBP lake-expanding events, corresponding to the global warming periods, were mainly determined by the abundant summer monsoon rainfall brought by strong Indian monsoon, aroused by enhanced solar radiation at earth orbital precessional cycle. The 40-28 kaBP lake-expanding event, also called the great lake period or the pan-lake period, for several great lake groups had come into being by the interconnection of the presently isolated and closed lake catchments. The total lake area over the Tibetan Plateau was estimated at least up to 150000 km2, 3.8 times of the present, and the lake supply coefficients were about 3-10. The 9.0-5.0 kaBP lake-expanding, with a total lake area of 68000 km2, less than the above mentioned reflected the Indian monsoon rainfall less than that of 40-28 kaBP. The expanded lak

  9. Research topics in explosives - a look at explosives behaviors

    International Nuclear Information System (INIS)

    The behaviors of explosives under many conditions - e.g., sensitivity to inadvertent reactions, explosion, detonation - are controlled by the chemical and physical properties of the explosive materials. Several properties are considered for a range of improvised and conventional explosives. Here I compare these properties across a wide range of explosives to develop an understanding of explosive behaviors. For improvised explosives, which are generally heterogeneous mixtures of ingredients, a range of studies is identified as needed to more fully understand their behavior and properties. For conventional explosives, which are generally comprised of crystalline explosive molecules held together with a binder, I identify key material properties that determine overall sensitivity, including the extremely safe behavior of Insensitive High Explosives, and discuss an approach to predicting the sensitivity or insensitivity of an explosive.

  10. Optically measured explosive impulse

    Science.gov (United States)

    Biss, Matthew M.; McNesby, Kevin L.

    2014-06-01

    An experimental technique is investigated to optically measure the explosive impulse produced by laboratory-scale spherical charges detonated in air. Explosive impulse has historically been calculated from temporal pressure measurements obtained via piezoelectric transducers. The presented technique instead combines schlieren flow visualization and high-speed digital imaging to optically measure explosive impulse. Prior to an explosive event, schlieren system calibration is performed using known light-ray refractions and resulting digital image intensities. Explosive charges are detonated in the test section of a schlieren system and imaged by a high-speed digital camera in pseudo-streak mode. Spatiotemporal schlieren intensity maps are converted using an Abel deconvolution, Rankine-Hugoniot jump equations, ideal gas law, triangular temperature decay profile, and Schardin's standard photometric technique to yield spatiotemporal pressure maps. Temporal integration of individual pixel pressure profiles over the positive pressure duration of the shock wave yields the explosive impulse generated for a given radial standoff. Calculated explosive impulses are shown to exhibit good agreement between optically derived values and pencil gage pressure transducers.

  11. Influence of BP Ultimate on engine cleanliness

    OpenAIRE

    Mieghem, R.S.P. van

    2007-01-01

    During early 2005, BP introduced two new fuels in the Netherlands. These new products are called BP Ultimate 98 Unleaded and BP Ultimate Diesel. These fuels were formulated to offer several benefits compared to ordinary fuels, specifically in engine cleanliness. TNO was asked to evaluate the test results from BP, examine the stated claims and, if proven, to give a specific endorsement of calculated claims of the product(s). In order to understand the performed research and the arising conclus...

  12. Research on honeycomb structure explosives and double sided explosive cladding

    International Nuclear Information System (INIS)

    Highlights: • Honeycomb structure explosives are used to ensure the quality of charge. • Double sided explosive cladding can clad two composite plates simultaneously. • The critical thickness of explosives decreased significantly. • The energy efficiency of explosives has been significantly improved. • Experiment results can be better predicted by calculation. - Abstract: In order to resolve the current issues about the backward method of charge and low energy efficiency of explosives, honeycomb structure explosives and double sided explosive cladding were used in the present study. Honeycomb structure explosives are used to ensure the quality of charge. Double sided explosive cladding can clad two composite plates simultaneously. Honeycomb structure explosives and double sided explosive cladding, which significantly reduce the critical thickness of stable detonation of explosives, are used to increase the energy efficiency of explosives and save the amount of explosives. Emulsion explosives with the thickness of 5 mm can be stable detonation. In this paper, the experiment of double sided explosive cladding for two groups of steel of No. 45 with the thickness of 2 mm to steel of Q235 with the thickness of 16 mm and two groups of stainless steel with the thickness of 3 mm to steel of Q235 with the thickness of 16 mm were successfully investigated. Without constraints, the critical diameter of emulsion explosives is 14–16 mm. Compared to the existing explosive cladding method, the consumption of explosives for steel of No. 45 to steel of Q235 and stainless steel to steel of Q235 are reduced by 83% and 77% in the case of cladding the same number of composite plates. The explosive cladding windows and collision velocity of flyer plate were calculated before experiment. It shows that the calculation prefigures exactly the explosive cladding for steel of No. 45 to steel of Q235 and stainless steel to steel of Q235

  13. Liquid explosives detection

    Science.gov (United States)

    Burnett, Lowell J.

    1994-03-01

    A Liquid Explosives Screening System capable of scanning unopened bottles for liquid explosives has been developed. The system can be operated to detect specific explosives directly, or to verify the labeled or bar-coded contents of the container. In this system nuclear magnetic resonance (NMR) is used to interrogate the liquid. NMR produces an extremely rich data set and many parameters of the NMR response can be determined simultaneously. As a result, multiple NMR signatures may be defined for any given set of liquids, and the signature complexity then selected according to the level of threat.

  14. CacyBP/SIP nuclear translocation regulates p27Kip1 stability in gastric cancer cells

    Science.gov (United States)

    Niu, Ying-Lin; Li, Ya-Jun; Wang, Jing-Bo; Lu, Yuan-Yuan; Liu, Zhen-Xiong; Feng, Shan-Shan; Hu, Jian-Guo; Zhai, Hui-Hong

    2016-01-01

    AIM: To investigate the mechanism of calcyclin binding protein/Siah-1 interacting protein (CacyBP/SIP) nuclear translocation in promoting the proliferation of gastric cancer (GC) cells. METHODS: The effect of CacyBP/SIP nuclear translocation on cell cycle was investigated by cell cycle analysis. Western blot analysis was used to assess the change in expression of cell cycle regulatory proteins and proteasome-mediated degradation of p27Kip1. Co-immunoprecipitation (co-IP) analysis was performed to examine the binding of CacyBP/SIP with Skp1. A CacyBP/SIP truncation mutant which lacked the Skp1 binding site was constructed and fused to a fluorescent protein. Subsequently, the effect on Skp1 binding with the fusion protein was examined by co-IP, while localization of fluorescent fusion protein observed by confocal laser microscopy, and change in p27Kip1 protein expression assessed by Western blot analysis. RESULTS: CacyBP/SIP nuclear translocation induced by gastrin promoted progression of GC cells from G1 phase. However, while CacyBP/SIP nuclear translocation was inhibited using siRNA to suppress CacyBP/SIP expression, cell cycle was clearly inhibited. CacyBP/SIP nuclear translocation significantly decreased the level of cell cycle inhibitor p27Kip1, increased Cyclin E protein expression whereas the levels of Skp1, Skp2, and CDK2 were not affected. Upon inhibition of CacyBP/SIP nuclear translocation, there were no changes in protein levels of p27Kip1 and Cyclin E, while p27Kip1 decrease could be prevented by the proteasome inhibitor MG132. Moreover, CacyBP/SIP was found to bind to Skp1 by immunoprecipitation, an event that was abolished by mutant CacyBP/SIP, which also failed to stimulate p27Kip1 degradation, even though the mutant could still translocate into the nucleus. CONCLUSION: CacyBP/SIP nuclear translocation contributes to the proliferation of GC cells, and CacyBP/SIP exerts this effect, at least in part, by stimulating ubiquitin-mediated degradation of p27

  15. Explosive Components Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The 98,000 square foot Explosive Components Facility (ECF) is a state-of-the-art facility that provides a full-range of chemical, material, and performance analysis...

  16. Parametric Explosion Spectral Model

    Energy Technology Data Exchange (ETDEWEB)

    Ford, S R; Walter, W R

    2012-01-19

    Small underground nuclear explosions need to be confidently detected, identified, and characterized in regions of the world where they have never before occurred. We develop a parametric model of the nuclear explosion seismic source spectrum derived from regional phases that is compatible with earthquake-based geometrical spreading and attenuation. Earthquake spectra are fit with a generalized version of the Brune spectrum, which is a three-parameter model that describes the long-period level, corner-frequency, and spectral slope at high-frequencies. Explosion spectra can be fit with similar spectral models whose parameters are then correlated with near-source geology and containment conditions. We observe a correlation of high gas-porosity (low-strength) with increased spectral slope. The relationship between the parametric equations and the geologic and containment conditions will assist in our physical understanding of the nuclear explosion source.

  17. Intermittent Explosive Disorder

    Directory of Open Access Journals (Sweden)

    Lut Tamam

    2011-09-01

    Full Text Available Intermittent explosive disorder is an impulse control disorder characterized by the occurrence of discrete episodes of failure to resist aggressive impulses that result in violent assault or destruction of property. Though the prevalence intermittent explosive disorder has been reported to be relatively rare in frontier studies on the field, it is now common opinion that intermittent explosive disorder is far more common than previously thought especially in clinical psychiatry settings. Etiological studies displayed the role of both psychosocial factors like childhood traumas and biological factors like dysfunctional neurotransmitter systems and genetics. In differential diagnosis of the disorder, disorders involving agression as a symptom such as alcohol and drug intoxication, antisocial and borderline personality disorders, personality changes due to general medical conditions and behavioral disorder should be considered. A combination of pharmacological and psychotherapeutic approaches are suggested in the treatment of the disorder. This article briefly reviews the historical background, diagnostic criteria, epidemiology, etiology and treatment of intermittent explosive disorder.

  18. Modeling nuclear explosion

    Science.gov (United States)

    Redd, Jeremy; Panin, Alexander

    2012-10-01

    As a result of the Nuclear Test Ban Treaty, no nuclear explosion tests have been performed by the US since 1992. This appreciably limits valuable experimental data needed for improvement of existing weapons and development of new ones, as well as for use of nuclear devices in non-military applications (such as making underground oil reservoirs or compressed air energy storages). This in turn increases the value of numerical modeling of nuclear explosions and of their effects on the environment. We develop numerical codes simulating fission chain reactions in a supercritical U and Pu core and the dynamics of the subsequent expansion of generated hot plasma in order to better understand the impact of such explosions on their surroundings. The results of our simulations (of both above ground and underground explosions) of various energy yields are presented.

  19. Shock waves & explosions

    CERN Document Server

    Sachdev, PL

    2004-01-01

    Understanding the causes and effects of explosions is important to experts in a broad range of disciplines, including the military, industrial and environmental research, aeronautic engineering, and applied mathematics. Offering an introductory review of historic research, Shock Waves and Explosions brings analytic and computational methods to a wide audience in a clear and thorough way. Beginning with an overview of the research on combustion and gas dynamics in the 1970s and 1980s, the author brings you up to date by covering modeling techniques and asymptotic and perturbative methods and ending with a chapter on computational methods.Most of the book deals with the mathematical analysis of explosions, but computational results are also included wherever they are available. Historical perspectives are provided on the advent of nonlinear science, as well as on the mathematical study of the blast wave phenomenon, both when visualized as a point explosion and when simulated as the expansion of a high-pressure ...

  20. Chemical Explosion Database

    Science.gov (United States)

    Johansson, Peder; Brachet, Nicolas

    2010-05-01

    A database containing information on chemical explosions, recorded and located by the International Data Center (IDC) of the CTBTO, should be established in the IDC prior to entry into force of the CTBT. Nearly all of the large chemical explosions occur in connection with mining activity. As a first step towards the establishment of this database, a survey of presumed mining areas where sufficiently large explosions are conducted has been done. This is dominated by the large coal mining areas like the Powder River (U.S.), Kuznetsk (Russia), Bowen (Australia) and Ekibastuz (Kazakhstan) basins. There are also several other smaller mining areas, in e.g. Scandinavia, Poland, Kazakhstan and Australia, with large enough explosions for detection. Events in the Reviewed Event Bulletin (REB) of the IDC that are located in or close to these mining areas, and which therefore are candidates for inclusion in the database, have been investigated. Comparison with a database of infrasound events has been done as many mining blasts generate strong infrasound signals and therefore also are included in the infrasound database. Currently there are 66 such REB events in 18 mining areas in the infrasound database. On a yearly basis several hundreds of events in mining areas have been recorded and included in the REB. Establishment of the database of chemical explosions requires confirmation and ground truth information from the States Parties regarding these events. For an explosion reported in the REB, the appropriate authority in whose country the explosion occurred is encouraged, on a voluntary basis, to seek out information on the explosion and communicate this information to the IDC.

  1. Modelling of gas explosions

    OpenAIRE

    Vågsæther, Knut

    2010-01-01

    The content of this thesis is a study of gas explosions in complex geometries and presentation and validation of a method for simulating flame acceleration and deflagration to detonation transition. The thesis includes a description of the mechanisms of flame acceleration and DDT that need to be modeled when simulating all stages of gas explosions. These mechanisms are flame acceleration due to instabilities that occur in fluid flow and reactive systems, shock propagation, deflagration to det...

  2. AcEST: BP912731 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_C03 403 Adiantum capillus-veneris mRNA. clone: YMU001_000022_C03. BP912731 CL3082C ... protein OS=Desul... 33 7.0 tr|B6ZAE3|B6ZAE3_HELAN Cycling ... DOF factor 2 (Fragment) OS=Helian... 33 7.0 tr|B6Z ... AE2|B6ZAE2_HELAN Cycling ... DOF factor 2 (Fragment) OS=Helian... 33 7.0 tr|B6Z ...

  3. Magnetospheric accretion on the T Tauri star BP Tauri

    CERN Document Server

    Donati, J F; Gregory, S G; Petit, P; Paletou, F; Bouvier, J; Dougados, C; Ménard, F; Cameron, A C; Harries, T J; Hussain, G A J; Unruh, Y; Morin, J; Marsden, S C; Manset, N; Aurière, M; Catala, C; Alecian, E

    2008-01-01

    From observations collected with the ESPaDOnS and NARVAL spectropolarimeters, we report the detection of Zeeman signatures on the classical T Tauri star BP Tau. Circular polarisation signatures in photospheric lines and in narrow emission lines tracing magnetospheric accretion are monitored throughout most of the rotation cycle of BP Tau at two different epochs in 2006. We observe that rotational modulation dominates the temporal variations of both unpolarised and circularly polarised spectral proxies tracing the photosphere and the footpoints of accretion funnels. From the complete data sets at each epoch, we reconstruct the large-scale magnetic topology and the location of accretion spots at the surface of BP Tau using tomographic imaging. We find that the field of BP Tau involves a 1.2 kG dipole and 1.6 kG octupole, both slightly tilted with respect to the rotation axis. Accretion spots coincide with the two main magnetic poles at high latitudes and overlap with dark photospheric spots; they cover about 2%...

  4. Peaceful nuclear explosions

    International Nuclear Information System (INIS)

    This paper reports on studies of the results of U.S. programs for the application of peaceful nuclear explosions which make it clear that they are not particularly attractive to the United States at this time, and that there is no significant indication that they will have commercial utilization by 1990. Although one must make allowances for different situations in other countries, there do not appear to be any obvious technical or economic reasons why this somewhat negative conclusion should not apply to virtually all other nations as well. This does not constitute an argument against R and D on possible peaceful uses, given the many technical unknowns and economic uncertainties. It does, however, strongly suggest that if continued testing of peaceful nuclear explosions represents a substantial interference to desirable arms control or disarmament objectives, the potential benefits from peaceful nuclear explosions would not appear to be sufficient to permit their testing to stand in the way. Specifically, it is hard to see why concern about peaceful nuclear explosions should interfere with negotiations toward a comprehensive test ban treaty. At the very minimum, a 10-year world moratorium on testing or use of peaceful nuclear explosions would seem to be a modest price to pay for the significant progress toward arms control and detente which a comprehensive test ban treaty could represent

  5. R-22 vapor explosions

    International Nuclear Information System (INIS)

    Previous experimental and theoretical studies of R-22 vapor explosions are reviewed. Results from two experimental investigations of vapor explosions in a medium scale R-22/water system are reported. Measurements following the drop of an unrestrained mass of R-22 into a water tank demonstrated the existence of two types of interaction behavior. Release of a constrained mass of R-22 beneath the surface of a water tank improved the visual resolution of the system thus allowing identification of two interaction mechansims: at low water temperatures, R-22/water contact would produce immediate violent boiling; at high water temperatures a vapor film formed around its R-22 as it was released, explosions were generated by a surface wave which initiated at a single location and propagated along the vapor film as a shock wave. A new vapor explosion model is proposed, it suggests explosions are the result of a sequence of three independent steps: an initial mixing phase, a trigger and growth phase, and a mature phase where a propagating shock wave accelerates the two liquids into a collapsing vapor layer causing a high velocity impact which finely fragments and intermixes the two liquids

  6. BP petchems unaffected by refinery sales

    Energy Technology Data Exchange (ETDEWEB)

    Young, I.

    1996-01-17

    BP chemicals says its petrochemical activities at Lima, Ohio and Lavera, France are unlikely to be affected by the BP group`s decision to sell or close its refineries at those sites. BP purchases propylene for acrylonitrile production from its Lima and Toledo, OH refineries. {open_quotes}Until we know who the buyer [of the Lima refinery] is and the terms of the sale, it is difficult to estimate the impact,{close_quotes} BP says. The company intends to continue operating the Lima acrylo unit. BP says its chemical activities in France - including the Lavera-based Naphtachimie olefins joint venture with Elf Atochem - are excluded from any intentions for the Lavera refinery and that there is no direct impact on them. {open_quotes}Any decision on the [refinery] sale will be geared toward protecting the value of these chemical interests as well as the synergy benefits from the refinery and petrochemical complex,{close_quotes} BP says.

  7. Presentation of the Central Office for the Suppression of Trafficking in Arms, Explosives and Sensitive Materials, OCRTAEMS [International conference on safety and security of radioactive sources: Towards a global system for the continuous control of sources throughout their life cycle

    International Nuclear Information System (INIS)

    The Central Office for the Suppression of Trafficking in Arms, Explosives and Sensitive Materials (OCRTAEMS) was created on 13 December 1982. For around twenty years it was no more than a simple group within the Anti-Terrorist Division of the Central Directorate of the Criminal Police (DCPJ). At that time, it was almost exclusively terrorists who had recourse to explosives and weapons of war, hence the name. In April 2002, following the Nanterre massacre (March 2002), where a mad marksman decimated the Municipal Council of the town during a meeting, it was decided to reactivate this office. Its mandate was also redefined to cover general suppression of arms trafficking, whatever the area of crime: organized crime, common law crime, terrorism, crime in sensitive areas, etc. The arms office was removed from the National Anti-Terrorist Division (DNAT) and became a separate office directly under the Subdirectorate for Criminal Affairs. The number of its staff was set at 30. Its function is to promote and coordinate the fight against crime relating to the manufacture and possession of, trading in and illicit use of weapons, ammunition, explosives and sensitive materials (nuclear, radiological, biological and chemical). Its structure is traditional and comprises two inquiry groups, one technical and legal analysis unit and an operational documentation section. It has a ballistics and weapons expert, an explosives specialist and a nuclear, radiological, biological and chemical threat consultant. French investigation procedures and technical resources are discussed. International tensions and the current terrorist situation have prompted the security services to include all kinds of attack hypotheses in their prevention or response plans. The information services (Directorate for National Surveillance or General Information) are responsible at the Ministry of the Interior for collecting information which may be subject to judicial use by such specialized services as the

  8. 78 FR 64246 - Commerce in Explosives; List of Explosives Materials

    Science.gov (United States)

    2013-10-28

    ... supersedes the List of Explosives Materials dated September 20, 2012 (Docket No. ATF 47N, 77 FR 58410.... Tetrazene [tetracene, tetrazine, 1(5-tetrazolyl)-4-guanyl tetrazene hydrate]. Tetrazole explosives....

  9. Overexpressed CacyBP/SIP leads to the suppression of growth in renal cell carcinoma

    International Nuclear Information System (INIS)

    Calcyclin-binding protein/Siah-1-interacting protein (CacyBP/SIP), a target protein of S100, has been identified as a component of a novel ubiquitinylation complex leading to β-catenin degradation, which was found to be related to the malignant phenotypes of gastric cancer. However, the roles of CacyBP/SIP in renal cell carcinoma still remain unclear. In the present study, we had analyzed the expression of the CacyBP/SIP protein in human renal cancer cells and clinical tissue samples. The possible roles of CacyBP/SIP in regulating the malignant phenotype of renal cancer cells were also investigated. The results demonstrated that the expression of CacyBP/SIP was markedly down-regulated in renal cell carcinoma tissues and cell lines. Ectopic overexpression of CacyBP/SIP in A498 cells inhibited the proliferation of this cell and delayed cell cycle progression significantly, which might be related to the down-regulation of Cyclin D1 through reducing β-catenin protein. CacyBP/SIP also suppressed colony formation in soft agar and its tumorigenicity in nude mice. Taken together, our work showed that CacyBP/SIP, as a novel down-regulated gene in renal cell carcinoma, suppressed proliferation and tumorigenesis of renal cancer cells

  10. Portable raman explosives detection

    Energy Technology Data Exchange (ETDEWEB)

    Moore, David Steven [Los Alamos National Laboratory; Scharff, Robert J [Los Alamos National Laboratory

    2008-01-01

    Recent advances in portable Raman instruments have dramatically increased their application to emergency response and forensics, as well as homeland defense. This paper reviews the relevant attributes and disadvantages of portable Raman spectroscopy, both essentially and instrumentally, to the task of explosives detection in the field.

  11. Propagation in thermal explosions

    International Nuclear Information System (INIS)

    In a number a small scale experiments the propagation phenomena in thermal explosions caused by contact of a molten metal with water were studied. To investigate the rapid vapor-blanket collapse a small amount of molten tin (800 deg C) was poured on to a crucible under water at decreased pressure. After pressurization to 1 bar the pressure rise in the vessel was measured and the occurring events were observed by cinephotography (8000ps-1). The experiment showed that explosion propagation by blanket collapse is energetically possible. Similar experiments were performed with a larger interacting surface in a through shaped and in a think tank shaped arrangement, which demonstrated that propagation actually occured; the propagation velocity could be estimated to about 5-103cm s-1. The findings favour the interpretation that the explosion is driven by fragmentation rather than by super heat. Fragmentation or mixing can occur through self-driven collapse and possibly by penetration of coolant jets formed by the collapse in the blanket. In a continuously propagation explosion, Taylor and Kelvin-Helmholtz instabilities may take part in the mixing process

  12. Electromagnetic pulse from nuclear explosions

    International Nuclear Information System (INIS)

    The effect of the electromagnetic pulse (EMP) accompanying a nuclear explosion on electronic equipment is presented largely in the form of examples of damage to equipment during nuclear test explosions. The range of such effects is related to the height above the ground at which the explosion takes place. Electric fields and currents generated by EMP in a number of tests, as measured or estimated at various distances are cited. Underground explosions only give EMP over short distances, less than 30 km, while the EMP from conventional explosions is weak and has no significance for electronic equipment. (JIW)

  13. Electronic states of BP, BP +, BP -, B 2P 2, B2P2- and B2P2+

    Science.gov (United States)

    Linguerri, Roberto; Komiha, Najia; Oswald, Rainer; Mitrushchenkov, Alexander; Rosmus, Pavel

    2008-05-01

    Using augmented sextuple zeta basis sets and internally contracted multireference configuration interaction (MRCI) wavefunctions, potential energy, electric dipole and transition moments have been computed for the X 3Π, a 1Σ +, b 1Π and A 3Σ - states of BP, X 2Σ + and A 2Π states of BP - and X 4Σ - and A 4Π states of BP +. From these data spectroscopic constants, radiative transition probabilities and photoelectron spectra of BP - and BP have been evaluated. The non-vanishing spin-orbit coupling elements between the four low lying triplet and singlet states of the neutral BP have also been calculated from MRCI wavefunctions. The treatment of the corresponding perturbations in the manifold of dense rovibrational states in the three lowest states would require a precise knowledge of the electronic excitation energies. Our best singlet-triplet separations (X-a) are calculated to be 2412 cm -1 (MRCI) and 2482 cm -1 (restricted coupled cluster with perturbative triples (RCCSD(T))) with an estimated error bound of about ±200 cm -1. All three states have long radiative lifetimes with cascading among the rovibrational levels of different states. The ionization energy IE e of BP is calculated to be 9.22 eV (MRCI) and 9.48 eV (RCCSD(T)), the electron affinity EA e 2.51 eV (MRCI) and 2.74 eV (RCCSD(T)). The photoelectron spectra of BP and BP - have been obtained from the Franck-Condon factors of the MRCI potentials. For the UV spectroscopy the dipole allowed radiative transition probabilities are given for A 3Σ - ↔ X 3Π, b 1Π ↔ a 1Σ + of BP, A 2Π ↔ X 2Σ + of BP - and A 4Π ↔ X 4Σ - of BP +. The ionization energy IE e of B 2P 2 of 8.71 eV and the electron affinity EA e of 2.34 eV have been calculated by the RCCSD(T)/aVQZ approach. Also the harmonic vibrational wavenumbers for the electronic ground states of the ions B2P2+ and B2P2- are given.

  14. Explosive bulk charge

    Science.gov (United States)

    Miller, Jacob Lee

    2015-04-21

    An explosive bulk charge, including: a first contact surface configured to be selectively disposed substantially adjacent to a structure or material; a second end surface configured to selectively receive a detonator; and a curvilinear side surface joining the first contact surface and the second end surface. The first contact surface, the second end surface, and the curvilinear side surface form a bi-truncated hemispherical structure. The first contact surface, the second end surface, and the curvilinear side surface are formed from an explosive material. Optionally, the first contact surface and the second end surface each have a substantially circular shape. Optionally, the first contact surface and the second end surface consist of planar structures that are aligned substantially parallel or slightly tilted with respect to one another. The curvilinear side surface has one of a smooth curved geometry, an elliptical geometry, and a parabolic geometry.

  15. Phytoremediation of explosives

    Czech Academy of Sciences Publication Activity Database

    Vaněk, Tomáš; Podlipná, Radka; Hebner, A.; Vavříková, Zuzana; Gerth, A.; Thomas, H.; Smrček, S.

    Krakow : -, 2005, s. 55. [Advanced Research Workshop. Viable methods of soil and water pollution monitoring, protection and remediation: development and use. Krakow (PL), 26.06.2005-01.07.2005] R&D Projects: GA MŠk(CZ) 1P05OC042; GA MŠk(CZ) ME 493 Institutional research plan: CEZ:AV0Z40550506 Keywords : explosives * TNT * phytoremediation Subject RIV: DK - Soil Contamination ; De-contamination incl. Pesticides

  16. High explosive compound

    Science.gov (United States)

    Crawford, Theodore C.

    1976-01-01

    1. A low detonation velocity explosive consisting essentially of a particulate mixture of ortho-boric acid and trinitrotoluene, said mixture containing from about 25 percent to about 65 percent by weight of ortho-boric acid, said ortho-boric acid comprised of from 60 percent to 90 percent of spherical particles having a mean particle size of about 275 microns and 10 percent to 40 percent of spherical particles having a particle size less than about 44 microns.

  17. Explosions in November

    OpenAIRE

    Steinitz, Richard

    2011-01-01

    Explosions in November tells the story of one of Europe’s leading cultural institutions, Huddersfield Contemporary Music Festival (hcmf), through the eyes of its founder and former artistic director, Professor Richard Steinitz. From its modest beginnings in 1978, when winter fog nearly sabotaged the inaugural programme, to today’s internationally renowned event, hcmf has been a pioneering champion of the best in contemporary music. Commissioning new work, reappraising existing legacies an...

  18. Phytoremediation of explosives

    Czech Academy of Sciences Publication Activity Database

    Vaněk, Tomáš; Nepovím, Aleš; Hebner, A.; Soudek, Petr; Gerth, A.; Thomas, H.; Smrček, S.

    Pisa: CNR Research Campus, 2005, s. 137. [Phytotechnologies to promote sustainable land use and improve food safety . Scientific Workshop and Management Committee Meeting /1./. Pisa (IT), 14.06.2005-16.06.2005] R&D Projects: GA MŠk(CZ) 1P05OC042; GA MŠk(CZ) ME 493 Institutional research plan: CEZ:AV0Z40550506 Keywords : phytoremediation * explosives Subject RIV: DK - Soil Contamination ; De-contamination incl. Pesticides

  19. Hydrological evolution in the Holocene (7,400 years BP) of Lake Sonachi (Kenya); L`evolution hydrologique du lac Sonachi (Kenya) a l`Holocene (7400-0 and BP)

    Energy Technology Data Exchange (ETDEWEB)

    Damnati, B.; Taieb, M. [Centre National de la Recherche Scientique, 13 -Aix-en-Provence (France)

    1996-08-01

    A sedimentary core (15.50 m long) was taken with a piston corer from a barge in the centre of the crater Lake Sonachi analysed for sedimentology (magnetic susceptibility) and geochemistry (organic matter and calcium carbonate) and radiocarbon dated. Two lacustrine phases are recognized between 7,400 and 3,200 a BP and between < 2,000 a BP and the present. The first phase of high lake-level is also recorded in the neighbouring lakes Naivasha, Nakuru and Elmenteita, and in several other East African lakes. This Holocene period is also marked by some volcanic explosions. (Authors). 20 refs., 5 figs.

  20. Explosives signatures and analysis

    Science.gov (United States)

    Fountain, Augustus Way, III; Oyler, Jonathan M.; Ostazeski, Stanley A.

    2008-04-01

    The challenge of sampling explosive materials for various high threat military and civilian operational scenarios requires the community to identify and exploit other chemical compounds within the mixtures that may be available to support stand-off detection techniques. While limited surface and vapor phase characterization of IEDs exist, they are insufficient to guide the future development and evaluation of field deployable explosives detection (proximity and standoff) capabilities. ECBC has conducted a limited investigation of three artillery ammunition types to determine what chemical vapors, if any, are available for sensing; the relative composition of the vapors which includes the more volatile compounds in munitions, i.e., plastersizers and binders; and the sensitivity needed detect these vapors at stand-off. Also in partnership with MIT-Lincoln Laboratory, we performed a background measurement campaign at the National Training Center to determine the baseline ambient amounts and variability of nitrates and nitro-ester compounds as vapors, particulates, and on surfaces; as well as other chemical compounds related to non-energetic explosive additives. Environmental persistence studies in contexts relevant to counter-IED sensing operations, such as surface residues, are still necessary.

  1. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication.

    Science.gov (United States)

    Kanginakudru, Sriramana; DeSmet, Marsha; Thomas, Yanique; Morgan, Iain M; Androphy, Elliot J

    2015-04-01

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. PMID:25666521

  2. CENP-C facilitates the recruitment of M18BP1 to centromeric chromatin.

    Science.gov (United States)

    Dambacher, Silvia; Deng, Wen; Hahn, Matthias; Sadic, Dennis; Fröhlich, Jonathan; Nuber, Alexander; Hoischen, Christian; Diekmann, Stephan; Leonhardt, Heinrich; Schotta, Gunnar

    2012-01-01

    Centromeres are important structural constituents of chromosomes that ensure proper chromosome segregation during mitosis by providing defined sites for kinetochore attachment. In higher eukaryotes, centromeres have no specific DNA sequence and thus, they are rather determined through epigenetic mechanisms. A fundamental process in centromere establishment is the incorporation of the histone variant CENP-A into centromeric chromatin, which provides a binding platform for the other centromeric proteins. The Mis18 complex, and, in particular, its member M18BP1 was shown to be essential for both incorporation and maintenance of CENP-A. Here we show that M18BP1 displays a cell cycle-regulated association with centromeric chromatin in mouse embryonic stem cells. M18BP1 is highly enriched at centromeric regions from late anaphase through to G1 phase. An interaction screen against 16 core centromeric proteins revealed a novel interaction of M18BP1 with CENP-C. We mapped the interaction domain in M18BP1 to a central region containing a conserved SANT domain and in CENP-C to the C-terminus. Knock-down of CENP-C leads to reduced M18BP1 association and lower CENP-A levels at centromeres, suggesting that CENP-C works as an important factor for centromeric M18BP1 recruitment and thus for maintaining centromeric CENP-A. PMID:22540025

  3. Characteristic Research on Evaporated Explosive Film

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    The evaporation source of evaporated explosive was designed and improved based on the inherent specialties of explosive. The compatibility of explosives and addition agent with evaporation vessels was analyzed. The influence of substrate temperature on explosive was analyzed, the control method of substrate temperature was suggested. The influences of evaporation rate on formation of explosive film and mixed explosive film were confirmed. Optimum evaporation rate for evaporation explosive and the better method for evaporating mixed explosive were presented. The necessary characteristics of the evaporated explosive film were obtained by the research of the differences between the evaporated explosive and other materials.

  4. DNA damage foci in mitosis are devoid of 53BP1.

    Science.gov (United States)

    Nelson, Glyn; Buhmann, Matthias; von Zglinicki, Thomas

    2009-10-15

    Nuclear DNA damage foci indicate ongoing DNA damage response, which is the major inducer of cell cycle arrest, cellular senescence and apoptosis. 53BP1 is one central mediator of the DNA damage response and a component of active DNA damage foci. Using an AcGFP-53BP1c fluorescent fusion protein that quantitatively reports DNA damage, we show that the recruitment of 53BP1 into gammaH2A.X-containing DNA damage foci was inhibited at G(2)/M. This suggests a possible mechanism for cells to continue through the G(2) checkpoint with gammaH2A.X-flagged double strand breaks via inhibition of 53BP1-mediated DNA damage signalling. PMID:19806024

  5. An iterative method for the canard explosion in general planar systems

    DEFF Research Database (Denmark)

    Brøns, Morten

    The canard explosion is the change of amplitude and period of a limit cycle born in a Hopf bifurcation in a very narrow parameter interval. The phenomenon is well understood in singular perturbation problems where a small parameter controls the slow/fast dynamics. However, canard explosions are...

  6. An iterative method for the canard explosion in general planar systems

    DEFF Research Database (Denmark)

    Brøns, Morten

    2012-01-01

    The canard explosion is the change of amplitude and period of a limit cycle born in a Hopf bifurcation in a very narrow parameter interval. The phenomenon is well understood in singular perturbation problems where a small parameter controls the slow/fast dynamics. However, canard explosions are...

  7. Welding of pyroclastic conduit infill: A mechanism for cyclical explosive eruptions

    Science.gov (United States)

    Kolzenburg, S.; Russell, J. K.

    2014-07-01

    Vulcanian-style eruptions are small- to moderate-sized, singular to cyclical events commonly having volcanic explosivity indices of 1-3. They produce pyroclastic flows, disperse tephra over considerable areas, and can occur as precursors to larger (e.g., Plinian) eruptions. The fallout deposits of the 2360 B.P. eruption of Mount Meager, BC, Canada, contain bread-crusted blocks of welded breccia as accessory lithics. They display a range of compaction/welding intensity and provide a remarkable opportunity to constrain the nature and timescales of mechanical processes operating within explosive volcanic conduits during repose periods between eruptive cycles. We address the deformation and porosity/permeability reduction within natural pyroclastic deposits infilling volcanic conduits. We measure the porosity, permeability, and ultrasonic wave velocities for a suite of samples and quantify the strain recorded by pumice clasts. We explore the correlations between the physical properties and deformation fabric. Based on these correlations, we reconstruct the deformation history within the conduit, model the permeability reduction timescales, and outline the implications for the repressurization of the volcanic conduit. Our results highlight a profound directionality in the measured physical properties of these samples related to the deformation-induced fabric. Gas permeability varies drastically with increasing strain and decreasing porosity along the compaction direction of the fabric but varies little along the elongation direction of the fabric. The deformation fabric records a combination of compaction within the conduit and postcompaction stretching associated with subsequent eruption. Model timescales of these processes are in good agreement with repose periods of cyclic vulcanian eruptions.

  8. BP Spill Sampling and Monitoring Data

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset analyzes waste from the the British Petroleum Deepwater Horizon Rig Explosion Emergency Response, providing opportunity to query data sets by metadata...

  9. Explosive and pyrotechnic aging demonstration

    Science.gov (United States)

    Rouch, L. L., Jr.; Maycock, J. N.

    1976-01-01

    The survivability was experimentally verified of fine selected explosive and pyrotechnic propellant materials when subjected to sterilization, and prolonged exposure to space environments. This verification included thermal characterization, sterilization heat cycling, sublimation measurements, isothermal decomposition measurements, and accelerated aging at a preselected elevated temperature. Temperatures chosen for sublimation and isothermal decomposition measurements were those in which the decomposition processess occurring would be the same as those taking place in real-time aging. The elevated temperature selected (84 C) for accelerated aging was based upon the parameters calculated from the kinetic data obtained in the isothermal measurement tests and was such that one month of accelerated aging in the laboratory approximated one year of real-time aging at 66 C. Results indicate that HNS-IIA, pure PbN6, KDNBF, and Zr/KC10 are capable of withstanding sterilization. The accelerated aging tests indicated that unsterilized HNS-IIA and Zr/KC104 can withstand the 10 year, elevated temperature exposure, pure PbN6 and KDNBF exhibit small weight losses (less than 2 percent) and B/KC104 exhibits significant changes in its thermal characteristics. Accelerated aging tests after sterilization indicated that only HNS-IIA exhibited high stability.

  10. Gas explosions in process pipes

    OpenAIRE

    Kristoffersen, Kjetil

    2004-01-01

    In this thesis, gas explosions inside pipes are considered. Laboratory experiments and numerical simulations are the basis of the thesis. The target of the work was to study gas explosions in pipes and to develop numer- ical models that could predict accidental gas explosions inside pipes. Experiments were performed in circular steel and plexiglass pipes. The steel pipes have an inner diameter of 22.3 mm and lengths of 1, 2, 5 and 11 m. The plexiglass pipe has an inner diame...

  11. The thermodynamics of thermal explosions

    International Nuclear Information System (INIS)

    Thermal explosions can occur when a hot liquid mixes with a cooler, volatile liquid. Measured explosion efficiencies do not exceed two or three percent, but simple thermodynamic analysis predicts twenty or thirty percent. The difference is crucial in some nuclear reactor safety problems. The mechanisms thought to operate in thermal explosions are considered, and an alternative thermodynamic approach proposed, which takes account of certain irreversibilities in the process, and predicts much lower efficiencies. (author)

  12. PROBABILISTIC MODELING OF EXPLOSIVE LOADING

    OpenAIRE

    Mkrtychev Oleg Vartanovich; Dorozhinskiy Vladimir Bogdanovich

    2012-01-01

    According to existing design standards, explosive loading represents a special type of loading. Explosive loading is, in most cases, local in nature, although it can exceed the loads for which buildings are designed by a dozen of times. The analysis of terrorist attacks with explosives employed demonstrates that charges have a great power and, consequently, a substantial shock wave pressure. Blast effects are predictable with a certain probability. Therefore, we cannot discuss ...

  13. Neoproterozoic Land Colonisation, Rising Oxygen, Global Cooling and the Cambrian Explosion

    Science.gov (United States)

    Lenton, T. M.; Watson, A. J.

    2004-12-01

    The Neoproterozoic (1000-542 Ma BP) was a time of severe glaciations and a major transition from microscopic to macroscopic life forms. We develop the hypothesis that a rise in atmospheric oxygen in the Neoproterozoic was driven by the biological colonization of the land surface. If early forms of photosynthetic land life selectively weathered continental rock in order to extract nutrients, this would have led to an increase in the flux of biologically available phosphorus to the ocean. We show that recent models for coupled biogeochemical cycles, despite differences in the feedback mechanisms represented, predict this would lead to a rise in atmospheric oxygen concentration, consistent with biological and geochemical evidence. Increased weathering of silicate rocks would also have caused a decline in atmospheric carbon dioxide, which could have been a causal factor in the Neoproterozoic glaciations. A rise in oxygen may have provided a necessary condition for the evolution of animals with hard skeletons seen in the Cambrian explosion. Furthermore, an increase in phosphorus supply to the ocean may have driven an increase in the phosphorus content of marine primary producers. This would have represented an increase in food quality for grazing animals, which have a high phosphorus requirement, and may thus have removed a further limitation on their evolutionary radiation.

  14. Wire explosion in water

    Czech Academy of Sciences Publication Activity Database

    Prukner, Václav; Koláček, Karel; Schmidt, Jiří; Frolov, Oleksandr; Štraus, Jaroslav

    Praha, 2007 - (Schmidt, J.; Simek, M.; Pekarek, S.; Prukner, V.). s. 145-145 ISBN 978-80-87026-00-7. [XXVIII International conference on phenomena in ionized gases ICPIG’07/28th./. 15.7.2007-20.7.2007, Prague] R&D Projects: GA ČR GA202/06/1324; GA AV ČR KJB100430702; GA MŠk 1P04LA235 Institutional research plan: CEZ:AV0Z20430508 Keywords : Wire explosion * x-ray * laser * plasma Subject RIV: BL - Plasma and Gas Discharge Physics

  15. Wire explosion in water

    Czech Academy of Sciences Publication Activity Database

    Prukner, Václav; Koláček, Karel; Schmidt, Jiří; Frolov, Oleksandr; Štraus, Jaroslav

    Prague: Institute of Plasma Physics AS CR,v.v.i, 2008 - (Schmidt, J.; Šimek, M.; Pekárek, S.; Prukner, V.), s. 1279-1281. (ICPIG. 28). ISBN 978-80-87026-01-4. [XXVIII International conference on phenomena in ionized gases ICPIG’07. Prague (CZ), 15.07.2007-20.07.2007] R&D Projects: GA ČR GA202/06/1324; GA AV ČR KJB100430702; GA MŠk 1P04LA235 Institutional research plan: CEZ:AV0Z20430508 Keywords : Wire explosion * x-ray * laser * plasma Subject RIV: BL - Plasma and Gas Discharge Physics

  16. Spectral Anlysis on Explosive Percolation

    CERN Document Server

    Chung, Ning Ning; Lai, Choy Heng

    2013-01-01

    We study the spectral properties of the process of explosive percolation. In particular, we explore how the maximum eigenvalue of the adjacency matrix of a network which governs the spreading efficiency evolves as the density of connection increases. Interestingly, for networks with connectivity that grow in an explosive way, information spreading and mass transport are found to be carried out inefficiently. In the conventional explosive percolation models that we studied, the sudden emergences of large-scale connectivity are found to come with relatively lowered efficiency of spreading. Nevertheless, the spreading efficiency of the explosive model can be increased by introducing heterogeneous structures into the networks.

  17. Computed tomography experiments of Pantex high explosives

    Science.gov (United States)

    Perkins, D. E.; Martz, H. E.; Hester, L. O.; Sobczak, G.; Pratt, C. L.

    1992-04-01

    X-ray computed tomography is an advanced imaging technique which provide three-dimensional nondestructive characterization of materials, components and assemblies. The CT Project group at Lawrence Livermore National Laboratory (LLNL) and the Pantex Plant are cooperating to examine the use of CT technology to inspect and characterize high-explosives pressings (e.g., PBX-9502, LX-10-2). High-explosives pressings manufactured by Pantex must be characterized prior to assembling into weapons systems; a nondestructive examination of all assembly parts would be preferable to the current sampling and destructive testing. The earlier in the processing cycle this can be done the more cost effective it will be. We have performed experiments that show that this characterization can be performed at the pressed billet stage using CT. We have detected 2-mm inclusions in a 15-cm diameter billet and 3.5-mm voids in a 20-cm diameter billet. Based on these results we show calculations that can be used to design production CT systems for characterization of high-explosives.

  18. Equipment Design for Oxidation of 1BP/2BP Using NO_x

    Institute of Scientific and Technical Information of China (English)

    ZHOU; Xian-ming; CHANG; Shang-wen; LI; Gao-liang; LAN; Tian; LIU; Jin-ping; TANG; Hong-bin; HE; Hui

    2013-01-01

    NOx can Oxidize the reductants in 1BP and 2BP feed of Purex process,and can adjust the oxidation state of plutonium as Pu(Ⅳ)to meet the need of 2AF feed.Using NOx in Purex process can reduce the volumn of solid waste effectively,and attract more and more interest of researchers.In this work the oxidation of reductants in 1BP/2BP feed were investigated in glass column as the same-current mode,in

  19. Controlled by Distant Explosions

    Science.gov (United States)

    2007-03-01

    VLT Automatically Takes Detailed Spectra of Gamma-Ray Burst Afterglows Only Minutes After Discovery A time-series of high-resolution spectra in the optical and ultraviolet has twice been obtained just a few minutes after the detection of a gamma-ray bust explosion in a distant galaxy. The international team of astronomers responsible for these observations derived new conclusive evidence about the nature of the surroundings of these powerful explosions linked to the death of massive stars. At 11:08 pm on 17 April 2006, an alarm rang in the Control Room of ESO's Very Large Telescope on Paranal, Chile. Fortunately, it did not announce any catastrophe on the mountain, nor with one of the world's largest telescopes. Instead, it signalled the doom of a massive star, 9.3 billion light-years away, whose final scream of agony - a powerful burst of gamma rays - had been recorded by the Swift satellite only two minutes earlier. The alarm was triggered by the activation of the VLT Rapid Response Mode, a novel system that allows for robotic observations without any human intervention, except for the alignment of the spectrograph slit. ESO PR Photo 17a/07 ESO PR Photo 17a/07 Triggered by an Explosion Starting less than 10 minutes after the Swift detection, a series of spectra of increasing integration times (3, 5, 10, 20, 40 and 80 minutes) were taken with the Ultraviolet and Visual Echelle Spectrograph (UVES), mounted on Kueyen, the second Unit Telescope of the VLT. "With the Rapid Response Mode, the VLT is directly controlled by a distant explosion," said ESO astronomer Paul Vreeswijk, who requested the observations and is lead-author of the paper reporting the results. "All I really had to do, once I was informed of the gamma-ray burst detection, was to phone the staff astronomers at the Paranal Observatory, Stefano Bagnulo and Stan Stefl, to check that everything was fine." The first spectrum of this time series was the quickest ever taken of a gamma-ray burst afterglow

  20. Explosion proof device

    International Nuclear Information System (INIS)

    A chamber for carrying in/out equipments of a nuclear facility building has a shutter capable of stopping at a predetermined position and an air curtain disposed at an opening formed upon stopping of the shutter. An openable/closable partition comprises a glass door as a rupture disk. The shutter is closed as a partition for the first and the second chambers for carrying in/out equipments to divide a radiation area. The shutter is stopped near the upper end of the air curtain by a limit switch, and the air curtain is driven at the opening portion from the lower end of the shutter to the floor of the building. Since operators can freely pass the opening from the lower end of the shutter to the floor of the building, and the opening area is ensured, even if missiles are rushed from the outside breaking through the shutter to ignite loaded burnable materials, acceleration of flames is moderated to prevent explosion. Since the glass door is made of the rupture disk and broken, even if burnable materials loaded on the missiles from the outside are burnt, no explosion is caused. (N.H.)

  1. Tenderizing Meat with Explosives

    Science.gov (United States)

    Gustavson, Paul K.; Lee, Richard J.; Chambers, George P.; Solomon, Morse B.; Berry, Brad W.

    2001-06-01

    Investigators at the Food Technology and Safety Laboratory have had success tenderizing meat by explosively shock loading samples submerged in water. This technique, referred to as the Hydrodynamic Pressure (HDP) Process, is being developed to improve the efficiency and reproducibility of the beef tenderization processing over conventional aging techniques. Once optimized, the process should overcome variability in tenderization currently plaguing the beef industry. Additional benefits include marketing lower quality grades of meat, which have not been commercially viable due to a low propensity to tenderization. The simplest and most successful arrangement of these tests has meat samples (50 to 75 mm thick) placed on a steel plate at the bottom of a plastic water vessel. Reported here are tests which were instrumented by Indian Head investigators. Carbon-composite resistor-gauges were used to quantify the shock profile delivered to the surface of the meat. PVDF and resistor gauges (used later in lieu of PVDF) provided data on the pressure-time history at the meat/steel interface. Resulting changes in tenderization were correlated with increasing shock duration, which were provided by various explosives.

  2. Peaceful nuclear explosions

    International Nuclear Information System (INIS)

    Article V of the Treaty on the Non-Proliferation of Nuclear Weapons (NPT) specifies that the potential benefits of peaceful applications of nuclear explosions be made available to non-nuclear weapon states party to the Treaty 'under appropriate international observation and through appropriate international procedures'. The International Atomic Energy Agency's responsibility and technical competence in this respect have been recognized by its Board of Governors, the Agency's General Conference and the United Nations' General Assembly. Since 1968 when the United Nations Conference of Non-Nuclear Weapon States also recommended that the Agency initiate the necessary studies in the peaceful nuclear explosions (PNE) field, the Agency has taken the following steps: 1. The exchange of scientific and technical information has been facilitated by circulating information on the status of the technology and through the Agency's International Nuclear Information System. A bibliography of PNE-related literature was published in 1970. 2. In 1972, guidelines for 'the international observation of PNE under the provisions of NPT and analogous provisions in other international agreements' were developed and approved by the Board of Governors. These guidelines defined the basic purpose of international observation as being to verify that in the course of conducting a PNE project the intent and letter of Articles I and II of the NPT are not violated. 3. In 1974, an advisory group developed 'Procedures for the Agency to Use in Responding to Requests for PNE-Related Services'. These procedures have also been approved by the Board of Governors. 4. The Agency has convened a series of technical meetings which reviewed the 'state-of-the- art'. These meetings were convened in 1970, 1971, 1972 and in January 1975. The Fourth Technical Committee was held in Vienna from 20-24 January 1975 under the chairmanship of Dr. Allen Wilson of Australia with Experts from: Australia, France, Federal

  3. A universal, broad-environment energy conversion signature of explosive cyclones

    Science.gov (United States)

    Black, Mitchell Timothy; Pezza, Alexandre Bernardes

    2013-01-01

    This study presents the first analysis of the Lorenz energetics associated with a global climatology of explosive cyclones. Energy budgets of the large-scale environment are calculated for 32 year climatologies (1980-2011) of explosive cyclones within four of the most active regions in the world: the Northwest Pacific, the North Atlantic, the Southwest Pacific, and the South Atlantic. A robust signature in the Lorenz energy cycle is observed; anomalous energy conversions commence 48 h before explosive cyclone development and remain strong (i.e., significantly above background noise) for 120 h. Remarkably, the calculated signature of energy conversion is virtually identical for all four geographical regions. While the conversions imply a classic baroclinic growth cycle, they are not seen in regular cyclones that undergo a deepening of less than half that exhibited by explosive cyclones. This finding opens a new avenue of exploration of explosive storm behavior based on the large-scale environment.

  4. Theory of bubble dynamics in condensed explosive during start-up transient

    Science.gov (United States)

    Benreuven, M.; Summerfield, M.

    1980-01-01

    Test firings with experimental liquid propellant gun systems indicate that the main concern standing in the way of practical application of LPG's is the possibility of unexpected explosions during start up when pressure is rapidly applied to the liquid monopropellant in the chamber. The phenomenon of many collapse-rebound cycles of imploding bubbles is theorized as the probable cause of explosions in LP systems. It may be concluded that LPG safety would be enhanced by choosing an LP with low bulk modulus, as well as low decomposition reaction rate, and that a benign looking DTA trace is not a sufficient quarantee of insensitivity to a pressure induced explosion. It is also shown that pre-pressurizing an LP charge, thus pre-compressing the bubbles near-isothermally, makes the system relatively insensitive to such pressure induced explosions. The applicability of this analysis to the question of acceleration induced explosion of explosive filled warheads is indicated.

  5. Role of 53BP1 in the regulation of DNA double-strand break repair pathway choice.

    Science.gov (United States)

    Gupta, Arun; Hunt, Clayton R; Chakraborty, Sharmistha; Pandita, Raj K; Yordy, John; Ramnarain, Deepti B; Horikoshi, Nobuo; Pandita, Tej K

    2014-01-01

    The p53-binding protein 1 (53BP1) is a well-known DNA damage response (DDR) factor, which is recruited to nuclear structures at the site of DNA damage and forms readily visualized ionizing radiation (IR) induced foci. Depletion of 53BP1 results in cell cycle arrest in G2/M phase as well as genomic instability in human as well as mouse cells. Within the DNA damage response mechanism, 53BP1 is classified as an adaptor/mediator, required for processing of the DNA damage response signal and as a platform for recruitment of other repair factors. More recently, specific 53BP1 contributions to DSB repair pathway choice have been recognized and are being characterized. In this review, we have summarized recent advances in understanding the role of 53BP1 in regulating DNA DSBs repair pathway choice, variable diversity joining [V(D)J] recombination and class-switch recombination (CSR). PMID:24320053

  6. Vegetation and Environment History for the Past 14000 yr BP from Dingnan, Jiangxi Province, South China

    Institute of Scientific and Technical Information of China (English)

    John Richard Dodson; Shirene Hickson; Rachel Khoo; Xiao-Qiang Li; Jemina Toia; Wei-Jian Zhou

    2006-01-01

    A Late Pleistocene-Holocene pollen, phosphorus, and charcoal record was reconstructed from apeatland in southern Jiangxi Province in southern China. The area today has a mountainous and rolling landscape with villages, small towns, and agriculture dominated by rice paddies, vegetable, and fruit gardens, as well as areas of secondary forest and pine re-afforestation. The record opens before 14 300 yr BP, with Alnus woodland dominating the wetland areas and with an open Quercus woodland on the surrounding slopes.The forest area becomes more complex from approximately 12 800 yr BP and further from 9 000 yr BP. At approximately 6 000 yr BP, there is evidence of clearing and, by 4 500-4 000 yr BP, a complete collapse in the wetland Alnus and terrestrial forest as the low-lying areas are converted to rice production. For much of the record, the occurrence of fire around the site was low, although there is evidence of regional fires. Fire was used as a tool in clearing and then used in the annual cycles of stubble burning after rice harvest. Nutrient levels, as reflected by total phosphorus in the sediment, seem to be closely related to forest changes and high values in the surface layers probably result from land-management techniques associated with agriculture. Therefore, human impact greatly altered forest cover, fire frequency, and nutrient dynamics; this has been evident for approximately 6 000 yr BP and then intensifies towards the present day.

  7. Kaliski's explosive driven fusion experiments

    International Nuclear Information System (INIS)

    An experiment performed by a group in Poland on the production of DD fusion neutrons by purely explosive means is discussed. A method for multiplying shock velocities ordinarily available from high explosives by a factor of ten is described, and its application to DD fusion experiments is discussed

  8. Lidar Detection of Explosives Traces

    OpenAIRE

    Bobrovnikov Sergei M.; Gorlov Evgeny V.; Zharkov Victor I.; Panchenko Yury N.

    2016-01-01

    The possibility of remote detection of traces of explosives using laser fragmentation/laser-induced fluorescence (LF/LIF) is studied. Experimental data on the remote visualization of traces of trinitrotoluene (TNT), hexogen (RDX), trotyl-hexogen (Comp B), octogen (HMX), and tetryl with a scanning lidar detector of traces of nitrogen-containing explosives at a distance of 5 m are presented.

  9. Nucleosynthesis in stellar explosions

    Energy Technology Data Exchange (ETDEWEB)

    Woosley, S.E.; Axelrod, T.S.; Weaver, T.A.

    1983-01-01

    The final evolution and explosion of stars from 10 M/sub solar/ to 10/sup 6/ M/sub solar/ are reviewed with emphasis on factors affecting the expected nucleosynthesis. We order our paper in a sequence of decreasing mass. If, as many suspect, the stellar birth function was peaked towards larger masses at earlier times (see e.g., Silk 1977; but also see Palla, Salpeter, and Stahler 1983), this sequence of masses might also be regarded as a temporal sequence. At each stage of Galactic chemical evolution stars form from the ashes of preceding generations which typically had greater mass. A wide variety of Type I supernova models, most based upon accreting white dwarf stars, are also explored using the expected light curves, spectra, and nucleosynthesis as diagnostics. No clearly favored Type I model emerges that is capable of simultaneously satisfying all three constraints.

  10. Mixing in explosions

    Energy Technology Data Exchange (ETDEWEB)

    Kuhl, A.L.

    1993-12-01

    Explosions always contain embedded turbulent mixing regions, for example: boundary layers, shear layers, wall jets, and unstable interfaces. Described here is one particular example of the latter, namely, the turbulent mixing occurring in the fireball of an HE-driven blast wave. The evolution of the turbulent mixing was studied via two-dimensional numerical simulations of the convective mixing processes on an adaptive mesh. Vorticity was generated on the fireball interface by baroclinic effects. The interface was unstable, and rapidly evolved into a turbulent mixing layer. Four phases of mixing were observed: (1) a strong blast wave phase; (2) and implosion phase; (3) a reshocking phase; and (4) an asymptotic mixing phase. The flowfield was azimuthally averaged to evaluate the mean and r.m.s. fluctuation profiles across the mixing layer. The vorticity decayed due to a cascade process. This caused the corresponding enstrophy parameter to increase linearly with time -- in agreement with homogeneous turbulence calculations of G.K. Batchelor.

  11. Nucleosynthesis in stellar explosions

    International Nuclear Information System (INIS)

    The final evolution and explosion of stars from 10 M/sub solar/ to 106 M/sub solar/ are reviewed with emphasis on factors affecting the expected nucleosynthesis. We order our paper in a sequence of decreasing mass. If, as many suspect, the stellar birth function was peaked towards larger masses at earlier times (see e.g., Silk 1977; but also see Palla, Salpeter, and Stahler 1983), this sequence of masses might also be regarded as a temporal sequence. At each stage of Galactic chemical evolution stars form from the ashes of preceding generations which typically had greater mass. A wide variety of Type I supernova models, most based upon accreting white dwarf stars, are also explored using the expected light curves, spectra, and nucleosynthesis as diagnostics. No clearly favored Type I model emerges that is capable of simultaneously satisfying all three constraints

  12. Direct imaging of explosives

    International Nuclear Information System (INIS)

    Any technique that can detect nitrogen concentrations can screen for concealed explosives. However, such a technique would have to be insensitive to metal, both encasing and incidental. If images of the nitrogen concentrations could be captured, then, since form follows function, a robust screening technology could be developed. However these images would have to be sensitive to the surface densities at or below that of the nitrogen contained in buried anti-personnel mines or of the SEMTEX that brought down Pan Am 103, ∼200 g. Although the ability to image in three-dimensions would somewhat reduce false positives, capturing collateral images of carbon and oxygen would virtually assure that nitrogenous non-explosive material like fertilizer, Melmac[reg] dinnerware, and salami could be eliminated. We are developing such an instrument, the Nitrogen Camera, which has met experimentally these criteria with the exception of providing oxygen images, which awaits the availability of a sufficiently energetic light source. Our Nitrogen Camera technique uses an electron accelerator to produce photonuclear reactions whose unique decays it registers. Clearly if our Nitrogen Camera is made mobile, it could be effective in detecting buried mines, either in an active battlefield situation or in the clearing of abandoned military munitions. Combat operations require that a swathe the width of an armored vehicle, 5 miles deep, be screened in an hour, which is within our camera's scanning speed. Detecting abandoned munitions is technically easier as it is free from the onerous speed requirement. We describe here our Nitrogen Camera and show its 180 pixel intensity images of elemental nitrogen in a 200 g mine simulant and in a 125 g stick of SEMTEX. We also report on our progress in creating a lorry transportable 70 MeV electron racetrack microtron, the principal enabling technology that will allow our Nitrogen Camera to be deployed in the field

  13. Optical detection of explosives: spectral signatures for the explosive bouquet

    Science.gov (United States)

    Osborn, Tabetha; Kaimal, Sindhu; Causey, Jason; Burns, William; Reeve, Scott

    2009-05-01

    Research with canines suggests that sniffer dogs alert not on the odor from a pure explosive, but rather on a set of far more volatile species present in an explosive as impurities. Following the explosive trained canine example, we have begun examining the vapor signatures for many of these volatile impurities utilizing high resolution spectroscopic techniques in several molecular fingerprint regions. Here we will describe some of these high resolution measurements and discuss strategies for selecting useful spectral signature regions for individual molecular markers of interest.

  14. AcEST: BP917781 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D04 511 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D04. BP917781 - Show BP9177...is mRNA. clone: YMU001_000105_D04. Accession BP917781 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177... programs, Nucleic Acids Res. 25:3389-3402. Query= BP917781|Adiantum capillus-ven

  15. AcEST: BP921101 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000145_F04 489 Adiantum capillus-veneris mRNA. clone: YMU001_000145_F04. BP921101 - Show BP921101...is mRNA. clone: YMU001_000145_F04. Accession BP921101 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921101|Adiantum cap... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921101

  16. Discriminating between explosions and earthquakes

    Science.gov (United States)

    Cho, Kwang-Hyun

    2014-12-01

    Earthquake, explosion, and a nuclear test data are compared with forward modeling and band-pass filtered surface wave amplitude data for exploring methodologies to improve earthquake-explosion discrimination. The proposed discrimination method is based on the solutions of a double integral transformation in the wavenumber and frequency domains. Recorded explosion data on June 26, 2001 (39.212°N, 125.383°E) and October 30, 2001 (38.748°N, 125.267°E), a nuclear test on October 9, 2006 (41.275°N, 129.095°E), and two earthquakes on April 14, 2002 (39.207°N, 125.686°E) and June 7, 2002 (38.703°N, 125.638°E), all in North Korea, are used to discriminate between explosions and earthquakes by seismic wave analysis and numerical modeling. The explosion signal is characterized by first P waves with higher energy than that of S waves. Rg waves are clearly dominant at 0.05-0.5 Hz in the explosion data but not in the earthquake data. This feature is attributed to the dominant P waves in the explosion and their coupling with the SH components.

  17. Explosive signatures: Pre & post blast

    Science.gov (United States)

    Bernier, Evan Thomas

    Manuscripts 1 and 2 of this dissertation both involve the pre-blast detection of trace explosive material. The first manuscript explores the analysis of human hair as an indicator of exposure to explosives. Field analysis of hair for trace explosives is quick and non-invasive, and could prove to be a powerful linkage to physical evidence in the form of bulk explosive material. Individuals tested were involved in studies which required handling or close proximity to bulk high explosives such as TNT, PETN, and RDX. The second manuscript reports the results of research in the design and application of canine training aids for non-traditional, peroxide-based explosives. Organic peroxides such as triacetonetriperoxide (TATP) and hexamethylenetriperoxidediamine (HMTD) can be synthesized relatively easily with store-bought ingredients and have become popular improvised explosives with many terrorist groups. Due to the hazards of handling such sensitive compounds, this research established methods for preparing training aids which contained safe quantities of TATP and HMTD for use in imprinting canines with their characteristic odor. Manuscripts 3 and 4 of this dissertation focus on research conducted to characterize pipe bombs during and after an explosion (post-blast). Pipe bombs represent a large percentage of domestic devices encountered by law enforcement. The current project has involved the preparation and controlled explosion of over 90 pipe bombs of different configurations in order to obtain data on fragmentation patterns, fragment velocity, blast overpressure, and fragmentation distance. Physical data recorded from the collected fragments, such as mass, size, and thickness, was correlated with the relative power of the initial device. Manuscript 4 explores the microstructural analysis of select pipe bomb fragments. Shock-loading of the pipe steel led to plastic deformation and work hardening in the steel grain structure as evidenced by optical microscopy and

  18. 2000 Johnston Site 1B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  19. 2000 Johnston Site 3B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 3B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 3, 2000. With a start point (meter 0) at...

  20. 2000 Johnston Site 2B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  1. Cambrian explosion triggered by geosphere-biosphere feedbacks

    Science.gov (United States)

    von Bloh, Werner; Bounama, Christine; Franck, Siegfried

    2003-09-01

    A new hypothesis for the cause of the Cambrian explosion is presented. For that the evolution of the planet Earth is described by the co-evolution of the geosphere-biosphere system. Here we specify our previously published Earth system model for the long-term carbon cycle by introducing three different types of biosphere: procaryotes, eucaryotes, and complex multicellular life. They are characterized by different global temperature tolerance windows. The biotic enhancement of silicate weathering by complex multicellular life adds an additional feedback to the system and triggers the Cambrian explosion. The Cambrian explosion is characterized by a sudden increase of biomass and a rapid cooling, which amplified the spread of complex multicellular life. Cooling events in the Neoproterozoic, however, could force a premature appearance of complex multicellular life.

  2. A method for detecting explosives

    International Nuclear Information System (INIS)

    Bombs concealed in luggage have threatened human life and property throughout the world's traffic. The plastic explosives could not be checked by the X-ray detecting device. A method has been tested in the present work for non-destructive detection of explosives. A neutron generator and relevant apparatus have been used as a tool to find explosives, regardless of the bomb's shape and the packing materials. It seems that this method is a promising one because of the strong transmission ability of both the incident and output specific radiations and low background. (author) 4 figs.; 4 tabs

  3. Noise From Shallow Underwater Explosions

    Science.gov (United States)

    Soloway, Alexander G.

    Naval activities such as ordnance disposal, demolition and requisite training, can involve detonation of small explosive charges in shallow water that have the potential to harm nearby marine life. Measurements of the underwater sound generated by sub-surface explosions were collected as part of a naval training exercise. In this thesis the noise levels from these explosions will be investigated using peak pressure, sound exposure level and energy spectral density. Measurements of very-low frequency Scholte interface waves will also be presented and used to investigate elastic parameters in the sediment.

  4. Explosive actuated valves

    Science.gov (United States)

    Cobb, Jr., Lawrence L.

    1983-01-01

    1. A device of the character described comprising the combination of a generally tubular housing having an end portion forming a chamber to receive the sensitive portion of an explosive squib, a plunger within said housing having an end portion exposed to said chamber, squib retaining means for engaging said housing and a said squib to releasably maintain the squib in close proximity to said plunger end portion including a retaining ring of fusible material spaced outwardly from and encircling at least part of a said squib and part of its sensitive portion for reception of heat from an external source prior to appreciable reception thereof by the sensitive portion of the squib, an annular compression spring bearing at one end against said housing for urging at least a portion of the squib retaining means and a said squib away from said housing and from said plunger end portion upon subjection of the fusible material to heat sufficient to melt at least a portion thereof, and guide means for said spring to maintain even expansion thereof as a said squib is being urged away from said housing.

  5. Explosive actuated valve

    Science.gov (United States)

    Byrne, Kenneth G.

    1983-01-01

    1. A device of the character described comprising the combination of a housing having an elongate bore and including a shoulder extending inwardly into said bore, a single elongate movable plunger disposed in said bore including an outwardly extending flange adjacent one end thereof overlying said shoulder, normally open conduit means having an inlet and an outlet perpendicularly piercing said housing intermediate said shoulder and said flange and including an intermediate portion intersecting and normally openly communicating with said bore at said shoulder, normally closed conduit means piercing said housing and intersecting said bore at a location spaced from said normally open conduit means, said elongate plunger including a shearing edge adjacent the other end thereof normally disposed intermediate both of said conduit means and overlying a portion of said normally closed conduit means, a deformable member carried by said plunger intermediate said flange and said shoulder and normally spaced from and overlying the intermediate portion of said normally open conduit means, and means on the housing communicating with the bore to retain an explosive actuator for moving said plunger to force the deformable member against the shoulder and extrude a portion of the deformable member out of said bore into portions of the normally open conduit means for plugging the same and to effect the opening of said normally closed conduit means by the plunger shearing edge substantially concomitantly with the plugging of the normally open conduit means.

  6. Explosive Contagion in Networks

    Science.gov (United States)

    Gómez-Gardeñes, J.; Lotero, L.; Taraskin, S. N.; Pérez-Reche, F. J.

    2016-01-01

    The spread of social phenomena such as behaviors, ideas or products is an ubiquitous but remarkably complex phenomenon. A successful avenue to study the spread of social phenomena relies on epidemic models by establishing analogies between the transmission of social phenomena and infectious diseases. Such models typically assume simple social interactions restricted to pairs of individuals; effects of the context are often neglected. Here we show that local synergistic effects associated with acquaintances of pairs of individuals can have striking consequences on the spread of social phenomena at large scales. The most interesting predictions are found for a scenario in which the contagion ability of a spreader decreases with the number of ignorant individuals surrounding the target ignorant. This mechanism mimics ubiquitous situations in which the willingness of individuals to adopt a new product depends not only on the intrinsic value of the product but also on whether his acquaintances will adopt this product or not. In these situations, we show that the typically smooth (second order) transitions towards large social contagion become explosive (first order). The proposed synergistic mechanisms therefore explain why ideas, rumours or products can suddenly and sometimes unexpectedly catch on.

  7. Furball Explosive Breakout Test

    Energy Technology Data Exchange (ETDEWEB)

    Carroll, Joshua David [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-08-05

    For more than 30 years the Onionskin test has been the primary way to study the surface breakout of a detonation wave. Currently the Onionskin test allows for only a small, one dimensional, slice of the explosive in question to be observed. Asymmetrical features are not observable with the Onionskin test and its one dimensional view. As a result, in 2011, preliminary designs for the Hairball and Furball were developed then tested. The Hairball used shorting pins connected to an oscilloscope to determine the arrival time at 24 discrete points. This limited number of data points, caused by the limited number of oscilloscope channels, ultimately led to the Hairball’s demise. Following this, the Furball was developed to increase the number of data points collected. Instead of shorting pins the Furball uses fiber optics imaged by a streak camera to determine the detonation wave arrival time for each point. The original design was able to capture the detonation wave’s arrival time at 205 discrete points with the ability to increase the number of data points if necessary.

  8. Disaster management following explosion.

    Science.gov (United States)

    Sharma, B R

    2008-01-01

    Explosions and bombings remain the most common deliberate cause of disasters involving large numbers of casualties, especially as instruments of terrorism. These attacks are virtually always directed against the untrained and unsuspecting civilian population. Unlike the military, civilians are poorly equipped or prepared to handle the severe emotional, logistical, and medical burdens of a sudden large casualty load, and thus are completely vulnerable to terrorist aims. To address the problem to the maximum benefit of mass disaster victims, we must develop collective forethought and a broad-based consensus on triage and these decisions must reach beyond the hospital emergency department. It needs to be realized that physicians should never be placed in a position of individually deciding to deny treatment to patients without the guidance of a policy or protocol. Emergency physicians, however, may easily find themselves in a situation in which the demand for resources clearly exceeds supply and for this reason, emergency care providers, personnel, hospital administrators, religious leaders, and medical ethics committees need to engage in bioethical decision-making. PMID:18522253

  9. The Cambrian explosion.

    Science.gov (United States)

    Briggs, Derek E G

    2015-10-01

    The sudden appearance of fossils that marks the so-called 'Cambrian explosion' has intrigued and exercised biologists since Darwin's time. In On the Origin of Species, Darwin made it clear that he believed that ancestral forms 'lived long before' their first fossil representatives. While he considered such an invisible record necessary to explain the level of complexity already seen in the fossils of early trilobites, Darwin was at a loss to explain why there were no corresponding fossils of these earlier forms. In chapter 9 of the Origin, entitled 'On the imperfection of the geological record', he emphasized the 'poorness of our palaeontological collections' and stated categorically that 'no organism wholly soft can be preserved'. Fortunately much has been discovered in the last 150 years, not least multiple examples of Cambrian and Precambrian soft-bodied fossils. We now know that the sudden appearance of fossils in the Cambrian (541-485 million years ago) is real and not an artefact of an imperfect fossil record: rapid diversification of animals coincided with the evolution of biomineralized shells. And although fossils in earlier rocks are rare, they are not absent: their rarity reflects the low diversity of life at this time, as well as the low preservation potential of Precambrian organisms (see Primer by Butterfield, in this issue). PMID:26439348

  10. Suppression of stratified explosive interactions

    Energy Technology Data Exchange (ETDEWEB)

    Meeks, M.K.; Shamoun, B.I.; Bonazza, R.; Corradini, M.L. [Wisconsin Univ., Madison, WI (United States). Dept. of Nuclear Engineering and Engineering Physics

    1998-01-01

    Stratified Fuel-Coolant Interaction (FCI) experiments with Refrigerant-134a and water were performed in a large-scale system. Air was uniformly injected into the coolant pool to establish a pre-existing void which could suppress the explosion. Two competing effects due to the variation of the air flow rate seem to influence the intensity of the explosion in this geometrical configuration. At low flow rates, although the injected air increases the void fraction, the concurrent agitation and mixing increases the intensity of the interaction. At higher flow rates, the increase in void fraction tends to attenuate the propagated pressure wave generated by the explosion. Experimental results show a complete suppression of the vapor explosion at high rates of air injection, corresponding to an average void fraction of larger than 30%. (author)

  11. Explosive Blast Neuropathology and Seizures

    Directory of Open Access Journals (Sweden)

    S. Krisztian eKovacs

    2014-04-01

    Full Text Available Traumatic brain injury (TBI due to explosive blast exposure is a leading combat casualty. It is also implicated as a key contributor to war related mental health diseases. A clinically important consequence of all types of TBI is a high risk for development of seizures and epilepsy. Seizures have been reported in patients who have suffered blast injuries in the Global War on Terror but the exact prevalence is unknown. The occurrence of seizures supports the contention that explosive blast leads to both cellular and structural brain pathology. Unfortunately, the exact mechanism by which explosions cause brain injury is unclear, which complicates development of meaningful therapies and mitigation strategies. To help improve understanding, detailed neuropathological analysis is needed. For this, histopathological techniques are extremely valuable and indispensable. In the following we will review the pathological results, including those from immunohistochemical and special staining approaches, from recent preclinical explosive blast studies.

  12. Explosive plane-wave lens

    Science.gov (United States)

    Marsh, Stanley P.

    1988-01-01

    An explosive plane-wave air lens which enables a spherical wave form to be converted to a planar wave without the need to specially machine or shape explosive materials is described. A disc-shaped impactor having a greater thickness at its center than around its periphery is used to convert the spherical wave into a plane wave. When the wave reaches the impactor, the center of the impactor moves first because the spherical wave reaches the center of the impactor first. The wave strikes the impactor later in time as one moves radially along the impactor. Because the impactor is thinner as one moves radially outward, the velocity of the impactor is greater at the periphery than at the center. An acceptor explosive is positioned so that the impactor strikes the acceptor simultaneously. Consequently, a plane detonation wave is propagated through the acceptor explosive.

  13. Explosive Spot Joining of Metals

    Science.gov (United States)

    Bement, Laurence J. (Inventor); Perry, Ronnie B. (Inventor)

    1997-01-01

    The invention is an apparatus and method for wire splicing using an explosive joining process. The apparatus consists of a prebend, U-shaped strap of metal that slides over prepositioned wires. A standoff means separates the wires from the strap before joining. An adhesive means holds two ribbon explosives in position centered over the U-shaped strap. A detonating means connects to the ribbon explosives. The process involves spreading strands of each wire to be joined into a flat plane. The process then requires alternating each strand in alignment to form a mesh-like arrangement with an overlapped area. The strap slides over the strands of the wires. and the standoff means is positioned between the two surfaces. The detonating means then initiates the ribbon explosives that drive the strap to accomplish a high velocity. angular collision between the mating surfaces. This collision creates surface melts and collision bonding resulting in electron-sharing linkups.

  14. Phenomenological modelling of steam explosions

    International Nuclear Information System (INIS)

    During a hypothetical core meltdown accident, an important safety issue to be addressed is the potential for steam explosions. This paper presents analysis and modelling of experimental results. There are four observations that can be drawn from the analysis: (1) vapor explosions are suppressed by noncondensible gases generated by fuel oxidation, by high ambient pressure, and by high water temperatures; (2) these effects appear to be trigger-related in that an explosion can again be induced in some cases by increasing the trigger magnitude; (3) direct fuel liquid-coolant liquid contact can explain small scale fuel fragmentation; (4) heat transfer during the expansion phase of the explosion can reduce the work potential

  15. Nuclear explosions for peaceful purposes

    International Nuclear Information System (INIS)

    Theoretical and technological aspects as well as peaceful applications of nuclear explosions are discussed emphasizing on contained and cratering explosions. For both types of explosions phenomenology as well as the dimensions of cavity and chimney or of the crater and their predictability are described. As regards applications engineering applications, e.g., canal and harbour construction, industrial applications, e.g., oil reservoir stimulation, oil shale recovery, natural gas stimulation and storage, in-site mineral recovery, and scientific applications, e.g., in neutron physics and geophysics, are dealt with. Safety aspects are discussed considering air-blast effects, soil movement and radiological effects depending on the two types of explosions. Finally, several national programs are outlined

  16. Explosion modelling for complex geometries

    Science.gov (United States)

    Nehzat, Naser

    A literature review suggested that the combined effects of fuel reactivity, obstacle density, ignition strength, and confinement result in flame acceleration and subsequent pressure build-up during a vapour cloud explosion (VCE). Models for the prediction of propagating flames in hazardous areas, such as coal mines, oil platforms, storage and process chemical areas etc. fall into two classes. One class involves use of Computation Fluid Dynamics (CFD). This approach has been utilised by several researchers. The other approach relies upon a lumped parameter approach as developed by Baker (1983). The former approach is restricted by the appropriateness of sub-models and numerical stability requirements inherent in the computational solution. The latter approach raises significant questions regarding the validity of the simplification involved in representing the complexities of a propagating explosion. This study was conducted to investigate and improve the Computational Fluid Dynamic (CFD) code EXPLODE which has been developed by Green et al., (1993) for use on practical gas explosion hazard assessments. The code employs a numerical method for solving partial differential equations by using finite volume techniques. Verification exercises, involving comparison with analytical solutions for the classical shock-tube and with experimental (small-scale, medium and large-scale) results, demonstrate the accuracy of the code and the new combustion models but also identify differences between predictions and the experimental results. The project has resulted in a developed version of the code (EXPLODE2) with new combustion models for simulating gas explosions. Additional features of this program include the physical models necessary to simulate the combustion process using alternative combustion models, improvement to the numerical accuracy and robustness of the code, and special input for simulation of different gas explosions. The present code has the capability of

  17. Multivalent display of the antimicrobial peptides BP100 and BP143

    OpenAIRE

    Imma Güell; Rafael Ferre; Kasper K. Sørensen; Esther Badosa; Iteng Ng-Choi; Emilio Montesinos; Eduard Bardají; Lidia Feliu; Jensen, Knud J; Marta Planas

    2012-01-01

    Carbohydrates are considered as promising templates for the display of multiple copies of antimicrobial peptides. Herein, we describe the design and synthesis of chimeric structures containing two or four copies of the antimicrobial peptides KKLFKKILKYL-NH2 (BP100) and KKLfKKILKYL-NH2 (BP143) attached to the carbohydrate template cyclodithioerythritol (cDTE) or α-D-galactopyranoside (Galp). The synthesis involved the preparation of the corresponding peptide aldehyde followed by coupling ...

  18. Simulation Analysis of Indoor Gas Explosion Damage

    Institute of Scientific and Technical Information of China (English)

    钱新明; 陈林顺; 冯长根

    2003-01-01

    The influence factors and process of indoor gas explosion are studied with AutoReaGas explosion simulator. The result shows that venting pressure has great influence on the indoor gas explosion damage. The higher the venting pressure is, the more serious the hazard consequence will be. The ignition location has also evident effect on the gas explosion damage. The explosion static overpressure would not cause major injury to person and serious damage to structure in the case of low venting pressure (lower than 2 kPa). The high temperature combustion after the explosion is the major factor to person injury in indoor gas explosion accidents.

  19. Tagging of Explosives for Detection

    Directory of Open Access Journals (Sweden)

    J. S. Gharia

    2000-01-01

    Full Text Available This paper gives the results of a study on estimation of shelf life of2,3-dimethyI2,3-dinitrobutane (DMNB-tagged RDX and PETN expiosives by monitoring DMNB depletion by high performanceliquid chromatography and simultaneously recording the detectability of the tagged explosive composition using explosive vapoUf detector Model-97 HS. DMNB was incorporated in the explosive using methanol as solvent for DMNB and the explosive compositions were stored at 35,55 and 75 °C over a long period. Methods developed for preparing the homogeneously tagged composition with DMNB at 0.5 per cent level and for the analysis ofDMNB for ensuring homogeneity of DMNB in the composition are described. The results show no change in compatibility and sensitivity on the incorporation of DMNB in the explosive. Estimation of shelf life of DMNB in the explosive was done for a period of storage of 202-304 days at different temperatures.

  20. Explosive Characteristics of Carbonaceous Nanoparticles

    Science.gov (United States)

    Turkevich, Leonid; Fernback, Joseph; Dastidar, Ashok

    2013-03-01

    Explosion testing has been performed on 20 codes of carbonaceous particles. These include SWCNTs (single-walled carbon nanotubes), MWCNTs (multi-walled carbon nanotubes), CNFs (carbon nanofibers), graphene, diamond, fullerene, carbon blacks and graphites. Explosion screening was performed in a 20 L explosion chamber (ASTM E1226-10 protocol), at a (dilute) concentration of 500 g/m3, using a 5 kJ ignition source. Time traces of overpressure were recorded. Samples exhibited overpressures of 5-7 bar, and deflagration index KSt = V1/3 (dp/pt)max ~ 10 - 80 bar-m/s, which places these materials in European Dust Explosion Class St-1 (similar to cotton and wood dust). There was minimal variation between these different materials. The explosive characteristics of these carbonaceous powders are uncorrelated with particle size (BET specific surface area). Additional tests were performed on selected materials to identify minimum explosive concentration [MEC]. These materials exhibit MEC ~ 101 -102 g/m3 (lower than the MEC for coals). The concentration scans confirm that the earlier screening was performed under fuel-rich conditions (i.e. the maximum over-pressure and deflagration index exceed the screening values); e.g. the true fullerene KSt ~ 200 bar-m/s, placing it borderline St-1/St-2. Work supported through the NIOSH Nanotechnology Research Center (NTRC)

  1. Hydrocarbon production with nuclear explosives

    International Nuclear Information System (INIS)

    The tremendous energy of nuclear explosives and the small dimensions of the explosive package make an ideal combination for drill-hole explosive emplacement in deep, thick hydrocarbon deposits. Potential applications exist in fracturing low permeability natural-gas and petroleum formations for stimulating production, fracturing oil shale to permit in situ retorting, and creating storage chimneys for natural gas, liquefied petroleum gas, petroleum, petroleum products, helium, and other fluids. Calculations show, for example, that less than 100 shots per year would be needed to stabilize the natural gas reserves to production ratio. Under the Government-industry Plowshare program, two experiments, Projects Gasbuggy and Rulison, were conducted to stimulate natural gas production from low-permeability formations. Incomplete information indicates that both were technically successful. Potential problems associated with the use of nuclear explosives for underground engineering applications are radioactive contamination, maximum yield limitations, high costs of detonating contained nuclear explosives, and adverse public opinion. Results at Project Gasbuggy and other considerations indicated that the problem of radioactive contamination was about as predicted and not an insurmountable one. Also, it was demonstrated that shots at adequate depths could be detonated without appreciable damage to existing surface and subsurface buildings, natural features, and equipment. However, costs must be reduced and the public must be better informed before these techniques can be widely used in field operations. On the basis of present knowledge, the potential of nuclear-explosive stimulation of hydrocarbon production appears good. Additional field experiments will be required to adequately explore that potential. (author)

  2. BP Oil Company's approach to risk management

    International Nuclear Information System (INIS)

    The oil and chemical industries face major challenges in deciding how to handle the numerous recommendations coming from various audits, reviews and studies conducted in the functional areas of personnel health and safety, loss prevention, and environmental protection. And, the number of recommendations continues to grow with time, as regulations and normal business requirements are met. BP Oil has developed a methodology for risk ranking the events leading to specific recommendations and then determining the cost-effectiveness of the recommendations in reducing the risk. The author completed successful pilot tests of this methodology at two of BP Oil's petroleum refineries, examining the recommendations from process hazards analyses and studies completed over the past few years. The methodology has since been implemented throughout their petroleum refining, distribution, transportation, and retail business streams

  3. BP refinery closure raises chemical feed issues

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-11-20

    BP chemicals has reaffirmed its plans to carry on chemicals production at Lima, OH, even though British Petroleum has decided to close the 160,000-bbl/day refinery there in two years. The closure will cut off some streams for chemicals production and marketing. {open_quotes}There will be some things to sort out,{close_quotes} the company says, {open_quotes}but we feel they`re manageable issues.{close_quotes} As with many refineries shut down in the past few years in the US, the site will continue to be operated as a terminal and blending facility. The key chemical plant is a 400-million lbs/year acrylonitrile unit, which uses 200 million lbs/year of propylene from the refinery. BP is the top acrylo producer in North America and its expanding its Green Lake, TX plant from 700 million lbs/year to more than 900 million lbs/year by adding a third reactor; the unit is to be onstream by the end of the year. BP says is will be able to find merchant propylene, if necessary, but will be working on {open_quotes}creative{close_quotes} ways of keeping the propylene splitter on-site operating, it says. BP also produces nitrogen, catalysts, and polymers at its site adjacent to the refinery--all of which will stay in operation. Merchant benzene production of 115 million gal/year and captive toluene production of 110 million gal/year will end with the refinery closing.

  4. The Value of a BP Determination Method Using a Novel Non-Invasive BP Device against the Invasive Catheter Measurement

    OpenAIRE

    Jinsong Xu; Yanqing Wu; Hai Su; Weitong Hu; Juxiang Li; Wenying Wang; Xin Liu; Xiaoshu Cheng

    2014-01-01

    OBJECTIVE: The aim of this study was to evaluate the accuracy of a new blood pressure (BP) measurement method (Pulse method). METHODS: This study enrolled 45 patients for selective percutaneous coronary intervention (PCI) via right radial artery. A BP device using either oscillometric (Microlife 3AC1-1) or Pulse method(RG-BP11)was used. At the beginning of each PCI, intra-radial BP was measured before Microlife BP or Pulse BP measurement as its own reference, respectively. At the end of PCI, ...

  5. Waste Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  6. Sediment Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  7. 76 FR 64974 - Commerce in Explosives; List of Explosive Materials (2011R-18T)

    Science.gov (United States)

    2011-10-19

    ... Explosive Materials dated November 17, 2010 (Docket No. ATF 42N, 75 FR 70291). Notice of List of Explosive... tetrazene hydrate]. Tetrazole explosives. Tetryl . Tetrytol. Thickened inorganic oxidizer salt...

  8. Effects of laser pulse duration and intensity on Coulomb explosion of CO2: Signatures of charge-resonance enhanced ionization

    Science.gov (United States)

    Litvinyuk, Igor V.; Bocharova, Irina; Sanderson, Joseph; Kieffer, Jean-Claude; Légaré, François

    2009-11-01

    We studied laser-induced Coulomb explosion of CO2 by full triple-coincidence momentum resolved detection of resulting ion fragments. From the coincidence momentum data we can reconstruct molecular geometry immediately before explosion. We observe the dynamics of Coulomb explosion by comparing reconstructed CO2 geometries for different Ti:Sapphire laser pulse durations (at the same intensity) ranging from few cycles (7 fs) to 200 fs. We conclude that for longer pulse durations (>=100 fs) Coulomb explosion proceeds through the enhanced ionization mechanism taking place at the critical O-O distance of 8 a.u., similarly to well known charge-resonance enhanced ionization (CREI) in H2.

  9. THE INFLUENCE OF BARRIERS ON FLAME AND EXPLOSION WAVE IN GAS EXPLOSION

    Institute of Scientific and Technical Information of China (English)

    林柏泉; 周世宁; 张仁贵

    1998-01-01

    This paper researches into the influence of barriers on flame and explosion wave in gasexplosion on the basis of experiment. The result shows that the barrier is very important to thetransmission of flame and explosion wave in gas explosion. When there are barriers, the speed oftransmission would be very fast and shock wave will appear in gas explosion, which would in-crease gas explosion power. The result of research is very important to prevent gas explosion anddecrease the power of it.

  10. Safe explosives for shaped charges

    International Nuclear Information System (INIS)

    It was demonstrated that high-performance shaped charges could be developed using as the explosive charge mixtures of ingredients that are not, by themselves, considered explosives. At least one of the ingredients needed to be a liquid, stored separately, that could be quickly injected into the shaped charge cavity to generate the active explosive. Precision copper shaped charge cones in diameters of 65.2, 83.8, and 100.2 mm (about 2.6, 3.3, and 4.0 in.) were obtained and appropriate hardware was fabricated. It was demonstrated that 4 cone diameters of penetration were obtained in 255 BHN armor plate steel if the explosive charge was nitromethane or a combination of fine crystalline ammonium nitrate at a density of 1.0 Mg/m3 with nitromethane. However, when prilled ammonium nitrate was used with nitromethane, the jet failed to form. The shaped charges would be used to destroy the high explosive in a nuclear warhead in case of imminent enemy threat to the weapon

  11. Shock Initiation of Heterogeneous Explosives

    International Nuclear Information System (INIS)

    The fundamental picture that shock initiation in heterogeneous explosives is caused by the linking of hot spots formed at inhomogeneities was put forward by several researchers in the 1950's and 1960's, and more recently. Our work uses the computer hardware and software developed in the Advanced Simulation and Computing (ASC) program of the U.S. Department of Energy to explicitly include heterogeneities at the scale of the explosive grains and to calculate the consequences of realistic although approximate models of explosive behavior. Our simulations are performed with ALE-3D, a three-dimensional, elastic-plastic-hydrodynamic Arbitrary Lagrange-Euler finite-difference program, which includes chemical kinetics and heat transfer, and which is under development at this laboratory. We developed the parameter values for a reactive-flow model to describe the non-ideal detonation behavior of an HMX-based explosive from the results of grain-scale simulations. In doing so, we reduced the number of free parameters that are inferred from comparison with experiment to a single one - the characteristic defect dimension. We also performed simulations of the run to detonation in small volumes of explosive. These simulations illustrate the development of the reaction zone and the acceleration of the shock front as the flame fronts start from hot spots, grow, and interact behind the shock front. In this way, our grain-scale simulations can also connect to continuum experiments directly

  12. Explosion limits for combustible gases

    Institute of Scientific and Technical Information of China (English)

    TONG Min-ming; WU Guo-qing; HAO Ji-fei; DAI Xin-lian

    2009-01-01

    Combustible gases in coal mines are composed of methane, hydrogen, some multi-carbon alkane gases and other gases. Based on a numerical calculation, the explosion limits of combustible gases were studied, showing that these limits are related to the concentrations of different components in the mixture. With an increase of C4H10 and C6H14, the Lower ExplosionLimit (LEL) and Upper Explosion-Limit (UEL) of a combustible gas mixture will decrease clearly. For every 0.1% increase in C4H10 and C6H14, the LEL decreases by about 0.19% and the UEL by about 0.3%. The results also prove that, by increasing the amount of H2, the UEL of a combustible gas mixture will increase considerably. If the level of H2 increases by 0.1%, the UEL will increase by about 0.3%. However, H2 has only a small effect on the LEL of the combustible gas mixture. Our study provides a theoretical foundation for judging the explosion risk of an explosive gas mixture in mines.

  13. The Quiet Explosion

    Science.gov (United States)

    2008-07-01

    A European-led team of astronomers are providing hints that a recent supernova may not be as normal as initially thought. Instead, the star that exploded is now understood to have collapsed into a black hole, producing a weak jet, typical of much more violent events, the so-called gamma-ray bursts. The object, SN 2008D, is thus probably among the weakest explosions that produce very fast moving jets. This discovery represents a crucial milestone in the understanding of the most violent phenomena observed in the Universe. Black Hole ESO PR Photo 23a/08 A Galaxy and two Supernovae These striking results, partly based on observations with ESO's Very Large Telescope, will appear tomorrow in Science Express, the online version of Science. Stars that were at birth more massive than about 8 times the mass of our Sun end their relatively short life in a cosmic, cataclysmic firework lighting up the Universe. The outcome is the formation of the densest objects that exist, neutron stars and black holes. When exploding, some of the most massive stars emit a short cry of agony, in the form of a burst of very energetic light, X- or gamma-rays. In the early afternoon (in Europe) of 9 January 2008, the NASA/STFC/ASI Swift telescope discovered serendipitously a 5-minute long burst of X-rays coming from within the spiral galaxy NGC 2770, located 90 million light-years away towards the Lynx constellation. The Swift satellite was studying a supernova that had exploded the previous year in the same galaxy, but the burst of X-rays came from another location, and was soon shown to arise from a different supernova, named SN 2008D. Researchers at the Italian National Institute for Astrophysics (INAF), the Max-Planck Institute for Astrophysics (MPA), ESO, and at various other institutions have observed the supernova at great length. The team is led by Paolo Mazzali of INAF's Padova Observatory and MPA. "What made this event very interesting," says Mazzali, "is that the X-ray signal was very

  14. AcEST: BP917767 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_B11 76 Adiantum capillus-veneris mRNA. clone: YMU001_000105_B11. BP917767 - Show BP9177... mRNA. clone: YMU001_000105_B11. Accession BP917767 Tissue type prothallium Developmental stage - Contig ID

  15. AcEST: BP916367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000086_H07 86 Adiantum capillus-veneris mRNA. clone: YMU001_000086_H07. BP916367 - Show BP916367... mRNA. clone: YMU001_000086_H07. Accession BP916367 Tissue type prothallium Developmental stage - Contig ID

  16. Dicty_cDB: FC-BP14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BP14 (Link to dictyBase) - - - Contig-U15220-1 FC-BP14P (Li...nk to Original site) FC-BP14F 507 FC-BP14Z 675 FC-BP14P 1182 - - Show FC-BP14 Library FC (Link to library) Clone ID FC-BP1...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BP/FC-BP14Q.Seq.d/ Repr...esentative seq. ID FC-BP14P (Link to Original site) Representative DNA sequence >FC-BP14 (FC-BP14Q) /CSM/FC/FC-BP/FC-BP1... CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-BP14 (FC-BP14Q) /CSM/FC/FC-BP/FC-BP1

  17. Coulomb explosion of "hot spot"

    CERN Document Server

    Oreshkin, V I; Chaikovsky, S A; Artyomov, A P

    2016-01-01

    The study presented in this paper has shown that the generation of hard x rays and high-energy ions, which are detected in pinch implosion experiments, may be associated with the Coulomb explosion of the hot spot that is formed due to the outflow of the material from the pinch cross point. During the process of material outflow, the temperature of the hot spot plasma increases, and conditions arise for the plasma electrons to become continuously accelerated. The runaway of electrons from the hot spot region results in the buildup of positive space charge in this region followed by a Coulomb explosion. The conditions for the hot spot plasma electrons to become continuously accelerated have been revealed and estimates have been obtained for the kinetic energy of the ions generated by the Coulomb explosion.

  18. Evidence for Nearby Supernova Explosions

    CERN Document Server

    Benítez, N; Canelles, M; Benitez, Narciso; Maiz-Apellaniz, Jesus; Canelles, Matilde

    2002-01-01

    Supernova explosions are one of the most energetic--and potentially lethal--phenomena in the Universe. Scientists have speculated for decades about the possible consequences for life on Earth of a nearby supernova, but plausible candidates for such an event were lacking. Here we show that the Scorpius-Centaurus OB association, a group of young stars currently located at~130 parsecs from the Sun, has generated 20 SN explosions during the last 11 Myr, some of them probably as close as 40 pc to our planet. We find that the deposition on Earth of 60Fe atoms produced by these explosions can explain the recent measurements of an excess of this isotope in deep ocean crust samples. We propose that ~2 Myr ago, one of the SNe exploded close enough to Earth to seriously damage the ozone layer, provoking or contributing to the Pliocene-Pleistocene boundary marine extinction.

  19. Optimal dynamic detection of explosives

    Energy Technology Data Exchange (ETDEWEB)

    Moore, David Steven [Los Alamos National Laboratory; Mcgrane, Shawn D [Los Alamos National Laboratory; Greenfield, Margo T [Los Alamos National Laboratory; Scharff, R J [Los Alamos National Laboratory; Rabitz, Herschel A [PRINCETON UNIV; Roslund, J [PRINCETON UNIV

    2009-01-01

    The detection of explosives is a notoriously difficult problem, especially at stand-off distances, due to their (generally) low vapor pressure, environmental and matrix interferences, and packaging. We are exploring optimal dynamic detection to exploit the best capabilities of recent advances in laser technology and recent discoveries in optimal shaping of laser pulses for control of molecular processes to significantly enhance the standoff detection of explosives. The core of the ODD-Ex technique is the introduction of optimally shaped laser pulses to simultaneously enhance sensitivity of explosives signatures while reducing the influence of noise and the signals from background interferents in the field (increase selectivity). These goals are being addressed by operating in an optimal nonlinear fashion, typically with a single shaped laser pulse inherently containing within it coherently locked control and probe sub-pulses. With sufficient bandwidth, the technique is capable of intrinsically providing orthogonal broad spectral information for data fusion, all from a single optimal pulse.

  20. Explosive evaporation in solar flares

    Science.gov (United States)

    Fisher, George H.

    1987-01-01

    This paper develops a simple analytical model for the phenomenon of 'explosive evaporation' driven by nonthermal electron heating in solar flares. The model relates the electron energy flux and spectrum, plus details of the preflare atmosphere, to the time scale for explosive evaporation to occur, the maximum pressure and temperature to be reached, rough estimates for the UV pulse emission flux and duration, and the evolution of the blueshifted component of the soft X-ray lines. An expression is given for the time scale for buildup to maximum pressures and the onset of rapid motion of the explosively evaporating plasma. This evaporation can excite a rapid response of UV line and continuum emission. The emission lines formed in the plasma approach a given emissivity-weighted blueshift speed.

  1. Seismic coupling of nuclear explosions

    International Nuclear Information System (INIS)

    The new Giant Magnet Experimental Facility employing digital recording of explosion induced motion has been constructed and successfully tested. Particle velocity and piezoresistance gage responses can be measured simultaneously thus providing the capability for determining the multi-component stress-strain history in the test material. This capability provides the information necessary for validation of computer models used in simulation of nuclear underground testing, chemical explosion testing, dynamic structural response, earth penetration response, and etc. This report discusses fully coupled and cavity decoupled explosions of the same energy (0.622 kJ) were carried out as experiments to study wave propagation and attenuation in polymethylmethacrylate (PMMA). These experiments produced particle velocity time histories at strains from 2 x 10-3 to as low as 5.8 x 10-6. Other experiments in PMMA, reported recently by Stout and Larson8 provide additional particle velocity data to strains of 10-1

  2. ATM-dependent phosphorylation of 53BP1 in response to genomic stress in oxic and hypoxic cells

    International Nuclear Information System (INIS)

    The ATM kinase is activated by chromatin modification following exogenous and endogenous DSBs or cell stress, including acute anoxia. The p53 binding protein 1 (53BP1) contains multiple ATM-consensus phosphorylation sites in its N- and C-termini and may therefore be a distal read-out of ATM function. We have examined the cellular activation of these phosphorylation sites for the first time in situ following anoxic/hypoxic stress and IR-induced exogenous DSBs. We show that multiple residues of 53BP1 are phosphorylated and that these phosphoforms form discrete nuclear foci following IR or during DNA replication as exogenous or endogenous DNA double strand breaks (DSBs), respectively. Novel data pertaining to the phosphorylation of 53BP1Ser25in situ supports its dependency on the ATM kinase; but this occurs independently of p53 function. We show that 53BP1Ser25 is activated specifically in S-phase cells during anoxia in an ATM-dependent manner. Exogenous DSBs form discrete IR-induced foci whereas oxygen stress induced non-localized 53BP1Ser25 activation. Our in vitro data are supported by irradiated xenograft studies in vivo whereby 53BP1Ser25 phosphorylation does not occur in sub-regions positive for the hypoxia marker EF5. We propose a model whereby DSBs induce chromatin modification at sites of DNA damage which are tracked by the ATM substrates γ H2AX and 53BP1Ser25 in a mechanism distinct from p53-mediated cell cycle arrest. Together this work indicates 53BP1Ser25, and possibly other 53BP1 phosphoforms, as a bona fide DSB-biomarkers for surveying ongoing DNA-damage related signaling in oxic and hypoxic cells during clinical radiotherapy.

  3. ICPP custom dissolver explosion recovery

    International Nuclear Information System (INIS)

    This report discusses the recovery from the February 9, 1991 small scale explosion in a custom processing dissolver at the Idaho Chemical Processing Plant. Custom processing is a small scale dissolution facility which processes nuclear material in an economical fashion. The material dissolved in this facility was uranium metal, uranium oxides, and uranium/fissium alloy in nitric acid. The paper explained the release of fission material, and the decontamination and recovery of the fuel material. The safety and protection procedures were also discussed. Also described was the chemical analysis which was used to speculate the most probable cause of the explosion. (MB)

  4. Explosive coalescence of magnetic islands

    Science.gov (United States)

    Tajima, T.; Sakai, J.-I.

    1986-01-01

    Simulation results from both the EM collisionless particle code and the MHD particle code reveal an explosive reconnection process associated with nonlinear evolution of the coalescence instability. The explosive coalescence is a self-similar process of magnetic collapse, and ensuing amplitude oscillations in the magnetic and electrostatic energies and temperatures are modeled by an equation of motion for the scale factor in the Sagdeev potential. This phenomenon may explain the rapid energy release of a certain class of solar flares during their impulsive phase.

  5. System for detecting nuclear explosions

    International Nuclear Information System (INIS)

    Apparatus for detecting underground nuclear explosions is described that is comprised of an antenna located in the dielectric substance of a deep waveguide in the earth and adapted to detect low frequency electromagnetic waves generated by a nuclear explosion, the deep waveguide comprising the high conductivity upper sedimentary layers of the earth, the dielectric basement rock, and a high conductivity layer of basement rock due to the increased temperature thereof at great depths, and means for receiving the electromagnetic waves detected by said antenna means

  6. AcEST: BP920166 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G12 149 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G12. BP920166 - Show BP92016...is mRNA. clone: YMU001_000133_G12. Accession BP920166 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920166|Adiantum capillus-veneris

  7. AcEST: BP920168 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H02 390 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H02. BP920168 - Show BP92016...is mRNA. clone: YMU001_000133_H02. Accession BP920168 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920168|Adiantum capillus-veneris mRNA,...c Acids Res. 25:3389-3402. Query= BP920168|Adiantum capillus-veneris mRNA, clone: YMU001_000133_H02. (390 le

  8. AcEST: BP920164 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G09 447 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G09. BP920164 - Show BP92016...is mRNA. clone: YMU001_000133_G09. Accession BP920164 Tissue type prothallium Developmental stage - Contig I...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920164|A...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920164|Adiantum cap

  9. AcEST: BP920169 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H03. BP920169 - Show BP92016...is mRNA. clone: YMU001_000133_H03. Accession BP920169 Tissue type prothallium Developmental stage - Contig I...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920169|Adiantum cap

  10. AcEST: BP920167 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H01 152 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H01. BP920167 - Show BP92016...is mRNA. clone: YMU001_000133_H01. Accession BP920167 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP920167|Adiantum capillus-veneris mRNA, clone: YMU...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920167

  11. AcEST: BP920165 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G11 301 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G11. BP920165 - Show BP92016...is mRNA. clone: YMU001_000133_G11. Accession BP920165 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920165...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016

  12. AcEST: BP920161 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G06. BP920161 - Show BP92016...is mRNA. clone: YMU001_000133_G06. Accession BP920161 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016

  13. AcEST: BP920163 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G08 372 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G08. BP92016...3 CL2472Contig1 Show BP920163 Clone id YMU001_000133_G08 Library YMU01 Length 372 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_G08. Accession BP920163 Tissue type prothallium Developmental stag...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920163|Adiantum cap... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920163|Adiantum capillus-veneris mRNA, clone: YM

  14. AcEST: BP912707 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_A02 298 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A02. BP912707 - Show BP912707...is mRNA. clone: YMU001_000022_A02. Accession BP912707 Tissue type prothallium Developmental stage - Contig I... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912707|Adiantum capillus-ven...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912707|Adiantum capillus-veneris mRNA, clone: YMU001_000022_

  15. AcEST: BP917711 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E02. BP917711 - Show BP9177...is mRNA. clone: YMU001_000104_E02. Accession BP917711 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP917711|Adiantum capillus-veneris mRNA, clone: YMU001_000104_E02. (534 letters) Dat...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917711|Adiantum capillus-ve

  16. AcEST: BP917703 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_D05 340 Adiantum capillus-veneris mRNA. clone: YMU001_000104_D05. BP9177...03 CL1948Contig1 Show BP917703 Clone id YMU001_000104_D05 Library YMU01 Length 340 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_D05. Accession BP917703 Tissue type prothallium Developmental stag...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917703|Adiantum capillus-veneris mRNA, clone: YMU00...ic Acids Res. 25:3389-3402. Query= BP917703|Adiantum capillus-veneris mRNA, clone

  17. AcEST: BP917787 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D11 582 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D11. BP917787 - Show BP9177...is mRNA. clone: YMU001_000105_D11. Accession BP917787 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917787|Adiantum capillus-veneris mRNA,...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  18. AcEST: BP917732 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_G02 305 Adiantum capillus-veneris mRNA. clone: YMU001_000104_G02. BP917732 - Show BP9177...is mRNA. clone: YMU001_000104_G02. Accession BP917732 Tissue type prothallium Developmental stage - Contig I...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917732|Adiantum capillus-veneris mRNA...ds Res. 25:3389-3402. Query= BP917732|Adiantum capillus-veneris mRNA, clone: YMU001_000104_G02. (305 letters

  19. AcEST: BP917756 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A08 493 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A08. BP917756 - Show BP9177...is mRNA. clone: YMU001_000105_A08. Accession BP917756 Tissue type prothallium Developmental stage - Contig I...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917756|Adi...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP917756|Adiantum capillus-veneris mRNA, clone: YMU001_00010

  20. AcEST: BP917783 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D07 525 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D07. BP917783 - Show BP9177...is mRNA. clone: YMU001_000105_D07. Accession BP917783 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP917783|Adiantum capillus-veneris mRNA, clone: YMU001_000105_D07. (525 letter...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  1. AcEST: BP917763 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_B06 159 Adiantum capillus-veneris mRNA. clone: YMU001_000105_B06. BP917763 - Show BP9177...is mRNA. clone: YMU001_000105_B06. Accession BP917763 Tissue type prothallium Developmental stage - Contig I...leic Acids Res. 25:3389-3402. Query= BP917763|Adiantum capillus-veneris mRNA, clo...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  2. AcEST: BP917796 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_E10 461 Adiantum capillus-veneris mRNA. clone: YMU001_000105_E10. BP9177...96 CL2065Contig1 Show BP917796 Clone id YMU001_000105_E10 Library YMU01 Length 461 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_E10. Accession BP917796 Tissue type prothallium Developmental stag...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917796|Adiantum capillus-...ids Res. 25:3389-3402. Query= BP917796|Adiantum capillus-veneris mRNA, clone: YMU

  3. AcEST: BP911772 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_A06 326 Adiantum capillus-veneris mRNA. clone: YMU001_000009_A06. BP911772 - Show BP91177...is mRNA. clone: YMU001_000009_A06. Accession BP911772 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91177...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91177

  4. AcEST: BP917735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_G07 461 Adiantum capillus-veneris mRNA. clone: YMU001_000104_G07. BP917735 - Show BP9177...is mRNA. clone: YMU001_000104_G07. Accession BP917735 Tissue type prothallium Developmental stage - Contig I...eic Acids Res. 25:3389-3402. Query= BP917735|Adiantum capillus-veneris mRNA, clon...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917735|Adiantum cap

  5. AcEST: BP911771 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_A05 478 Adiantum capillus-veneris mRNA. clone: YMU001_000009_A05. BP911771 - Show BP91177...is mRNA. clone: YMU001_000009_A05. Accession BP911771 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP911771|Adiantum capillus-veneris mRNA, clone... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911771|Adiantum capillus-veneri

  6. AcEST: BP917727 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_F09 528 Adiantum capillus-veneris mRNA. clone: YMU001_000104_F09. BP917727 - Show BP9177...is mRNA. clone: YMU001_000104_F09. Accession BP917727 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP917727|Adiantum capillus-veneris mRNA, clone: YMU001_000104_F09. (528 letters) D...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  7. AcEST: BP917741 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_H02 445 Adiantum capillus-veneris mRNA. clone: YMU001_000104_H02. BP917741 - Show BP9177...is mRNA. clone: YMU001_000104_H02. Accession BP917741 Tissue type prothallium Developmental stage - Contig I... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  8. AcEST: BP917752 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A04 422 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A04. BP917752 - Show BP9177...is mRNA. clone: YMU001_000105_A04. Accession BP917752 Tissue type prothallium Developmental stage - Contig I...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917752|Adiantum capillus-...ncharacterized protein OS=Vitis vinifera GN=VITISV_008296 PE=4 SV=1 Length = 1027 Score = 72.8 bits (177

  9. AcEST: BP917740 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_G12 396 Adiantum capillus-veneris mRNA. clone: YMU001_000104_G12. BP917740 - Show BP9177...is mRNA. clone: YMU001_000104_G12. Accession BP917740 Tissue type prothallium Developmental stage - Contig I...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917740|Adiantum capillus-veneris mR...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917740|Adiantum ...: 4 DLLKAYVTEVDQRDQWKNHSPLVEYVYNYSTHTSTRKTLFKVTEERLKIRLIVKTLG--K 177 D+L+A V +D +

  10. AcEST: BP917700 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_D02 544 Adiantum capillus-veneris mRNA. clone: YMU001_000104_D02. BP9177...00 CL272Contig1 Show BP917700 Clone id YMU001_000104_D02 Library YMU01 Length 544 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000104_D02. Accession BP917700 Tissue type prothallium Developmental stage... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917700|Adiantum capillus-ven...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917700|Adiantum capillus-vener

  11. AcEST: BP917712 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E03 514 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E03. BP917712 - Show BP9177...is mRNA. clone: YMU001_000104_E03. Accession BP917712 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917712|Adia...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917712|Adiantu...073 PE=4 SV=1 Length = 146 Score = 34.7 bits (78), Expect = 2.5 Identities = 22/91 (24%), Positives = 38/91

  12. AcEST: BP917747 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_H10 483 Adiantum capillus-veneris mRNA. clone: YMU001_000104_H10. BP917747 - Show BP9177...is mRNA. clone: YMU001_000104_H10. Accession BP917747 Tissue type prothallium Developmental stage - Contig I...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...s. 25:3389-3402. Query= BP917747|Adiantum capillus-veneris mRNA, clone: YMU001_000104_H10. (483 letters) Dat

  13. AcEST: BP917743 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_H04 524 Adiantum capillus-veneris mRNA. clone: YMU001_000104_H04. BP917743 - Show BP9177...is mRNA. clone: YMU001_000104_H04. Accession BP917743 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917743|Adiantum capi...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917743|Adiantum capillus-veneris mRNA, clo

  14. AcEST: BP917775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_C08 544 Adiantum capillus-veneris mRNA. clone: YMU001_000105_C08. BP917775 - Show BP9177...is mRNA. clone: YMU001_000105_C08. Accession BP917775 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917775|Adiantum capill

  15. AcEST: BP917780 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D03. BP917780 - Show BP9177...is mRNA. clone: YMU001_000105_D03. Accession BP917780 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917780|Ad...) Frame = +1 Query: 229 TLGN*FDLFGPPIRRLPF-WIVLWSILGLA*GGAC 330 TLG D+F P ++LP W+ LWS LG GG C Sbjct: 177

  16. AcEST: BP911775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_A09 285 Adiantum capillus-veneris mRNA. clone: YMU001_000009_A09. BP91177...5 CL2064Contig1 Show BP911775 Clone id YMU001_000009_A09 Library YMU01 Length 285 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000009_A09. Accession BP911775 Tissue type prothallium Developmental stag...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911775...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911775|Adiantum capillus

  17. AcEST: BP917799 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_F02 443 Adiantum capillus-veneris mRNA. clone: YMU001_000105_F02. BP917799 - Show BP9177...is mRNA. clone: YMU001_000105_F02. Accession BP917799 Tissue type prothallium Developmental stage - Contig I...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91779...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917799|Adiantum capillus

  18. AcEST: BP917718 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E11 470 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E11. BP917718 - Show BP9177...is mRNA. clone: YMU001_000104_E11. Accession BP917718 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917718|Adiantum capillus-veneris mRNA, clone: YMU0...es. 25:3389-3402. Query= BP917718|Adiantum capillus-veneris mRNA, clone: YMU001_000104_E11. (470 letters) Da

  19. AcEST: BP917785 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D09 516 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D09. BP917785 - Show BP9177...is mRNA. clone: YMU001_000105_D09. Accession BP917785 Tissue type prothallium Developmental stage - Contig I...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917785|Adiantum capillus-veneris mRNA,

  20. AcEST: BP917736 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_G08 378 Adiantum capillus-veneris mRNA. clone: YMU001_000104_G08. BP917736 - Show BP9177...is mRNA. clone: YMU001_000104_G08. Accession BP917736 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917736|Adiantum capillus-veneris... programs, Nucleic Acids Res. 25:3389-3402. Query= BP917736|Adiantum capillus-veneris mRNA, clone: YMU001_00

  1. AcEST: BP917708 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_D11 459 Adiantum capillus-veneris mRNA. clone: YMU001_000104_D11. BP9177...08 CL668Contig1 Show BP917708 Clone id YMU001_000104_D11 Library YMU01 Length 459 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000104_D11. Accession BP917708 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP917708|Adiantum capillus-vener...cids Res. 25:3389-3402. Query= BP917708|Adiantum capillus-veneris mRNA, clone: YMU001_000104_D11. (459 lette

  2. AcEST: BP916177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_C01 435 Adiantum capillus-veneris mRNA. clone: YMU001_000084_C01. BP916177 - Show BP916177...is mRNA. clone: YMU001_000084_C01. Accession BP916177 Tissue type prothallium Developmental stage - Contig I...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916177...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916177

  3. AcEST: BP917716 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E09 452 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E09. BP9177...16 CL2904Contig1 Show BP917716 Clone id YMU001_000104_E09 Library YMU01 Length 452 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_E09. Accession BP917716 Tissue type prothallium Developmental stag...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917716|Adiant...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  4. AcEST: BP917744 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_H05 493 Adiantum capillus-veneris mRNA. clone: YMU001_000104_H05. BP9177...44 CL73Contig1 Show BP917744 Clone id YMU001_000104_H05 Library YMU01 Length 493 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000104_H05. Accession BP917744 Tissue type prothallium Developmental stage ... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917744|Adiantum capil...s Res. 25:3389-3402. Query= BP917744|Adiantum capillus-veneris mRNA, clone: YMU001_000104_H05. (493 letters)

  5. AcEST: BP917771 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_C03 433 Adiantum capillus-veneris mRNA. clone: YMU001_000105_C03. BP917771 - Show BP9177...is mRNA. clone: YMU001_000105_C03. Accession BP917771 Tissue type prothallium Developmental stage - Contig I...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  6. AcEST: BP921773 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_A04 367 Adiantum capillus-veneris mRNA. clone: YMU001_000154_A04. BP921773 - Show BP92177...is mRNA. clone: YMU001_000154_A04. Accession BP921773 Tissue type prothallium Developmental stage - Contig I... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921773|Adiantum capillus-ven...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP921773|Adiantum capillus-veneris mRNA, clone: YMU001_00015

  7. AcEST: BP921177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000146_F04 542 Adiantum capillus-veneris mRNA. clone: YMU001_000146_F04. BP921177 - Show BP921177...is mRNA. clone: YMU001_000146_F04. Accession BP921177 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP921177|Adiantum capillus-veneris mRNA, clone: YMU001_000146_F04....T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921177|Ad

  8. AcEST: BP921778 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_A09 262 Adiantum capillus-veneris mRNA. clone: YMU001_000154_A09. BP921778 - Show BP92177...is mRNA. clone: YMU001_000154_A09. Accession BP921778 Tissue type prothallium Developmental stage - Contig I...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92177...s, Nucleic Acids Res. 25:3389-3402. Query= BP921778|Adiantum capillus-veneris mRNA, clone: YMU001_000154_A09

  9. AcEST: BP917751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A03 466 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A03. BP9177...51 CL2236Contig1 Show BP917751 Clone id YMU001_000105_A03 Library YMU01 Length 466 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_A03. Accession BP917751 Tissue type prothallium Developmental stag...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917751|Adiantum..., Nucleic Acids Res. 25:3389-3402. Query= BP917751|Adiantum capillus-veneris mRNA, clone: YMU001_000105_A03.

  10. AcEST: BP917768 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_B12 509 Adiantum capillus-veneris mRNA. clone: YMU001_000105_B12. BP917768 - Show BP9177...is mRNA. clone: YMU001_000105_B12. Accession BP917768 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...Res. 25:3389-3402. Query= BP917768|Adiantum capillus-veneris mRNA, clone: YMU001_000105_B12. (509 letters) D

  11. AcEST: BP917792 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_E06 308 Adiantum capillus-veneris mRNA. clone: YMU001_000105_E06. BP917792 - Show BP9177...is mRNA. clone: YMU001_000105_E06. Accession BP917792 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP917792|Adiantum capillus-veneris mRNA, clone: YMU001_000105_E06. (308 l...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  12. AcEST: BP913000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_C05 322 Adiantum capillus-veneris mRNA. clone: YMU001_000025_C05. BP913000... CL1177Contig1 Show BP913000 Clone id YMU001_000025_C05 Library YMU01 Length 322 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000025_C05. Accession BP913000 Tissue type prothallium Developmental stag.... 25:3389-3402. Query= BP913000|Adiantum capillus-veneris mRNA, clone: YMU001_000025_C05. (322 letters) Data...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913000|Adiantum capill

  13. AcEST: BP921010 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E04 526 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E04. BP921010 - Show BP92101...is mRNA. clone: YMU001_000144_E04. Accession BP921010 Tissue type prothallium Developmental stage - Contig I...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921010|Adiantum capillus-veneris mRNA...programs, Nucleic Acids Res. 25:3389-3402. Query= BP921010|Adiantum capillus-veneris mRNA, clone: YMU001_000

  14. AcEST: BP921016 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E10 528 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E10. BP92101...6 CL35Contig1 Show BP921016 Clone id YMU001_000144_E10 Library YMU01 Length 528 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_E10. Accession BP921016 Tissue type prothallium Developmental stage ... Res. 25:3389-3402. Query= BP921016|Adiantum capillus-veneris mRNA, clone: YMU001... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921016|Adia

  15. AcEST: BP919713 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C09 384 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C09. BP919713 - Show BP91971...is mRNA. clone: YMU001_000128_C09. Accession BP919713 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919713|Adiantum capillus-veneris mRNA, c...rams, Nucleic Acids Res. 25:3389-3402. Query= BP919713|Adiantum capillus-veneris

  16. AcEST: BP911971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_E04 469 Adiantum capillus-veneris mRNA. clone: YMU001_000011_E04. BP911971... CL204Contig1 Show BP911971 Clone id YMU001_000011_E04 Library YMU01 Length 469 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000011_E04. Accession BP911971 Tissue type prothallium Developmental stage..., Nucleic Acids Res. 25:3389-3402. Query= BP911971|Adiantum capillus-veneris mRNA...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911971|Adiantum capillus-veneris mRNA,

  17. AcEST: BP919715 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C11 494 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C11. BP91971...5 CL3828Contig1 Show BP919715 Clone id YMU001_000128_C11 Library YMU01 Length 494 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_C11. Accession BP919715 Tissue type prothallium Developmental stag...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91971... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919715|Adia

  18. AcEST: BP919717 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_D01 387 Adiantum capillus-veneris mRNA. clone: YMU001_000128_D01. BP919717 - Show BP91971...is mRNA. clone: YMU001_000128_D01. Accession BP919717 Tissue type prothallium Developmental stage - Contig I...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919717|Adiantum capill... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919717|Adiantum capillus-veneris mRNA, clone: YMU001_00

  19. AcEST: BP919711 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C07 523 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C07. BP919711 - Show BP91971...is mRNA. clone: YMU001_000128_C07. Accession BP919711 Tissue type prothallium Developmental stage - Contig I...eic Acids Res. 25:3389-3402. Query= BP919711|Adiantum capillus-veneris mRNA, clone: YMU001_000128_C07. (523 ... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919711|Adiantum capillus-ven

  20. AcEST: BP918818 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000117_G09 538 Adiantum capillus-veneris mRNA. clone: YMU001_000117_G09. BP918818 - Show BP918818...is mRNA. clone: YMU001_000117_G09. Accession BP918818 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP918818|Adiantum capillus-veneris mRNA, clone: YMU001_000117_G09. (525 letters) Dat...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918818|Adiantum capillus-veneris mRNA, clon

  1. AcEST: BP912219 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_E07 496 Adiantum capillus-veneris mRNA. clone: YMU001_000016_E07. BP912219 - Show BP912219...is mRNA. clone: YMU001_000016_E07. Accession BP912219 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912219...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912219|Adiantum capillus-veneris mRNA, clone: Y

  2. AcEST: BP919775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_A08 507 Adiantum capillus-veneris mRNA. clone: YMU001_000129_A08. BP919775 - Show BP919775...is mRNA. clone: YMU001_000129_A08. Accession BP919775 Tissue type prothallium Developmental stage - Contig I...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP919775|Adiantum capillus-ve... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919775|Adiantum capillus-veneris mRNA,

  3. AcEST: BP916775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000091_D11 369 Adiantum capillus-veneris mRNA. clone: YMU001_000091_D11. BP916775 - Show BP916775...is mRNA. clone: YMU001_000091_D11. Accession BP916775 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP916775|Adiantum capillus-veneris mRNA, clone: YMU001_000091_...programs, Nucleic Acids Res. 25:3389-3402. Query= BP916775|Adiantum capillus-veneris mRNA, clone: YMU001_000

  4. AcEST: BP917753 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A05 482 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A05. BP91775...3 CL2810Contig1 Show BP917753 Clone id YMU001_000105_A05 Library YMU01 Length 482 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_A05. Accession BP917753 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917753|Adiant...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917753|Adiantum capillus

  5. AcEST: BP914775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000062_G03 488 Adiantum capillus-veneris mRNA. clone: YMU001_000062_G03. BP914775... CL4173Contig1 Show BP914775 Clone id YMU001_000062_G03 Library YMU01 Length 488 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000062_G03. Accession BP914775 Tissue type prothallium Developmental stag...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914775...leic Acids Res. 25:3389-3402. Query= BP914775|Adiantum capillus-veneris mRNA, clo

  6. AcEST: BP920775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000141_D06 589 Adiantum capillus-veneris mRNA. clone: YMU001_000141_D06. BP920775 - Show BP920775...is mRNA. clone: YMU001_000141_D06. Accession BP920775 Tissue type prothallium Developmental stage - Contig I...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920775|Adi...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920775|Adiantum capillus-veneris mRNA, clone: YMU001_000141_D0

  7. AcEST: BP917750 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A02 462 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A02. BP91775...0 CL3417Contig1 Show BP917750 Clone id YMU001_000105_A02 Library YMU01 Length 462 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_A02. Accession BP917750 Tissue type prothallium Developmental stag...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917750|Adiantu...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917750|Adiantum capillus-veneris mRNA, clone

  8. AcEST: BP915775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000076_F10 565 Adiantum capillus-veneris mRNA. clone: YMU001_000076_F10. BP915775 - Show BP915775...is mRNA. clone: YMU001_000076_F10. Accession BP915775 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915775|Adiantum capillus-veneris mRNA,...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915775|Adiantum capi

  9. AcEST: BP913775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000035_B05 311 Adiantum capillus-veneris mRNA. clone: YMU001_000035_B05. BP913775 - Show BP913775...is mRNA. clone: YMU001_000035_B05. Accession BP913775 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913775|Adiantum capillus...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913775

  10. AcEST: BP917758 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A12 315 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A12. BP91775...8 CL2869Contig1 Show BP917758 Clone id YMU001_000105_A12 Library YMU01 Length 315 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_A12. Accession BP917758 Tissue type prothallium Developmental stag... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91775...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP917758|Adiantum capillus-vener

  11. AcEST: BP919367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_C07 523 Adiantum capillus-veneris mRNA. clone: YMU001_000124_C07. BP919367... CL601Contig1 Show BP919367 Clone id YMU001_000124_C07 Library YMU01 Length 523 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000124_C07. Accession BP919367 Tissue type prothallium Developmental stage...es. 25:3389-3402. Query= BP919367|Adiantum capillus-veneris mRNA, clone: YMU001_000124_C07. (523 letters) Da...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919367|Adiantum ca

  12. AcEST: BP914367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_B03 578 Adiantum capillus-veneris mRNA. clone: YMU001_000058_B03. BP914367 - Show BP914367...is mRNA. clone: YMU001_000058_B03. Accession BP914367 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914367|Adiantum ...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914367|

  13. AcEST: BP913671 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A02 620 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A02. BP913671 - Show BP91367...is mRNA. clone: YMU001_000033_A02. Accession BP913671 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP913671|Adiantum capillus-veneris mRNA, clone: YMU001_000033_A02. ...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913671|Adiantum capillus-veneris mRNA, c

  14. AcEST: BP913676 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A07 497 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A07. BP913676 - Show BP91367...is mRNA. clone: YMU001_000033_A07. Accession BP913676 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP913676|Adiantum capillus-ven...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913676|Adiantum capillus-veneris mRNA, clone:

  15. AcEST: BP917367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_A02 384 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A02. BP917367 - Show BP917367...is mRNA. clone: YMU001_000100_A02. Accession BP917367 Tissue type prothallium Developmental stage - Contig I...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917367|Adiantum capill...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917367|Adiantum capillus-veneris mR

  16. AcEST: BP913367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_E01 457 Adiantum capillus-veneris mRNA. clone: YMU001_000029_E01. BP913367 - Show BP913367...is mRNA. clone: YMU001_000029_E01. Accession BP913367 Tissue type prothallium Developmental stage - Contig I...leic Acids Res. 25:3389-3402. Query= BP913367|Adiantum capillus-veneris mRNA, clo...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913367

  17. AcEST: BP913675 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A06 440 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A06. BP913675 - Show BP91367...is mRNA. clone: YMU001_000033_A06. Accession BP913675 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP913675|Adiantum capillus-veneris mRNA,...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91367

  18. AcEST: BP913677 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A08 517 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A08. BP913677 - Show BP91367...is mRNA. clone: YMU001_000033_A08. Accession BP913677 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91367...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91367

  19. AcEST: BP913679 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A11 505 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A11. BP91367...9 CL11Contig1 Show BP913679 Clone id YMU001_000033_A11 Library YMU01 Length 505 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000033_A11. Accession BP913679 Tissue type prothallium Developmental stage ...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91367...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913679|Adiantum cap

  20. AcEST: BP920367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000136_C07 537 Adiantum capillus-veneris mRNA. clone: YMU001_000136_C07. BP920367 - Show BP920367...is mRNA. clone: YMU001_000136_C07. Accession BP920367 Tissue type prothallium Developmental stage - Contig I...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920367...grams, Nucleic Acids Res. 25:3389-3402. Query= BP920367|Adiantum capillus-veneris mRNA, clone: YMU001_000136

  1. AcEST: BP913674 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A05 472 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A05. BP913674 - Show BP91367...is mRNA. clone: YMU001_000033_A05. Accession BP913674 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP913674|Adiantum capillus-veneris mRNA, cl...rams, Nucleic Acids Res. 25:3389-3402. Query= BP913674|Adiantum capillus-veneris mRNA, clone: YMU001_000033_

  2. AcEST: BP913672 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A03 488 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A03. BP913672 - Show BP91367...is mRNA. clone: YMU001_000033_A03. Accession BP913672 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913672|Adiantum cap...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913672|Adiantum capillus-

  3. AcEST: BP913678 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A10 511 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A10. BP913678 - Show BP91367...is mRNA. clone: YMU001_000033_A10. Accession BP913678 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP913678|Adiantum capillus-veneris mRNA, clone: YMU001_000033_A10. (511 l...s Res. 25:3389-3402. Query= BP913678|Adiantum capillus-veneris mRNA, clone: YMU001_000033_A10. (511 letters)

  4. AcEST: BP918367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_F09 563 Adiantum capillus-veneris mRNA. clone: YMU001_000112_F09. BP918367 - Show BP918367...is mRNA. clone: YMU001_000112_F09. Accession BP918367 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP918367|Adiantum capillus-veneris mRNA, clone: YMU001_000112_F09. (5...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918367|Adiantum capillus-veneris

  5. AcEST: BP912343 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A05 305 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A05. BP912343 - Show BP91234...is mRNA. clone: YMU001_000018_A05. Accession BP912343 Tissue type prothallium Developmental stage - Contig I... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91234...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912343|Adiantum capill

  6. AcEST: BP912346 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A08 453 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A08. BP912346 - Show BP91234...is mRNA. clone: YMU001_000018_A08. Accession BP912346 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP912346|Adiantum capillus-veneris mRNA, clone...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91234

  7. AcEST: BP921234 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_C09 556 Adiantum capillus-veneris mRNA. clone: YMU001_000147_C09. BP921234... CL2723Contig1 Show BP921234 Clone id YMU001_000147_C09 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000147_C09. Accession BP921234 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921234|Adiantum capillus-veneris mRNA, ...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921234|A

  8. AcEST: BP912344 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A06 486 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A06. BP91234...4 CL599Contig1 Show BP912344 Clone id YMU001_000018_A06 Library YMU01 Length 486 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000018_A06. Accession BP912344 Tissue type prothallium Developmental stage... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912344|Adiantum capil...leic Acids Res. 25:3389-3402. Query= BP912344|Adiantum capillus-veneris mRNA, clone: YMU001_000018_A06. (468

  9. AcEST: BP912340 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A02 465 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A02. BP91234...0 CL1330Contig1 Show BP912340 Clone id YMU001_000018_A02 Library YMU01 Length 465 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_A02. Accession BP912340 Tissue type prothallium Developmental stag...Nucleic Acids Res. 25:3389-3402. Query= BP912340|Adiantum capillus-veneris mRNA, ...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91234

  10. AcEST: BP912349 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A11 539 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A11. BP912349 - Show BP91234...is mRNA. clone: YMU001_000018_A11. Accession BP912349 Tissue type prothallium Developmental stage - Contig I... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91234...ucleic Acids Res. 25:3389-3402. Query= BP912349|Adiantum capillus-veneris mRNA, clone: YMU001_000018_A11. (5

  11. AcEST: BP912342 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A04 553 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A04. BP91234...2 CL2124Contig1 Show BP912342 Clone id YMU001_000018_A04 Library YMU01 Length 553 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_A04. Accession BP912342 Tissue type prothallium Developmental stag...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912342|Adiantum capillus-veneris mRNA, clone:...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912342|Adiantum capillus-

  12. AcEST: BP920120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C05 434 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C05. BP920120 - Show BP92012...is mRNA. clone: YMU001_000133_C05. Accession BP920120 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920120|Ad...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920120|

  13. AcEST: BP920124 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C09 380 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C09. BP920124 - Show BP92012...is mRNA. clone: YMU001_000133_C09. Accession BP920124 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920124|Adiantum capillus-veneris ...ic Acids Res. 25:3389-3402. Query= BP920124|Adiantum capillus-veneris mRNA, clone: YMU001_000133_C09. (380 l

  14. AcEST: BP920127 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_D02 541 Adiantum capillus-veneris mRNA. clone: YMU001_000133_D02. BP92012...7 CL3843Contig1 Show BP920127 Clone id YMU001_000133_D02 Library YMU01 Length 541 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_D02. Accession BP920127 Tissue type prothallium Developmental stag...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920127|Adiantum capillus-ve... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920127|Adian

  15. AcEST: BP920125 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C12 422 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C12. BP920125 - Show BP92012...is mRNA. clone: YMU001_000133_C12. Accession BP920125 Tissue type prothallium Developmental stage - Contig I...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92012...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92012

  16. AcEST: BP920121 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C06. BP920121 - Show BP92012...is mRNA. clone: YMU001_000133_C06. Accession BP920121 Tissue type prothallium Developmental stage - Contig I...ds Res. 25:3389-3402. Query= BP920121|Adiantum capillus-veneris mRNA, clone: YMU001_000133_C06. (542 letters...Res. 25:3389-3402. Query= BP920121|Adiantum capillus-veneris mRNA, clone: YMU001_000133_C06. (542 letters) D

  17. AcEST: BP912012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP912012... CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912012

  18. AcEST: BP920129 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_D04 550 Adiantum capillus-veneris mRNA. clone: YMU001_000133_D04. BP92012...9 CL1276Contig1 Show BP920129 Clone id YMU001_000133_D04 Library YMU01 Length 550 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_D04. Accession BP920129 Tissue type prothallium Developmental stag...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920129|Adiantum capillus-ve...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920129|Adiantum capillus-vener

  19. Lead-free primary explosives

    Science.gov (United States)

    Huynh, My Hang V.

    2010-06-22

    Lead-free primary explosives of the formula (cat).sub.Y[M.sup.II(T).sub.X(H.sub.2O).sub.6-X].sub.Z, where T is 5-nitrotetrazolate, and syntheses thereof are described. Substantially stoichiometric equivalents of the reactants lead to high yields of pure compositions thereby avoiding dangerous purification steps.

  20. Explosion mitigation by water mist

    NARCIS (Netherlands)

    Wal, R. van der; Cargill, S.; Longbottom, A.; Rhijnsburger, M.P.M.; Erkel, A.G. van

    2010-01-01

    The internal explosion of an anti-ship missile or stored ammunition is a potentially catastrophic threat for a navy vessel. These events generally cause heavy blast loading and fragments to perforate the ship structure. As a solution to reduce the blast loading, the compartment can be filled with wa

  1. Explosion-proof scintillation counter

    International Nuclear Information System (INIS)

    It is noted that measuring devices used in the research works conducted with the help of radioactive isotopes on the chemical industry installations dangerous from the point of view of explosions, especially on the installations of the petrochemistry industry, must not limit the exploitation safety of these installations. The said especially concerns with the Geiger-Mueller type counters and scintillation detectors, located immediately in the places of measurements on the installations and supplied by high voltage power supply. It has been shown that electronic circuits for the detector's signals processing and obtaining working voltages can be located out of the explosive dangerous premices, for example, in the car trailer. Description is given of the device, with the help of which explosion safety is provided for the serially produced scintillation counter with forced ventilation (counter of the VA-S-50 type). Due to this device application, the exploitation parameters of the counter do not go down and there is no need for any changes in its design. Description is given of the device for external power supply and control of the counter which can swich off the power supply in the case of an accident, dangerous from the point of view of violation of the explosion safety conditions. The device is described for providing service to 10 measuring chanels, mounted on the car trailer

  2. Experimental approach to explosive nucleosynthesis

    International Nuclear Information System (INIS)

    Recent development of experimental studies on explosive nucleosynthesis, especially the rapid proton process and the primordial nucleosynthesis were discussed with a stress on unstable nuclei. New development in the experimental methods for the nuclear astrophysics is also discussed which use unstable nuclear beams. (author)

  3. Excavation research with chemical explosives

    International Nuclear Information System (INIS)

    The US Army Engineer Nuclear Cratering Group (NCG) is located at the Lawrence Radiation Laboratory in Livermore, California. NCG was established in 1962 and assigned responsibility for technical program direction of the Corps of Engineers Nuclear Excavation Research Program. The major part of the experimental program has been the execution of chemical explosive excavation experiments. In the past these experiments were preliminary to planned nuclear excavation experiments. The experience gained and technology developed in accomplishing these experiments has led to an expansion of NCG's research mission. The overall research and development mission now includes the development of chemical explosive excavation technology to enable the Corps of Engineers to more economically accomplish Civil Works Construction projects of intermediate size. The current and future chemical explosive excavation experiments conducted by NCG will be planned so as to provide data that can be used in the development of both chemical and nuclear excavation technology. In addition, whenever possible, the experiments will be conducted at the specific sites of authorized Civil Works Construction Projects and will be designed to provide a useful portion of the engineering structures planned in that project. Currently, the emphasis in the chemical explosive excavation program is on the development of design techniques for producing specific crater geometries in a variety of media. Preliminary results of two such experiments are described in this paper; Project Pre-GONDOLA III, Phase III, Reservoir Connection Experiment; and a Safety Calibration Series for Project TUGBOAT, a small boat harbor excavation experiment

  4. Turbulent Combustion in SDF Explosions

    Energy Technology Data Exchange (ETDEWEB)

    Kuhl, A L; Bell, J B; Beckner, V E

    2009-11-12

    A heterogeneous continuum model is proposed to describe the dispersion and combustion of an aluminum particle cloud in an explosion. It combines the gas-dynamic conservation laws for the gas phase with a continuum model for the dispersed phase, as formulated by Nigmatulin. Inter-phase mass, momentum and energy exchange are prescribed by phenomenological models. It incorporates a combustion model based on the mass conservation laws for fuel, air and products; source/sink terms are treated in the fast-chemistry limit appropriate for such gasdynamic fields, along with a model for mass transfer from the particle phase to the gas. The model takes into account both the afterburning of the detonation products of the C-4 booster with air, and the combustion of the Al particles with air. The model equations were integrated by high-order Godunov schemes for both the gas and particle phases. Numerical simulations of the explosion fields from 1.5-g Shock-Dispersed-Fuel (SDF) charge in a 6.6 liter calorimeter were used to validate the combustion model. Then the model was applied to 10-kg Al-SDF explosions in a an unconfined height-of-burst explosion. Computed pressure histories are compared with measured waveforms. Differences are caused by physical-chemical kinetic effects of particle combustion which induce ignition delays in the initial reactive blast wave and quenching of reactions at late times. Current simulations give initial insights into such modeling issues.

  5. Underground nuclear explosions and earthquakes

    International Nuclear Information System (INIS)

    The stages that have marked the ways towards the interdiction of nuclear tests are reviewed. Although seismographic equipments have been greatly improved, it is shown that a separate detection of underground nuclear explosions from natural seismic vibrations is still quite uneasy. The use of nuclear loads for civil engineering still makes it more complicate to apply a treatee of interdiction of nuclear tests

  6. Episodic Explosions in Interstellar Ices

    CERN Document Server

    Rawlings, J M C; Viti, S; Cecchi-Pestellini, C

    2013-01-01

    We present a model for the formation of large organic molecules in dark clouds. The molecules are produced in the high density gas-phase that exists immediately after ice mantles are explosively sublimated. The explosions are initiated by the catastrophic recombination of trapped atomic hydrogen. We propose that, in molecular clouds, the processes of freeze-out onto ice mantles, accumulation of radicals, explosion and then rapid (three-body) gas-phase chemistry occurs in a cyclic fashion. This can lead to a cumulative molecular enrichment of the interstellar medium. A model of the time-dependent chemistries, based on this hypothesis, shows that significant abundances of large molecular species can be formed, although the complexity of the species is limited by the short expansion timescale in the gas, immediately following mantle explosion. We find that this mechanism may be an important source of smaller organic species, such as methanol and formaldehyde, as well as precursors to bio-molecule formation. Most...

  7. Statistical estimation of loads from gas explosions

    OpenAIRE

    Høiset, Stian

    1998-01-01

    In the design of structures in the offshore and process industries, the possibility of a gas explosion must always be considered. This is usually incorporated by performing explosion simulations. However, estimations based on such calculations introduce uncertainties in the design process. The main uncertainties in explosion simulations are the assumption of the gas cloud,the location of the ignition point and the properties of the explosion simulator itself. In this thesis, we try to investi...

  8. 14 CFR 420.63 - Explosive siting.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Explosive siting. 420.63 Section 420.63... TRANSPORTATION LICENSING LICENSE TO OPERATE A LAUNCH SITE Responsibilities of a Licensee § 420.63 Explosive... the configuration of the launch site is in accordance with an explosive site plan, and that...

  9. 46 CFR 188.10-25 - Explosive.

    Science.gov (United States)

    2010-10-01

    ... release of gas and heat. Explosives are discussed in more detail in 49 CFR parts 171-179. ... 46 Shipping 7 2010-10-01 2010-10-01 false Explosive. 188.10-25 Section 188.10-25 Shipping COAST... Definition of Terms Used in This Subchapter § 188.10-25 Explosive. This term means a chemical compound...

  10. 33 CFR 401.67 - Explosive vessels.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Explosive vessels. 401.67 Section... TRANSPORTATION SEAWAY REGULATIONS AND RULES Regulations Dangerous Cargo § 401.67 Explosive vessels. A vessel carrying explosives, either Government or commercial, as defined in the Dangerous Cargo Act of the...

  11. Numerical computation algorithm of explosion equations and thermodynamics parameters of mine explosives

    Institute of Scientific and Technical Information of China (English)

    李守巨; 刘迎曦; 何翔; 周圆π

    2001-01-01

    A new numerical algorithm is presented to simulate the explosion reaction process of mine explosives based on the equation of state, the equation of mass conservation and thermodynamics balance equation of explosion products. With the affection of reversible reaction of explosion products to explosion reaction equations and thermodynamics parameters considered, the computer program has been developed. The computation values show that computer simulation results are identical with the testinq ones.

  12. Numerical computation algorithm of explosion equations and thermodynamics parameters of mine explosives

    Institute of Scientific and Technical Information of China (English)

    LI Shou-ju; LIU Ying-xi; HE Xiang; ZHOU Y uan-pai

    2001-01-01

    A new numerical algorithm is presented to simulate the explosion reacti on process of mine explosives based on the equation of state, the equation of ma ss conservation and thermodynamics balance equation of explosion products. With the affection of reversible reaction of explosion products to explosion reaction equations and thermodynamics parameters considered, the computer program has be en developed. The computation values show that computer simulation results are i dentical with the testing ones.

  13. 27 CFR 555.205 - Movement of explosive materials.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Movement of explosive..., FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Storage § 555.205 Movement of explosive materials. All explosive materials must be kept in locked magazines meeting...

  14. 27 CFR 555.32 - Special explosive devices.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Special explosive devices..., AND EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Administrative and Miscellaneous Provisions § 555.32 Special explosive devices. The Director may exempt certain explosive...

  15. Fast neutron activation measurement of concealed explosives

    International Nuclear Information System (INIS)

    Spectra of 0.511 MeV γ-ray of nitrogen and 6.13 MeV γ-ray of oxygen and their ratio are measured by using two neutron sourses of different yield for explosive or non-explosive materials. Sensitivity and detecting speed are determined. A planar distribution of the explosive or non-explosive materials with different contents of nitrogen and oxygen is given. The whole design and security of detection method of fast neutron activation analysis system is discussed for concealed explosives

  16. Forensic recovery of transient eruption parameters for the 2360 BP fall deposit, Mount Meager, British Columbia

    Science.gov (United States)

    Campbell, Michelle E.; Porritt, Lucy; Russell, J. K.

    2016-02-01

    The 2360 BP eruption of Mount Meager, Canada featured an explosive subplinian onset resulting in dacitic fallout tephra and associated pumiceous pyroclastic flow deposits, followed by the effusion of dacite lava and the deposition of a thick sequence of block and ash flow deposits. Fall deposits are distributed to the NE of the vent onto a rugged, deeply incised landscape. The central axis of deposition is ~ 063° Az; the lateral margins of the fall deposit are massive to unbedded whereas deposits underlying the plume axis feature complex bedding relationships. We present componentry and granulometry data for eight outcroppings of the fall deposit (four on plume axis and four off plume axis). Vertical cross-sections, based on surface outcrops and drill core logs from local commercial drilling programs, are used to relate the accessory lithics to their source depth in the underlying subvolcanic basement. These combined datasets inform on the dynamics of this explosive phase of the eruption including variations in column height, eruption intensity, atmospheric conditions, and depth to fragmentation front. The lateral variations within the fall strata reflect the effects of the prevailing atmospheric conditions on the form and dispersal pattern of the subplinian plume. Vertical variations in granulometry and componentry of the fall deposits are used to track temporal changes in eruption intensity and column height and the transient influence of the jetstream on the dispersal pattern of the plume. Lastly, vertical variations in lithic componentry, combined with our knowledge of the subsurface geology, are used to quantitatively track the deepening of the fragmentation front. Our computed results show that the fragmentation front migrated from ~ 640 m to ~ 1160 m below the vent over the course of the 2360 BP Mount Meager eruption.

  17. Spot test kit for explosives detection

    Energy Technology Data Exchange (ETDEWEB)

    Pagoria, Philip F; Whipple, Richard E; Nunes, Peter J; Eckels, Joel Del; Reynolds, John G; Miles, Robin R; Chiarappa-Zucca, Marina L

    2014-03-11

    An explosion tester system comprising a body, a lateral flow membrane swab unit adapted to be removeably connected to the body, a first explosives detecting reagent, a first reagent holder and dispenser operatively connected to the body, the first reagent holder and dispenser containing the first explosives detecting reagent and positioned to deliver the first explosives detecting reagent to the lateral flow membrane swab unit when the lateral flow membrane swab unit is connected to the body, a second explosives detecting reagent, and a second reagent holder and dispenser operatively connected to the body, the second reagent holder and dispenser containing the second explosives detecting reagent and positioned to deliver the second explosives detecting reagent to the lateral flow membrane swab unit when the lateral flow membrane swab unit is connected to the body.

  18. Hazards of explosives dusts: Particle size effects

    Energy Technology Data Exchange (ETDEWEB)

    Cashdollar, K L; Hertzberg, M; Green, G M

    1992-02-01

    At the request of the Department of Energy, the Bureau of Mines has investigated the hazards of military explosives dispersed as dust clouds in a 20-L test chamber. In this report, the effect of particle size for HMX, HNS, RDX, TATB, and TNT explosives dusts is studied in detail. The explosibility data for these dusts are also compared to those for pure fuel dusts. The data show that all of the sizes of the explosives dusts that were studied were capable of sustaining explosions as dust clouds dispersed in air. The finest sizes (<10 [mu]m) of explosives dusts were less reactive than the intermediate sizes (20 to 60 [mu]m); this is opposite to the particle size effect observed previously for the pure fuel dusts. At the largest sizes studied, the explosives dusts become somewhat less reactive as dispersed dust clouds. The six sizes of the HMX dust were also studied as dust clouds dispersed in nitrogen.

  19. AcEST: BP921774 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_A05 442 Adiantum capillus-veneris mRNA. clone: YMU001_000154_A05. BP921774 - Show BP92177...is mRNA. clone: YMU001_000154_A05. Accession BP921774 Tissue type prothallium Developmental stage - Contig I...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25...: 414 TDILNAQTVSLSNDTIAIKDKADEKIIFLFEASTGKPLGDGKLLSHKNEISEVALDQKGL 473 Query: 177 IADRMLIFIDSNNDLYIACIVK----...bjct: 414 TDILNAQTVSLSNDTIAIKDKADEKIIFLFEASTGKPLGDGKLLSHKNEISEIALDQKGL 473 Query: 177 IADRMLIFIDSNNDLYIACIVK

  20. Underwater explosions and cavitation phenomena

    Energy Technology Data Exchange (ETDEWEB)

    Kamegai, M.

    1979-08-28

    Some aspects of underwater explosions and cavitation phenomena have been studied by using a thermodynamic equation of state for water and a one-dimensional Lagrangian hydrocode. The study showed that surface cavitation is caused by the main blast wave and a bubble pulse from rebound of a release wave moving toward the center of the exploding bubble. Gravity has little effect on the surface cavitation. In nuclear explosions the bubble is bounded by a two-phase region rather than a gas-water interface. The two-phase region cavitates as the bubble expands, changing the optical absorption coefficient by many orders of magnitude and significantly affecting the optical signature. In assessing cavitation damage, it is concluded that a water jet of unstable bubble collapse erodes solid walls. The study leads to suggestions for future research.

  1. Underwater explosions and cavitation phenomena

    International Nuclear Information System (INIS)

    Some aspects of underwater explosions and cavitation phenomena have been studied by using a thermodynamic equation of state for water and a one-dimensional Lagrangian hydrocode. The study showed that surface cavitation is caused by the main blast wave and a bubble pulse from rebound of a release wave moving toward the center of the exploding bubble. Gravity has little effect on the surface cavitation. In nuclear explosions the bubble is bounded by a two-phase region rather than a gas-water interface. The two-phase region cavitates as the bubble expands, changing the optical absorption coefficient by many orders of magnitude and significantly affecting the optical signature. In assessing cavitation damage, it is concluded that a water jet of unstable bubble collapse erodes solid walls. The study leads to suggestions for future research

  2. Waves from an underground explosion

    Science.gov (United States)

    Krymskii, A. V.; Lyakhov, G. M.

    1984-05-01

    The problem of the propagation of a spherical detonation wave in water-saturated soil was solved in [1, 2] by using a model of a liquid porous multicomponent medium with bulk viscosity. Experiments show that soils which are not water saturated are solid porous multicomponent media having a viscosity, nonlinear bulk compression limit diagrams, and irreversible deformations. Taking account of these properties, and using the model in [2], we have solved the problem of the propagation of a spherical detonation wave from an underground explosion. The solution was obtained by computer, using the finite difference method [3]. The basic wave parameters were determined at various distances from the site of the explosion. The values obtained are in good agreement with experiment. Models of soils as viscous media which take account of the dependence of deformations on the rate of loading were proposed in [4 7] also. In [8] a model was proposed corresponding to a liquid multicomponent medium with a variable viscosity.

  3. AcEST: BP917704 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_D07 615 Adiantum capillus-veneris mRNA. clone: YMU001_000104_D07. BP9177...04 CL3815Contig1 Show BP917704 Clone id YMU001_000104_D07 Library YMU01 Length 615 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_D07. Accession BP917704 Tissue type prothallium Developmental stag... 25:3389-3402. Query= BP917704|Adiantum capillus-veneris mRNA, clone: YMU001_000104_D07. (568 letters) Datab...C---SICKGYLIDATTITECLHTFCKSCIVRHFY--YSNRCPKCNIVV 177 Query: 374 GGS-PLEKLRADRQLDEVCAKI 312 + PL +R DRQL ++ K

  4. AcEST: BP917755 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A07 465 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A07. BP9177...55 CL1516Contig1 Show BP917755 Clone id YMU001_000105_A07 Library YMU01 Length 465 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_A07. Accession BP917755 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917755|Adia...K+ L+ + +R+ +EC+ ++A LI +D R G + T Sbjct: 129 IEGEGSQKKKLRLISSLF---LRASPIECR--------YLARLILEDMRIGMNVPTILDA 177

  5. AcEST: BP914177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_H06 551 Adiantum capillus-veneris mRNA. clone: YMU001_000042_H06. BP914177... CL2231Contig1 Show BP914177 Clone id YMU001_000042_H06 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000042_H06. Accession BP914177 Tissue type prothallium Developmental stag...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914177...+H AAA GH + + LL R E+D +PLH AA NGH Q E L+ Sbjct: 531 EGYNSIHYAAAYGHRQCLELLLERTNTGFEESDGGALKSPLHLAAYNGHHQALEVLLQSL 590 Query: 177

  6. AcEST: BP917707 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_D10 539 Adiantum capillus-veneris mRNA. clone: YMU001_000104_D10. BP9177...07 CL598Contig1 Show BP917707 Clone id YMU001_000104_D10 Library YMU01 Length 539 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000104_D10. Accession BP917707 Tissue type prothallium Developmental stage...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917707|Adiantum capillus-...AEEFILNMPIKPDDVIWKALL 450 Query: 332 GACRLHCHVELAEYAFEQIMKFQPQWAAPYVLMSNMYADKLQNFAELAELHI 177 GACR+ +VE+ + +

  7. AcEST: BP917714 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E06 519 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E06. BP9177...14 CL2848Contig1 Show BP917714 Clone id YMU001_000104_E06 Library YMU01 Length 519 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_E06. Accession BP917714 Tissue type prothallium Developmental stag...s, Nucleic Acids Res. 25:3389-3402. Query= BP917714|Adiantum capillus-veneris mRNA, clone: YMU001_000104_E06...+ Q+ P Sbjct: 79 ELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEDVRQSVTP 138 Query: 177

  8. AcEST: BP917791 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_E05 415 Adiantum capillus-veneris mRNA. clone: YMU001_000105_E05. BP9177...91 CL2548Contig1 Show BP917791 Clone id YMU001_000105_E05 Library YMU01 Length 415 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_E05. Accession BP917791 Tissue type prothallium Developmental stag...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917791|Adian....9 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 242 QPKEILACFLAGCLPPTSGSFS 177 Q KEI+

  9. AcEST: BP921777 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_A08 476 Adiantum capillus-veneris mRNA. clone: YMU001_000154_A08. BP921777 - Show BP92177...is mRNA. clone: YMU001_000154_A08. Accession BP921777 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921777|Adia...= +1 Query: 37 HYPDQHPKWAHTPTSHLDTKTTHQMEERRHRPKCQHACHRQHNQNHPKVNNSSRQSSTSP 216 H P QHP H P + + H H H H+ +HP V ++ + P Sbjct: 177... +P HP +H+ + +H TT Q ++++ H H H QH+ + Sbjct: 720 HSHPQHPHSHPHQSHSHSHAHSQPTTTVQPQQQQQHSLSTVVHPHNATPSHHHHHQHSHS 779 Query: 172 HP 177

  10. AcEST: BP918101 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_F02 520 Adiantum capillus-veneris mRNA. clone: YMU001_000109_F02. BP918101 - Show BP918101...is mRNA. clone: YMU001_000109_F02. Accession BP918101 Tissue type prothallium Developmental stage - Contig I...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918101...(329), Expect = 2e-30 Identities = 65/161 (40%), Positives = 101/161 (62%), Gaps = 3/161 (1%) Frame = -3 Que...s = 64/161 (39%), Positives = 101/161 (62%), Gaps = 3/161 (1%) Frame = -3 Query:

  11. AcEST: BP918187 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E08 530 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E08. BP91818...7 CL1163Contig1 Show BP918187 Clone id YMU001_000110_E08 Library YMU01 Length 530 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000110_E08. Accession BP918187 Tissue type prothallium Developmental stag...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91818...jct: 486 DSRTQIVENLLRGTRHEITDHNLEKIRRLTDGY 518 Score = 27.3 bits (59), Expect(2) = 5e-34 Identities = 10/21

  12. AcEST: BP911818 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_E07 537 Adiantum capillus-veneris mRNA. clone: YMU001_000009_E07. BP911818... CL3769Contig1 Show BP911818 Clone id YMU001_000009_E07 Library YMU01 Length 537 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000009_E07. Accession BP911818 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911818|Adiantum c...MQ1|PP376_ARATH Pentatricopeptide repeat-containing protei... 47 6e-05 sp|Q9SFV9|PP218_ARATH Pentatricopepti

  13. AcEST: BP918188 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E09 493 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E09. BP91818...8 CL1036Contig1 Show BP918188 Clone id YMU001_000110_E09 Library YMU01 Length 493 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000110_E09. Accession BP918188 Tissue type prothallium Developmental stag...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP918188|Adiantum capillus-veneris mRNA, clone: YMU001_000110_E09. (493 letters) Databa

  14. AcEST: BP918118 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_G07 522 Adiantum capillus-veneris mRNA. clone: YMU001_000109_G07. BP918118... CL74Contig1 Show BP918118 Clone id YMU001_000109_G07 Library YMU01 Length 522 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000109_G07. Accession BP918118 Tissue type prothallium Developmental stage ... Res. 25:3389-3402. Query= BP918118|Adiantum capillus-veneris mRNA, clone: YMU001_000109_G07. (522 letters) ...P-RRSGAVLSWNARFQ 470 Query: 170 VALGTARGLAYLHEECPKPILHFDVKPQNILLDGNLDAKLADFGLAKLVAR 18

  15. AcEST: BP918182 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E03. BP918182 - Show BP91818...is mRNA. clone: YMU001_000110_E03. Accession BP918182 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918... protei... 140 4e-33 sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protei... 139 6e-33 sp|P93011|PP18...RPTDARRVFDEMDVRDSVSYNT 278 Query: 314 IIXXXXXXXXXXXALQLFHEMQKKCVKPDEVTYITVLNACSH 18

  16. AcEST: BP918418 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C06 558 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C06. BP918418... CL2832Contig1 Show BP918418 Clone id YMU001_000113_C06 Library YMU01 Length 558 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_C06. Accession BP918418 Tissue type prothallium Developmental stag...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918418|Adiantum capillus-veneris mRNA, clone:...2 Length = 1243 Score = 30.4 bits (67), Expect = 6.1 Identities = 18/58 (31%), Po

  17. AcEST: BP918318 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B03 534 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B03. BP918318 - Show BP918318...is mRNA. clone: YMU001_000112_B03. Accession BP918318 Tissue type prothallium Developmental stage - Contig I...leic Acids Res. 25:3389-3402. Query= BP918318|Adiantum capillus-veneris mRNA, clone: YMU001_000112_B03. (534... protein 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL 181) GN=dc... + N++K + D S ++ Sbjct: 138 QLVFHK-------GKILVLLPGPPQELEPMLNNAL----NEIKPQPDLSTLSMLFFSIPE 186 Query: 459 LFLD

  18. AcEST: BP918189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E11 450 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E11. BP91818...9 CL495Contig1 Show BP918189 Clone id YMU001_000110_E11 Library YMU01 Length 450 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000110_E11. Accession BP918189 Tissue type prothallium Developmental stage...cleic Acids Res. 25:3389-3402. Query= BP918189|Adiantum capillus-veneris mRNA, cl...QQPMEQSRKEKIKSILRLLRGVIP 186 YG+ T + C ++++ NN + Q S + ++K+K ++ +LR ++P Sbjct: 158 YGNTTAESCCSSYGYNNNNNNNSRK

  19. AcEST: BP921818 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_E07 485 Adiantum capillus-veneris mRNA. clone: YMU001_000154_E07. BP921818 - Show BP921818...is mRNA. clone: YMU001_000154_E07. Accession BP921818 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP921818|Adiantum capillus-ven...IM domain-containing protein A OS=Dictyostelium discoideum GN=limA PE=2 SV=1 Length = 1183 Score = 31.2 bits...CLLTICENRWLEWHHYYEFSFSIQNVRTSPLEL*LLSAQ 218 E + PIL +L I +N W+H+ + F + +V T + L LLS Q Sbjct: 58 ETYRYTPILAIL

  20. AcEST: BP918186 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E07 514 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E07. BP918186 - Show BP91818...is mRNA. clone: YMU001_000110_E07. Accession BP918186 Tissue type prothallium Developmental stage - Contig I... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91818...s (75), Expect = 0.60 Identities = 21/69 (30%), Positives = 31/69 (44%) Frame = +2 Query: 185 TAEEGEPASVVLGL.../59 (33%), Positives = 31/59 (52%) Frame = -2 Query: 363 SKTSS*PSKAPCQIQFPSMPSGSFIFTAASPSSHFARGLPFVNLQSSPSTTDAGSPSSA 18

  1. PetroChina and BP Launch Retail Venture in Guangdong

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    @@ PetroChina and BP launched a gas station business joint venture in South China's Guangdong Province on November 18, marking a further move in BP's foray into China's booming oil fuel retail market. The joint venture will operate a retail network of 500 petrol stations in the province. Called "PetroChina-BP Petroleum Co Ltd" and registered in Jiangmen City of Guangdong Province, the venture is set up as a result of a memorandum of understanding reached with BP's acquisition of 20 percent of the listed shares from PetroChina's global initial public offering as the sole strategic investor in 2000.

  2. AcEST: BP917754 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A06 425 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A06. BP91775...4 CL28Contig1 Show BP917754 Clone id YMU001_000105_A06 Library YMU01 Length 425 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000105_A06. Accession BP917754 Tissue type prothallium Developmental stage ...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91775...H R H + S SERR + Sbjct: 1722 ARRSHRSPSERSHHSPSERSHHSPSERRHHSPSERSHCSPSERSHCSPSERRHR 1775 >sp|Q9JIG7|CCD22_MO

  3. AcEST: BP913673 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A04 543 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A04. BP91367...3 CL2745Contig1 Show BP913673 Clone id YMU001_000033_A04 Library YMU01 Length 543 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000033_A04. Accession BP913673 Tissue type prothallium Developmental stag...s, Nucleic Acids Res. 25:3389-3402. Query= BP913673|Adiantum capillus-veneris mRNA, clone: YMU001_000033_A04... +VKL +++KL + A F+ + I F + + D ++ W+ + ++ FW Sbjct: 367 QRQIVKLNMYKKLLYIIYASFLSVLAGSIVSSFIYVGMNTIDMIEKNWRSRF

  4. AcEST: BP920648 [AcEST

    Lifescience Database Archive (English)

    Full Text Available on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920648|Adiantu...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920648|Adiantum capillus-veneris ...YMU001_000139_G01 166 Adiantum capillus-veneris mRNA. clone: YMU001_000139_G01. BP920648 CL768Conti...g1 Show BP920648 Clone id YMU001_000139_G01 Library YMU01 Length 166 Definition Adiantum cap...on sp|Q5G872|SCUB2_DANRE Signal peptide, CUB and EGF-like domain-cont

  5. Explosive shielding by weak layers

    International Nuclear Information System (INIS)

    This paper presents the results of a series of computations which were carried out to determine the effect that a layer of extremely weak rock embedded in an otherwise strong rock matrix would have on the displacements and velocities which result from the detonation of a nearby explosive source. The motivation for the study was the apparently different measurements obtained on the Mission Cyber Nuclear Event when compared to results obtained from other events of equal yield in similar geologic media

  6. Nuclear explosions and their effects

    International Nuclear Information System (INIS)

    Nuclear weapons of all kinds and forms are a threat to mankind and earth due to the destruction, devastation and death resulting from them. The nuclear reactors and atomic power stations present in the world today will never be fully safe and secured, but it can be made safer in the future by constructing a new generation of nuclear reactors, relying on the auto security system. The article shows the different effects resulting from nuclear explosions. (author)

  7. Explosive Formulation Code Naming SOP

    Energy Technology Data Exchange (ETDEWEB)

    Martz, H. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2014-09-19

    The purpose of this SOP is to provide a procedure for giving individual HME formulations code names. A code name for an individual HME formulation consists of an explosive family code, given by the classified guide, followed by a dash, -, and a number. If the formulation requires preparation such as packing or aging, these add additional groups of symbols to the X-ray specimen name.

  8. Causes of the Cambrian Explosion.

    OpenAIRE

    Smith, M P; Harper, D.A.T.

    2013-01-01

    In the last decade, at least thirty individual hypotheses have been invoked to explain the Cambrian Explosion, ranging from starbursts in the Milky Way to intrinsic genomic reorganization and developmental patterning. It has been noted (1) that recent hypotheses fall into three categories: a) developmental/genetic, b) ecologic and c) abiotic environmental, with geochemical hypotheses forming an abundant and distinctive subset of the last. With a few notable exceptions, a significant majority ...

  9. Nuclear Explosions 1945-1998

    International Nuclear Information System (INIS)

    The main part of this report is a list of nuclear explosions conducted by the United States, the Soviet Union, the United Kingdom, France, China, India and Pakistan in 1945-98. The list includes all known nuclear test explosions and is compiled from a variety of sources including officially published information from the USA, Russia and France. The details given for each explosion (date, origin time, location, yield, type, etc.) are often compiled from more than one source because the individual sources do not give complete information. The report includes a short background to nuclear testing and provides brief information on the Comprehensive Nuclear-Test-Ban Treaty and the verification regime now being established to verify compliance with the treaty. It also summarizes nuclear testing country by country. The list should be used with some caution because its compilation from a variety of sources means that some of the data could be incorrect. This report is the result of cooperation between the Defence Research Establishment (FOA) and the Stockholm International Peace Research Institute (SIPRI)

  10. Thermodynamic States in Explosion Fields

    Energy Technology Data Exchange (ETDEWEB)

    Kuhl, A L

    2010-03-12

    We investigate the thermodynamic states occurring in explosion fields from condensed explosive charges. These states are often modeled with a Jones-Wilkins-Lee (JWL) function. However, the JWL function is not a Fundamental Equation of Thermodynamics, and therefore cannot give a complete specification of such states. We use the Cheetah code of Fried to study the loci of states of the expanded detonation products gases from C-4 charges, and their combustion products air. In the Le Chatelier Plane of specific-internal-energy versus temperature, these loci are fit with a Quadratic Model function u(T), which has been shown to be valid for T < 3,000 K and p < 1k-bar. This model is used to derive a Fundamental Equation u(v,s) for C-4. Given u(v,s), one can use Maxwell's Relations to derive all other thermodynamic functions, such as temperature: T(v,s), pressure: p(v,s), enthalpy: h(v,s), Gibbs free energy: g(v,s) and Helmholz free energy: f(v,s); these loci are displayed in figures for C-4. Such complete equations of state are needed for numerical simulations of blast waves from explosive charges, and their reflections from surfaces.

  11. Nuclear Explosions 1945-1998

    Energy Technology Data Exchange (ETDEWEB)

    Bergkvist, Nils-Olov; Ferm, Ragnhild

    2000-07-01

    The main part of this report is a list of nuclear explosions conducted by the United States, the Soviet Union, the United Kingdom, France, China, India and Pakistan in 1945-98. The list includes all known nuclear test explosions and is compiled from a variety of sources including officially published information from the USA, Russia and France. The details given for each explosion (date, origin time, location, yield, type, etc.) are often compiled from more than one source because the individual sources do not give complete information. The report includes a short background to nuclear testing and provides brief information on the Comprehensive Nuclear-Test-Ban Treaty and the verification regime now being established to verify compliance with the treaty. It also summarizes nuclear testing country by country. The list should be used with some caution because its compilation from a variety of sources means that some of the data could be incorrect. This report is the result of cooperation between the Defence Research Establishment (FOA) and the Stockholm International Peace Research Institute (SIPRI)

  12. Seismic discrimination of nuclear explosions

    International Nuclear Information System (INIS)

    The monitoring of underground nuclear explosions has been discussed for over 30 years in connection with verification of test ban treaties, and monitoring is also one of the basic ways to learn about nuclear weapons development in different countries. Explosion monitoring is thus an important technical exercise, occasionally attracting attention for high-level policymakers and generating front page news. The underlying issues here are related to the uses of nuclear weapons, their cost, and the strategic capabilities and vulnerabilities of the superpowers and other countries. Because these are some of the largest and most contentious questions of our time, arguments sometimes spill over from the policy arena into the technical subject of monitoring capability itself. As a side effect of the debate, geophysics (especially seismology) continues to be shaped by significant funding for research and development in verification/monitoring technologies. New funds at the level of about $30 million came into seismic monitoring programs in the United States in 1989. In this paper, the authors review the history of nuclear testing and test ban negotiations, introduce some basic terminology, give examples of detection capability, describe characteristics of different seismic sources and methods of explosion identification, and briefly review different evasion scenarios. The authors conclude with a summary statement of identification capability and its implication for future possibilities in verifying new nuclear testing limitations

  13. Fish kill from underwater explosions

    Science.gov (United States)

    Stuart, David J.

    1962-01-01

    The U.S. Geological Survey has used 23 different shotpoints during two seasons of field work in our seismic study of crustal structure in western United States. Without exception, it has been found that under-water shotpoints result in a more efficient conversion of explosive energy into seismic energy than do drilled-hole shotpoints. This experience, together with elimination of drilling costs, has led to the use of underwater shotpoints wherever possible. Three of the 23 shotpoints were in the Pacific Ocean, and for these we have no detailed information on the fish kill. Another six shotpoints were located in inland bodies of water. These are: * Soda Lake near Fallon, Nevada * Mono Lake near Lee Vining, California * Lake Mead near Boulder City, Nevada * Shasta Lake near Redding, California * C.J. Strike Reservoir near Bruneau, Idaho * Lucky Peak Reservoir near Boise, Idaho The 22 high-explosive charges, weighing a total of 95,100 pounds, that were fired in lakes containing fish life resulted in the known death of 2,413 game fish with a total weight of 759 pounds. The average mortality was 110 game fish or 34.5 pounds of game fish killed per average shot of 4,325 pounds of high-explosives.

  14. The impact of arithmetic representation on implementing MLP-BP on FPGAs: a study.

    Science.gov (United States)

    Savich, Antony W; Moussa, Medhat; Areibi, Shawki

    2007-01-01

    In this paper, arithmetic representations for implementing multilayer perceptrons trained using the error backpropagation algorithm (MLP-BP) neural networks on field-programmable gate arrays (FPGAs) are examined in detail. Both floating-point (FLP) and fixed-point (FXP) formats are studied and the effect of precision of representation and FPGA area requirements are considered. A generic very high-speed integrated circuit hardware description language (VHDL) program was developed to help experiment with a large number of formats and designs. The results show that an MLP-BP network uses less clock cycles and consumes less real estate when compiled in an FXP format, compared with a larger and slower functioning compilation in an FLP format with similar data representation width, in bits, or a similar precision and range. PMID:17278475

  15. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    Energy Technology Data Exchange (ETDEWEB)

    Gago-Ferrero, Pablo, E-mail: pablo.gago@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Badia-Fabregat, Marina, E-mail: marina.badia@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Olivares, Alba, E-mail: esalba.olivares@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Pina, Benjamin, E-mail: benjami.pina@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Blanquez, Paqui, E-mail: paqui.blanquez@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Vicent, Teresa, E-mail: teresa.vicent@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Caminal, Gloria, E-mail: gloria.caminal@uab.cat [Unitat de Biocatalisi Aplicada associada al IQAC (CSIC-UAB). Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Diaz-Cruz, M. Silvia, E-mail: silvia.diaz@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); and others

    2012-06-15

    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: Black-Right-Pointing-Pointer Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. Black-Right-Pointing-Pointer BP3 is not degraded under simulated sunlight. Black-Right-Pointing-Pointer Glycoconjugates have been identified as the main intermediate metabolites. Black-Right-Pointing-Pointer Decrease in endocrine activity

  16. Data base of chemical explosions in Kazakhstan

    Energy Technology Data Exchange (ETDEWEB)

    Demin, V.N. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Malahova, M.N. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Martysevich, P.N. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Mihaylova, N.N. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Nurmagambetov, A. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Kopnichev, Yu.F. D. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Edomin, V.I. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan)

    1996-12-01

    Within the bounds of this report, the following works were done: (1) Information about explosion quarries, located in Southern, Eastern and Northern Kasakstan was summarized. (2) The general information about seismicity of areas of location of explosion quarries was adduced. (3) The system of observation and seismic apparatus, recording the local earthquakes and quarry explosions at the territory of Kazakstan were described. (4) Data base of quarry explosions, that were carried out in Southern, Eastern and Northern Kazakstan during 1995 and first half of 1996 year was adduced. (5) Upon the data of registration of explosions in Southern Kazakstan the correlative dependences between power class of explosions and summary weight of charge were constructed. (6) Seismic records of quarry explosions were adduced. It is necessary to note, that the collection of data about quarry explosions in Kazakstan in present time is very difficult task. Organizations, that makes these explosions, are always suffering reorganizations and sometimes it is actually impossible to receive all the necessary information. Some quarries are situated in remote, almost inaccessible regions, and within the bounds of supplier financing not the every quarry was in success to visit. So the present data base upon the chemical explosions for 1995 is not full and in further it`s expansion is possible.

  17. EST Table: BP117714 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP117714 ce--0824 11/12/09 n.h 10/09/28 58 %/195 aa ref|XP_001987762.1| GH22093 [Drosophila grim ... gi|91079384|ref|XP_971392.1| PREDICTED: similar to jitterbug ... CG30092-PD [Tribolium castaneum] BP117714 ce-- ...

  18. EST Table: BP116696 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available f|XP_971592.1| PREDICTED: similar to pre-mRNA-splicing factor prp1 [Tribolium castaneum] BP116696 brS- ... ...BP116696 brS-0450 11/12/09 GO hit GO:0005622(intracellular)|GO:0006396(RNA processi

  19. EST Table: BP128000 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available a gi|91085759|ref|XP_974103.1| PREDICTED: similar to smap1 [Tribolium castaneum] BP128000 tesV ... ...BP128000 tesV0058 11/12/09 GO hit GO:0008060(ARF GTPase activator activity)|GO:0008

  20. EST Table: BP124713 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available mel|GB10445-PA 10/09/10 60 %/125 aa gi|91088399|ref|XP_972896.1| PREDICTED: similar to Rapgap1 CG34374-PF [Tribolium castaneum] BP124713 fbS2 ... ...BP124713 fbS20190 11/12/09 GO hit GO:0005096(GTPase activator activity)|GO:0005622(

  1. BP Cooperates with Chinese Partners for Clean Energy Research

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    @@ China's Academy of Sciences (CAS) and Tsinghua University held a seminar on clean energy at the Tsinghua-BP Clean Energy Research and Educational Center on November 12 to review the results achieved in the past year to implement the 10-year CAS-BP cooperative research project titled "Clean Energy for Future."

  2. BP Announces Withdrawal from West-to-East Gas Project

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    @@ On August 31, 2001, BP announced that BP would not participate in the bidding launched by PetroChina for the West-to-East gas transmission project,China's landmark project for West Development that is valued billions of US dollars.

  3. EST Table: BP120373 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP120373 ceN-2172 10/09/28 76 %/104 aa ref|XP_972469.2| PREDICTED: similar to sticks.../09/10 low homology 10/09/10 76 %/104 aa gi|189235128|ref|XP_972469.2| PREDICTED: similar to sticks and stones CG33141-PA [Tribolium castaneum] BP122133 ceN- ...

  4. AcEST: BP914154 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_E08 499 Adiantum capillus-veneris mRNA. clone: YMU001_000042_E08. BP914154 CL3257C ... ession BP914154 Tissue type prothallium Developmental s tage - Contig ID CL3257Contig1 Sequence CTGAAAAGTC ... DCYLRLGAMARDKGNFYEASDWFKE 556 Query: 295 ALRLEENNVDALS FRGNVELKADDWLKAKETFKAV-QQLTDGKDAYSLLALGN 450 AL++ + ...

  5. AcEST: BP915162 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_C04 522 Adiantum capillus-veneris mRNA. clone: YMU001_000067_C04. BP915162 - Show ... ession BP915162 Tissue type prothallium Developmental s tage - Contig ID - Sequence CAGACCAAAACCAGACTGAGCT ... Methanococcus thermoli... 65 3e-10 sp|Q9HN70|THSA_HALS A Thermosome subunit alpha OS=Halobacterium s... 65 ...

  6. AcEST: BP914755 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000062_E07 515 Adiantum capillus-veneris mRNA. clone: YMU001_000062_E07. BP914755 CL3257C ... ession BP914755 Tissue type prothallium Developmental s tage - Contig ID CL3257Contig1 Sequence GCCGCATACA ... DCYLRLGAMARDKGNFYEASDWFKE 556 Query: 281 ALRLEENNVDALS FRGNVELKADDWLKAKETFKAV-QQLTDGKDAYSLLALGNWNYYAAG 105 ...

  7. AcEST: BP919234 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_G03 570 Adiantum capillus-veneris mRNA. clone: YMU001_000122_G03. BP919234 - Show ... ession BP919234 Tissue type prothallium Developmental s tage - Contig ID - Sequence GCCTTCCTAAACTATCGTGTTT ... Query: 515 PSYRSQNFCLLQTRYYSHKVGYDLLLIY*ISSRSPLYVSIALS WS 381 PSY+S NF LQ + HK YD + Y I + L ++ALS ... S Sbjct: ...

  8. AcEST: BP913901 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000037_F04 523 Adiantum capillus-veneris mRNA. clone: YMU001_000037_F04. BP913901 - Show ... ession BP913901 Tissue type prothallium Developmental s tage - Contig ID - Sequence TTTTTTTTTTTTTTTTTTTAAA ... DTFGAFRSSTKEKSSLSEGRLPG--RRP 438 Query: 313 TQNANPVALS HSMAFQESS 257 ANP ALS ... S F ESS Sbjct: 439 ELQANPAALS ...

  9. Accord Ignition Diagnosis Based on Improved GA-BP

    Directory of Open Access Journals (Sweden)

    Tie Wang

    2013-09-01

    Full Text Available BP neural network as a kind of intelligent method is widely used in fault diagnosis, due to the single BP neural network’s error is big, GA algorithm is often used in optimizing BP neural network, but the standard GA algorithm’s searching efficiency is low and it is easy to fall into local convergence. According to the characters of Accord car ignition diagnosis and BP neural network, this article puts forward an improved scheme of the standard GA algorithm optimizing BP net, calculate and analyze different simulation results gotten by MATLAB program. Through calculation: the single BP neural network’s convergence step number is 101, the final mean square error is 0.000997167; the convergence step number that standard GA algorithm optimizes the BP neural net is 83, the final mean square error is 0.000142126; the convergence step number that GA algorithm improved optimizes the BP neural net is 73, the final mean square error is 0.000137508. By the comparison, the improved GA algorithm has a better search efficiency and it’s computation can avoid falling into a local convergence.

  10. Delivering aminopyridine ligands into cancer cells through conjugation to the cell-penetrating peptide BP16

    OpenAIRE

    Soler Vives, Marta; González-Bártulos, Marta; Figueras, Eduard; Massaguer i Vall-llovera, Anna; Feliu Soley, Lídia; Planas i Grabuleda, Marta; Ribas Salamaña, Xavi; Costas Salgueiro, Miquel

    2016-01-01

    Peptide conjugates incorporating the red-ox active ligands Me2PyTACN or (S,S')-BPBP at the N- or the C-terminus of the cell-penetrating peptide BP16 were synthesized (PyTACN-BP16 (BP341), BP16-PyTACN (BP342), BPBP-BP16 (BP343), and BP16-BPBP (BP344)). Metal binding peptides bearing at the N-terminus the ligand, an additional Lys and a β-Ala were also prepared (PyTACN-βAK-BP16 (BP345) and BPBP-βAK-BP16 (BP346)). Moreover, taking into account the clathrin-dependent endocytic mechanism of BP16, ...

  11. Biogeochemical Cycling

    Science.gov (United States)

    Bebout, Brad; Fonda, Mark (Technical Monitor)

    2002-01-01

    This lecture will introduce the concept of biogeochemical cycling. The roles of microbes in the cycling of nutrients, production and consumption of trace gases, and mineralization will be briefly introduced.

  12. Sulfur cycle

    Digital Repository Service at National Institute of Oceanography (India)

    LokaBharathi, P.A.

    Microbes, especially bacteria, play an important role in oxidative and reductive cycle of sulfur. The oxidative part of the cycle is mediated by photosynthetic bacteria in the presence of light energy and chemosynthetic forms in the absence of light...

  13. AcEST: BP920162 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G07 416 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G07. BP92016...2 CL2758Contig1 Show BP920162 Clone id YMU001_000133_G07 Library YMU01 Length 416 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_G07. Accession BP920162 Tissue type prothallium Developmental stag...s Res. 25:3389-3402. Query= BP920162|Adiantum capillus-veneris mRNA, clone: YMU00... 25:3389-3402. Query= BP920162|Adiantum capillus-veneris mRNA, clone: YMU001_000133_G07. (416 letters) Datab

  14. AcEST: BP917720 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_F01 351 Adiantum capillus-veneris mRNA. clone: YMU001_000104_F01. BP9177...20 CL1160Contig1 Show BP917720 Clone id YMU001_000104_F01 Library YMU01 Length 351 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_F01. Accession BP917720 Tissue type prothallium Developmental stag...c Acids Res. 25:3389-3402. Query= BP917720|Adiantum capillus-veneris mRNA, clone: YMU001_000104_F01. (351 le...eic Acids Res. 25:3389-3402. Query= BP917720|Adiantum capillus-veneris mRNA, clone: YMU001_000104_F01. (351

  15. AcEST: BP918177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_D10 560 Adiantum capillus-veneris mRNA. clone: YMU001_000110_D10. BP918177 - Show BP918177...is mRNA. clone: YMU001_000110_D10. Accession BP918177 Tissue type prothallium Developmental stage - Contig I...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP918177|Adiantum capillus-veneris mRNA, clone: YMU001_0001...o sapiens GN=... 31 4.7 sp|P17765|POLG_BYMV Genome polyprotein OS=Bean yellow mosaic vir... 31 4.7 sp|Q06248...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918177|Adiantum capillus-veneris mRNA, clone

  16. AcEST: BP911776 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_A10 541 Adiantum capillus-veneris mRNA. clone: YMU001_000009_A10. BP91177...6 CL3433Contig1 Show BP911776 Clone id YMU001_000009_A10 Library YMU01 Length 541 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000009_A10. Accession BP911776 Tissue type prothallium Developmental stag...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911776|Adiantum capillus-veneris mRNA, clone: ...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91177

  17. AcEST: BP917724 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_F05 279 Adiantum capillus-veneris mRNA. clone: YMU001_000104_F05. BP9177...24 CL1287Contig1 Show BP917724 Clone id YMU001_000104_F05 Library YMU01 Length 279 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_F05. Accession BP917724 Tissue type prothallium Developmental stag...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917724|Adian...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  18. AcEST: BP917738 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_G10 219 Adiantum capillus-veneris mRNA. clone: YMU001_000104_G10. BP9177...38 CL2559Contig1 Show BP917738 Clone id YMU001_000104_G10 Library YMU01 Length 219 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_G10. Accession BP917738 Tissue type prothallium Developmental stag...s Res. 25:3389-3402. Query= BP917738|Adiantum capillus-veneris mRNA, clone: YMU001_000104_G10. (219 letters)... Res. 25:3389-3402. Query= BP917738|Adiantum capillus-veneris mRNA, clone: YMU001

  19. AcEST: BP917723 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_F04 557 Adiantum capillus-veneris mRNA. clone: YMU001_000104_F04. BP9177...23 CL1134Contig1 Show BP917723 Clone id YMU001_000104_F04 Library YMU01 Length 557 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_F04. Accession BP917723 Tissue type prothallium Developmental stag...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP917723|Adiantum capillus-veneris mRNA, clone: YMU001_00010...s. 25:3389-3402. Query= BP917723|Adiantum capillus-veneris mRNA, clone: YMU001_000104_F04. (557 letters) Dat

  20. AcEST: BP917761 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_B04 422 Adiantum capillus-veneris mRNA. clone: YMU001_000105_B04. BP9177...61 CL1598Contig1 Show BP917761 Clone id YMU001_000105_B04 Library YMU01 Length 422 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_B04. Accession BP917761 Tissue type prothallium Developmental stag...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917761|Adiantum capillus-vener

  1. AcEST: BP917772 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_C04 317 Adiantum capillus-veneris mRNA. clone: YMU001_000105_C04. BP9177...72 CL2826Contig1 Show BP917772 Clone id YMU001_000105_C04 Library YMU01 Length 317 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_C04. Accession BP917772 Tissue type prothallium Developmental stag... Acids Res. 25:3389-3402. Query= BP917772|Adiantum capillus-veneris mRNA, clone: YMU001_000105_C04. (317 let...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  2. AcEST: BP917731 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_G01 113 Adiantum capillus-veneris mRNA. clone: YMU001_000104_G01. BP9177...31 CL2673Contig1 Show BP917731 Clone id YMU001_000104_G01 Library YMU01 Length 113 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_G01. Accession BP917731 Tissue type prothallium Developmental stag...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917731|Adiantum capill

  3. AcEST: BP917719 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E12 452 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E12. BP9177...19 CL1406Contig1 Show BP917719 Clone id YMU001_000104_E12 Library YMU01 Length 452 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_E12. Accession BP917719 Tissue type prothallium Developmental stag... Res. 25:3389-3402. Query= BP917719|Adiantum capillus-veneris mRNA, clone: YMU001...ids Res. 25:3389-3402. Query= BP917719|Adiantum capillus-veneris mRNA, clone: YMU001_000104_E12. (452 letter

  4. AcEST: BP917728 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_F10 247 Adiantum capillus-veneris mRNA. clone: YMU001_000104_F10. BP9177...28 CL1210Contig1 Show BP917728 Clone id YMU001_000104_F10 Library YMU01 Length 247 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_F10. Accession BP917728 Tissue type prothallium Developmental stag...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917728|Adiantum capillus-veneris mRNA, clone: YMU001...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917728|Adiantum capillus-veneris mRNA, clon

  5. AcEST: BP917776 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_C10 521 Adiantum capillus-veneris mRNA. clone: YMU001_000105_C10. BP9177...76 CL4063Contig1 Show BP917776 Clone id YMU001_000105_C10 Library YMU01 Length 521 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_C10. Accession BP917776 Tissue type prothallium Developmental stag... Acids Res. 25:3389-3402. Query= BP917776|Adiantum capillus-veneris mRNA, clone: YMU001_000105_C10. (521 let...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  6. AcEST: BP921014 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E08 348 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E08. BP921014 - Show BP92101...is mRNA. clone: YMU001_000144_E08. Accession BP921014 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP921014|Adiantum capillus-veneris mRNA, clone: YMU001_000144_E08. (348 let... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92101... polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1019p24 PE=4 SV=1 Length = 228 Score = 33.9 bits (76), Ex

  7. AcEST: BP916101 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000083_B05 435 Adiantum capillus-veneris mRNA. clone: YMU001_000083_B05. BP916101 - Show BP916101 Clone id YMU001_000083_B05 Library YMU01 Length 435 Definition Adiantum capillus-veneris mRNA. clone: YMU001_000083_B05. Accession BP916101 ...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916101...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916101...gment) OS=Physcomit... 99 6e-28 tr|A9U1X0|A9U1X0_PHYPA Predicted protein (Fragment) OS=Physcomit... 101 1e-2...LMKKHGTRIIIYNLW 355 Score = 52.0 bits (123), Expect(2) = 4e-30 Identities = 21/33 (63%), Positives = 30/33 (

  8. AcEST: BP921012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E06 231 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E06. BP92101...2 CL3383Contig1 Show BP921012 Clone id YMU001_000144_E06 Library YMU01 Length 231 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_E06. Accession BP921012 Tissue type prothallium Developmental stag.... 25:3389-3402. Query= BP921012|Adiantum capillus-veneris mRNA, clone: YMU001_000144_E06. (231 letters) Data...ds Res. 25:3389-3402. Query= BP921012|Adiantum capillus-veneris mRNA, clone: YMU0

  9. AcEST: BP921018 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E12 314 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E12. BP92101...8 CL1324Contig1 Show BP921018 Clone id YMU001_000144_E12 Library YMU01 Length 314 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_E12. Accession BP921018 Tissue type prothallium Developmental stag...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92101...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92101

  10. AcEST: BP913399 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_G10 521 Adiantum capillus-veneris mRNA. clone: YMU001_000029_G10. BP913399... CL1902Contig1 Show BP913399 Clone id YMU001_000029_G10 Library YMU01 Length 521 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000029_G10. Accession BP913399 Tissue type prothallium Developmental stag... Acids Res. 25:3389-3402. Query= BP913399|Adiantum capillus-veneris mRNA, clone: YMU001_000029_G10. (521 let...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913399|Adiantum capillus-veneris mRNA, clon

  11. AcEST: BP919716 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C12 533 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C12. BP91971...6 CL2852Contig1 Show BP919716 Clone id YMU001_000128_C12 Library YMU01 Length 533 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_C12. Accession BP919716 Tissue type prothallium Developmental stag...eic Acids Res. 25:3389-3402. Query= BP919716|Adiantum capillus-veneris mRNA, clon...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91971

  12. AcEST: BP919712 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C08 508 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C08. BP91971...2 CL3958Contig1 Show BP919712 Clone id YMU001_000128_C08 Library YMU01 Length 508 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_C08. Accession BP919712 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP919712|Adiantum capillus-veneris mRNA, clone: YMU001_000128_C08. (508 letters... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91971

  13. AcEST: BP919710 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C06 540 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C06. BP91971...0 CL1009Contig1 Show BP919710 Clone id YMU001_000128_C06 Library YMU01 Length 540 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_C06. Accession BP919710 Tissue type prothallium Developmental stag...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919710|Adiantum capillus-veneris mRNA, clone:...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919710|Adiantum capillus-vener

  14. AcEST: BP919718 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_D02 319 Adiantum capillus-veneris mRNA. clone: YMU001_000128_D02. BP91971...8 CL199Contig1 Show BP919718 Clone id YMU001_000128_D02 Library YMU01 Length 319 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000128_D02. Accession BP919718 Tissue type prothallium Developmental stage...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91971...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP919718|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  15. AcEST: BP919714 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C10 352 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C10. BP91971...4 CL3562Contig1 Show BP919714 Clone id YMU001_000128_C10 Library YMU01 Length 352 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_C10. Accession BP919714 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP919714|Adiantum capillus-veneris mRNA, clone: YMU001_000128_C10. (352 lett...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91971

  16. AcEST: BP919719 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_D03 530 Adiantum capillus-veneris mRNA. clone: YMU001_000128_D03. BP91971...9 CL2560Contig1 Show BP919719 Clone id YMU001_000128_D03 Library YMU01 Length 530 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_D03. Accession BP919719 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919719|Adiantum capillus-veneris mRNA, ... Nucleic Acids Res. 25:3389-3402. Query= BP919719|Adiantum capillus-veneris mRNA, clone: YMU001_000128_D03.

  17. Black Phosphorus (BP) Nanodots for Potential Biomedical Applications.

    Science.gov (United States)

    Lee, Hyun Uk; Park, So Young; Lee, Soon Chang; Choi, Saehae; Seo, Soonjoo; Kim, Hyeran; Won, Jonghan; Choi, Kyuseok; Kang, Kyoung Suk; Park, Hyun Gyu; Kim, Hee-Sik; An, Ha Rim; Jeong, Kwang-Hun; Lee, Young-Chul; Lee, Jouhahn

    2016-01-13

    Recently, the appeal of 2D black phosphorus (BP) has been rising due to its unique optical and electronic properties with a tunable band gap (≈0.3-1.5 eV). While numerous research efforts have recently been devoted to nano- and optoelectronic applications of BP, no attention has been paid to promising medical applications. In this article, the preparation of BP-nanodots of a few nm to water or air is observed. As for the BP-nanodot crystals' stability (ionization and persistence of fluorescent intensity) in aqueous solution, after 10 d, ≈80% at 1.5 mg mL(-1) are degraded (i.e., ionized) in phosphate buffered saline. They showed no or little cytotoxic cell-viability effects in vitro involving blue- and green-fluorescence cell imaging. Thus, BP-nanodots can be considered a promising agent for drug delivery or cellular tracking systems. PMID:26584654

  18. AcEST: BP917757 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A10 478 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A10. BP91775...7 CL588Contig1 Show BP917757 Clone id YMU001_000105_A10 Library YMU01 Length 478 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000105_A10. Accession BP917757 Tissue type prothallium Developmental stage...c Acids Res. 25:3389-3402. Query= BP917757|Adiantum capillus-veneris mRNA, clone:...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP917757|Adiantum capillus-veneris mRNA, clone: YMU001_00010

  19. AcEST: BP921775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_A06 512 Adiantum capillus-veneris mRNA. clone: YMU001_000154_A06. BP921775... CL4074Contig1 Show BP921775 Clone id YMU001_000154_A06 Library YMU01 Length 512 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000154_A06. Accession BP921775 Tissue type prothallium Developmental stag.... 25:3389-3402. Query= BP921775|Adiantum capillus-veneris mRNA, clone: YMU001_000154_A06. (512 letters) Data...ms, Nucleic Acids Res. 25:3389-3402. Query= BP921775|Adiantum capillus-veneris mRNA, clone: YMU001_000154_A0

  20. AcEST: BP917759 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_B01 501 Adiantum capillus-veneris mRNA. clone: YMU001_000105_B01. BP91775...9 CL1351Contig1 Show BP917759 Clone id YMU001_000105_B01 Library YMU01 Length 501 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_B01. Accession BP917759 Tissue type prothallium Developmental stag...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91775...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917759|Adian

  1. AcEST: BP918775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000117_D01 560 Adiantum capillus-veneris mRNA. clone: YMU001_000117_D01. BP918775... CL2449Contig1 Show BP918775 Clone id YMU001_000117_D01 Library YMU01 Length 560 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000117_D01. Accession BP918775 Tissue type prothallium Developmental stag...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918775|Adiantum capillus-veneris mRNA, cl...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918775

  2. AcEST: BP921367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000149_A05 567 Adiantum capillus-veneris mRNA. clone: YMU001_000149_A05. BP921367... CL2099Contig1 Show BP921367 Clone id YMU001_000149_A05 Library YMU01 Length 567 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000149_A05. Accession BP921367 Tissue type prothallium Developmental stag...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921367|Adiantum capillus-veneris mRNA, clone: Y...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP921367|Adiantum capillus-veneris mRNA, clone: YMU001_

  3. AcEST: BP912367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_C06 544 Adiantum capillus-veneris mRNA. clone: YMU001_000018_C06. BP912367 - Show BP912367...is mRNA. clone: YMU001_000018_C06. Accession BP912367 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP912367|Adiantum capillus-veneris mRNA, clone: YMU001_000018_C06. ... LQSLQQQVPLCEKLPRKHSAHPAKP*CSHMAPAAES 263 ++SL Q PL LP +H HP+ P HM P E+ Sbjct: 332 IRSLFQPQPLQPLLPVQHPHHPSPPQGMHMPPQLET 367...s. 25:3389-3402. Query= BP912367|Adiantum capillus-veneris mRNA, clone: YMU001_000018_C06. (531 letters) Dat

  4. AcEST: BP915367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000070_F10 478 Adiantum capillus-veneris mRNA. clone: YMU001_000070_F10. BP915367... CL2241Contig1 Show BP915367 Clone id YMU001_000070_F10 Library YMU01 Length 478 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000070_F10. Accession BP915367 Tissue type prothallium Developmental stag...ucleic Acids Res. 25:3389-3402. Query= BP915367|Adiantum capillus-veneris mRNA, clone: YMU001_000070_F10. (4...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915367

  5. AcEST: BP912347 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A09 547 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A09. BP91234...7 CL3073Contig1 Show BP912347 Clone id YMU001_000018_A09 Library YMU01 Length 547 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_A09. Accession BP912347 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912347|Adiantum capillus-ven...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91234

  6. AcEST: BP912341 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A03 404 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A03. BP91234...1 CL1767Contig1 Show BP912341 Clone id YMU001_000018_A03 Library YMU01 Length 404 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_A03. Accession BP912341 Tissue type prothallium Developmental stag...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91234...c Acids Res. 25:3389-3402. Query= BP912341|Adiantum capillus-veneris mRNA, clone: YMU001_000018_A03. (404 le

  7. AcEST: BP912348 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A10 600 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A10. BP91234...8 CL2991Contig1 Show BP912348 Clone id YMU001_000018_A10 Library YMU01 Length 600 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_A10. Accession BP912348 Tissue type prothallium Developmental stag...s Res. 25:3389-3402. Query= BP912348|Adiantum capillus-veneris mRNA, clone: YMU001_000018_A10. (600 letters)...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912348|Adiantum capillus-veneris mRN

  8. AcEST: BP920128 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_D03 530 Adiantum capillus-veneris mRNA. clone: YMU001_000133_D03. BP92012...8 CL890Contig1 Show BP920128 Clone id YMU001_000133_D03 Library YMU01 Length 530 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_D03. Accession BP920128 Tissue type prothallium Developmental stage...ds Res. 25:3389-3402. Query= BP920128|Adiantum capillus-veneris mRNA, clone: YMU001_000133_D03. (530 letters... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920128|Adiantum capillus-veneris mRNA, clone: YM

  9. AcEST: BP920126 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_D01 482 Adiantum capillus-veneris mRNA. clone: YMU001_000133_D01. BP92012...6 CL113Contig1 Show BP920126 Clone id YMU001_000133_D01 Library YMU01 Length 482 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_D01. Accession BP920126 Tissue type prothallium Developmental stage...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92012...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920126|Adiantum capillus-veneris mRNA, clone: YMU001_000133_D0

  10. AcEST: BP920122 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C07 537 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C07. BP92012...2 CL2470Contig1 Show BP920122 Clone id YMU001_000133_C07 Library YMU01 Length 537 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_C07. Accession BP920122 Tissue type prothallium Developmental stag...programs, Nucleic Acids Res. 25:3389-3402. Query= BP920122|Adiantum capillus-veneris mRNA, clone: YMU001_000...grams, Nucleic Acids Res. 25:3389-3402. Query= BP920122|Adiantum capillus-veneris mRNA, clone: YMU001_000133

  11. Explosives Detection: Exploitation of the Physical Signatures

    Science.gov (United States)

    Atkinson, David

    2010-10-01

    Explosives based terrorism is an ongoing threat that is evolving with respect to implementation, configuration and materials used. There are a variety of devices designed to detect explosive devices, however, each technology has limitations and operational constraints. A full understanding of the signatures available for detection coupled with the array of detection choices can be used to develop a conceptual model of an explosives screening operation. Physics based sensors provide a robust approach to explosives detection, typically through the identification of anomalies, and are currently used for screening in airports around the world. The next generation of detectors for explosives detection will need to be more sensitive and selective, as well as integrate seamlessly with devices focused on chemical signatures. An appreciation for the details of the physical signature exploitation in cluttered environments with time, space, and privacy constraints is necessary for effective explosives screening of people, luggage, cargo, and vehicles.

  12. Explosive Surface Hardening of Austenitic Stainless Steel

    Science.gov (United States)

    Kovacs-Coskun, T.

    2016-04-01

    In this study, the effects of explosion hardening on the microstructure and the hardness of austenitic stainless steel have been studied. The optimum explosion hardening technology of austenitic stainless steel was researched. In case of the explosive hardening used new idea mean indirect hardening setup. Austenitic stainless steels have high plasticity and can be easily cold formed. However, during cold processing the hardening phenomena always occurs. Upon the explosion impact, the deformation mechanism indicates a plastic deformation and this deformation induces a phase transformation (martensite). The explosion hardening enhances the mechanical properties of the material, includes the wear resistance and hardness. In case of indirect hardening as function of the setup parameters specifically the flayer plate position the hardening increased differently. It was find a relationship between the explosion hardening setup and the hardening level.

  13. Holocene explosive volcanism of the Jan Mayen (island) volcanic province, North-Atlantic

    Science.gov (United States)

    Gjerløw, Eirik; Haflidason, H.; Pedersen, R. B.

    2016-07-01

    The volcanic island Jan Mayen, located in the Norwegian-Greenland Sea, hosts the active stratovolcano of Beerenberg, the northernmost active subaerial volcano in the world. At least five eruptions are known from the island following its discovery in the 17th century, but its eruptive history prior to this is basically unknown. In this paper two sediment cores retrieved close to Jan Mayen have been studied in detail to shed light on the Holocene history of explosive volcanism from the Jan Mayen volcanic province. Horizons with elevated tephra concentrations were identified and tephra from these was analysed to determine major element chemistry of the tephra. The tephra chemistry was used to provide a link between the two cores and the land based tephra records from Jan Mayen Island. We managed to link two well-developed tephra peaks in the cores by their geochemical composition and age to Jan Mayen. One of these peaks represents the 1732 AD eruption of Eggøya while the other peak represents a previously undescribed eruption dated to around 10.3 ka BP. Two less prominent tephra peaks, one in each core, dated to approximately 2.3 and 3.0 ka BP, also have a distinct geochemical character linking them to Jan Mayen volcanism. However, the most prominent tephra layer in the cores located close to Jan Mayen and numerous other cores along the Jan Mayen ridge is the 12.1 ka BP Vedde Ash originating from the Iceland volcanic province. We find that the Holocene volcanism on Jan Mayen is much less explosive than volcanism in Iceland, and propose that either low amounts of explosive volcanic activity from the summit region of Beerenberg or small to absent glacier cover on Beerenberg is responsible for this.

  14. Stellar Explosions: Hydrodynamics and Nucleosynthesis

    Science.gov (United States)

    José, Jordi

    2015-12-01

    Stars are the main factories of element production in the universe through a suite of complex and intertwined physical processes. Such stellar alchemy is driven by multiple nuclear interactions that through eons have transformed the pristine, metal-poor ashes leftover by the Big Bang into a cosmos with 100 distinct chemical species. The products of stellar nucleosynthesis frequently get mixed inside stars by convective transport or through hydrodynamic instabilities, and a fraction of them is eventually ejected into the interstellar medium, thus polluting the cosmos with gas and dust. The study of the physics of the stars and their role as nucleosynthesis factories owes much to cross-fertilization of different, somehow disconnected fields, ranging from observational astronomy, computational astrophysics, and cosmochemistry to experimental and theoretical nuclear physics. Few books have simultaneously addressed the multidisciplinary nature of this field in an engaging way suitable for students and young scientists. Providing the required multidisciplinary background in a coherent way has been the driving force for Stellar Explosions: Hydrodynamics and Nucleosynthesis. Written by a specialist in stellar astrophysics, this book presents a rigorous but accessible treatment of the physics of stellar explosions from a multidisciplinary perspective at the crossroads of computational astrophysics, observational astronomy, cosmochemistry, and nuclear physics. Basic concepts from all these different fields are applied to the study of classical and recurrent novae, type I and II supernovae, X-ray bursts and superbursts, and stellar mergers. The book shows how a multidisciplinary approach has been instrumental in our understanding of nucleosynthesis in stars, particularly during explosive events.

  15. Explosive site percolation and finite size hysteresis

    OpenAIRE

    Bastas, Nikolaos; Kosmidis, Kosmas; Argyrakis, Panos

    2011-01-01

    We report the critical point for site percolation for the "explosive" type for 2D square lattices using Monte Carlo simulations and compare it to the classical well known percolation. We use similar algorithms as have been recently reported for bond percolation and networks. We calculate the "explosive" site percolation threshold as $p_c=0.695$ and we find evidence that "explosive" site percolation surprisingly may belong to a different universality class than bond percolation on lattices, pr...

  16. New Dark Matter Detector using Nanoscale Explosives

    OpenAIRE

    Lopez, Alejandro; Drukier, Andrzej; Freese, Katherine; Kurdak, Cagliyan; Tarle, Gregory

    2014-01-01

    We present nanoscale explosives as a novel type of dark matter detector and study the ignition properties. When a Weakly Interacting Massive Particle WIMP from the Galactic Halo elastically scatters off of a nucleus in the detector, the small amount of energy deposited can trigger an explosion. For specificity, this paper focuses on a type of two-component explosive known as a nanothermite, consisting of a metal and an oxide in close proximity. When the two components interact they undergo a ...

  17. Analysis of TROI-13 Steam Explosion Experiment

    OpenAIRE

    Mitja Uršič; Matjaž Leskovar

    2008-01-01

    The prediction of steam explosion inducing loads in nuclear power plants must be based on results of experimental research programmes and on simulations using validated fuel-coolant interaction codes. In this work, the TROI-13 steam explosion experiment was analysed with the fuel-coolant interaction MC3D computer code. The TROI-13 experiment is one of several experiments performed in the TROI research program and resulted in a spontaneous steam explosion using corium melt. First, the TROI-13 ...

  18. Is a Cambrian Explosion Coming for Robotics?

    OpenAIRE

    Gill A. Pratt

    2015-01-01

    About half a billion years ago, life on earth experienced a short period of very rapid diversification called the "Cambrian Explosion." Many theories have been proposed for the cause of the Cambrian Explosion, one of the most provocative being the evolution of vision, allowing animals to dramatically increase their ability to hunt and find mates. Today, technological developments on several fronts are fomenting a similar explosion in the diversification and applicability of robotics. Many of ...

  19. The gas dynamics of explosions

    CERN Document Server

    Lee,\tJohn H S

    2016-01-01

    Explosions, and the non-steady shock propagation associated with them, continue to interest researchers working in different fields of physics and engineering (such as astrophysics and fusion). Based on the author's course in shock dynamics, this book describes the various analytical methods developed to determine non-steady shock propagation. These methods offer a simple alternative to the direct numerical integration of the Euler equations and offer a better insight into the physics of the problem. Professor Lee presents the subject systematically and in a style that is accessible to graduate students and researchers working in shock dynamics, combustion, high-speed aerodynamics, propulsion and related topics.

  20. Explosive demolition of activated concrete

    International Nuclear Information System (INIS)

    This paper describes the removal of a radiologically contaminated concrete pad. This pad was removed during 1979 by operating personnel under the direction of the Waste Management Program of EG and G Idaho, Inc. The concrete pad was the foundation for the Organic Moderated Reactor Experiment (OMRE) reactor vessel located at the Idaho National Engineering Laboratory (INEL). The pad consisted of a cylindrical concrete slab 15 ft in diameter, 2 ft thick, and reinforced with steel bar. It was poured directly onto basalt rocks approximately 20 ft below grade. The entire pad contained induced radioactivity and was therefore demolished, boxed, and buried rather than being decontaminated. The pad was demolished by explosive blasting

  1. 75 FR 1085 - Commerce in Explosives; List of Explosive Materials (2009R-18T)

    Science.gov (United States)

    2010-01-08

    ... 31, 2008 (Docket No. ATF 28N, 73 FR 80428). Notice of List of Explosive Materials Pursuant to 18 U.S... tetrazene hydrate]. Tetrazole explosives. Tetryl . Tetrytol. Thickened inorganic oxidizer salt...

  2. 75 FR 70291 - Commerce in Explosives; List of Explosive Materials (2010R-27T)

    Science.gov (United States)

    2010-11-17

    ..., 75 FR 1085). Notice of List of Explosive Materials Pursuant to 18 U.S.C. 841(d) and 27 CFR 555.23, I.... Tetrazene [tetracene, tetrazine, 1(5-tetrazolyl)-4-guanyl tetrazene hydrate]. Tetrazole explosives....

  3. 77 FR 58410 - Commerce in Explosives; List of Explosive Materials (2012R-10T)

    Science.gov (United States)

    2012-09-20

    ..., 76 FR 64974). Notice of List of Explosive Materials Pursuant to 18 U.S.C. 841(d) and 27 CFR 555.23, I.... Tetrazene [tetracene, tetrazine, 1(5-tetrazolyl)-4-guanyl tetrazene hydrate]. Tetrazole explosives....

  4. Expanding the BP1-BP2 15q11.2 Microdeletion Phenotype: Tracheoesophageal Fistula and Congenital Cataracts

    Directory of Open Access Journals (Sweden)

    D. Wong

    2013-01-01

    Full Text Available The proximal q arm of chromosome 15 contains breakpoint regions BP1–BP5 with the classic deletion of BP1–BP3 best known to be associated with Prader-Willi and Angelman syndromes. The region is approximately 500 kb and microdeletions within the BP1-BP2 region have been reported in patients with developmental delay, behavioral abnormalities, and motor apraxia as well as dysmorphic features including hypertelorism, cleft or narrow palate, ear abnormalities, and recurrent upper airway infections. We report two patients with unique, never-before-reported 15q11.2 BP1-2 microdeletion syndrome findings, one with proximal esophageal atresia and distal tracheoesophageal fistula (type C and one with congenital cataracts. Cataracts have been described in Prader-Willi syndrome but we could not find any description of cataracts in Angelman syndrome. Esophageal atresia and tracheoesophageal fistula have not been reported to our knowledge in either syndrome. A chance exists that both cases are sporadic birth defects; however, the findings of the concomitant microdeletion cannot be overlooked as a possible cause. Based on our review of the literature and the presentation of our patients, we recommend that esophageal atresia and distal tracheoesophageal fistula as well as congenital cataracts be included in the phenotypic spectrum of 15q11.2 BP1-2 microdeletion syndrome.

  5. High Explosives Research and Development (HERD) Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The purpose is to provide high explosive formulation, chemical analysis, safety and performance testing, processing, X-ray, quality control and loading support for...

  6. Radiation techniques for detection of explosives

    International Nuclear Information System (INIS)

    The detection of explosive material in airport baggage requires a device that can quickly detect a small amount of explosives with a high success rate and a low positive false alarm rate. The device should be able to handle carry-on as well as checked baggage and should provide indications that are independent of the geometric configuration of the material. The mass density of an explosive compound is relatively high. Also, explosives have high nitrogen and oxygen densities. Most detection techniques exploit the nitrogen-rich nature of explosives. Although few materials have such a high nitrogen density, some plastics, clothing materials and narcotics have also high nitrogen content. In order to distinguish such innocuous materials from explosives, one needs to detect the presence of other elements, particularly oxygen. The measurement of high oxygen density in the inspected object, together with a high nitrogen density, provides a strong indication that the object contains an explosive material. This is the minimum requirement for unambiguous determination of the presence of explosives. An additional measurement will decrease the degree of ambiguity and increase the reliability of the system. A number of radiation based techniques have been developed, or are being considered for the detection of explosives. This paper reviews some of these techniques, based on the type and mode of interaction of the radiation employed

  7. Detonation Propagation Characteristics of Superposition Explosive Materials

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    In order to investigate detonation propagation characteristics of different charge patterns,the detonation velocities of superposition strip-shaped charges made up of a detonating cord and explosives were measured by a detonation velocity measuring instrument under conditions of different ignition.The experimental results and theoretical analysis show that the maximum detonation propagation velocity depends on the explosive materials with the maximum velocity among all the explosive materials.Using detonating cord in a superposition charge can shorten detonation propagation time and improve the efficiency of explosive energy.The measurement method of detonation propagation velocity and experimental results are presented and investigated.

  8. Analysis of TROI-13 Steam Explosion Experiment

    Directory of Open Access Journals (Sweden)

    Mitja Uršič

    2008-01-01

    Full Text Available The prediction of steam explosion inducing loads in nuclear power plants must be based on results of experimental research programmes and on simulations using validated fuel-coolant interaction codes. In this work, the TROI-13 steam explosion experiment was analysed with the fuel-coolant interaction MC3D computer code. The TROI-13 experiment is one of several experiments performed in the TROI research program and resulted in a spontaneous steam explosion using corium melt. First, the TROI-13 premixing simulations were performed to determine the initial conditions for the steam explosion simulations and to evaluate the melt droplets hydrodynamic fragmentation model. Next, a number of steam explosion simulations were performed, varying the steam explosion triggering position and the melt droplets mass participating in the steam explosion. The simulation results revealed that there is an important influence of the participating melt droplets mass on the calculated pressure loads, whereas the influence of the steam explosion triggering position on the steam explosion development was less expressive.

  9. A study on the thermal shock for explosive plugged part

    International Nuclear Information System (INIS)

    Supposing the thermal shock which take place in the heat-exchanger due to misoperation of valves, thermal shock test of explosive plugged part is conducted under severer condition than that in service. Microscopic inspection (x 200) of the section of specimen after thermal shock test, ultrasonic inspection and observation of acoustic emission during testing are conducted to detect the peeling of bonded boundary and cracking in the material. SUS 321 steel, 2 1/4 Cr - 1 Mo steel and SUS 304 steel are used as testing materials, supposing the material of the super heater, and evaporator of FBR, and steam generater of PWR, respectively. Range of temperature variation are also desided supposing the operating temperature of secondary cooling circuit of each type of reactor. Reasults of testing are plotted against the number of heating and cooling cycles. However, peeling is seemed to take place in short period after beginning of the testing, considerable number of cycles are required to initiate the cracks and to propagate them to inside of plug or outside surface of tube plate. Mechanism of fracture due to thermal shock are considered and it is concluded that there are three type of fracture depending on the result of welding. Conclusions of these investigations are obtained as follows. 1. Failures of explosive welded part are divided into two types, peeling and cracking. 2. There are three type of crack initiation, i.e. crack initiation from peeling, crack initiation from unbonded zone near the surface of tube plate, and crack initiation from melting zone in bonded boundary. 3. It is possible to distinguish the peeling and cracking by AE, however, it is impossible to distinguish the above three type of crack initiation by AE. 4. Peeling occurs immediately after beginning of test but cracking occurs after 150 ∼ 200 cycles in SH, 200 ∼ 400 cycles in EV and 1000 cycles in SG. (J.P.N.)

  10. The value of a BP determination method using a novel non-invasive BP device against the invasive catheter measurement.

    Directory of Open Access Journals (Sweden)

    Jinsong Xu

    Full Text Available OBJECTIVE: The aim of this study was to evaluate the accuracy of a new blood pressure (BP measurement method (Pulse method. METHODS: This study enrolled 45 patients for selective percutaneous coronary intervention (PCI via right radial artery. A BP device using either oscillometric (Microlife 3AC1-1 or Pulse method(RG-BP11was used. At the beginning of each PCI, intra-radial BP was measured before Microlife BP or Pulse BP measurement as its own reference, respectively. At the end of PCI, BP was measured again with the measurement order of Microlife BP and Pulse BP reversed. The differences between intra-radial and Microlife (BPi-M or Pulse BP (BPi-P on SBP, DBP and mean artery pressure (MAP were calculated. Meanwhile, in 48 patients the intra-brachial BP and intra-radial artery BP were measured to calculate the brachial -radial BP difference (BPr-b. RESULTS: The intra-radial SBP references used prior to both the Microlife and Pulse SBP that were similar (145.1±27.7 vs 145.8±24.2 mmHg, but the Microlife SBP was significantly lower than the Pulse SBP (127.7±20.5 vs 130.3±22.7 mmHg, P<0.05, thus the SBPi-M was higher than SBPi-P (18.1±11.8 vs 14.8±12.8 mmHg, P<0.05. As the mean SBPr-b was 12.4 mmHg, the Pulse SBP was closer to expected intra-brachial SBP by about 3.3 mmHg than was Microlife SBP to expected intra-brachial SBP. Meanwhile, Bland-Altman plots showed that the 95% limits of agreement for intra-radial SBP by Pulse SBP were narrower than those by Microlife SBP (12.0∼17.5 vs 15.5∼20.6 mmHg. However, the 95% limits of agreement for Pulse DBP and MAP were similar to those for Microlife DBP and MAP. CONCLUSION: Against the invasive BP measurement, the pulse method may provide more accurate SBP and comparable DBP and MAP as compared with the oscillometric method.

  11. 27 CFR 555.181 - Reporting of plastic explosives.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Reporting of plastic..., FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Marking of Plastic Explosives § 555.181 Reporting of plastic explosives. All persons, other than an agency of the United...

  12. 27 CFR 555.23 - List of explosive materials.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false List of explosive..., FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Administrative and Miscellaneous Provisions § 555.23 List of explosive materials. The Director shall compile a list of...

  13. 27 CFR 555.28 - Stolen explosive materials.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Stolen explosive materials..., AND EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Administrative and Miscellaneous Provisions § 555.28 Stolen explosive materials. No person shall receive, conceal, transport,...

  14. 30 CFR 75.1310 - Explosives and blasting equipment.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Explosives and blasting equipment. 75.1310... SAFETY AND HEALTH MANDATORY SAFETY STANDARDS-UNDERGROUND COAL MINES Explosives and Blasting § 75.1310 Explosives and blasting equipment. (a) Only permissible explosives, approved sheathed explosive units,...

  15. Subsurface Explosions in Granular Media

    Science.gov (United States)

    Lai, Shuyue; Houim, Ryan; Oran, Elaine

    2015-11-01

    Numerical simulations of coupled gas-granular flows are used to study properties of shock formation and propagation in media, such as sand or regolith on the moon, asteroids, or comets. The simulations were performed with a multidimensional fully compressible model, GRAF, which solves two sets of coupled Navier-Stokes equations, one for the gas and one for the granular medium. The specific case discussed here is for a subsurface explosion in a granular medium initiated by an equivalent of 200g of TNT in depths ranging from 0.1m to 3m. The background conditions of 100K, 10 Pa and loose initial particle volume fraction of 25% are consistent with an event on a comet. The initial blast creates a cavity as a granular shock expands outwards. Since the gas-phase shock propagates faster than the granular shock in loose, granular material, some gas and particles are ejected before the granular shock arrives. When the granular shock reaches the surface, a cap-like structure forms. This cap breaks and may fall back on the surface and in this process, relatively dense particle clusters form. At lower temperatures, the explosion timescales are increased and entrained particles are more densely packed.

  16. Explosive double salts and preparation

    Science.gov (United States)

    Cady, Howard H.; Lee, Kien-yin

    1984-01-01

    Applicants have discovered a new composition of matter which is an explosive addition compound of ammonium nitrate (AN) and diethylenetriamine trinitrate (DETN) in a 50:50 molar ratio. The compound is stable over extended periods of time only at temperatures higher than 46.degree. C., decomposing to a fine-grained eutectic mixture (which is also believed to be new) of AN and DETN at temperatures lower than 46.degree. C. The compound of the invention has an x-ray density of 1.61 g/cm.sup.3, explodes to form essentially only gaseous products, has higher detonation properties (i.e., detonation velocity and pressure) than those of any mechanical mixture having the same density and composition as the compound of the invention, is a quite insensitive explosive material, can be cast at temperatures attainable by high pressure steam, and is prepared from inexpensive ingredients. Methods of preparing the compound of the invention and the fine-grained eutectic composition of the invention are given.

  17. Chernobyl: Anatomy of the explosion

    International Nuclear Information System (INIS)

    On Friday, 26 April 1986, it was planned to shut down the fourth unit of the Chernobyl Atomic Power Station, U.S.S.R., for periodic maintenance. The procedure supplied the opportunity to perform a further experiment; operation of the turbine in free rotation regime, which occurs when the steam is cut down while the turbine is still running. It so happened that carrying out this experiment turned out to be the worst accident in the history of nuclear power industry. The first part of the article proceeds to a second by second detailed analysis of the causes of the catastrophe. The analysis uses official data and reports. The author covers the sequence of events, which led up to two explosions in the second hour of that tragic morning. In the second part of the article, the author provides hints and suggestions, so that 'the tragedy of Chernobyl does not become a useless lesson'. With regard to what, so far, has been published, the novelty of the article may be a diagram showing the excessive changes that affected the main parameters (power, water flow through circulating pumps, steam pressure in separators, and length of the immersed part of control rods) in the fourth unit during the last seconds before the explosion. If may be noteworthy to mention that the curves supplied here are based on data stored in the computer 'SCALA'. 2 figs

  18. Possible enhancement of BP180 autoantibody production by herpes zoster.

    Science.gov (United States)

    Kamiya, Koji; Aoyama, Yumi; Suzuki, Takahiro; Niwa, Haruo; Horio, Ai; Nishio, Eiichi; Tokura, Yoshiki

    2016-02-01

    Bullous pemphigoid (BP) is an autoimmune blistering disease caused by autoantibodies against type XVII collagen/BP180 (BP180). Although the mechanisms of autoantibody production remain to be elucidated, herpes virus infections have been identified as a possible triggering factor for pemphigus. We report a case of herpes zoster (HZ) having anti-BP180 serum antibodies. The patient developed sudden-onset, tense blisters and edematous erythema on the right anterior chest, shoulder and upper back. Histopathology showed remarkable degeneration of keratinocytes, acantholysis and blister formation with ballooning cells, indicating herpes virus infection. A polymerase chain reaction analysis of varicella zoster virus (VZV) was positive in crusts and effusions from the skin lesions, confirming the definitive diagnosis of HZ. Notably, we found that the patient had anti-BP180 serum antibodies in association with the occurrence of HZ. After successful treatment with valacyclovir hydrochloride for 7 days, the serum levels of anti-BP180 antibodies decreased in accordance with the improvement of skin lesions. These findings suggest that the production of anti-BP180 antibodies could be triggered by the reactivation of VZV. PMID:26212492

  19. Soil infiltration based on bp neural network and grey relational analysis

    Directory of Open Access Journals (Sweden)

    Wang Juan

    2013-02-01

    Full Text Available Soil infiltration is a key link of the natural water cycle process. Studies on soil permeability are conducive for water resources assessment and estimation, runoff regulation and management, soil erosion modeling, nonpoint and point source pollution of farmland, among other aspects. The unequal influence of rainfall duration, rainfall intensity, antecedent soil moisture, vegetation cover, vegetation type, and slope gradient on soil cumulative infiltration was studied under simulated rainfall and different underlying surfaces. We established a six factor-model of soil cumulative infiltration by the improved back propagation (BP-based artificial neural network algorithm with a momentum term and self-adjusting learning rate. Compared to the multiple nonlinear regression method, the stability and accuracy of the improved BP algorithm was better. Based on the improved BP model, the sensitive index of these six factors on soil cumulative infiltration was investigated. Secondly, the grey relational analysis method was used to individually study grey correlations among these six factors and soil cumulative infiltration. The results of the two methods were very similar. Rainfall duration was the most influential factor, followed by vegetation cover, vegetation type, rainfall intensity and antecedent soil moisture. The effect of slope gradient on soil cumulative infiltration was not significant.

  20. Low Frequency Electromagnetic Pulse and Explosions

    Energy Technology Data Exchange (ETDEWEB)

    Sweeney, J J

    2011-02-01

    This paper reviews and summarizes prior work related to low frequency (< 100 Hz) EMP (ElectroMagnetic Pulse) observed from explosions. It focuses on how EMP signals might, or might not, be useful in monitoring underground nuclear tests, based on the limits of detection, and physical understanding of these signals. In summary: (1) Both chemical and nuclear explosions produce an EMP. (2) The amplitude of the EMP from underground explosions is at least two orders of magnitude lower than from above ground explosions and higher frequency components of the signal are rapidly attenuated due to ground conductivity. (3) In general, in the near field, that is distances (r) of less than 10s of kilometers from the source, the amplitude of the EMP decays approximately as 1/r{sup 3}, which practically limits EMP applications to very close (<{approx}1km) distances. (4) One computational model suggests that the EMP from a decoupled nuclear explosion may be enhanced over the fully coupled case. This has not been validated with laboratory or field data. (5) The magnitude of the EMP from an underground nuclear explosion is about two orders of magnitude larger than that from a chemical explosion, and has a larger component of higher frequencies. In principle these differences might be used to discriminate a nuclear from a chemical explosion using sensors at very close (<{approx}1 km) distances. (6) Arming and firing systems (e.g. detonators, exploding bridge wires) can also produce an EMP from any type of explosion. (7) To develop the understanding needed to apply low frequency EMP to nuclear explosion monitoring, it is recommended to carry out a series of controlled underground chemical explosions with a variety of sizes, emplacements (e.g. fully coupled and decoupled), and arming and firing systems.

  1. Close-in airblast from underground explosions

    International Nuclear Information System (INIS)

    Air overpressures as a function of time have been measured from surface zero to about 170 ft/lb1/3 along the ground from nuclear and chemical explosions. Charge depths varied from the surface to depths below which explosion gases are contained. A ground-shock-induced air pressure pulse is clearly distinguishable from the pulse caused by venting gases. Measured peak overpressures show reasonable agreement with the theoretical treatment by Monta. In a given medium the suppression of blast with explosion burial depth is a function of the relative distance at which the blast is observed. Rates of suppression of peak overpressure with charge burial are different for the two pulses. Rates are determined for each pulse over the range of distances at which measurements have been made of air overpressure from chemical explosions in several media. Nuclear data are available from too few shots for similar dependence on burial depth and distance to be developed, but it is clear that the gas venting peak overpressure from nuclear explosions is much more dependent on medium than that from chemical explosions. For above-ground explosions, experiment has shown that airblast from a I-kiloton nuclear explosion is equal to that from a 0.5-kiloton TNT explosion. Data on ground-shock-induced airblast is now sufficient to show that a similar relationship may exist for buried explosions. Because of medium dependence of the gas venting pulse from nuclear explosions, data from additional nuclear events will be required before a chemical/nuclear airblast equivalence can be determined for the gas-venting pulse. (author)

  2. The RanBP2/RanGAP1*SUMO1/Ubc9 SUMO E3 ligase is a disassembly machine for Crm1-dependent nuclear export complexes

    Science.gov (United States)

    Ritterhoff, Tobias; Das, Hrishikesh; Hofhaus, Götz; Schröder, Rasmus R.; Flotho, Annette; Melchior, Frauke

    2016-01-01

    Continuous cycles of nucleocytoplasmic transport require disassembly of transport receptor/Ran-GTP complexes in the cytoplasm. A basic disassembly mechanism in all eukaryotes depends on soluble RanGAP and RanBP1. In vertebrates, a significant fraction of RanGAP1 stably interacts with the nucleoporin RanBP2 at a binding site that is flanked by FG-repeats and Ran-binding domains, and overlaps with RanBP2's SUMO E3 ligase region. Here, we show that the RanBP2/RanGAP1*SUMO1/Ubc9 complex functions as an autonomous disassembly machine with a preference for the export receptor Crm1. We describe three in vitro reconstituted disassembly intermediates, which show binding of a Crm1 export complex via two FG-repeat patches, cargo-release by RanBP2's Ran-binding domains and retention of free Crm1 at RanBP2 after Ran-GTP hydrolysis. Intriguingly, all intermediates are compatible with SUMO E3 ligase activity, suggesting that the RanBP2/RanGAP1*SUMO1/Ubc9 complex may link Crm1- and SUMO-dependent functions. PMID:27160050

  3. Nature's third cycle a story of sunspots

    CERN Document Server

    Choudhuri, Arnab Rai

    2015-01-01

    The cycle of day and night and the cycle of seasons are two familiar natural cycles around which many human activities are organized. But is there a third natural cycle of importance for us humans? On 13 March 1989, six million people in Canada went without electricity for many hours: a large explosion on the sun was discovered as the cause of this blackout. Such explosions occur above sunspots, dark features on the surface of the Sun that have been observed through telescopes since the time of Galileo. The number of sunspots has been found to wax and wane over a period of 11 years. Although this cycle was discovered less than two centuries ago, it is becoming increasingly important for us as human society becomes more dependent on technology. For nearly a century after its discovery, the cause of the sunspot cycle remained completely shrouded in mystery. The 1908 discovery of strong magnetic fields in sunspots made it clear that the 11-year cycle is the magnetic cycle of the sun. It is only during the last ...

  4. AcEST: BP913614 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000032_C03 511 Adiantum capillus-veneris mRNA. clone: YMU001_000032_C03. BP9...13614 - Show BP913614 Clone id YMU001_000032_C03 Library YMU01 Length 511 Definition Adiantum capillus-vener... programs, Nucleic Acids Res. 25:3389-3402. Query= BP913614|Adiantum capillus-veneris mRNA, clone: YMU001_00.....................................................done Score E Sequences producing significant alignment...S=Moorella thermoa... 69 1e-11 sp|Q8TZ24|AROE_METKA Shikimate dehydrogenase OS=Methanopyrus kan... 67 3e-11

  5. AcEST: BP919878 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |P12927|NTP2_VACCW Nucleoside triphosphatase II OS=Vaccinia virus (strain Western Reserve) Align length 54 S... II OS=Vaccinia virus (strain Western Reserve) GN=NPH2 PE=1 SV=2 Length = 676 Sco...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919878|Adiantum capillus-vener...YMU001_000130_C01 531 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C01. BP9...19878 - Show BP919878 Clone id YMU001_000130_C01 Library YMU01 Length 531 Definition Adiantum capillus-veneris mRNA. clone

  6. AcEST: BP915098 [AcEST

    Lifescience Database Archive (English)

    Full Text Available programs, Nucleic Acids Res. 25:3389-3402. Query= BP915098|Adiantum capillus-veneris mRNA, clone...... 52 1e-05 tr|Q43625|Q43625_PEA Putative ORF; conserved in 5' leaders of pl... ... ORF; conserved in 5' leaders of plant SAMdC OS=Pisum sativum PE=4 SV=1 Length = 54 Score =...YMU001_000066_E02 480 Adiantum capillus-veneris mRNA. clone: YMU001_000066_E02. BP9...15098 - Show BP915098 Clone id YMU001_000066_E02 Library YMU01 Length 480 Definition Adiantum capillus-veneris mRNA. clone

  7. AcEST: BP914124 [AcEST

    Lifescience Database Archive (English)

    Full Text Available jandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BL...2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Mille...ery= BP914124|Adiantum capillus-veneris mRNA, clone: YMU001_000042_B06. (320 letters) Database: uniprot_spro...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914124|Adiantum capillus...YMU001_000042_B06 320 Adiantum capillus-veneris mRNA. clone: YMU001_000042_B06. BP9

  8. AcEST: BP919971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ce: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Mille...affer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gappe...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919971|Adiantum capillus-veneris mRNA.... Query= BP919971|Adiantum capillus-veneris mRNA, clone: YMU001_000131_D09. (312 letters) Database: uniprot_...YMU001_000131_D09 312 Adiantum capillus-veneris mRNA. clone: YMU001_000131_D09. BP9

  9. AcEST: BP912179 [AcEST

    Lifescience Database Archive (English)

    Full Text Available jandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped...nghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generat...ic Acids Res. 25:3389-3402. Query= BP912179|Adiantum capillus-veneris mRNA, clone: YMU001_000016_A11. (549 le...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912179|Adiantum capill...YMU001_000016_A11 549 Adiantum capillus-veneris mRNA. clone: YMU001_000016_A11. BP9

  10. AcEST: BP915724 [AcEST

    Lifescience Database Archive (English)

    Full Text Available andro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI...02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Mille...25:3389-3402. Query= BP915724|Adiantum capillus-veneris mRNA, clone: YMU001_000076_A12. (520 letters) Databa...YMU001_000076_A12 520 Adiantum capillus-veneris mRNA. clone: YMU001_000076_A12. BP9...15724 - Show BP915724 Clone id YMU001_000076_A12 Library YMU01 Length 520 Definition Adiantum capillus-vener

  11. AcEST: BP920355 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sphosulfate reductase OS=Serratia proteamaculans (strain 568) GN=cysH PE=3 SV=1 L...20355 - Show BP920355 Clone id YMU001_000136_B07 Library YMU01 Length 298 Definition Adiantum capillus-vener...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920355|Adiantum capillus-vener...1 AWQEARYGKLWE---QGVEGIERYNDLN-KVEPMNRALE 145 >sp|Q8JGS1|STIL_DANRE SCL-interrupting locus protein homolog OS=Danio rerio GN=sti...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920355|Adiantum capillus-vener

  12. Modelling and Analysis of Dynamic Reconfiguration in BP-Calculus

    DEFF Research Database (Denmark)

    Abouzaid, Faisal; Mullins, John; Mazzara, Manuel;

    2012-01-01

    The BP-calculus is a formalism based on the π-calculus and encoded in WS-BPEL. The BP-calculus is intended to specificaly model and verify Service Oriented Applications. One important feature of SOA is the ability to compose services that may dynamically evolve along runtime. Dynamic...... reconfiguration of services increases their availability, but puts accordingly, heavy demands for validation, verification, and evaluation. In this paper we formally model and analyze dynamic reconfigurations and their requirements in BP-calculus and show how reconfigurable components can be modeled using...

  13. AcEST: BP917190 [AcEST

    Lifescience Database Archive (English)

    Full Text Available lignments: (bits) Value sp|Q9JHC9|ELF2_MOUSE ETS-related transcription factor Elf-2 OS=M... 30 4.2 sp...YMU001_000097_D09 473 Adiantum capillus-veneris mRNA. clone: YMU001_000097_D09. BP9...17190 - Show BP917190 Clone id YMU001_000097_D09 Library YMU01 Length 473 Definition Adiantum capillus-veneris...|Q9JHC9|ELF2_MOUSE ETS-related transcription factor Elf-2 O...eic Acids Res. 25:3389-3402. Query= BP917190|Adiantum capillus-veneris mRNA, clon

  14. Summary of European directives for explosion safety

    NARCIS (Netherlands)

    Versloot, N.H.A.; Klein, A.J.J.; Maaijer, M. de

    2008-01-01

    On July 1, 2003 a transitional period has ended and two European directives became fully active: • Directive 1999/92/EC • Directive 94/9/EC These directives have an impact on companies with an explosion hazard (gas, vapor, mist, or dust explosions) and on manufacturers of equipment intended to be us

  15. Glass produced by underground nuclear explosions

    International Nuclear Information System (INIS)

    Detonation of an underground nuclear explosive produces a strong shock wave which propagates spherically outward, vaporizing the explosive and nearby rock and melting, the surrounding rock. The vaporized material expands adiabatically, forming a cavity. As the energy is dissipated during the cavity formation process, the explosive and rock debris condense and mix with the melted rock. The melt flows to the bottom of the cavity where it is quenched by fractured rock fragments falling from above as the cavity collapses. Measurements indicate that about 740 tonnes of rock and/or soil are melted for every kiloton (1012 calories) of explosive energy, or about 25% of the explosive energy goes to melting rock. The resulting glass composition reflects the composition of the unaltered rock with explosive debris. The appearance ranges from white pumice to dense, dark lava. The bulk composition and color vary with the amount of explosive iron incorporated into the glass. The refractory explosion products are mixed with the solidified melt, although the degree of mixing is variable. Electron microprobe studies of glasses produced by Rainier in welded tuff have produced the following results: glasses are dehydrated relative to the host media, glasses are extremely heterogeneous on a 20 μm scale, a ubiquitous feature is the presence of dark marble-cake regions in the glass, which were locally enriched in iron and may be related to the debris, optically amorphous regions provide evidence of shock melting, only limited major element redistribution and homogenization occur within the cavity

  16. Fire and explosion hazards of oil shale

    Energy Technology Data Exchange (ETDEWEB)

    1989-01-01

    The US Bureau of Mines publication presents the results of investigations into the fire and explosion hazards of oil shale rocks and dust. Three areas have been examined: the explosibility and ignitability of oil shale dust clouds, the fire hazards of oil shale dust layers on hot surfaces, and the ignitability and extinguishment of oil shale rubble piles. 10 refs., 54 figs., 29 tabs.

  17. 基于多元线性回归-BP 神经网络的自移式破碎机生产能力预测%Prediction of self-moving crusher's production based on multiple linear regression-BP neural network

    Institute of Scientific and Technical Information of China (English)

    张崇欣; 李克民; 肖双双

    2013-01-01

    The equipment running time ,explosives consumption and shovel cycle time are selected to be the quantifiable argument ,and the production capacity of the system is selected to be the dependent variable to establish a multiple linear regression equation ,based on analyzing the factors affected the self-moving crusher system's production .The equation can predict system production .The BP neural network is established to adjust residuals of the multiple linear regression model ,used with the feature of the model in nonlinear fitting .The prediction accuracy is significantly improved .The error of multiple linear regression model is 7% ,and the error of the modified model is 1 .42% .%本文在对自移式破碎机系统生产能力影响因素分析的基础上,选取设备运行时间、炸药单耗和电铲作业周期时间作为可量化自变量,以系统生产能力为因变量建立多元线性回归方程,得到系统生产能力的预测模型。对多元线性回归模型预测结果的残差建立BP神经网络模型,利BP神经网络非线性拟合能力对残差进行调整。以某露天煤矿自移式破碎机系统生产数据为样本进行计算,多元线性回归模型预测误差为7%,修正后的模型预测误差为1.42%,预测精度显著提高。

  18. Environmental control for nuclear explosives

    International Nuclear Information System (INIS)

    Peaceful applications introduce some new environmental considerations into the design of nuclear explosives. Much of the experience gained in weapon work can be applied, but the requirement of survival in a very deep hole is not found in any military system. We will briefly mention the overall environment and make a few comparisons with some general characteristics of the weapon environment. The major portion of this paper is devoted to the special problems of pressure and temperature found in the emplacement environment. Potential users should know where we stand with regard to survival in hostile environments in terms of feasibility and possible effects on field operations. In all applications there are several things competing for the available diameter. Given that explosives can be made to work over a range of diameters and that necessary environmental control is feasible, all further discussions can be related to the cost of providing a hole big enough to accomplish the task. The items competing for diameter are: 1) bare nuclear assembly 2) insulation and cooling system if needed 3) pressure canister 4) shielding material 5) emplacement clearance All of these must be considered with the cost of the hole in optimizing an overall design. Conditions in a particular location will affect the shielding requirements and the emplacement clearance. The nuclear assembly can vary in size, but the long development time requires that decisions be made quite early, perhaps in ignorance of the economic details of a particular application. The pressure canister is a relatively straightforward design problem that can be resolved by giving appropriate consideration to all of the design requirements. In particular for 20,000 psi pressure in the emplacement hole, a canister of heat-treated alloy steel having a yield strength of 200,000 psi and a wall thickness which is about .07 times the outside diameter is adequate and straight- forward to fabricate. The insulation and cooling

  19. Explosives remain preferred methods for platform abandonment

    International Nuclear Information System (INIS)

    Economics and safety concerns indicate that methods involving explosives remain the most practical and cost-effective means for abandoning oil and gas structures in the Gulf of Mexico. A decade has passed since 51 dead sea turtles, many endangered Kemp's Ridleys, washed ashore on the Texas coast shortly after explosives helped remove several offshore platforms. Although no relationship between the explosions and the dead turtles was ever established, in response to widespread public concern, the US Minerals Management Service (MMS) and National Marine Fisheries Service (NMFS) implemented regulations limiting the size and timing of explosive charges. Also, more importantly, they required that operators pay for observers to survey waters surrounding platforms scheduled for removal for 48 hr before any detonations. If observers spot sea turtles or marine mammals within the danger zone, the platform abandonment is delayed until the turtles leave or are removed. However, concern about the effects of explosives on marine life remains

  20. Hydrodynamics of Explosion Experiments and Models

    CERN Document Server

    Kedrinskii, Valery K

    2005-01-01

    Hydronamics of Explosion presents the research results for the problems of underwater explosions and contains a detailed analysis of the structure and the parameters of the wave fields generated by explosions of cord and spiral charges, a description of the formation mechanisms for a wide range of cumulative flows at underwater explosions near the free surface, and the relevant mathematical models. Shock-wave transformation in bubbly liquids, shock-wave amplification due to collision and focusing, and the formation of bubble detonation waves in reactive bubbly liquids are studied in detail. Particular emphasis is placed on the investigation of wave processes in cavitating liquids, which incorporates the concepts of the strength of real liquids containing natural microinhomogeneities, the relaxation of tensile stress, and the cavitation fracture of a liquid as the inversion of its two-phase state under impulsive (explosive) loading. The problems are classed among essentially nonlinear processes that occur unde...

  1. Scaled experiments of explosions in cavities

    Science.gov (United States)

    Grun, J.; Cranch, G. A.; Lunsford, R.; Compton, S.; Walton, O. R.; Weaver, J.; Dunlop, W.; Fournier, K. B.

    2016-05-01

    Consequences of an explosion inside an air-filled cavity under the earth's surface are partly duplicated in a laboratory experiment on spatial scales 1000 smaller. The experiment measures shock pressures coupled into a block of material by an explosion inside a gas-filled cavity therein. The explosion is generated by suddenly heating a thin foil that is located near the cavity center with a short laser pulse, which turns the foil into expanding plasma, most of whose energy drives a blast wave in the cavity gas. Variables in the experiment are the cavity radius and explosion energy. Measurements and GEODYN code simulations show that shock pressures measured in the block exhibit a weak dependence on scaled cavity radius up to ˜25 m/kt1/3, above which they decrease rapidly. Possible mechanisms giving rise to this behavior are described. The applicability of this work to validating codes used to simulate full-scale cavity explosions is discussed.

  2. Seismometric detection of underground nuclear explosions

    International Nuclear Information System (INIS)

    Processes which take place instantaneously after the detonation of the underground nuclear device are explained. Methods to discriminate between nuclear explosions and earthquakes by studying the P-waves and S-waves are described. Empirical relationships have been developed between the magnitude and yield of the explosions. The effect of tectonic strain release on seismic discrimination is mentioned. Propagation of shock waves in atmospheric explosions in compared with the propagation of waves in underground explosions. It is pointed out that underground nuclear explosions are very helpful in the studies on the structure of the interior of the earth to build up velocity models for earthquakes and also to predict earthquakes in some regions. (A.K.)

  3. Underwater detection of a TNT explosive

    International Nuclear Information System (INIS)

    Tagged neutron inspection system was used for the detection of explosive in water. Neutrons were produced in d+t nuclear reaction with API-120 sealed tube neutron generator. Five kilograms of the TNT explosive were measured in a pool filled with water. Measurements were done in target in, target out configuration. In addition, a sandwich made of 6 mm thick iron plates with explosive in between was placed between two layers of sea sediments and measured underwater. Sediments were collected in the Adriatic Sea. Measurements were repeated with TNT explosive replaced by rocks of similar size and shape. Neutron tube was rotated in order to find the position and dimension of explosive (rocks) in the sandwich. It was found that TNT can be detected in the water. Moreover, TNT and, sea rocks have had distinguished ratio of carbon and oxygen while measured between 6 mm thick iron plates and placed between layers of sediments. (authors)

  4. Explosion prediction of oil gas using SVM and Logistic Regression

    OpenAIRE

    Wang, Xiaofei; Zhang, Mingming; Shen, Liyong; Gao, Suixiang

    2012-01-01

    The prevention of dangerous chemical accidents is a primary problem of industrial manufacturing. In the accidents of dangerous chemicals, the oil gas explosion plays an important role. The essential task of the explosion prevention is to estimate the better explosion limit of a given oil gas. In this paper, Support Vector Machines (SVM) and Logistic Regression (LR) are used to predict the explosion of oil gas. LR can get the explicit probability formula of explosion, and the explosive range o...

  5. Network Traffic Prediction based on Particle Swarm BP Neural Network

    Directory of Open Access Journals (Sweden)

    Yan Zhu

    2013-11-01

    Full Text Available The traditional BP neural network algorithm has some bugs such that it is easy to fall into local minimum and the slow convergence speed. Particle swarm optimization is an evolutionary computation technology based on swarm intelligence which can not guarantee global convergence. Artificial Bee Colony algorithm is a global optimum algorithm with many advantages such as simple, convenient and strong robust. In this paper, a new BP neural network based on Artificial Bee Colony algorithm and particle swarm optimization algorithm is proposed to optimize the weight and threshold value of BP neural network. After network traffic prediction experiment, we can conclude that optimized BP network traffic prediction based on PSO-ABC has high prediction accuracy and has stable prediction performance.

  6. AcEST: BP914772 [AcEST

    Lifescience Database Archive (English)

    Full Text Available -BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9147...avid J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  7. AcEST: BP917801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-ve...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs,

  8. BP Spill in the Gulf of Mexico Water Data

    Data.gov (United States)

    U.S. Environmental Protection Agency — In response to the BP oil spill, EPA monitored water near the spill. While emergency response data collection has ended, results continue to be available on this...

  9. AcEST: BP911902 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911902|Adiantum capillus-vener...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911902|Adiantum capillus-veneris mRNA, clone: Y...3.4 tr|Q1VZT4|Q1VZT4_9FLAO Putative uncharacterized protein OS=Psych... 33 5.7 tr|Q2K9T6|Q2K9T6_RHIEC Hypothetical conserve...YMU001_000010_F05 501 Adiantum capillus-veneris mRNA. clone: YMU001_000010_F05. BP9...11902 - Show BP911902 Clone id YMU001_000010_F05 Library YMU01 Length 501 Definition Adiantum capillus-veneris mRNA. clone

  10. AcEST: BP921669 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ase OS=Photorhabdus lum... 32 2.3 sp|Q91009|NTRK1_CHICK High affinity nerve growth factor receptor... 31 5.1...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921669|Adiantum capillus-veneris mRNA, clone...y= BP921669|Adiantum capillus-veneris mRNA, clone: YMU001_000152_G06. (579 letters) Database: uniprot_trembl...YMU001_000152_G06 579 Adiantum capillus-veneris mRNA. clone: YMU001_000152_G06. BP9...21669 CL3975Contig1 Show BP921669 Clone id YMU001_000152_G06 Library YMU01 Length 579 Definition Adiantum capillus-vener

  11. AcEST: BP919108 [AcEST

    Lifescience Database Archive (English)

    Full Text Available + Sbjct: 239 LFGIKLPALENAYV 252 >sp|P06440|VP4B_VACCW Major core protein P4b OS=Vaccinia virus (strain Western Reserve...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919108|Adiantum capillus-vener...YMU001_000121_C11 516 Adiantum capillus-veneris mRNA. clone: YMU001_000121_C11. BP9...19108 - Show BP919108 Clone id YMU001_000121_C11 Library YMU01 Length 516 Definition Adiantum capillus-veneris mRNA. clone...y= BP919108|Adiantum capillus-veneris mRNA, clone: YMU001_000121_C11. (516 letters) Database: unipr

  12. BP Spill in the Gulf of Mexico Sediment Data

    Data.gov (United States)

    U.S. Environmental Protection Agency — In response to the BP oil spill, EPA monitored sediment near the spill. While emergency response data collection has ended, results continue to be available on this...

  13. AcEST: BP912177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_A09 469 Adiantum capillus-veneris mRNA. clone: YMU001_000016_A09. BP912177 - Show BP912177...is mRNA. clone: YMU001_000016_A09. Accession BP912177 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP912177|Adiantum capillus-veneris mRNA, clone: YMU...rotein 1-3 OS=Homo sapiens GN=KRTAP1-3 PE=2 SV=1 Length = 177 Score = 29.3 bits (64), Expect = 9.1 Identitie... >sp|Q07627|KRA11_HUMAN Keratin-associated protein 1-1 OS=Homo sapiens GN=KRTAP1-1 PE=2 SV=1 Length = 177 Sc

  14. AcEST: BP917748 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_H11 456 Adiantum capillus-veneris mRNA. clone: YMU001_000104_H11. BP9177...48 CL3751Contig1 Show BP917748 Clone id YMU001_000104_H11 Library YMU01 Length 456 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_H11. Accession BP917748 Tissue type prothallium Developmental stag...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917748|Adiantum capillus-v...|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 Length = 603 Score = 72.8 bits (177

  15. AcEST: BP917760 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_B02 559 Adiantum capillus-veneris mRNA. clone: YMU001_000105_B02. BP9177...60 CL2121Contig1 Show BP917760 Clone id YMU001_000105_B02 Library YMU01 Length 559 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_B02. Accession BP917760 Tissue type prothallium Developmental stag...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917760|...5|GAG_VILVK Gag polyprotein OS=Maedi visna virus (strain KV1772) GN=gag PE=3 SV=1 Length = 442 Score = 35.4

  16. AcEST: BP918618 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000115_E11 490 Adiantum capillus-veneris mRNA. clone: YMU001_000115_E11. BP918618... CL3774Contig1 Show BP918618 Clone id YMU001_000115_E11 Library YMU01 Length 490 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000115_E11. Accession BP918618 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918618...6WRL0|Y3322_SHEB8 UPF0250 protein Shew185_3322 OS=Shewanella... 32 1.6 sp|A3D7P7|

  17. AcEST: BP918180 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E01 492 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E01. BP91818...0 CL642Contig1 Show BP918180 Clone id YMU001_000110_E01 Library YMU01 Length 492 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000110_E01. Accession BP918180 Tissue type prothallium Developmental stage... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918180|Adiantum capil...otein OS=Bos taurus GN=RRP15 ... 35 0.24 sp|Q8TFG4|YL54_SCHPO Uncharacterized protein PB18E9.04c OS=Schiz...

  18. AcEST: BP918185 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E06 534 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E06. BP91818...5 CL3982Contig1 Show BP918185 Clone id YMU001_000110_E06 Library YMU01 Length 534 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000110_E06. Accession BP918185 Tissue type prothallium Developmental stag..., Nucleic Acids Res. 25:3389-3402. Query= BP918185|Adiantum capillus-veneris mRNA, clone: YMU001_000110_E06....(67), Expect = 5.6 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +2 Query: 50 REKAVGGVLSKFAADRPH

  19. AcEST: BP918184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E05 469 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E05. BP91818...4 CL72Contig1 Show BP918184 Clone id YMU001_000110_E05 Library YMU01 Length 469 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000110_E05. Accession BP918184 Tissue type prothallium Developmental stage ...ic Acids Res. 25:3389-3402. Query= BP918184|Adiantum capillus-veneris mRNA, clone...re = 30.0 bits (66), Expect = 5.3 Identities = 22/85 (25%), Positives = 36/85 (42%) Frame = +1 Query: 18

  20. AcEST: BP918183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E04 482 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E04. BP918183 - Show BP91818...is mRNA. clone: YMU001_000110_E04. Accession BP918183 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP918183|Adiantum capillus-veneris mRNA, clone: ...5RBR7|LYPA1_PONAB Acyl-protein thioesterase 1 OS=Pongo abeli... 35 0.18 sp|O75608|LYPA1_HUMAN Acyl-protein t...hioesterase 1 OS=Homo sapien... 35 0.18 sp|Q750X7|APTH1_ASHGO Acyl-protein thioesterase 1 OS=Ashbya goss... 35 0.18

  1. AcEST: BP918218 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_H06 505 Adiantum capillus-veneris mRNA. clone: YMU001_000110_H06. BP918218... CL468Contig1 Show BP918218 Clone id YMU001_000110_H06 Library YMU01 Length 505 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000110_H06. Accession BP918218 Tissue type prothallium Developmental stage...s. 25:3389-3402. Query= BP918218|Adiantum capillus-veneris mRNA, clone: YMU001_000110_H06. (505 letters) Dat...re = 33.5 bits (75), Expect = 0.58 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Frame = +2 Query: 18

  2. AcEST: BP918181 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E02 549 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E02. BP918181 CL18...38Contig1 Show BP918181 Clone id YMU001_000110_E02 Library YMU01 Length 549 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000110_E02. Accession BP918181 Tissue type prothallium Developmental stage - Contig ID CL18...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918181|Adiantum capillus-veneris mRN...RFLYVFGGMVDGLLQPAASSGLRFDGELFMVE 460 Query: 189 LTP*KITLEFASL-YNYKPG 133 L L F+ L + +PG Sbjct: 461 L-----VLG

  3. AcEST: BP918718 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000116_F12 450 Adiantum capillus-veneris mRNA. clone: YMU001_000116_F12. BP918718 - Show BP918718...is mRNA. clone: YMU001_000116_F12. Accession BP918718 Tissue type prothallium Developmental stage - Contig I...um capillus-veneris Align length 98 Score (bit) 184.0 E-value 2.0e-46 Report BLASTX 2.2.19 [Nov-02-2008] Ref...rams, Nucleic Acids Res. 25:3389-3402. Query= BP918718|Adiantum capillus-veneris ...nificant alignments: (bits) Value sp|Q85FP1|NU2C_ADICA NAD(P)H-quinone oxidoreductase chain 2, chl... 18

  4. AcEST: BP918918 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000119_A05 543 Adiantum capillus-veneris mRNA. clone: YMU001_000119_A05. BP918918 - Show BP918918...is mRNA. clone: YMU001_000119_A05. Accession BP918918 Tissue type prothallium Developmental stage - Contig I...Definition sp|A8ERT9|SYP_ARCB4 Prolyl-tRNA synthetase OS=Arcobacter butzleri (strain RM4018) Align length 62...c Acids Res. 25:3389-3402. Query= BP918918|Adiantum capillus-veneris mRNA, clone: YMU001_000119_A05. (543 le...nthetase OS=Arcobacter butzleri (strain RM4018) GN=proS PE=3 SV=1 Length = 568 Score = 35.8 bits (81), Expec

  5. AcEST: BP918018 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F06 436 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F06. BP918018 - Show BP918018...is mRNA. clone: YMU001_000108_F06. Accession BP918018 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918018|Adiantum capillus-veneris mRNA, clone: YM..._ARATH Probable alpha,alpha-trehalose-phosphate sy... 190 3e-48 sp|Q9LRA7|TPS9_ARATH Probable alpha,alpha-tr...ehalose-phosphate sy... 189 3e-48 sp|Q0WUI9|TPS8_ARATH Probable alpha,alpha-trehalose-phosphate sy... 18

  6. AcEST: BP921271 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_G02 451 Adiantum capillus-veneris mRNA. clone: YMU001_000147_G02. BP921271 CL143Cont...ig1 Show BP921271 Clone id YMU001_000147_G02 Library YMU01 Length 451 Definition Adiantum capillus-veneris mRNA. clon... rerio GN=spon2a PE=2 SV=1 Length = 334 Score = 33.9 bits (76), Expect = 4.2 Identities = 21/57 (36%), Pos...e: YMU001_000147_G02. Accession BP921271 Tissue type prothallium Developmental stage - Contig ID CL143Cont...ucleic Acids Res. 25:3389-3402. Query= BP921271|Adiantum capillus-veneris mRNA, clon

  7. EST Table: BP116780 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP116780 brS-0568 11/12/09 GO hit GO:0006754(ATP biosynthetic process)|GO:0006812(cation transpo ... ase activity, coupled to transmembrane movement of ions , phosphorylative mechanism)|GO:0016020(membrane) 1 ...

  8. EST Table: BP120654 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP120654 ceN-3489 11/12/09 GO hit GO:0006754(ATP biosynthetic process)|GO:0006812(cation transpo ... ase activity, coupled to transmembrane movement of ions , phosphorylative mechanism)|GO:0016020(membrane) 1 ...

  9. AcEST: BP915124 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000066_G08 467 Adiantum capillus-veneris mRNA. clone: YMU001_000066_G08. BP915124 - Show ... DVDNNRCYMLVHQAKRLNSPCLLVTNHDSSVFPNL----------------VTT ... 253 Query: 280 LYADAKSTAGNEERGIVFDRILCDVPCSGDGTIRK ...

  10. AcEST: BP919090 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_B05 548 Adiantum capillus-veneris mRNA. clone: YMU001_000121_B05. BP919090 - Show BP919090...is mRNA. clone: YMU001_000121_B05. Accession BP919090 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP919090|Adiantum capillus-veneris mRNA, clone: YMU001_000121_B...HUMAN Transferrin receptor protein 2 OS=Homo sapi... 75 2e-13 sp|Q90997|TFR1_CHICK Transferrin receptor prot...02786|TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapi... 61 3e-09 sp|Q2V905|TFR1_HORSE Transferrin re

  11. AcEST: BP921278 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_G12 241 Adiantum capillus-veneris mRNA. clone: YMU001_000147_G12. BP921278 CL4207C ... RSRPRAPAPVPQPFSLPEPSQPILPSVLSLLGLPTPGPSHSDGSFNLLGS-DAHL ... 439 Query: 161 HPSQTFLSDEPPQPHHKEEFEAPRSHS 241 P T ...

  12. Ionospheric effects of supernova explosions

    Science.gov (United States)

    Edwards, P. J.

    Possible ionospheric effects of supernova explosions are considered, with special attention given to those of SN 1987a. Results are presented on the calculations of anticipated X-ray/UV flare parameters, including the shock temperature, the minimum flare duration, the average photon energy, and the shock-front travel time for a range of stellar radii bracketing SK 202-69, which was identified by White Malin (1987) as the progenitor star for SN 1987a. It is shown that the characteristics of the X-ray/UV flare are strongly influenced by the radius of the shock wave breakout, so that the flare from SN 1987a can be anticipated to have characteristics intermediate between those attributed to compact stars and stars with extended envelopes.

  13. Halon explosion protection system development

    International Nuclear Information System (INIS)

    A loss-of-coolant-accident in a water-cooled nuclear reactor could result in the accumulation of hydrogen and oxygen gases in the containment vessel, ignition of which might produce explosion pressures that exceed the containment design. Protection against suh a hazard can be provided by an inerting system which utilizes Halon 1301 (CF3Br). This inerting gas would be stored in the liquified state and injected only if needed. A development study is reported in which the quantity of Halon required for inerting has been measured, and several envisioned problems investigated. A sub-scale system has been fabicated and used to simulate operation of an actual system under post-LOCA conditions. The testing, together with a system analysis, indicates that the 1301 inerting concept is very suitable for containment application

  14. Mass extinctions and supernova explosions

    CERN Document Server

    Korschinek, Gunther

    2016-01-01

    A nearby supernova (SN) explosion could have negatively influenced life on Earth, maybe even been responsible for mass extinctions. Mass extinction poses a significant extinction of numerous species on Earth, as recorded in the paleontologic, paleoclimatic, and geological record of our planet. Depending on the distance between the Sun and the SN, different types of threats have to be considered, such as ozone depletion on Earth, causing increased exposure to the Sun's ultraviolet radiation, or the direct exposure of lethal x-rays. Another indirect effect is cloud formation, induced by cosmic rays in the atmosphere which result in a drop in the Earth's temperature, causing major glaciations of the Earth. The discovery of highly intensive gamma ray bursts (GRBs), which could be connected to SNe, initiated further discussions on possible life-threatening events in Earth's history. The probability that GRBs hit the Earth is very low. Nevertheless, a past interaction of Earth with GRBs and/or SNe cannot be exclude...

  15. BP Spill Monitoring Data April-September 2010

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset provides all of the monitoring data from the the British Petroleum Deepwater Horizon Rig Explosion Emergency Response. The data were collected between...

  16. BP Spill Sampling Data April-September 2010

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset provides all of the sampling data from the the British Petroleum Deepwater Horizon Rig Explosion Emergency Response. The data were collected between...

  17. BP/Mobil. Joint-venture directions for use

    International Nuclear Information System (INIS)

    This paper analyzes the economical reasons which have led BP and Mobil companies to join their forces in 1996. Thanks to their complementarity and to their European implantation, the two companies could win the first or second position in petroleum products marketing in 8 European countries. The cumulated petrol sales and the number of petrol stations of the BP/Mobil joint venture are the highest in Europe (800 petrol stations in France). (J.S.)

  18. EST Table: BP115336 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP115336 brP-0777 10/09/28 61 %/206 aa ref|XP_001843664.1| neuroendocrine protein 7...b2 [Culex quinquefasciatus] gb|EDS33875.1| neuroendocrine protein 7b2 [Culex quinquefasciatus] 10/08/28 42 %...1 %/192 aa gi|91081787|ref|XP_973692.1| PREDICTED: similar to neuroendocrine protein 7b2 [Tribolium castaneum] BP115163 brP- ...

  19. AcEST: BP915450 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_F10 516 Adiantum capillus-veneris mRNA. clone: YMU001_000071_F10. BP915450 CL1053C ... capillus-veneris mRNA. clone: YMU001_000071_F10. Acce ssion BP915450 Tissue type prothallium Developmenta ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _5217 PE=4 SV=1 Length = 278 Score = 36.6 bits (83) ...

  20. AcEST: BP912733 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_C05 633 Adiantum capillus-veneris mRNA. clone: YMU001_000022_C05. BP912733 - Show ... capillus-veneris mRNA. clone: YMU001_000022_C05. Acce ssion BP912733 Tissue type prothallium Developmenta ... FCSIAHHLGCLAQG---LAYRLIFFNTSSTSCSWLIATSSFGAVLADLLPLCCE ... 370 VHF LGC+AQG L RL TSS + + F D P+CCE ... Sbjct: 231 ... FVRWVPSLGCVAQGGEDLTVRLWDVRTSSDGMKAIDLSLGFTMACIDYHPICCE ... 286 ...

  1. AcEST: BP920431 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000137_A04 293 Adiantum capillus-veneris mRNA. clone: YMU001_000137_A04. BP920431 CL2921C ... capillus-veneris mRNA. clone: YMU001_000137_A04. Acce ssion BP920431 Tissue type prothallium Developmenta ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _2211 PE=4 SV=1 Length = 234 Score = 32.7 bits (73) ...

  2. AcEST: BP919442 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000125_B07 468 Adiantum capillus-veneris mRNA. clone: YMU001_000125_B07. BP919442 - Show ... capillus-veneris mRNA. clone: YMU001_000125_B07. Acce ssion BP919442 Tissue type prothallium Developmenta ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _5053 PE=4 SV=1 Length = 273 Score = 35.0 bits (79) ...

  3. AcEST: BP919225 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_F06 379 Adiantum capillus-veneris mRNA. clone: YMU001_000122_F06. BP919225 CL2262C ... capillus-veneris mRNA. clone: YMU001_000122_F06. Acce ssion BP919225 Tissue type prothallium Developmenta ... Flavoprotein OS=Cyanothece (strain ATCC 51142) GN=cce _3835 PE=4 SV=1 Length = 575 Score = 80.1 bits (196 ...

  4. AcEST: BP912073 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_G04 498 Adiantum capillus-veneris mRNA. clone: YMU001_000012_G04. BP912073 CL1947C ... capillus-veneris mRNA. clone: YMU001_000012_G04. Acce ssion BP912073 Tissue type prothallium Developmenta ... ining protein OS=Cyanothece (strain ATCC 51142) GN=cce _2739 PE=4 SV=1 Length = 94 Score = 139 bits (349), ...

  5. AcEST: BP916870 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000093_A05 427 Adiantum capillus-veneris mRNA. clone: YMU001_000093_A05. BP916870 CL1798C ... capillus-veneris mRNA. clone: YMU001_000093_A05. Acce ssion BP916870 Tissue type prothallium Developmenta ... YAA5 Protease OS=Cyanothece (strain ATCC 51142) GN=cce _3195 PE=4 SV=1 Length = 517 Score = 33.1 bits (74) ...

  6. AcEST: BP915556 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000073_A06 466 Adiantum capillus-veneris mRNA. clone: YMU001_000073_A06. BP915556 CL403Co ... capillus-veneris mRNA. clone: YMU001_000073_A06. Acce ssion BP915556 Tissue type prothallium Developmenta ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _2722 PE=4 SV=1 Length = 179 Score = 35.0 bits (79) ...

  7. AcEST: BP921577 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000151_F10 408 Adiantum capillus-veneris mRNA. clone: YMU001_000151_F10. BP921577 - Show ... capillus-veneris mRNA. clone: YMU001_000151_F10. Acce ssion BP921577 Tissue type prothallium Developmenta ... -like protein OS=Cyanothece (strain ATCC 51142) GN=cce _2464 PE=4 SV=1 Length = 555 Score = 34.3 bits (77) ...

  8. AcEST: BP915857 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000078_B12 469 Adiantum capillus-veneris mRNA. clone: YMU001_000078_B12. BP915857 - Show ... capillus-veneris mRNA. clone: YMU001_000078_B12. Acce ssion BP915857 Tissue type prothallium Developmenta ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _3872 PE=4 SV=1 Length = 629 Score = 35.0 bits (79) ...

  9. AcEST: BP912608 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H03 451 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H03. BP912608 - Show ... capillus-veneris mRNA. clone: YMU001_000020_H03. Acce ssion BP912608 Tissue type prothallium Developmenta ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _3238 PE=4 SV=1 Length = 273 Score = 32.7 bits (73) ...

  10. AcEST: BP917922 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000107_D04 507 Adiantum capillus-veneris mRNA. clone: YMU001_000107_D04. BP917922 - Show ... capillus-veneris mRNA. clone: YMU001_000107_D04. Acce ssion BP917922 Tissue type prothallium Developmenta ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _5102 PE=4 SV=1 Length = 273 Score = 28.9 bits (63) ...

  11. AcEST: BP920193 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_B07 515 Adiantum capillus-veneris mRNA. clone: YMU001_000134_B07. BP920193 CL2940C ... capillus-veneris mRNA. clone: YMU001_000134_B07. Acce ssion BP920193 Tissue type prothallium Developmenta ... ease factor 2 OS=Cyanothece (strain ATCC 51142) GN=cce _4187 PE=4 SV=1 Length = 358 Score = 239 bits (609) ...

  12. AcEST: BP919484 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000125_F03 338 Adiantum capillus-veneris mRNA. clone: YMU001_000125_F03. BP919484 CL2736C ... capillus-veneris mRNA. clone: YMU001_000125_F03. Acce ssion BP919484 Tissue type prothallium Developmenta ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _0870 PE=4 SV=1 Length = 421 Score = 33.1 bits (74) ...

  13. Network Traffic Prediction based on Particle Swarm BP Neural Network

    OpenAIRE

    Yan Zhu; Guanghua Zhang; Jing Qiu

    2013-01-01

    The traditional BP neural network algorithm has some bugs such that it is easy to fall into local minimum and the slow convergence speed. Particle swarm optimization is an evolutionary computation technology based on swarm intelligence which can not guarantee global convergence. Artificial Bee Colony algorithm is a global optimum algorithm with many advantages such as simple, convenient and strong robust. In this paper, a new BP neural network based on Artificial Bee Colony algorithm and part...

  14. The human element of right-sizing. BP experiences

    International Nuclear Information System (INIS)

    BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning

  15. Sensor Temperature Compensation Technique Simulation Based on BP Neural Network

    OpenAIRE

    Xiangwu Wei

    2013-01-01

    Innovatively, neural network function programming in the BPNN (BP neural network) tool boxes from MATLAB are applied, and data processing is done about CYJ-101 pressure sensor, and the problem of the sensor temperature compensation is solved. The paper has made the pressure sensors major sensors and temperature sensor assistant sensors, input the voltage signal from the two sensors into the established BP neural network model, and done the simulation under the NN Toolbox environment of MATLAB...

  16. AcEST: BP918043 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A02 493 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A02. BP918043 CL3885C ... ession BP918043 Tissue type prothallium Developmental s tage - Contig ID CL3885Contig1 Sequence AATTCGCGGC ... NSLDEIQFSRGKSEFYQLLCAIVACGHIDQQL 1798 Query: 195 LLALS NMF 172 +LSN F Sbjct: 1799 GTSLSNAF 1806 >sp|Q4IBR4 ...

  17. EST Table: BP117229 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP117229 ce--0036 11/12/09 n.h 10/09/28 65 %/184 aa ref|XP_001601352.1| PREDICTED: similar to spectrin...aa K10B3.10#CE07373#WBGene00004951#locus:spc-1#spectrin alpha chain#status:Partially_confirmed#UniProt:Q2140...973750.2| PREDICTED: similar to spectrin [Tribolium castaneum] BP117229 ce-- ...

  18. Dicty_cDB: FC-BP17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BP17 (Link to dictyBase) - - - - FC-BP17E (Link to Original... site) - - - - - - FC-BP17E 493 Show FC-BP17 Library FC (Link to library) Clone ID FC-BP17 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BP/FC-BP1...7Q.Seq.d/ Representative seq. ID FC-BP17E (Link to Original s...ite) Representative DNA sequence >FC-BP17 (FC-BP17Q) /CSM/FC/FC-BP/FC-BP17Q.Seq.d/ GAACTTTCCTTGCTGTTAAACCAGA

  19. Chemical analysis kit for the presence of explosives

    Science.gov (United States)

    Eckels, Joel Del; Nunes; Peter J.; Alcaraz, Armando; Whipple, Richard E.

    2011-05-10

    A tester for testing for explosives associated with a test location comprising a first explosives detecting reagent; a first reagent holder, the first reagent holder containing the first explosives detecting reagent; a second explosives detecting reagent; a second reagent holder, the second reagent holder containing the second explosives detecting reagent; a sample collection unit for exposure to the test location, exposure to the first explosives detecting reagent, and exposure to the second explosives detecting reagent; and a body unit containing a heater for heating the sample collection unit for testing the test location for the explosives.

  20. 27 CFR 555.109 - Identification of explosive materials.

    Science.gov (United States)

    2010-04-01

    ... Business or Operations § 555.109 Identification of explosive materials. (a) General. Explosive materials... in the English language, using Roman letters and Arabic numerals. (3) Licensed manufacturers...

  1. Cycling more for safer cycling

    OpenAIRE

    VAN HOUT, Kurt

    2009-01-01

    Cycling presents a lot of benefits to the individual and to society. Health, environment, accessibility, local businesses, … all gain when more people cycle. Yet many governments are reluctant when it comes to promoting cycling, mainly because of (perceived) safety issues. Since studies have established a clear and consistent relationship between bicycle use and cyclist accident risk, this lack of bicycle promotion will influence the safety outcome of bicyclists. In this paper the relation be...

  2. Cycling injuries.

    OpenAIRE

    Cohen, G. C.

    1993-01-01

    Bicycle-related injuries have increased as cycling has become more popular. Most injuries to recreational riders are associated with overuse or improper fit of the bicycle. Injuries to racers often result from high speeds, which predispose riders to muscle strains, collisions, and falls. Cyclists contact bicycles at the pedals, seat, and handlebars. Each is associated with particular cycling injuries.

  3. Prevalence of the 4977-bp and 4408-bp mitochondrial DNA deletions in mesenteric arteries from patients with colorectal cancer.

    Science.gov (United States)

    Li, Tao; Chen, Gui-Lan; Lan, Huan; Mao, Liang; Zeng, Bo

    2016-09-01

    Mitochondrial DNA (mtDNA) deletions are found in many diseased tissues and lead to impairment of mitochondrial functions. In this study, we found wide presence of the common 4977-bp and a novel 4408-bp deletion in the mtDNA of mesenteric arteries from patients with colorectal cancer. These two deletions were also detected in samples from healthy individuals. The content of mtDNA with the 4977-bp deletion was significantly lower in healthy controls than cancer-associated samples, and there was no significant difference for the 4408-bp deletion between the two groups. These results suggest that mtDNA in blood vessels around cancer cells may be strongly affected by oxidative stress and tend to accumulate more large-scale variations. PMID:26332461

  4. Bp44mT: an orally active iron chelator of the thiosemicarbazone class with potent anti-tumour efficacy

    Science.gov (United States)

    Yu, Y; Rahmanto, Y Suryo; Richardson, DR

    2012-01-01

    BACKGROUND AND PURPOSE Our previous studies demonstrated that a thiosemicarbazone iron chelator (di-2-pyridylketone-4,4-dimethyl-3-thiosemicarbazone; Dp44mT) possesses potent and selective anti-cancer activity but led to cardiotoxicity at non-optimal doses. In this study, we examined the in vivo anti-tumour efficacy and tolerability of a new-generation 2-benzoylpyridine thiosemicarbazone iron chelator (2-benzoylpyridine-4,4-dimethyl-3-thiosemicarbazone; Bp44mT) administered via the oral or i.v. routes. EXPERIMENTAL APPROACH BpT chelators were tested in vitro against human lung cancer cells (DMS-53) and in vivo in DMS-53 tumour xenografts in mice. The toxicity of Bp44mT in vivo and its effects on the expression of iron-regulated molecules involved in growth and cell cycle control were investigated. KEY RESULTS Administration of Bp44mT by either route resulted in marked dose-dependent inhibition of tumour growth. When administered at 50 mg·kg−1 via oral gavage three times per week for 23 days, the net xenograft growth was inhibited by 75%, compared with vehicle-treated mice. Toxicological examination showed reversible alterations including slight reduction of RBC count, with a decrease of liver and splenic iron levels, which confirmed iron chelation in vivo. Importantly, in contrast to Dp44mT, the chelator-treated mice did not show cardiac histological abnormalities. There was also no significant weight loss in mice, suggesting oral administration of Bp44mT was well tolerated. CONCLUSIONS AND IMPLICATIONS This is the first study to show that Bp44mT can be given orally with potent anti-tumour efficacy. Oral administration of a novel and effective chemotherapeutic agent provides the benefits of convenience for chronic dosing regimens. PMID:21658021

  5. Fast Chromatographic Method for Explosive Profiling

    Directory of Open Access Journals (Sweden)

    Pierre-Hugues Stefanuto

    2015-05-01

    Full Text Available Security control is becoming a major global issue in strategic locations, such as airports, official buildings, and transit stations. The agencies responsible for public security need powerful and sensitive tools to detect warfare agents and explosives. Volatile signature detection is one of the fastest and easiest ways to achieve this task. However, explosive chemicals have low volatility making their detection challenging. In this research, we developed and evaluated fast chromatographic methods to improve the characterization of volatile signatures from explosives samples. The headspace of explosives was sampled with solid phase micro-extraction fiber (SPME. Following this step, classical gas chromatography (GC and comprehensive two-dimensional GC (GC×GC were used for analysis. A fast GC approach allows the elution temperature of each analyte to be decreased, resulting in decreased thermal degradation of sensitive compounds (e.g., nitro explosives. Using fast GC×GC, the limit of detection is further decreased based on the cryo-focusing effect of the modulator. Sampling of explosives and chromatographic separation were optimized, and the methods then applied to commercial explosives samples. Implementation of fast GC methods will be valuable in the future for defense and security forensics applications.

  6. Pixelated diffraction signatures for explosive detection

    Science.gov (United States)

    O'Flynn, Daniel; Reid, Caroline; Christodoulou, Christiana; Wilson, Matt; Veale, Matthew C.; Seller, Paul; Speller, Robert

    2012-06-01

    Energy dispersive X-ray diffraction (EDXRD) is a technique which can be used to improve the detection and characterisation of explosive materials. This study has performed EDXRD measurements of various explosive compounds using a novel, X-ray sensitive, pixelated, energy resolving detector developed at the Rutherford Appleton Laboratory, UK (RAL). EDXRD measurements are normally performed at a fixed scattering angle, but the 80×80 pixel detector makes it possible to collect both spatially resolved and energy resolved data simultaneously. The detector material used is Cadmium Telluride (CdTe), which can be utilised at room temperature and gives excellent spectral resolution. The setup uses characteristics from both energy dispersive and angular dispersive scattering techniques to optimise specificity and speed. The purpose of the study is to develop X-ray pattern "footprints" of explosive materials based on spatial and energy resolved diffraction data, which can then be used for the identification of such materials hidden inside packages or baggage. The RAL detector is the first energy resolving pixelated detector capable of providing an energy resolution of 1.0-1.5% at energies up to 150 keV. The benefit of using this device in a baggage scanner would be the provision of highly specific signatures to a range of explosive materials. We have measured diffraction profiles of five explosives and other compounds used to make explosive materials. High resolution spectra have been obtained. Results are presented to show the specificity of the technique in finding explosives within baggage.

  7. Countermeasures (iRED, ARED CEVIS, MEC, TVIS, T2, Periodic Fitness Evaluation, BP-ECG, HRM). Critical Readiness Review Increment 23 and 24

    Science.gov (United States)

    Toder, Carly; Gipson, Iona; Conly, Danielle; Nieschwitz, Linda; Perk, Austin

    2010-01-01

    This slide presentation reviews attempts to counteract the effects of being in space. It includes information on the Resistive Exercise Device (RED), the Advanced Resistive Exercise Device (ARED), Cycle Ergometer with Vibration Isolation and Stabilization (CEVIS), Treadmill with Vibration Isolation and Stabilization (TVIS) and periodic fitness evaluation with specific information on BP/ECG, heart rate monitor 2 and data distribution.

  8. Explosives and pyrotechnic propellants for use in long term deep space missions

    Science.gov (United States)

    Gorzynski, C. S., Jr.; Maycock, J. N.

    1973-01-01

    Explosives and pyrotechnic propellant materials which will withstand heat sterilization cycling at 125 C and ten year deep space aging under 10 to the minus 6th power torr and 66 C have been selected. The selection was accomplished through a detailed literature survey and an analytical evaluation of the physicochemical properties of the materials. The chemical components of the electroexplosive devices used in U.S. missiles and spacecraft were categorized into primary explosives, secondary explosives, and propellant ingredients. Kinetic data on such parameters as thermal decomposition and sublimation were obtained for these materials and used as a basis for the ten year life prediction. From these experimental data and some analytical calculations, a listing of candidate materials for deep space missions was made.

  9. Explosive Detection and Identification by PGNAA

    Energy Technology Data Exchange (ETDEWEB)

    E.H. Seabury; A.J. Caffrey

    2004-11-01

    The goal of this project was to determine the feasibility of using field-portable prompt gamma-ray neutron activation analysis (PGNAA) to detect and identify explosives in improvised nuclear devices (INDs). The studies were carried out using the Monte Carlo N-Particle (MCNP) code developed at Los Alamos National Laboratory. The model results were tested experimentally using explosive simulants and the PINS PGNAA system developed at Idaho National Engineering and Environmental Laboratory (INEEL). The results of the MCNP calculations and PINS measurements are presented in this report. The calculations and measurements were in good agreement and indicate that most explosives are readily distinguishable from one another.

  10. Explosive Detection and Identification by PGNAA

    International Nuclear Information System (INIS)

    The goal of this project was to determine the feasibility of using field-portable prompt gamma-ray neutron activation analysis (PGNAA) to detect and identify explosives in improvised nuclear devices (INDs). The studies were carried out using the Monte Carlo N-Particle (MCNP) code developed at Los Alamos National Laboratory. The model results were tested experimentally using explosive simulants and the PINS PGNAA system developed at Idaho National Engineering and Environmental Laboratory (INEEL). The results of the MCNP calculations and PINS measurements are presented in this report. The calculations and measurements were in good agreement and indicate that most explosives are readily distinguishable from one another

  11. Terahertz spectroscopy of explosives and drugs

    Directory of Open Access Journals (Sweden)

    A. Giles Davies

    2008-03-01

    Full Text Available Terahertz frequency radiation possesses a unique combination of desirable properties for noninvasive imaging and spectroscopy of materials. This includes the ability to obtain chemical and structural information about substances concealed within dry packaging, such as paper, plastics, and cardboard. As a result, the application of terahertz frequency spectroscopy for the sensing and identification of materials of security interest, such as explosives and, to a lesser extent, drugs-of-abuse, has caught the attention of a number of researchers and security agencies. We describe terahertz time-domain spectroscopy and examine the terahertz spectra of a wide range of drugs-of-abuse, pure explosives, and plastic explosives.

  12. Water waves generated by underwater explosion

    CERN Document Server

    Mehaute, Bernard Le

    1996-01-01

    This is the first book on explosion-generated water waves. It presents the theoretical foundations and experimental results of the generation and propagation of impulsively generated waves resulting from underwater explosions. Many of the theories and concepts presented herein are applicable to other types of water waves, in particular, tsunamis and waves generated by the fall of a meteorite. Linear and nonlinear theories, as well as experimental calibrations, are presented for cases of deep and shallow water explosions. Propagation of transient waves on dissipative, nonuniform bathymetries to

  13. Techniques of industrial radiology in military explosives

    International Nuclear Information System (INIS)

    The use of industrial radiology techniques id very important for military explosive fabrication. The cylindrical-ogive bodies made in forged metal have their interior fulfilled with high melted explosive and they must explode when they reach the target. The granades, as these bodies are called, are thrown by cannons and their interior are submitted to high pressures and accelerations which can cause a premature detonation, in most case, in interior of tube, in case of they have defects in explosive mass. The origins of defects, its localization and classification presenting the techniques used and disposable in Brazil are discussed. (M.C.K.)

  14. Explosives detection: a challenge for physical chemistry.

    Science.gov (United States)

    Steinfeld, J I; Wormhoudt, J

    1998-01-01

    The detection of explosives, energetic materials, and their associated compounds for security screening, demining, detection of unexploded ordnance, and pollution monitoring is an active area of research. A wide variety of detection methods and an even wider range of physical chemistry issues are involved in this very challenging area. This review focuses on techniques such as optical and mass spectrometry and chromatography for detection of trace amounts of explosives with short response times. We also review techniques for detecting the decomposition fragments of these materials. Molecular data for explosive compounds are reviewed where available. PMID:15012428

  15. Explosive eruptive record in the Katmai region, Alaska Peninsula: an overview

    Science.gov (United States)

    Fierstein, Judy

    2007-03-01

    At least 15 explosive eruptions from the Katmai cluster of volcanoes and another nine from other volcanoes on the Alaska Peninsula are preserved as tephra layers in syn- and post-glacial (Last Glacial Maximum) loess and soil sections in Katmai National Park, AK. About 400 tephra samples from 150 measured sections have been collected between Kaguyak volcano and Mount Martin and from Shelikof Strait to Bristol Bay (˜8,500 km2). Five tephra layers are distinctive and widespread enough to be used as marker horizons in the Valley of Ten Thousand Smokes area, and 140 radiocarbon dates on enclosing soils have established a time framework for entire soil tephra sections to 10 ka; the white rhyolitic ash from the 1912 plinian eruption of Novarupta caps almost all sections. Stratigraphy, distribution and tephra characteristics have been combined with microprobe analyses of glass and Fe Ti oxide minerals to correlate ash layers with their source vents. Microprobe analyses (typically 20 50 analyses per glass or oxide sample) commonly show oxide compositions to be more definitive than glass in distinguishing one tephra from another; oxides from the Kaguyak caldera-forming event are so compositionally coherent that they have been used as internal standards throughout this study. Other than the Novarupta and Trident eruptions of the last century, the youngest locally derived tephra is associated with emplacement of the Snowy Mountain summit dome (seven explosive events (9,400 to 2,400 14C years B.P.) preserved as tephra layers. Mount Martin erupted entirely during the Holocene, with lava coulees (>6 ka), two tephras (˜3,700 and ˜2,700 14C years B.P.), and a summit scoria cone with a crater still steaming today. Mount Katmai has three times produced very large explosive plinian to sub-plinian events (in 1912; 12 16 ka; and 23 ka) and many smaller pyroclastic deposits show that explosive activity has long been common there. Mount Griggs, fumarolically active and moderately

  16. Glacial cycles

    DEFF Research Database (Denmark)

    Kaufmann, R. K.; Juselius, Katarina

    We use a statistical model, the cointegrated vector autoregressive model, to assess the degree to which variations in Earth's orbit and endogenous climate dynamics can be used to simulate glacial cycles during the late Quaternary (390 kyr-present). To do so, we estimate models of varying complexity...... and compare the accuracy of their in-sample simulations. Results indicate that strong statistical associations between endogenous climate variables are not enough for statistical models to reproduce glacial cycles. Rather, changes in solar insolation associated with changes in Earth's orbit are needed...... to simulate glacial cycles accurately. Also, results suggest that non-linear 10 dynamics, threshold effects, and/or free oscillations may not play an overriding role in glacial cycles....

  17. Fuel cycles

    International Nuclear Information System (INIS)

    AECL publications, from the open literature, on fuels and fuel cycles used in CANDU reactors are listed in this bibliography. The accompanying index is by subject. The bibliography will be brought up to date periodically

  18. Modern microcenter heat explosion model

    International Nuclear Information System (INIS)

    Modernization and investigation of the microcenter heat explosion model of the energetic materials initiated by the pulse radiation was made in this paper. Absorptivity of aluminium nanoparticles in PETN-matrix was calculated and was taken into account. Dependences of the absorptivity on the particles' sizes and wave length of irradiation was also taken into account. It was shown that the particle's radius, which corresponds to the absorption maximum, and the peak value both depend on the irradiation wave length. For the first harmonic of the ND:YAG laser the absorption maximum corresponds to the nanoparticle's radius 100 nm, for the second harmonic to the radius it is 44 nm. The peak value increases from 0.2942 to 0.7064. Dependences of the critical initiation energy densities on the metal inclusions' radii were calculated for the energetic materials. It was concluded that the RDX – aluminium composite is the perspective material to use in optic detonator especially for the second harmonic of the ND:YAG laser

  19. Supernova neutrinos and explosive nucleosynthesis

    Energy Technology Data Exchange (ETDEWEB)

    Kajino, T. [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588, Japan and Department of Astronomy, Graduate School of Science, The University of Tokyo, Hongo 7-3-1, Bunkyo-ku, Tokyo 113-0033 (Japan); Aoki, W. [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Cheoun, M.-K. [Department of Physics, Soongsil University, Seoul 156-743 (Korea, Republic of); Hayakawa, T. [Japan Atomic Energy Agency, Shirakara-Shirane 2-4, Tokai-mura, Ibaraki 319-1195 (Japan); Hidaka, J.; Hirai, Y.; Shibagaki, S. [National Astronomical Observatory, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Mathews, G. J. [Center for Astrophysics, Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Nakamura, K. [Faculty of Science and Engineering, Waseda University, Ohkubo 3-4-1, Shinjuku, Tokyo 169-8555 (Japan); Suzuki, T. [Department of Physics, College of Humanities and Sciences, Nihon University, Sakurajosui 3-25-40, Setagaya-ku, Tokyo 156-8550 (Japan)

    2014-05-09

    Core-collapse supernovae eject huge amount of flux of energetic neutrinos. We studied the explosive nucleosyn-thesis in supernovae and found that several isotopes {sup 7}Li, {sup 11}B, {sup 92}Nb, {sup 138}La and {sup 180}Ta as well as r-process nuclei are affected by the neutrino interactions. The abundance of these isotopes therefore depends strongly on the neutrino flavor oscillation due to the Mikheyev-Smirnov-Wolfenstein (MSW) effect. We discuss first how to determine the neutrino temperatures in order to explain the observed solar system abundances of these isotopes, combined with Galactic chemical evolution of the light nuclei and the heavy r-process elements. We then study the effects of neutrino oscillation on their abundances, and propose a novel method to determine the still unknown neutrino oscillation parameters, mass hierarchy and θ{sub 13}, simultaneously. There is recent evidence that SiC X grains from the Murchison meteorite may contain supernova-produced light elements {sup 11}B and {sup 7}Li encapsulated in the presolar grains. Combining the recent experimental constraints on θ{sub 13}, we show that our method sug-gests at a marginal preference for an inverted neutrino mass hierarchy. Finally, we discuss supernova relic neutrinos that may indicate the softness of the equation of state (EoS) of nuclear matter as well as adiabatic conditions of the neutrino oscillation.

  20. Supernova explosions in the Universe.

    Science.gov (United States)

    Burrows, A

    2000-02-17

    During the lifetime of our Milky Way galaxy, there have been something like 100 million supernova explosions, which have enriched the Galaxy with the oxygen we breathe, the iron in our cars, the calcium in our bones and the silicon in the rocks beneath our feet. These exploding stars also influence the birth of new stars and are the source of the energetic cosmic rays that irradiate us on the Earth. The prodigious amount of energy (approximately 10(51), or approximately 2.5 x 10(28) megatonnes of TNT equivalent) and momentum associated with each supernova may even have helped to shape galaxies as they formed in the early Universe. Supernovae are now being used to measure the geometry of the Universe, and have recently been implicated in the decades-old mystery of the origin of the gamma-ray bursts. Together with major conceptual advances in our theoretical understanding of supernovae, these developments have made supernovae the centre of attention in astrophysics. PMID:10693794