WorldWideScience

Sample records for bp explosive cycle

  1. The historical (218 ± 14 aBP) explosive eruption of Tutupaca volcano (Southern Peru)

    Science.gov (United States)

    Samaniego, Pablo; Valderrama, Patricio; Mariño, Jersy; van Wyk de Vries, Benjamín; Roche, Olivier; Manrique, Nélida; Chédeville, Corentin; Liorzou, Céline; Fidel, Lionel; Malnati, Judicaëlle

    2015-06-01

    The little known Tutupaca volcano (17° 01' S, 70° 21' W), located at the southern end of the Peruvian arc, is a dacitic dome complex that experienced a large explosive eruption during historical times. Based on historic chronicles and our radiometric data, this eruption occurred 218 ± 14 aBP, probably between 1787 and 1802 AD. This eruption was characterised by a large sector collapse that triggered a small debris avalanche (<1 km3) and an associated pyroclastic eruption whose bulk volume was 6.5-7.5 × 107 m3. Both units were emplaced synchronously and spread onto the plain situated to the northeast of Tutupaca volcano. The spatial and temporal relationship between the debris avalanche and the pyroclastic density current deposits, coupled with the petrological similarity between the juvenile fragments in the debris avalanche, the pyroclastic density current deposits and the pre-avalanche domes, indicates that juvenile magma was involved in the sector collapse. Large amounts of hydrothermally altered material are also found in the avalanche deposit. Thus, the ascent of a dacitic magma, coupled with the fact that the Tutupaca dome complex was constructed on top of an older, altered volcanic sequence, probably induced the destabilisation of the hydrothermally active edifice, producing the debris avalanche and its related pyroclastic density currents. This eruption probably represents the youngest debris avalanche in the Andes and was accompanied by one of the larger explosive events to have occurred in Southern Peru during historical times.

  2. Cycles revealed in Jurassic paleoclimatic data (ca. 200-145 Ma B.P.)

    Science.gov (United States)

    Dmitriev, P. B.; Dergachev, V. A.; Tyasto, M. I.; Blagoveshchenskaya, E. E.

    2016-12-01

    Limestone varves from the Todilto Basin, New Mexico (United States), are studied. These deposits cover a time interval of 1592 years and belong to the Jurassic (ca. 200-145 Ma B.P.). Via the construction of a combined spectral periodogram, quasiharmonic components are revealed in the initial data. The periods of these components are close to the basic contemporary solar activity cycles: the periods of 13 and 20 years agree with the Schwabe and Hale cycles; that of 78 years is in accord with the Gleissberg cycle (with both branches of 69 and 105 years represented); and the components of 179 and 235 years can be probably related to the Suess or de Vries cycles. The results indicate the influence of solar activity on the terrestrial climate in the geological past.

  3. Explosion of limit cycles and chaotic waves in a simple nonlinear chemical system

    DEFF Research Database (Denmark)

    Brøns, Morten; Sturis, Jeppe

    2001-01-01

    A model of an autocatalytic chemical reaction was employed to study the explosion of limit cycles and chaotic waves in a nonlinear chemical system. The bifurcation point was determined using asymptotic analysis and perturbations. Scaling laws for amplitude and period were derived. A strong...

  4. Canard explosion of limit cycles in templator models of self-replication mechanisms

    Science.gov (United States)

    Brøns, Morten

    2011-04-01

    Templators are differential equation models for self-replicating chemical systems. Beutel and Peacock-López [J. Chem. Phys. 126, 125104 (2007)], 10.1063/1.2716396 have numerically analyzed a model for a cross-catalytic self-replicating system and found two cases of canard explosion, that is, a substantial change of amplitude of a limit cycle over a very short parameter interval. We show how the model can be reduced to a two-dimensional system and how canard theory for slow-fast equations can be applied to yield analytic information about the canard explosion. In particular, simple expressions for the parameter value where the canard explosion occurs are obtained. The connection to mixed-mode oscillations also observed in the model is briefly discussed.

  5. Farmer-Entrepreneurs, Agricultural Innovation, and Explosive Research and Development Cycles

    Directory of Open Access Journals (Sweden)

    João Ricardo Faria

    2016-09-01

    Full Text Available Private sector research and development (R&D in food processing has seen a growing share of agricultural R&D. This paper analyzes market and technological links between farmer-entrepreneurs and food processing firms. It is shown that processing sector R&D tends to display explosive cycles. To avoid explosive cycles, the processing sector sets the R&D growth path and its target. Dynamic adjustments are related to the shadow price of R&D and farm output price. In equilibrium, the effects of increases in technological innovations (e.g., at the farm level, in public agricultural research, from entrepreneurial talent, in processing sector R&D, and in the price of final goods on agricultural price and output are positive. The patent race does not affect steady-state agricultural price and output, nor processing sector R&D; it only reduces the opportunity cost of R&D.

  6. Cycles of explosive and effusive eruptions at Kīlauea Volcano, Hawai‘i

    Science.gov (United States)

    Swanson, Don; Rose, Timothy R.; Mucek, Adonara E; Garcia, Michael O.; Fiske, Richard S.; Mastin, Larry G.

    2014-01-01

    The subaerial eruptive activity at Kīlauea Volcano (Hawai‘i) for the past 2500 yr can be divided into 3 dominantly effusive and 2 dominantly explosive periods, each lasting several centuries. The prevailing style of eruption for 60% of this time was explosive, manifested by repeated phreatic and phreatomagmatic activity in a deep summit caldera. During dominantly explosive periods, the magma supply rate to the shallow storage volume beneath the summit dropped to only a few percent of that during mainly effusive periods. The frequency and duration of explosive activity are contrary to the popular impression that Kīlauea is almost unceasingly effusive. Explosive activity apparently correlates with the presence of a caldera intersecting the water table. The decrease in magma supply rate may result in caldera collapse, because erupted or intruded magma is not replaced. Glasses with unusually high MgO, TiO2, and K2O compositions occur only in explosive tephra (and one related lava flow) and are consistent with disruption of the shallow reservoir complex during caldera formation. Kīlauea is a complex, modulated system in which melting rate, supply rate, conduit stability (in both mantle and crust), reservoir geometry, water table, and many other factors interact with one another. The hazards associated with explosive activity at Kīlauea’s summit would have major impact on local society if a future dominantly explosive period were to last several centuries. The association of lowered magma supply, caldera formation, and explosive activity might characterize other basaltic volcanoes, but has not been recognized.

  7. Canard explosion of limit cycles in templator models of self-replication mechanisms

    DEFF Research Database (Denmark)

    Brøns, Morten

    2011-01-01

    Templators are differential equation models for self-replicating chemical systems. Beutel and Peacock-López [J. Chem. Phys. 126, 125104 (2007)]10.1063/1.2716396 have numerically analyzed a model for a cross-catalytic self-replicating system and found two cases of canard explosion, that is, a sub...

  8. Integration of BpMADS4 on various linkage groups improves the utilization of the rapid cycle breeding system in apple.

    Science.gov (United States)

    Weigl, Kathleen; Wenzel, Stephanie; Flachowsky, Henryk; Peil, Andreas; Hanke, Magda-Viola

    2015-02-01

    Rapid cycle breeding in apple is a new approach for the rapid introgression of agronomically relevant traits (e.g. disease resistances) from wild apple species into domestic apple cultivars (Malus × domestica Borkh.). This technique drastically shortens the long-lasting juvenile phase of apple. The utilization of early-flowering apple lines overexpressing the BpMADS4 gene of the European silver birch (Betula pendula Roth.) in hybridization resulted in one breeding cycle per year. Aiming for the selection of non-transgenic null segregants at the end of the breeding process, the flower-inducing transgene and the gene of interest (e.g. resistance gene) that will be introgressed by hybridization need to be located on different chromosomes. To improve the flexibility of the existing approach in apple, this study was focused on the development and characterization of eleven additional BpMADS4 overexpressing lines of four different apple cultivars. In nine lines, the flowering gene was mapped to different linkage groups. The differences in introgressed T-DNA sequences and plant genome deletions post-transformation highlighted the unique molecular character of each line. However, transgenic lines demonstrated no significant differences in flower organ development and pollen functionality compared with non-transgenic plants. Hybridization studies using pollen from the fire blight-resistant wild species accession Malus fusca MAL0045 and the apple scab-resistant cultivar 'Regia' indicated that BpMADS4 introgression had no significant effect on the breeding value of each transgenic line. © 2014 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

  9. eRF3b, a biomarker for hepatocellular carcinoma, influences cell cycle and phosphoralation status of 4E-BP1.

    Directory of Open Access Journals (Sweden)

    Man Li

    Full Text Available BACKGROUND: Hepatitis B virus (HBV infection and its sequelae are now recognized as serious problems globally. Our aime is to screen hepatocellular carcinoma (HCC from chronic hepatitis B (CHB and identify the characteristics of proteins involved. METHODOLOGY/PRINCIPAL FINDINGS: We affinity-purified sample serum with weak cation-exchange (WCX magnetic beads and matrix-assisted laser desorption/ionization time of flight mass spectrometry (MALDI-TOF MS analysis to search for potential markers. The 4210 Da protein, which differed substantially between HCC and CHB isolates, was later identified to be eukaryotic peptide chain release factor GTP-binding subunit eRF3b. Further research showed that eRF3b/GSPT2 was positively expressed in liver tissues. GSPT2 mRNA was, however differentially expressed in blood. Compared with normal controls, the relative expression of GSPT2/18s rRNA was higher in CHB patients than in patients with either LC or HCC (P = 0.035 for CHB vs. LC; P = 0.020 for CHB vs. HCC. The data of further research showed that eRF3b/GSPT2 promoted the entrance of the HepG2 cells into the S-phase and that one of the substrates of the mTOR kinase, 4E-BP1, was hyperphosphorylated in eRF3b-overexpressing HepG2 cells. CONCLUSIONS: Overall, the differentially expressed protein eRF3b, which was discovered as a biomarker for HCC, could change the cell cycle and influence the phosphorylation status of 4E-BP1 on Ser65 in HepG2.

  10. Dynamics of the subcellular localization of RalBP1/RLIP through the cell cycle: the role of targeting signals and of protein-protein interactions.

    Science.gov (United States)

    Fillatre, Jonathan; Delacour, Delphine; Van Hove, Lucie; Bagarre, Thomas; Houssin, Nathalie; Soulika, Marina; Veitia, Reiner A; Moreau, Jacques

    2012-05-01

    The small G protein Ras regulates many cell processes, such as gene expression, proliferation, apoptosis, and cell differentiation. Its mutations are associated with one-third of all cancers. Ras functions are mediated, at least in part, by Ral proteins and their downstream effector the Ral-binding protein 1 (RalBP1). RalBP1 is involved in endocytosis and in regulating the dynamics of the actin cytoskeleton. It also regulates early development since it is required for the completion of gastrulation in Xenopus laevis. RalBP1 has also been reported to be the main transporter of glutathione electrophiles, and it is involved in multidrug resistance. Such a variety of functions could be explained by a differential regulation of RalBP1 localization. In this study, we have detected endogenous RalBP1 in the nucleus of interphasic cells. This nuclear targeting is mediated by nuclear localization sequences that map to the N-terminal third of the protein. Moreover, in X. laevis embryos, a C-terminal coiled-coil sequence mediates RalBP1 retention in the nucleus. We have also observed RalBP1 at the level of the actin cytoskeleton, a localization that depends on interaction of the protein with active Ral. During mitosis RalBP1 also associates with the mitotic spindle and the centrosome, a localization that could be negatively regulated by active Ral. Finally, we demonstrate the presence of post-transcriptional and post-translational isoforms of RalBP1 lacking the Ral-binding domain, which opens new possibilities for the existence of Ral-independent functions.

  11. Changes of explosive strength in professional basketball players after a six week training cycle with plyometric training and resistance training

    Directory of Open Access Journals (Sweden)

    Michal Lehnert

    2014-03-01

    Full Text Available BACKGROUND: Explosive strength of the lower extremities and agility are important parts of game performance in basketball. Although numerous studies have focused on the assessment of the training effect of plyometric training, studies focusing on elite players are missing. OBJECTIVE: The aim of the study was to find out what changes in explosive strength of the lower extremities take place after a 6 week strength training with plyometric exercises and resistance exercises in elite basketball players. METHODS: Elite basketball players (n = 12; age 24.71 ± 1.5 years; height 197.0 ± 7.6 cm; weight 95.8 ± 8.1 kg performed during pre-season a 6 week training program with plyometric exercises and resistance exercises which were conducted biweekly during the pre-season. The changes in explosive strength were measured by the squat jump without arms, the counter movement jump without arms, the counter movement jump free arms and the 2 step run up jump. The players participated in two measurements. The 1st (pretesting was performed on the first day of pre-season and the 2nd (posttesting was completed two days after terminating the PT programme. The differences between the average values of the monitored parameters were determined by the Wilcoxon paired test. To calculate the effect size formula according to Fritz, Morris, and Richler (2012: R = Z/√N was used. RESULTS: Analysis of intra-group changes confirmed significant differences between the two measurements in tests of vertical jump squat (Z = 2.58, p = .01, r = .75, vertical jump from the point of the swing arm (Z = 2.49, p = .01, r = .72 and vertical jump from place without the swing arm (Z = 2.75, p = .01, r = .79. In case of the two step run up jump significant differences were not found (Z = 1.60, p = .11, r = .56. Analysis of intra-individual changes showed the significant interindividual differences in the changes of the explosive power of the lower limbs after a 6 week training. The

  12. Explosives tester

    Science.gov (United States)

    Haas, Jeffrey S [San Ramon, CA; Howard, Douglas E [Livermore, CA; Eckels, Joel D [Livermore, CA; Nunes, Peter J [Danville, CA

    2011-01-11

    An explosives tester that can be used anywhere as a screening tool by non-technical personnel to determine whether a surface contains explosives. First and second explosives detecting reagent holders and dispensers are provided. A heater is provided for receiving the first and second explosives detecting reagent holders and dispensers.

  13. Primary explosives

    Energy Technology Data Exchange (ETDEWEB)

    Matyas, Robert; Pachman, Jiri [Pardubice Univ. (Czech Republic). Faculty of Chemical Technology

    2013-06-01

    The first chapter provides background such as the basics of initiation and differences between requirements on primary explosives used in detonators and igniters. The authors then clarify the influence of physical characteristics on explosive properties, focusing on those properties required for primary explosives. Furthermore, the issue of sensitivity is discussed. All the chapters on particular groups of primary explosives are structured in the same way, including introduction, physical and chemical properties, explosive properties, preparation and documented use.

  14. Tracing the cycling and fate of the explosive 2,4,6-trinitrotoluene in coastal marine systems with a stable isotopic tracer, 15N-[TNT

    Science.gov (United States)

    Smith, Richard W.; Vlahos, Penny; Böhlke, John Karl; Ariyarathna, Thivanka; Ballentine, Mark; Cooper, Christopher; Fallis, Stephen; Groshens, Thomas J.; Tobias, Craig

    2015-01-01

    2,4,6-Trinitrotoluene (TNT) has been used as a military explosive for over a hundred years. Contamination concerns have arisen as a result of manufacturing and use on a large scale; however, despite decades of work addressing TNT contamination in the environment, its fate in marine ecosystems is not fully resolved. Here we examine the cycling and fate of TNT in the coastal marine systems by spiking a marine mesocosm containing seawater, sediments, and macrobiota with isotopically labeled TNT (15N-[TNT]), simultaneously monitoring removal, transformation, mineralization, sorption, and biological uptake over a period of 16 days. TNT degradation was rapid, and we observed accumulation of reduced transformation products dissolved in the water column and in pore waters, sorbed to sediments and suspended particulate matter (SPM), and in the tissues of macrobiota. Bulk δ15N analysis of sediments, SPM, and tissues revealed large quantities of 15N beyond that accounted for in identifiable derivatives. TNT-derived N was also found in the dissolved inorganic N (DIN) pool. Using multivariate statistical analysis and a 15N mass balance approach, we identify the major transformation pathways of TNT, including the deamination of reduced TNT derivatives, potentially promoted by sorption to SPM and oxic surface sediments.

  15. Liquid explosives

    CERN Document Server

    Liu, Jiping

    2015-01-01

    The book drawing on the author's nearly half a century of energetic materials research experience intends to systematically review the global researches on liquid explosives. The book focuses on the study of the conception, explosion mechanism, properties and preparation of liquid explosives. It provides a combination of theoretical knowledge and practical examples in a reader-friendly style. The book is likely to be interest of university researchers and graduate students in the fields of energetic materials, blasting engineering and mining.

  16. Palaeolithic Timekeepers Looking At The Golden Gate Of The Ecliptic; The Lunar Cycle And The Pleiades In The Cave Of La-TETe-Du-Lion (Ardéche, France) - 21,000 BP

    Science.gov (United States)

    Rappenglück, Michael A.

    Decades of research work done by several scientists all over the world since the beginning of the 20th century confirmed the idea, that Palaeolithic man looked up to the starry sky and recognized prominent patterns of stars as well as the course of the celestial bodies. Though sometimes highly speculative, the investigations made clear, that time-factored notations played an important role in the archaic cultures of Palaeolithic epochs (from 33,000 to 10,000 BP). There are some distinct and detailed examples of lunar-, solar- and lunisolar-calendars sometimes combined with pictures of seasonality, mostly discovered on transportable bones and stones, but also on the fixed walls of certain caves. The investigations showed that in Palaeolithic epochs time-reckoning, in particular the lunar cycle, had been related to the pregnancy of women too (Figure 2a-d). Recently I showed, that in the Magdalenian time (16,000-12,000 BP) man also recognized single and very complex star patterns, including the Milky Way: the Northern Crown in the cave of El Castillo (Spain), the Pleiades in the cave of Lascaux (France) and the main constellations of the sky at the same location. They were used by the Palaeolithic hunter-gatherers for orientation in space and for time-reckoning. These star patterns also played an important role in the cosmovisions of archaic cultures. Together with the depictions of the course of the moon and the sun, they helped to organize the spatiotemporal structure of daily and spiritual life of Palaeolithic man. Now I present a rock panel in the cave of La-T^ete-du-Lion (France) that shows the combination of a star pattern - Aldebaran in the Bull and the Pleiades - with a drawing of the moons cycle above. This picture comes from the Solutrean epoch ca 21,000-22,000 BP. It shows not only a remarkable similarity with the representation in the Lascaux cave, but clearly connects the star pattern with a part of the lunar cycle.

  17. Explosive compositions

    Energy Technology Data Exchange (ETDEWEB)

    Craig, J.F.M.; Falconer, E.L.

    1971-04-13

    A thickening agent for an aqueous slurry explosive composition consists of the combination of a cross-linked galactomannan with psyllium flour in specific proportions. This thickener provides good fluidity and reduced tackiness. (7 claims)

  18. 78 FR 60270 - BP America Inc., BP Corporation North America Inc., BP America Production Company, and BP Energy...

    Science.gov (United States)

    2013-10-01

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission BP America Inc., BP Corporation North America Inc., BP America Production Company, and BP Energy Company; Notice of Designation of Commission Staff as Non-Decisional With respect...

  19. Explosive Pleuritis

    Directory of Open Access Journals (Sweden)

    Jasdeep K Sharma

    2001-01-01

    Full Text Available The objective of the present paper is to describe the clinical and computed tomography features of 'explosive pleuritis', an entity first named by Braman and Donat in 1986, and to propose a case definition. A case report of a previously healthy, 45-year-old man admitted to hospital with acute onset pleuritic chest pain is presented. The patient arrived at the emergency room at 15:00 in mild respiratory distress; the initial chest x-ray revealed a small right lower lobe effusion. The subsequent clinical course in hospital was dramatic. Within 18 h of admission, he developed severe respiratory distress with oxygen desaturation to 83% on room air and dullness of the right lung field. A repeat chest x-ray, taken the morning after admission, revealed complete opacification of the right hemithorax. A computed tomography scan of the thorax demonstrated a massive pleural effusion with compression of pulmonary tissue and mediastinal shift. Pleural fluid biochemical analysis revealed the following concentrations: glucose 3.5 mmol/L, lactate dehydrogenase 1550 U/L, protein 56.98 g/L, amylase 68 U/L and white blood cell count 600 cells/mL. The pleural fluid cultures demonstrated light growth of coagulase-negative staphylococcus and viridans streptococcus, and very light growth of Candida albicans. Cytology was negative for malignant cells. Thoracotomy was performed, which demonstrated a loculated parapneumonic effusion that required decortication. The patient responded favourably to the empirical administration of intravenous levofloxacin and ceftriaxone, and conservative surgical methods in the management of the empyema. This report also discusses the patient's rapidly progressing pleural effusion and offers a potential case definition for explosive pleuritis. Explosive pleuritis is a medical emergency defined by the rapid development of a pleural effusion involving more than 90% of the hemithorax over 24 h, which causes compression of pulmonary tissue and

  20. Effect of Velocity of Detonation of Explosives on Seismic Radiation

    Science.gov (United States)

    Stroujkova, A. F.; Leidig, M.; Bonner, J. L.

    2014-12-01

    We studied seismic body wave generation from four fully contained explosions of approximately the same yields (68 kg of TNT equivalent) conducted in anisotropic granite in Barre, VT. The explosions were detonated using three types of explosives with different velocities of detonation (VOD): Black Powder (BP), Ammonium Nitrate Fuel Oil/Emulsion (ANFO), and Composition B (COMP B). The main objective of the experiment was to study differences in seismic wave generation among different types of explosives, and to determine the mechanism responsible for these differences. The explosives with slow burn rate (BP) produced lower P-wave amplitude and lower corner frequency, which resulted in lower seismic efficiency (0.35%) in comparison with high burn rate explosives (2.2% for ANFO and 3% for COMP B). The seismic efficiency estimates for ANFO and COMP B agree with previous studies for nuclear explosions in granite. The body wave radiation pattern is consistent with an isotropic explosion with an added azimuthal component caused by vertical tensile fractures oriented along pre-existing micro-fracturing in the granite, although the complexities in the P- and S-wave radiation patterns suggest that more than one fracture orientation could be responsible for their generation. High S/P amplitude ratios and low P-wave amplitudes suggest that a significant fraction of the BP source mechanism can be explained by opening of the tensile fractures as a result of the slow energy release.

  1. Explosive Formulation Pilot Plant

    Data.gov (United States)

    Federal Laboratory Consortium — The Pilot Plant for Explosive Formulation supports the development of new explosives that are comprised of several components. This system is particularly beneficial...

  2. Underground Explosions

    Science.gov (United States)

    2015-09-09

    is viewed as a result of the propulsion of broken rock mass by explosion gas by-products. The physical model used to recreate the second and the third...period seismographs. Seismologists of the                                                              5  Edinaya  Sistema   Seismicheskih  Nablyudenii...d’explosifs chiniques dans le sable: Programme Dynasol, Centre d’etudes Nucl. De Grenoble Lab. D’applications Speciales de la Physique, Grenoble. 9

  3. Chemical profiling of explosives

    NARCIS (Netherlands)

    Brust, G.M.H.

    2014-01-01

    The primary goal of this thesis is to develop analytical methods for the chemical profiling of explosives. Current methodologies for the forensic analysis of explosives focus on identification of the explosive material. However, chemical profiling of explosives becomes increasingly important, as

  4. Supernova explosions

    CERN Document Server

    Branch, David

    2017-01-01

    Targeting advanced students of astronomy and physics, as well as astronomers and physicists contemplating research on supernovae or related fields, David Branch and J. Craig Wheeler offer a modern account of the nature, causes and consequences of supernovae, as well as of issues that remain to be resolved. Owing especially to (1) the appearance of supernova 1987A in the nearby Large Magellanic Cloud, (2) the spectacularly successful use of supernovae as distance indicators for cosmology, (3) the association of some supernovae with the enigmatic cosmic gamma-ray bursts, and (4) the discovery of a class of superluminous supernovae, the pace of supernova research has been increasing sharply. This monograph serves as a broad survey of modern supernova research and a guide to the current literature. The book’s emphasis is on the explosive phases of supernovae. Part 1 is devoted to a survey of the kinds of observations that inform us about supernovae, some basic interpreta tions of such data, and an overview of t...

  5. Understanding vented gas explosions

    Energy Technology Data Exchange (ETDEWEB)

    Lautkaski, R. [VTT Energy, Espoo (Finland). Energy Systems

    1997-12-31

    The report is an introduction to vented gas explosions for nonspecialists, particularly designers of plants for flammable gases and liquids. The phenomena leading to pressure generation in vented gas explosions in empty and congested rooms are reviewed. The four peak model of vented gas explosions is presented with simple methods to predict the values of the individual peaks. Experimental data on the external explosion of dust and gas explosions is discussed. The empirical equation relating the internal and external peak pressures in vented dust explosions is shown to be valid for gas explosion tests in 30 m{sup 3} and 550 m{sup 3} chambers. However, the difficulty of predicting the internal peak pressure in large chambers remains. Methods of explosion relief panel design and principles of vent and equipment layout to reduce explosion overpressures are reviewed. (orig.) 65 refs.

  6. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    Energy Technology Data Exchange (ETDEWEB)

    Kanginakudru, Sriramana, E-mail: skangina@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); DeSmet, Marsha, E-mail: mdesmet@iupui.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Thomas, Yanique, E-mail: ysthomas@umail.iu.edu [Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States); Morgan, Iain M., E-mail: immorgan@vcu.edu [VCU Philips Institute for Oral Health Research, Virginia Commonwealth University, Richmond, Virginia (United States); Androphy, Elliot J., E-mail: eandro@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States)

    2015-04-15

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication.

  7. Identification of CUG-BP1/EDEN-BP target mRNAs in Xenopus tropicalis.

    OpenAIRE

    Graindorge, Antoine; Le Tonquèze, Olivier; Thuret, Raphaël; Pollet, Nicolas; Osborne, Howard Beverley; Audic, Yann

    2008-01-01

    International audience; The early development of many animals relies on the posttranscriptional regulations of maternally stored mRNAs. In particular, the translation of maternal mRNAs is tightly controlled during oocyte maturation and early mitotic cycles in Xenopus. The Embryonic Deadenylation ElemeNt (EDEN) and its associated protein EDEN-BP are known to trigger deadenylation and translational silencing to several mRNAs bearing an EDEN. This Xenopus RNA-binding protein is an ortholog of th...

  8. Inspection tester for explosives

    Science.gov (United States)

    Haas, Jeffrey S.; Simpson, Randall L.; Satcher, Joe H.

    2007-11-13

    An inspection tester that can be used anywhere as a primary screening tool by non-technical personnel to determine whether a surface contains explosives. It includes a body with a sample pad. First and second explosives detecting reagent holders and dispensers are operatively connected to the body and the sample pad. The first and second explosives detecting reagent holders and dispensers are positioned to deliver the explosives detecting reagents to the sample pad. A is heater operatively connected to the sample pad.

  9. 75 FR 5545 - Explosives

    Science.gov (United States)

    2010-02-03

    ... for classifying, labeling, and providing safety data sheets for explosives. By withdrawing this.... OSHA-S031-2006-0665 and OSHA-S-031)] RIN 1218-AC09 Explosives AGENCY: Occupational Safety and Health... the rulemaking to amend its Explosives and Blasting Agents Standard at 29 CFR 1910.109. OSHA is taking...

  10. New Mix Explosives for Explosive Welding

    Science.gov (United States)

    Andreevskikh, Leonid

    2011-06-01

    Suggested and tested were some mix explosives--powder mixtures of a brisant high explosive (HE = RDX, PETN) and an inert diluent (baking soda)--for use in explosive welding. RDX and PETN were selected in view of their high throwing ability and low critical diameter. Since the decomposition of baking soda yields a huge amount of gaseous products, its presence ensures (even at a low HE percentage) a throwing speed that is sufficient for realization of explosive welding, at a reduced brisant action of charge. Mix chargers containing 30-70 wt % HE (the rest baking soda) have been tested experimentally and optimized. For study of possibility to reduce critical diameter of HE mixture, the mixture was prepared where HE crystal sizes did not exceed 10 μm. The tests, which were performed with this HE, revealed that the mixture detonated stably with the velocity D ~ 2 km/s, if the layer thickness was d = 2 mm. The above explosives afford to markedly diminish deformations within the oblique impact zone and thus to carry out explosive welding of hollow items and thin metallic foils.

  11. Genomic organization, expression, and localization of murine Ran-binding protein 2 (RanBP2) gene.

    NARCIS (Netherlands)

    Fauser, S.; Aslanukov, A.; Roepman, R.; Ferreira, P.A.

    2001-01-01

    The Ran-binding protein 2 (RanBP2) is a giant scaffold and mosaic cyclophilin-related nucleoporin implicated in the Ran-GTPase cycle. There are no orthologs of the RanBP2 gene in yeast and Drosophila genomes. In humans, this bona fide gene is partially duplicated in a RanBP2 gene cluster and lies in

  12. Explosives tester with heater

    Science.gov (United States)

    Del Eckels, Joel [Livermore, CA; Nunes, Peter J [Danville, CA; Simpson, Randall L [Livermore, CA; Whipple, Richard E [Livermore, CA; Carter, J Chance [Livermore, CA; Reynolds, John G [San Ramon, CA

    2010-08-10

    An inspection tester system for testing for explosives. The tester includes a body and a swab unit adapted to be removeably connected to the body. At least one reagent holder and dispenser is operatively connected to the body. The reagent holder and dispenser contains an explosives detecting reagent and is positioned to deliver the explosives detecting reagent to the swab unit. A heater is operatively connected to the body and the swab unit is adapted to be operatively connected to the heater.

  13. Explosive Technology Group

    Data.gov (United States)

    Federal Laboratory Consortium — The Explosive Technology Group (ETG) provides diverse technical expertise and an agile, integrated approach to solve complex challenges for all classes of energetic...

  14. Active explosion barrier performance against methane and coal dust explosions

    National Research Council Canada - National Science Library

    J. J. L. du Plessis

    2015-01-01

    Preventing the propagation of methane or coal dust explosions through the use of active explosion-suppression systems remains one of the most underutilised explosion controls in underground coal mines...

  15. Explosions and static electricity

    DEFF Research Database (Denmark)

    Jonassen, Niels M

    1995-01-01

    The paper deals with the problem of electrostatic discharges as causes of ignition of vapor/gas and dust/gas mixtures. A series of examples of static-caused explosions will be discussed. The concepts of explosion limits, the incendiveness of various discharge types and safe voltages are explained...

  16. Cell phone explosion.

    Science.gov (United States)

    Atreya, Alok; Kanchan, Tanuj; Nepal, Samata; Pandey, Bhuwan Raj

    2016-03-01

    Cell phone explosions and resultant burn injuries are rarely reported in the scientific literature. We report a case of cell phone explosion that occurred when a young male was listening to music while the mobile was plugged in for charging. © The Author(s) 2015.

  17. Steam explosion studies review

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, Moon Kyu; Kim, Hee Dong

    1999-03-01

    When a cold liquid is brought into contact with a molten material with a temperature significantly higher than the liquid boiling point, an explosive interaction due to sudden fragmentation of the melt and rapid evaporation of the liquid may take place. This phenomenon is referred to as a steam explosion or vapor explosion. Depending upon the amount of the melt and the liquid involved, the mechanical energy released during a vapor explosion can be large enough to cause serious destruction. In hypothetical severe accidents which involve fuel melt down, subsequent interactions between the molten fuel and coolant may cause steam explosion. This process has been studied by many investigators in an effort to assess the likelihood of containment failure which leads to large scale release of radioactive materials to the environment. In an effort to understand the phenomenology of steam explosion, extensive studies has been performed so far. The report presents both experimental and analytical studies on steam explosion. As for the experimental studies, both small scale tests which involve usually less than 20 g of high temperature melt and medium/large scale tests which more than 1 kg of melt is used are reviewed. For the modelling part of steam explosions, mechanistic modelling as well as thermodynamic modelling is reviewed. (author)

  18. Melt Cast High Explosives

    Directory of Open Access Journals (Sweden)

    Stanisław Cudziło

    2014-12-01

    Full Text Available [b]Abstract[/b]. This paper reviews the current state and future developments of melt-cast high explosives. First the compositions, properties and methods of preparation of trinitrotoluene based (TNT conventional mixtures with aluminum, hexogen (RDX or octogen (HMX are described. In the newer, less sensitive explosive formulations, TNT is replaced with dinitroanisole (DNANDNANDNAN and nitrotriazolone (NTONTONTO, nitroguanidine (NG or ammonium perchlorate (AP are the replacement for RDRDX and HMX. Plasticized wax or polymer-based binder systems for melt castable explosives are also included. Hydroxyl terminated polybutadiene (HPTB is the binder of choice, but polyethylene glycol, and polycaprolactone with energetic plasticizers are also used. The most advanced melt-cast explosives are compositions containing energetic thermoplastic elastomers and novel highly energetic compounds (including nitrogen rich molecules in whose particles are nanosized and practically defect-less.[b]Keywords[/b]: melt-cast explosives, detonation parameters

  19. Shock Initiation of Damaged Explosives

    Energy Technology Data Exchange (ETDEWEB)

    Chidester, S K; Vandersall, K S; Tarver, C M

    2009-10-22

    Explosive and propellant charges are subjected to various mechanical and thermal insults that can increase their sensitivity over the course of their lifetimes. To quantify this effect, shock initiation experiments were performed on mechanically and thermally damaged LX-04 (85% HMX, 15% Viton by weight) and PBX 9502 (95% TATB, 5% Kel-F by weight) to obtain in-situ manganin pressure gauge data and run distances to detonation at various shock pressures. We report the behavior of the HMX-based explosive LX-04 that was damaged mechanically by applying a compressive load of 600 psi for 20,000 cycles, thus creating many small narrow cracks, or by cutting wedge shaped parts that were then loosely reassembled, thus creating a few large cracks. The thermally damaged LX-04 charges were heated to 190 C for long enough for the beta to delta solid - solid phase transition to occur, and then cooled to ambient temperature. Mechanically damaged LX-04 exhibited only slightly increased shock sensitivity, while thermally damaged LX-04 was much more shock sensitive. Similarly, the insensitive explosive PBX 9502 was mechanically damaged using the same two techniques. Since PBX 9502 does not undergo a solid - solid phase transition but does undergo irreversible or 'rachet' growth when thermally cycled, thermal damage to PBX 9502 was induced by this procedure. As for LX-04, the thermally damaged PBX 9502 demonstrated a greater shock sensitivity than mechanically damaged PBX 9502. The Ignition and Growth reactive flow model calculated the increased sensitivities by igniting more damaged LX-04 and PBX 9502 near the shock front based on the measured densities (porosities) of the damaged charges.

  20. The plinian fallout associated with Quilotoa's 800 yr BP eruption, Ecuadorian Andes

    Science.gov (United States)

    Mothes, Patricia A.; Hall, Minard L.

    2008-09-01

    Large volcanic eruptions at dacitic or rhyolitic volcanoes often generate exceptional volumes of fine ash that mantles an area up to a million km 2. These eruptions are characterized by extreme fragmentation of the magma and hence extraordinary dispersal of ash and are categorized as plinian, ultraplinian, or phreatoplinian events. Large-volume co-ignimbrites or co-plinian ashes are often produced by such eruptions. High fragmentation indices of > 90% are attributed to the violent eruption of silicic magma, especially if augmented by fuel-coolant reactions produced when abundant external water interacts with the magma. The present study documents a case where the fine ash (≤ 1 mm diameter) fall deposit related to the plinian phase of the eruption comprises the overwhelming bulk - about 87 wt.% of the eruptive products. This is another example demonstrating the predominance of a widespread, fine-grained, co-plinian ash which follows the initial coarser lapilli fall. Historical eruptions at two other Andean volcanoes Quizapu, (Chile) and Huaynaputina, (Peru), and at Santa Maria, (Guatemala) and Novarupta, (Alaska) produced similar ash fall sequences. Quilotoa's 800 yr BP eruption, in the Ecuadorian Andes, is an example of a powerful plinian eruption at a small dacitic volcano. It produced a crystal-rich, fine-grained ash layer which mantled an extrapolated ˜ 810,000 km 2 with ≥ 1 mm thickness and has a bulk magma volume of about 18.3 km 3. Stratigraphic and petrographic studies, as well as granulometric and density analyses were employed to investigate these eruptive products, particularly the distal co-plinian fall deposits. The eruptive cycle consisted of a phreatomagmatic triggering, the establishment of a powerful sustained plinian column and subsequently partial column collapses, leading to widespread surge and ash flow activity. Quilotoa's 800 yr BP eruption has a (VEI) Volcano Explosivity Index = 6, and generated a maximum column height of about 35 km and

  1. Chemical explosive stimulation

    Energy Technology Data Exchange (ETDEWEB)

    LaRocca, S.J.; McLamore, R.T.; Spencer, A.M. Jr.

    1974-02-01

    A safe, reliable chemical explosive fracturing process has been demonstrated and prototype equipment for its use has been successfully field tested.Called the Astro-Flow II process, it utilizes a highly energetic, hydrazine-based family of liquid explosives known as Astrolite. A unique property of these explosives is that they can be divided into 2 nonexplosive pumpable components that can be handled safely. The 2 components are pumped independently and simultaneously into the well and blended together downhole to form the explosive which is circulated in place or displaced into formation fractures. Explosive hazards to surface equipment and personnel are eliminated. Extensive testing of the physical and chemical stability of the mixed explosive indicates that the material can be reliable and safely used at elevated temperatures, pressures, and in the adverse chemical environment often found in deep oil and gas wells. These tests of prototype equipment proved that the 2 components could be independently pumped with precision and blended together to form the desired explosive formulation. How the process works is described.

  2. ENVIRONMENTAL TOXICOLOGY OF EXPLOSIVES

    OpenAIRE

    KOYUNCU, Hülya

    2017-01-01

    Explosives are used on a large scale byboth the military and by various civilian industries (e.g. mining, high-energymetalwork, and civil engineering). Explosives utilization contributes to the high environmentalcontamination. TNT(2,4,6-trinitrotoluene), RDX (hexahydro-1,3,5-trinitro-1,3,5-triazine), HMX (octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine) are found mainly in soils and surface waters; there havealso been cases of groundwater contamination. Most explosives are stable du...

  3. Aging of civil explosives (Poster)

    NARCIS (Netherlands)

    Krabbendam-La Haye, E.L.M.; Klerk, W.P.C. de; Hoen, C. 't; Krämer, R.E.

    2014-01-01

    For the Dutch MoD and police, TNO composed sets with different kinds of civil explosives to train their detection dogs. The manufacturer of these explosives guarantees several years of stability of these explosives. These sets of explosives are used under different conditions, like temperature and

  4. Shock waves & explosions

    CERN Document Server

    Sachdev, PL

    2004-01-01

    Understanding the causes and effects of explosions is important to experts in a broad range of disciplines, including the military, industrial and environmental research, aeronautic engineering, and applied mathematics. Offering an introductory review of historic research, Shock Waves and Explosions brings analytic and computational methods to a wide audience in a clear and thorough way. Beginning with an overview of the research on combustion and gas dynamics in the 1970s and 1980s, the author brings you up to date by covering modeling techniques and asymptotic and perturbative methods and ending with a chapter on computational methods.Most of the book deals with the mathematical analysis of explosions, but computational results are also included wherever they are available. Historical perspectives are provided on the advent of nonlinear science, as well as on the mathematical study of the blast wave phenomenon, both when visualized as a point explosion and when simulated as the expansion of a high-pressure ...

  5. Explosive Components Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The 98,000 square foot Explosive Components Facility (ECF) is a state-of-the-art facility that provides a full-range of chemical, material, and performance analysis...

  6. Intermittent Explosive Disorder

    Science.gov (United States)

    ... Headache Intermittent explosive disorder Symptoms & causes Diagnosis & treatment Advertisement Mayo Clinic does not endorse companies or products. ... a Job Site Map About This Site Twitter Facebook Google YouTube Pinterest Mayo Clinic is a not- ...

  7. Parametric Explosion Spectral Model

    Energy Technology Data Exchange (ETDEWEB)

    Ford, S R; Walter, W R

    2012-01-19

    Small underground nuclear explosions need to be confidently detected, identified, and characterized in regions of the world where they have never before occurred. We develop a parametric model of the nuclear explosion seismic source spectrum derived from regional phases that is compatible with earthquake-based geometrical spreading and attenuation. Earthquake spectra are fit with a generalized version of the Brune spectrum, which is a three-parameter model that describes the long-period level, corner-frequency, and spectral slope at high-frequencies. Explosion spectra can be fit with similar spectral models whose parameters are then correlated with near-source geology and containment conditions. We observe a correlation of high gas-porosity (low-strength) with increased spectral slope. The relationship between the parametric equations and the geologic and containment conditions will assist in our physical understanding of the nuclear explosion source.

  8. Ammonium nitrate explosion hazards

    Directory of Open Access Journals (Sweden)

    Negovanović Milanka

    2015-01-01

    Full Text Available Ammonium nitrate (AN primarily is used as a fertilizer but it is also very important compound in the production of industrial explosives. The application of ammonium nitrate in the production of industrial explosives was related with the early era of Nobel dynamite and widely increased with the appearance of blasting agents such as ANFO and Slurry, in the middle of the last Century. Throughout the world millions of tons of ammonium nitrate are produced annually and handled without incident. Although ammonium nitrate generally is used safely, accidental explosions involving AN have high impact resulting in loss of lives and destruction of property. The paper presents the basic properties of ammonium nitrate as well as hazards in handling of ammonium nitrate in order to prevent accidents. Several accidents with explosions of ammonium nitrate resulted in catastrophic consequences are listed in the paper as examples of non-compliance with prescribed procedures.

  9. Intermittent Explosive Disorder

    Directory of Open Access Journals (Sweden)

    Lut Tamam

    2011-09-01

    Full Text Available Intermittent explosive disorder is an impulse control disorder characterized by the occurrence of discrete episodes of failure to resist aggressive impulses that result in violent assault or destruction of property. Though the prevalence intermittent explosive disorder has been reported to be relatively rare in frontier studies on the field, it is now common opinion that intermittent explosive disorder is far more common than previously thought especially in clinical psychiatry settings. Etiological studies displayed the role of both psychosocial factors like childhood traumas and biological factors like dysfunctional neurotransmitter systems and genetics. In differential diagnosis of the disorder, disorders involving agression as a symptom such as alcohol and drug intoxication, antisocial and borderline personality disorders, personality changes due to general medical conditions and behavioral disorder should be considered. A combination of pharmacological and psychotherapeutic approaches are suggested in the treatment of the disorder. This article briefly reviews the historical background, diagnostic criteria, epidemiology, etiology and treatment of intermittent explosive disorder.

  10. Modeling nuclear explosion

    Science.gov (United States)

    Redd, Jeremy; Panin, Alexander

    2012-10-01

    As a result of the Nuclear Test Ban Treaty, no nuclear explosion tests have been performed by the US since 1992. This appreciably limits valuable experimental data needed for improvement of existing weapons and development of new ones, as well as for use of nuclear devices in non-military applications (such as making underground oil reservoirs or compressed air energy storages). This in turn increases the value of numerical modeling of nuclear explosions and of their effects on the environment. We develop numerical codes simulating fission chain reactions in a supercritical U and Pu core and the dynamics of the subsequent expansion of generated hot plasma in order to better understand the impact of such explosions on their surroundings. The results of our simulations (of both above ground and underground explosions) of various energy yields are presented.

  11. Explosion suppression system

    Science.gov (United States)

    Sapko, Michael J.; Cortese, Robert A.

    1992-01-01

    An explosion suppression system and triggering apparatus therefor are provided for quenching gas and dust explosions. An electrically actuated suppression mechanism which dispenses an extinguishing agent into the path ahead of the propagating flame is actuated by a triggering device which is light powered. This triggering device is located upstream of the propagating flame and converts light from the flame to an electrical actuation signal. A pressure arming device electrically connects the triggering device to the suppression device only when the explosion is sensed by a further characteristic thereof beside the flame such as the pioneer pressure wave. The light powered triggering device includes a solar panel which is disposed in the path of the explosion and oriented between horizontally downward and vertical. Testing mechanisms are also preferably provided to test the operation of the solar panel and detonator as well as the pressure arming mechanism.

  12. Polymeric binder for explosives

    Science.gov (United States)

    Bissell, E. R.

    1972-01-01

    Chemical reaction for producing a polymer which can be mixed with explosives to produce a rigid material is discussed. Physical and chemical properties of polymers are described and chemical structure of the polymer is illustrated.

  13. TopBP1 is required at mitosis to reduce transmission of DNA damage to G1 daughter cells

    DEFF Research Database (Denmark)

    Pedersen, Rune Troelsgaard; Kruse, Thomas; Nilsson, Jakob

    2015-01-01

    mitotic entry. In early mitosis, TopBP1 marks sites of and promotes unscheduled DNA synthesis. Moreover, TopBP1 is required for focus formation of the structure-selective nuclease and scaffold protein SLX4 in mitosis. Persistent TopBP1 foci transition into 53BP1 nuclear bodies (NBs) in G1 and precise...... temporal depletion of TopBP1 just before mitotic entry induced formation of 53BP1 NBs in the next cell cycle, showing that TopBP1 acts to reduce transmission of DNA damage to G1 daughter cells. Based on these results, we propose that TopBP1 maintains genome integrity in mitosis by controlling chromatin...

  14. Explosion containment device

    Science.gov (United States)

    Benedick, William B.; Daniel, Charles J.

    1977-01-01

    The disclosure relates to an explosives storage container for absorbing and containing the blast, fragments and detonation products from a possible detonation of a contained explosive. The container comprises a layer of distended material having sufficient thickness to convert a portion of the kinetic energy of the explosion into thermal energy therein. A continuous wall of steel sufficiently thick to absorb most of the remaining kinetic energy by stretching and expanding, thereby reducing the momentum of detonation products and high velocity fragments, surrounds the layer of distended material. A crushable layer surrounds the continuous steel wall and accommodates the stretching and expanding thereof, transmitting a moderate load to the outer enclosure. These layers reduce the forces of the explosion and the momentum of the products thereof to zero. The outer enclosure comprises a continuous pressure wall enclosing all of the layers. In one embodiment, detonation of the contained explosive causes the outer enclosure to expand which indicates to a visual observer that a detonation has occurred.

  15. Surface explosion cavities

    CERN Document Server

    Benusiglio, Adrien; Clanet, Christophe

    2012-01-01

    We present a fluid dynamics video on cavities created by explosions of firecrackers at the water free surface. We use three types of firecrackers containing 1, 1.3 and 5 g of flash powder. The firecrackers are held with their center at the surface of water in a cubic meter pool. The movies are recorded from the side with a high-speed video camera. Without confinement the explosion produces an hemispherical cavity. Right after the explosion this cavity grows isotropically, the bottom then stops while the sides continue to expand. In the next phase the bottom of the cavity accelerates backwards to the surface. During this phase the convergence of the flow creates a central jet that rises above the free surface. In the last part of the video the explosion is confined in a vertical open tube made of glass and of centimetric diameter. The explosion creates a cylindrical cavity that develops towards the free end of the tube. Depending on the charge, the cavity can either stop inside the tube or at its exit, but nev...

  16. 78 FR 64246 - Commerce in Explosives; List of Explosives Materials

    Science.gov (United States)

    2013-10-28

    ... hydrocarbons. Explosive organic nitrate mixtures. Explosive powders. F Flash powder. ] Fulminate of mercury. Fulminate of silver. Fulminating gold. Fulminating mercury. Fulminating platinum. Fulminating silver. G... fulminate. Mercury oxalate. Mercury tartrate. Metriol trinitrate. Minol-2 . MMAN ; methylamine nitrate...

  17. Big Data and Cycling

    NARCIS (Netherlands)

    Romanillos, Gustavo; Zaltz Austwick, Martin; Ettema, Dick; De Kruijf, Joost

    2016-01-01

    Big Data has begun to create significant impacts in urban and transport planning. This paper covers the explosion in data-driven research on cycling, most of which has occurred in the last ten years. We review the techniques, objectives and findings of a growing number of studies we have classified

  18. CacyBP/SIP nuclear translocation induced by gastrin promotes gastric cancer cell proliferation.

    Science.gov (United States)

    Zhai, Hui-Hong; Meng, Juan; Wang, Jing-Bo; Liu, Zhen-Xiong; Li, Yuan-Fei; Feng, Shan-Shan

    2014-08-07

    To investigate the role of nuclear translocation of calcyclin binding protein, also called Siah-1 interacting protein (CacyBP/SIP), in gastric carcinogenesis. The expression of CacyBP/SIP protein in gastric cancer cell lines was detected by Western blot. Immunofluorescence experiments were performed on gastric cancer cell lines that had been either unstimulated or stimulated with gastrin. To confirm the immunofluorescence findings, the relative abundance of CacyBP/SIP in nuclear and cytoplasmic compartments was assessed by Western blot. The effect of nuclear translocation of CacyBP/SIP on cell proliferation was examined using MTT assay. The colony formation assay was used to measure clonogenic cell survival. The effect of CacyBP/SIP nuclear translocation on cell cycle progression was investigated. Two CacyBP/SIP-specific siRNA vectors were designed and constructed to inhibit CacyBP/SIP expression in order to reduce the nuclear translocation of CacyBP/SIP, and the expression of CacyBP/SIP in stably transfected cells was determined by Western blot. The effect of inhibiting CacyBP/SIP nuclear translocation on cell proliferation was then assessed. CacyBP/SIP protein was present in most of gastric cancer cell lines. In unstimulated cells, CacyBP/SIP was distributed throughout the cytoplasm; while in stimulated cells, CacyBP/SIP was found mainly in the perinuclear region. CacyBP/SIP nuclear translocation generated a growth-stimulatory effect on cells. The number of colonies in the CacyBP/SIP nuclear translocation group was significantly higher than that in the control group. The percentage of stimulated cells in G1 phase was significantly lower than that of control cells (69.70% ± 0.46% and 65.80% ± 0.60%, control cells and gastrin-treated SGC7901 cells, P = 0.008; 72.99% ± 0.46% and 69.36% ± 0.51%, control cells and gastrin-treated MKN45 cells, P = 0.022). CacyBP/SIPsi1 effectively down-regulated the expression of CacyBP/SIP, and cells stably transfected by CacyBP

  19. Interactions of the human MCM-BP protein with MCM complex components and Dbf4.

    Directory of Open Access Journals (Sweden)

    Tin Nguyen

    Full Text Available MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.

  20. XIT Commercial Explosives Identification Tool

    Science.gov (United States)

    2014-05-01

    Explosives Identification Tool (XIT) was supported by the Canadian Safety and Security Program ( CSSP ) which is led by Defence Research and Development...Explosives Training Unit, and Toronto Police Service, Explosives Disposal Unit. CSSP is a federally-funded program to strengthen Canada’s ability to

  1. Explosive detection technology

    Science.gov (United States)

    Doremus, Steven; Crownover, Robin

    2017-05-01

    The continuing proliferation of improvised explosive devices is an omnipresent threat to civilians and members of military and law enforcement around the world. The ability to accurately and quickly detect explosive materials from a distance would be an extremely valuable tool for mitigating the risk posed by these devices. A variety of techniques exist that are capable of accurately identifying explosive compounds, but an effective standoff technique is still yet to be realized. Most of the methods being investigated to fill this gap in capabilities are laser based. Raman spectroscopy is one such technique that has been demonstrated to be effective at a distance. Spatially Offset Raman Spectroscopy (SORS) is a technique capable of identifying chemical compounds inside of containers, which could be used to detect hidden explosive devices. Coherent Anti-Stokes Raman Spectroscopy (CARS) utilized a coherent pair of lasers to excite a sample, greatly increasing the response of sample while decreasing the strength of the lasers being used, which significantly improves the eye safety issue that typically hinders laser-based detection methods. Time-gating techniques are also being developed to improve the data collection from Raman techniques, which are often hindered fluorescence of the test sample in addition to atmospheric, substrate, and contaminant responses. Ultraviolet based techniques have also shown significant promise by greatly improved signal strength from excitation of resonance in many explosive compounds. Raman spectroscopy, which identifies compounds based on their molecular response, can be coupled with Laser Induced Breakdown Spectroscopy (LIBS) capable of characterizing the sample's atomic composition using a single laser.

  2. Adaptor protein 3BP2 and cherubism.

    Science.gov (United States)

    Hatani, Tomoko; Sada, Kiyonao

    2008-01-01

    The adaptor protein 3BP2 (c-Abl Src homology 3 domain-binding protein-2, also referred to SH3BP2) is known to play a regulatory role in signaling from immunoreceptors. In mast cells, 3BP2 is rapidly tyrosine phosphorylated by the aggregation of the high affinity IgE receptor and the overexpression of its SH2 domain results in the dramatic suppression of IgE-mediated tyrosine phosphorylation of PLC-alpha, Ca2+ mobilization and degranulation. 3BP2 is a substrate of the protein-tyrosine kinase Syk, which phosphorylates it on Tyr174, Tyr183, and Tyr446 (in the mouse protein). Phosphorylation of Tyr183 promotes the activation of Rac1 through the interaction with the SH2 domain of Vav1. Phosphorylation of Tyr446 induces the binding to the SH2 domain of the upstream protein-tyrosine kinase Lyn and enhances its kinase activity. Thus, 3BP2 has a positive regulatory role in IgE-mediated mast cell activation. In lymphocytes, engagement of T cell or B cell receptors triggers tyrosine phosphorylation of 3BP2. Suppression of the 3BP2 expression by siRNA results in the inhibition of T cell or B cell receptor-mediated activation of NFAT. Genetic analyses reveal that 3BP2 is required for the proliferation of B cells and B cell receptor signaling. Point mutations of the 3BP2 gene cause the rare human inherited disorder cherubism, characterized by excessive bone resorption in the jaw bones. These mutations include substitution and deletion mutations of 3BP2. "Cherubism" mice exhibit increased myeloid cell responses to M-CSF and RANKL leading to the activation of osteoclasts. Further analysis could demonstrate that inhibition of 3BP2 might have therapeutic potential.

  3. Development of ammonium nitrate based explosives to optimize explosive properties and explosive welding parameters used during explosion cladding

    Science.gov (United States)

    Hurley, Christoph

    The ability to accurately measure and predict the velocity of explosively driven flyer plates has been a subject of significant work by the explosives community for some time. The majority of this work has focused on the use of high-energy, ideal explosives that are of interest for defense applications. Several attempts have been made to modify the experimental methods developed for these ideal explosives for use in testing low-energy, non-ideal explosive compounds (including industrially useful mixtures of ammonium nitrate, fuels, and additives) with varying degrees of success. The detonation properties of non-ideal explosives are difficult to measure precisely due to the effect of physical, environmental, and geometric factors on the detonation of these materials. The work presented in this document attempts to mitigate the variability inherent in measurements of non-ideal, ammonium nitrate-based explosives by performing testing using charge geometry similar to that used in the industrial process of explosion welding. A method to measure flyer plate velocity with optical high-speed imaging using commercially available equipment is described. Flyer plate velocity data from both experimental measurements and numerical modeling is presented. A new formula for predicting explosive energy based on the detonation velocity of an ammonium nitrate based explosive in a planar geometry is proposed and applied to a theoretical explosive cladding scenario.

  4. Biodegradation of nitro-explosives.

    Science.gov (United States)

    Kanekar, Pradnya; Dautpure, Premlata; Sarnaik, Seema

    2003-09-01

    Environmental contamination by nitro compounds is associated principally with the explosives industry. However, global production and use of explosives is unavoidable. The presently widely used nitro-explosives are TNT (Trinitrotoluene), RDX (Royal Demolition Explosive) and HMX (High Melting Explosive). Nevertheless, the problems of these nitro-explosives are almost parallel due to their similarities of production processes, abundance of nitro-explosives and resembling chemical structures. The nitro-explosives per se as well as their environmental transformation products are toxic, showing symptoms as methaemoglobinaemia, kidney trouble, jaundice etc. Hence their removal/degradation from soil/water is essential. Aerobic and anaerobic degradation of TNT and RDX have been reported, while for HMX anaerobic or anoxic degradation have been described in many studies. A multisystem involvement using plants in remediation is gaining importance. Thus the information about degradation of nitro-explosives is available in jigsaw pieces which needs to be arranged and lacunae filled to get concrete degradative schemes so that environmental pollution from nitro-explosives can be dealt with more successfully at a macroscale. An overview of the reports on nitro-explosives degradation, future outlook and studies done by us are presented in this review.

  5. Home blood pressure (BP) monitoring in kidney transplant recipients is more adequate to monitor BP than office BP.

    Science.gov (United States)

    Agena, Fabiana; Prado, Elisangela dos Santos; Souza, Patricia Soares; da Silva, Giovanio Vieira; Lemos, Francine Brambate Carvalhinho; Mion, Decio; Nahas, William Carlos; David-Neto, Elias

    2011-11-01

    Hypertension is highly prevalent among kidney transplantation recipients and considered as an important cardiovascular risk factor influencing patient survival and kidney graft survival. Aim. Compare the blood pressure (BP) control in kidney transplant patients through the use of home blood pressure monitoring (HBPM) is more comparable with the results of ambulatory blood pressure monitoring compared to the measurement of office blood pressure. From March 2008 to April 2009 prospectively were evaluated 183 kidney transplant recipients with time after transplantation between 1 and 10 years. Patients underwent three methods for measuring BP: office blood pressure measurement (oBP), HBPM and ambulatory blood pressure monitoring (ABPM). In total, 183 patients were evaluated, among them 94 were men (54%) and 89 women (46%). The average age was 50 ± 11 years. The average time of transplant was 57 ± 32 months. Ninety-nine patients received grafts from deceased donors (54%) and 84 were recipients of living donors (46%). When assessed using oBP, 56.3% presented with uncontrolled and 43.7% with adequate control of BP with an average of 138.9/82.3 ± 17.8/12.1 mmHg. However, when measured by HBPM, 55.2% of subjects were controlled and 44.8% presented with uncontrolled BP with an average of 131.1/78.5 ± 17.4/8.9 mmHg. Using the ABPM, we observed that 63.9% of subjects were controlled and 36.1% of patients presented uncontrolled BP with an average 128.8/80.5 ± 12.5/8.1 mmHg. We found that the two methods (oBP and HBPM) have a significant agreement, but the HBPM has a higher agreement that oBP, confirmed P = 0.026. We found that there is no symmetry in the data for both methods with McNemar test. The correlation index of Pearson linear methods for the ABPM with the other two methods were 0.494 for office measurement and 0.768 for HBPM, best value of HBPM with ABPM. Comparing the errors of the two methods by paired t-test, we obtained the descriptive level of 0.837. Looking

  6. Services Textbook of Explosives

    Science.gov (United States)

    1972-03-01

    and shock effects is obtained by the use of ’primary’ (also known as ’initiatory’) explosives, among the most important of which are mercury fulminate ...Brown had discovered that compressed dry guncotton could be detonated by a mercury fulminate detonator, and a little later they found that compressed wet...of his powder (a mixture of mercury fulminate and potassium chlorate) enclosed in thin copper caps. This idea did not at once meet with the approval

  7. Explosives signatures and analysis

    Science.gov (United States)

    Fountain, Augustus Way, III; Oyler, Jonathan M.; Ostazeski, Stanley A.

    2008-04-01

    The challenge of sampling explosive materials for various high threat military and civilian operational scenarios requires the community to identify and exploit other chemical compounds within the mixtures that may be available to support stand-off detection techniques. While limited surface and vapor phase characterization of IEDs exist, they are insufficient to guide the future development and evaluation of field deployable explosives detection (proximity and standoff) capabilities. ECBC has conducted a limited investigation of three artillery ammunition types to determine what chemical vapors, if any, are available for sensing; the relative composition of the vapors which includes the more volatile compounds in munitions, i.e., plastersizers and binders; and the sensitivity needed detect these vapors at stand-off. Also in partnership with MIT-Lincoln Laboratory, we performed a background measurement campaign at the National Training Center to determine the baseline ambient amounts and variability of nitrates and nitro-ester compounds as vapors, particulates, and on surfaces; as well as other chemical compounds related to non-energetic explosive additives. Environmental persistence studies in contexts relevant to counter-IED sensing operations, such as surface residues, are still necessary.

  8. Explosive Welding of Pipes

    Science.gov (United States)

    Drennov, Oleg; Drennov, Andrey; Burtseva, Olga

    2013-06-01

    For connection by welding it is suggested to use the explosive welding method. This method is rather new. Nevertheless, it has become commonly used among the technological developments. This method can be advantageous (saving material and physical resources) comparing to its statical analogs (electron-beam welding, argon-arc welding, plasma welding, gas welding, etc.), in particular, in hard-to-reach areas due to their geographic and climatic conditions. Explosive welding of cylindrical surfaces is performed by launching of welded layer along longitudinal axis of construction. During this procedure, it is required to provide reliable resistance against radial convergent strains. The traditional method is application of fillers of pipe cavity, which are dense cylindrical objects having special designs. However, when connecting pipes consecutively in pipelines by explosive welding, removal of the fillers becomes difficult and sometimes impossible. The suggestion is to use water as filler. The principle of non-compressibility of liquid under quasi-dynamic loading is used. In one-dimensional gasdynamic and elastic-plastic calculations we determined non-deformed mass of water (perturbations, which are moving in the axial direction with sound velocity, should not reach the layer end boundaries for 5-7 circulations of shock waves in the radial direction). Linear dimension of the water layer from the zone of pipe coupling along axis in each direction is >= 2R, where R is the internal radius of pipe.

  9. An iterative method for the canard explosion in general planar systems

    DEFF Research Database (Denmark)

    Brøns, Morten

    2013-01-01

    The canard explosion is the change of amplitude and period of a limit cycle born in a Hopf bifurcation in a very narrow parameter interval. The phenomenon is well understood in singular perturbation problems where a small parameter controls the slow/fast dynamics. However, canard explosions...

  10. BP Spill Sampling and Monitoring Data

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset analyzes waste from the the British Petroleum Deepwater Horizon Rig Explosion Emergency Response, providing opportunity to query data sets by metadata...

  11. Photoacoustic Sensing of Explosives

    Science.gov (United States)

    2013-11-01

    weight (6 kg), and its power require- ments (24 W) allow for the high portability of the system. Laser vibrometer measurement, 2 meters from target...2515 P ar tic le v el oc ity (× 1 0 μ m /s ) −1 −2 2 0 1 −1 −2 2 0 1 −1 −2 2 0 1 The laser vibrometer and processing algorithms clearly...technique is depicted for a moving system. Note that the laser vibrometer measures the vibrations caused by the explosive vaporization process. At the same

  12. Protein Phosphatase 2A Dephosphorylates CaBP4 and Regulates CaBP4 Function

    Science.gov (United States)

    Haeseleer, Françoise; Sokal, Izabela; Gregory, Frederick D.; Lee, Amy

    2013-01-01

    Purpose. CaBP4 is a neuronal Ca2+-binding protein that is expressed in the retina and in the cochlea, and is essential for normal photoreceptor synaptic function. CaBP4 is phosphorylated by protein kinase C zeta (PKCζ) in the retina at serine 37, which affects its interaction with and modulation of voltage-gated Cav1 Ca2+ channels. In this study, we investigated the potential role and functional significance of protein phosphatase 2A (PP2A) in CaBP4 dephosphorylation. Methods. The effect of protein phosphatase inhibitors, light, and overexpression of PP2A subunits on CaBP4 dephosphorylation was measured in in vitro assays. Pull-down experiments using retinal or transfected HEK293 cell lysates were used to investigate the association between CaBP4 and PP2A subunits. Electrophysiologic recordings of cotransfected HEK293 cells were performed to analyze the effect of CaBP4 dephosphorylation in modulating Cav1.3 currents. Results. PP2A inhibitors, okadaic acid (OA), and fostriecin, but not PP1 selective inhibitors, NIPP-1, and inhibitor 2, block CaBP4 dephosphorylation in retinal lysates. Increased phosphatase activity in light-dependent conditions reverses phosphorylation of CaBP4 by PKCζ. In HEK293 cells, overexpression of PP2A enhances the rate of dephosphorylation of CaBP4. In addition, inhibition of protein phosphatase activity by OA increases CaBP4 phosphorylation and potentiates the modulatory effect of CaBP4 on Cav1.3 Ca2+ channels in HEK293T cells. Conclusions. This study provides evidence that CaBP4 is dephosphorylated by PP2A in the retina. Our findings reveal a novel role for protein phosphatases in regulating CaBP4 function in the retina, which may fine tune presynaptic Ca2+ signals at the photoreceptor synapse. PMID:23341017

  13. Laser machining of explosives

    Science.gov (United States)

    Perry, Michael D.; Stuart, Brent C.; Banks, Paul S.; Myers, Booth R.; Sefcik, Joseph A.

    2000-01-01

    The invention consists of a method for machining (cutting, drilling, sculpting) of explosives (e.g., TNT, TATB, PETN, RDX, etc.). By using pulses of a duration in the range of 5 femtoseconds to 50 picoseconds, extremely precise and rapid machining can be achieved with essentially no heat or shock affected zone. In this method, material is removed by a nonthermal mechanism. A combination of multiphoton and collisional ionization creates a critical density plasma in a time scale much shorter than electron kinetic energy is transferred to the lattice. The resulting plasma is far from thermal equilibrium. The material is in essence converted from its initial solid-state directly into a fully ionized plasma on a time scale too short for thermal equilibrium to be established with the lattice. As a result, there is negligible heat conduction beyond the region removed resulting in negligible thermal stress or shock to the material beyond a few microns from the laser machined surface. Hydrodynamic expansion of the plasma eliminates the need for any ancillary techniques to remove material and produces extremely high quality machined surfaces. There is no detonation or deflagration of the explosive in the process and the material which is removed is rendered inert.

  14. Explosives detection for aviation security.

    Science.gov (United States)

    Fainberg, A

    1992-03-20

    The threat of terrorism against commercial aviation has received much attention in the past few years. In response, new ways to detect explosives and to combine techniques based on different phenomena into integrated security systems are being developed to improve aviation security. Several leading methods for explosives and weapons detection are presented.

  15. Introduction to High Explosives Science

    Energy Technology Data Exchange (ETDEWEB)

    Skidmore, Cary Bradford [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Preston, Daniel N. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-11-17

    These are a set of slides for educational outreach to children on high explosives science. It gives an introduction to the elements involved in this science: carbon, hydrogen, nitrogen, and oxygen. Combined, these form the molecule HMX. Many pictures are also included to illustrate explosions.

  16. Numerical Model for Hydrovolcanic Explosions.

    Science.gov (United States)

    Mader, Charles; Gittings, Michael

    2007-03-01

    A hydrovolcanic explosion is generated by the interaction of hot magma with ground water. It is called Surtseyan after the 1963 explosive eruption off Iceland. The water flashes to steam and expands explosively. Liquid water becomes water gas at constant volume and generates pressures of about 3GPa. The Krakatoa hydrovolcanic explosion was modeled using the full Navier-Stokes AMR Eulerian compressible hydrodynamic code called SAGE [1] which includes the high pressure physics of explosions. The water in the hydrovolcanic explosion was described as liquid water heated by magma to 1100 K. The high temperature water is treated as an explosive with the hot liquid water going to water gas. The BKW [2] steady state detonation state has a peak pressure of 8.9 GPa, a propagation velocity of 5900 meters/sec and the water is compressed to 1.33 g/cc. [1] Numerical Modeling of Water Waves, Second Edition, Charles L. Mader, CRC Press 2004. [2] Numerical Modeling of Explosions and Propellants, Charles L. Mader, CRC Press 1998.

  17. Microbial bioreporters of trace explosives.

    Science.gov (United States)

    Shemer, Benjamin; Koshet, Ori; Yagur-Kroll, Sharon; Belkin, Shimshon

    2017-06-01

    Since its introduction as an explosive in the late 19th century, 2,4,6-trinitrotoluene (TNT), along with other explosive compounds, has left numerous environmental marks. One of these is widespread soil and water pollution by trace explosives in military proving grounds, manufacturing facilities, or actual battlefields. Another dramatic impact is that exerted by the millions of landmines and other explosive devices buried in large parts of the world, causing extensive loss of life, injuries, and economical damage. In this review we highlight recent advances in the design and construction of microbial bioreporters, molecularly engineered to generate a quantifiable dose-dependent signal in the presence of trace amounts of explosives. Such sensor strains may be employed for monitoring environmental pollution as well as for the remote detection of buried landmines. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Caribbean AIDS explosion examined.

    Science.gov (United States)

    2000-03-13

    Homophobia, sex tourism, infidelity, and poverty are major factors causing a rapid explosion of AIDS and increasingly infecting women in the Caribbean. The region has the second largest incidence of AIDS in the world after Africa. The number of people with the HIV virus is likely greater than 500,000 and could be as high as 700,000, about twice the previously reported figures. Societal norms encourage homosexuals to have heterosexual relationships, and married men to have extramarital affairs, while poverty forces men and women to prostitution, often with tourists. In addition, a survey of 8100 school children in 4 English-speaking Caribbean islands revealed that 42% of the children had experienced sex before the age of 10 years; 62% had experienced it by age 12. This finding may reflect a high rate of child molestation in the region.

  19. Nucleosynthesis in stellar explosions

    Energy Technology Data Exchange (ETDEWEB)

    Woosley, S.E.; Axelrod, T.S.; Weaver, T.A.

    1983-01-01

    The final evolution and explosion of stars from 10 M/sub solar/ to 10/sup 6/ M/sub solar/ are reviewed with emphasis on factors affecting the expected nucleosynthesis. We order our paper in a sequence of decreasing mass. If, as many suspect, the stellar birth function was peaked towards larger masses at earlier times (see e.g., Silk 1977; but also see Palla, Salpeter, and Stahler 1983), this sequence of masses might also be regarded as a temporal sequence. At each stage of Galactic chemical evolution stars form from the ashes of preceding generations which typically had greater mass. A wide variety of Type I supernova models, most based upon accreting white dwarf stars, are also explored using the expected light curves, spectra, and nucleosynthesis as diagnostics. No clearly favored Type I model emerges that is capable of simultaneously satisfying all three constraints.

  20. Mixing in explosions

    Energy Technology Data Exchange (ETDEWEB)

    Kuhl, A.L.

    1993-12-01

    Explosions always contain embedded turbulent mixing regions, for example: boundary layers, shear layers, wall jets, and unstable interfaces. Described here is one particular example of the latter, namely, the turbulent mixing occurring in the fireball of an HE-driven blast wave. The evolution of the turbulent mixing was studied via two-dimensional numerical simulations of the convective mixing processes on an adaptive mesh. Vorticity was generated on the fireball interface by baroclinic effects. The interface was unstable, and rapidly evolved into a turbulent mixing layer. Four phases of mixing were observed: (1) a strong blast wave phase; (2) and implosion phase; (3) a reshocking phase; and (4) an asymptotic mixing phase. The flowfield was azimuthally averaged to evaluate the mean and r.m.s. fluctuation profiles across the mixing layer. The vorticity decayed due to a cascade process. This caused the corresponding enstrophy parameter to increase linearly with time -- in agreement with homogeneous turbulence calculations of G.K. Batchelor.

  1. TopBP1 is required at mitosis to reduce transmission of DNA damage to G1 daughter cells

    Science.gov (United States)

    Pedersen, Rune Troelsgaard; Kruse, Thomas; Nilsson, Jakob

    2015-01-01

    Genome integrity is critically dependent on timely DNA replication and accurate chromosome segregation. Replication stress delays replication into G2/M, which in turn impairs proper chromosome segregation and inflicts DNA damage on the daughter cells. Here we show that TopBP1 forms foci upon mitotic entry. In early mitosis, TopBP1 marks sites of and promotes unscheduled DNA synthesis. Moreover, TopBP1 is required for focus formation of the structure-selective nuclease and scaffold protein SLX4 in mitosis. Persistent TopBP1 foci transition into 53BP1 nuclear bodies (NBs) in G1 and precise temporal depletion of TopBP1 just before mitotic entry induced formation of 53BP1 NBs in the next cell cycle, showing that TopBP1 acts to reduce transmission of DNA damage to G1 daughter cells. Based on these results, we propose that TopBP1 maintains genome integrity in mitosis by controlling chromatin recruitment of SLX4 and by facilitating unscheduled DNA synthesis. PMID:26283799

  2. Discriminating between explosions and earthquakes

    Science.gov (United States)

    Cho, Kwang-Hyun

    2014-12-01

    Earthquake, explosion, and a nuclear test data are compared with forward modeling and band-pass filtered surface wave amplitude data for exploring methodologies to improve earthquake-explosion discrimination. The proposed discrimination method is based on the solutions of a double integral transformation in the wavenumber and frequency domains. Recorded explosion data on June 26, 2001 (39.212°N, 125.383°E) and October 30, 2001 (38.748°N, 125.267°E), a nuclear test on October 9, 2006 (41.275°N, 129.095°E), and two earthquakes on April 14, 2002 (39.207°N, 125.686°E) and June 7, 2002 (38.703°N, 125.638°E), all in North Korea, are used to discriminate between explosions and earthquakes by seismic wave analysis and numerical modeling. The explosion signal is characterized by first P waves with higher energy than that of S waves. Rg waves are clearly dominant at 0.05-0.5 Hz in the explosion data but not in the earthquake data. This feature is attributed to the dominant P waves in the explosion and their coupling with the SH components.

  3. Explosive signatures: Pre & post blast

    Science.gov (United States)

    Bernier, Evan Thomas

    Manuscripts 1 and 2 of this dissertation both involve the pre-blast detection of trace explosive material. The first manuscript explores the analysis of human hair as an indicator of exposure to explosives. Field analysis of hair for trace explosives is quick and non-invasive, and could prove to be a powerful linkage to physical evidence in the form of bulk explosive material. Individuals tested were involved in studies which required handling or close proximity to bulk high explosives such as TNT, PETN, and RDX. The second manuscript reports the results of research in the design and application of canine training aids for non-traditional, peroxide-based explosives. Organic peroxides such as triacetonetriperoxide (TATP) and hexamethylenetriperoxidediamine (HMTD) can be synthesized relatively easily with store-bought ingredients and have become popular improvised explosives with many terrorist groups. Due to the hazards of handling such sensitive compounds, this research established methods for preparing training aids which contained safe quantities of TATP and HMTD for use in imprinting canines with their characteristic odor. Manuscripts 3 and 4 of this dissertation focus on research conducted to characterize pipe bombs during and after an explosion (post-blast). Pipe bombs represent a large percentage of domestic devices encountered by law enforcement. The current project has involved the preparation and controlled explosion of over 90 pipe bombs of different configurations in order to obtain data on fragmentation patterns, fragment velocity, blast overpressure, and fragmentation distance. Physical data recorded from the collected fragments, such as mass, size, and thickness, was correlated with the relative power of the initial device. Manuscript 4 explores the microstructural analysis of select pipe bomb fragments. Shock-loading of the pipe steel led to plastic deformation and work hardening in the steel grain structure as evidenced by optical microscopy and

  4. Fire and explosion hazards to flora and fauna from explosives.

    Science.gov (United States)

    Merrifield, R

    2000-06-30

    Deliberate or accidental initiation of explosives can produce a range of potentially damaging fire and explosion effects. Quantification of the consequences of such effects upon the surroundings, particularly on people and structures, has always been of paramount importance. Information on the effects on flora and fauna, however, is limited, with probably the weakest area lying with fragmentation of buildings and their effects on different small mammals. Information has been used here to gain an appreciation of the likely magnitude of the potential fire and explosion effects on flora and fauna. This is based on a number of broad assumptions and a variety of data sources including World War II bomb damage, experiments performed with animals 30-40 years ago, and more recent field trials on building break-up under explosive loading.

  5. Testing of Confining Pressure Impacton Explosion Energy of Explosive Materials

    Science.gov (United States)

    Drzewiecki, Jan; Myszkowski, Jacek; Pytlik, Andrzej; Pytlik, Mateusz

    2017-06-01

    This paper presents the results of testing the explosion effects of two explosive charges placed in an environment with specified values of confining pressure. The aim of this study is to determine the impact of variable environmental conditions on the suitability of particular explosives for their use in the prevention of natural hazards in hard coal mining. The research results will contribute to improving the efficiency of currently adopted technologies of natural hazard prevention and aid in raising the level of occupational safety. To carry out the subject matter measurements, a special test stand was constructed which allows the value of the initial pressure inside the chamber, which constitutes its integral part, to be altered before the detonation of the charge being tested. The obtained characteristics of the pressure changes during the explosion of the analysed charge helped to identify the work (energy) which was produced during the process. The test results are a valuable source of information, opening up new possibilities for the use of explosives, the development of innovative solutions for the construction of explosive charges and their initiation.

  6. [Causation, prevention and treatment of dust explosion].

    Science.gov (United States)

    Dong, Maolong; Jia, Wenbin; Wang, Hongtao; Han, Fei; Li, Xiao-Qiang; Hu, Dahai

    2014-10-01

    With the development of industrial technology, dust explosion accidents have increased, causing serious losses of people's lives and property. With the development of economy, we should lay further emphasis on causation, prevention, and treatment of dust explosion. This article summarizes the background, mechanism, prevention, and treatment of dust explosion, which may provide some professional knowledge and reference for the treatment of dust explosion.

  7. Explosives mimic for testing, training, and monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Reynolds, John G.; Durban, Matthew M.; Gash, Alexander E.; Grapes, Michael D.; Kelley, Ryan S.; Sullivan, Kyle T.

    2018-02-13

    Additive Manufacturing (AM) is used to make mimics for explosives. The process uses mixtures of explosives and matrices commonly used in AM. The explosives are formulated into a mixture with the matrix and printed using AM techniques and equipment. The explosive concentrations are kept less than 10% by wt. of the mixture to conform to requirements of shipping and handling.

  8. Microglass spheres in ammonium nitrate explosives

    OpenAIRE

    Y. Kazakov; G. Turesheva; Olga Golovchenko; N. Bergeneva; R. Seisembayev

    2010-01-01

    Developed consisting the explosive ammonium nitrate, paraffin and mikrosteklosfer. Due to the input of the explosive paraffin increased water resistance of explosives to 60 minutes. By entering into the explosive mikrosteklosfers been improved caking indices, since steklomikrosfers and paraffin was formed seal between the granules of ammonium nitrate.

  9. Microglass spheres in ammonium nitrate explosives

    Directory of Open Access Journals (Sweden)

    Y. Kazakov

    2010-03-01

    Full Text Available Developed consisting the explosive ammonium nitrate, paraffin and mikrosteklosfer. Due to the input of the explosive paraffin increased water resistance of explosives to 60 minutes. By entering into the explosive mikrosteklosfers been improved caking indices, since steklomikrosfers and paraffin was formed seal between the granules of ammonium nitrate.

  10. Suppression of stratified explosive interactions

    Energy Technology Data Exchange (ETDEWEB)

    Meeks, M.K.; Shamoun, B.I.; Bonazza, R.; Corradini, M.L. [Wisconsin Univ., Madison, WI (United States). Dept. of Nuclear Engineering and Engineering Physics

    1998-01-01

    Stratified Fuel-Coolant Interaction (FCI) experiments with Refrigerant-134a and water were performed in a large-scale system. Air was uniformly injected into the coolant pool to establish a pre-existing void which could suppress the explosion. Two competing effects due to the variation of the air flow rate seem to influence the intensity of the explosion in this geometrical configuration. At low flow rates, although the injected air increases the void fraction, the concurrent agitation and mixing increases the intensity of the interaction. At higher flow rates, the increase in void fraction tends to attenuate the propagated pressure wave generated by the explosion. Experimental results show a complete suppression of the vapor explosion at high rates of air injection, corresponding to an average void fraction of larger than 30%. (author)

  11. Explosive Blast Neuropathology and Seizures

    Directory of Open Access Journals (Sweden)

    S. Krisztian eKovacs

    2014-04-01

    Full Text Available Traumatic brain injury (TBI due to explosive blast exposure is a leading combat casualty. It is also implicated as a key contributor to war related mental health diseases. A clinically important consequence of all types of TBI is a high risk for development of seizures and epilepsy. Seizures have been reported in patients who have suffered blast injuries in the Global War on Terror but the exact prevalence is unknown. The occurrence of seizures supports the contention that explosive blast leads to both cellular and structural brain pathology. Unfortunately, the exact mechanism by which explosions cause brain injury is unclear, which complicates development of meaningful therapies and mitigation strategies. To help improve understanding, detailed neuropathological analysis is needed. For this, histopathological techniques are extremely valuable and indispensable. In the following we will review the pathological results, including those from immunohistochemical and special staining approaches, from recent preclinical explosive blast studies.

  12. Causes of the Cambrian Explosion

    National Research Council Canada - National Science Library

    M. Paul Smith; David A. T. Harper

    2013-01-01

    .... Recent hypotheses for the Cambrian explosion fall into three main categories: developmental/genetic, ecologic, and abiotic/environmental, with geochemical hypotheses forming an abundant and distinctive subset of the last...

  13. Explosive dome eruptions modulated by periodic gas-driven inflation

    Science.gov (United States)

    Johnson, Jeffrey B.; Lyons, John; Andrews, B. J.; Lees, J.M.

    2014-01-01

    Volcan Santiaguito (Guatemala) “breathes” with extraordinary regularity as the edifice's conduit system accumulates free gas, which periodically vents to the atmosphere. Periodic pressurization controls explosion timing, which nearly always occurs at peak inflation, as detected with tiltmeters. Tilt cycles in January 2012 reveal regular 26 ± 6 min inflation/deflation cycles corresponding to at least ~101 kg/s of gas fluxing the system. Very long period (VLP) earthquakes presage explosions and occur during cycles when inflation rates are most rapid. VLPs locate ~300 m below the vent and indicate mobilization of volatiles, which ascend at ~50 m/s. Rapid gas ascent feeds pyroclast-laden eruptions lasting several minutes and rising to ~1 km. VLPs are not observed during less rapid inflation episodes; instead, gas vents passively through the conduit producing no infrasound and no explosion. These observations intimate that steady gas exsolution and accumulation in shallow reservoirs may drive inflation cycles at open-vent silicic volcanoes.

  14. Furball Explosive Breakout Test

    Energy Technology Data Exchange (ETDEWEB)

    Carroll, Joshua David [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-08-05

    For more than 30 years the Onionskin test has been the primary way to study the surface breakout of a detonation wave. Currently the Onionskin test allows for only a small, one dimensional, slice of the explosive in question to be observed. Asymmetrical features are not observable with the Onionskin test and its one dimensional view. As a result, in 2011, preliminary designs for the Hairball and Furball were developed then tested. The Hairball used shorting pins connected to an oscilloscope to determine the arrival time at 24 discrete points. This limited number of data points, caused by the limited number of oscilloscope channels, ultimately led to the Hairball’s demise. Following this, the Furball was developed to increase the number of data points collected. Instead of shorting pins the Furball uses fiber optics imaged by a streak camera to determine the detonation wave arrival time for each point. The original design was able to capture the detonation wave’s arrival time at 205 discrete points with the ability to increase the number of data points if necessary.

  15. Based on BP Neural Network Stock Prediction

    Science.gov (United States)

    Liu, Xiangwei; Ma, Xin

    2012-01-01

    The stock market has a high profit and high risk features, on the stock market analysis and prediction research has been paid attention to by people. Stock price trend is a complex nonlinear function, so the price has certain predictability. This article mainly with improved BP neural network (BPNN) to set up the stock market prediction model, and…

  16. 2000 Johnston Site 2B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  17. 2000 Johnston Site 1B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  18. 2000 Johnston Site 3B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 3B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 3, 2000. With a start point (meter 0) at...

  19. Lidar Detection of Explosives Traces

    Directory of Open Access Journals (Sweden)

    Bobrovnikov Sergei M.

    2016-01-01

    Full Text Available The possibility of remote detection of traces of explosives using laser fragmentation/laser-induced fluorescence (LF/LIF is studied. Experimental data on the remote visualization of traces of trinitrotoluene (TNT, hexogen (RDX, trotyl-hexogen (Comp B, octogen (HMX, and tetryl with a scanning lidar detector of traces of nitrogen-containing explosives at a distance of 5 m are presented.

  20. Intraperitoneal explosion following gastric perforation.

    Science.gov (United States)

    Mansfield, Scott K; Borrowdale, Roderick

    2014-04-01

    The object of this study is to report a rare case of explosion during laparotomy where diathermy ignited intraperitoneal gas from a spontaneous stomach perforation. Fortunately, the patient survived but the surgeon experienced a finger burn. A literature review demonstrates other examples of intraoperative explosion where gastrointestinal gases were the fuel source. Lessons learned from these cases provide recommendations to prevent this potentially lethal event from occurring. Copyright © 2012. Published by Elsevier B.V.

  1. Intraperitoneal explosion following gastric perforation

    Directory of Open Access Journals (Sweden)

    Scott K. Mansfield

    2014-04-01

    Full Text Available The object of this study is to report a rare case of explosion during laparotomy where diathermy ignited intraperitoneal gas from a spontaneous stomach perforation. Fortunately, the patient survived but the surgeon experienced a finger burn. A literature review demonstrates other examples of intraoperative explosion where gastrointestinal gases were the fuel source. Lessons learned from these cases provide recommendations to prevent this potentially lethal event from occurring.

  2. exLOPA for explosion risks assessment.

    Science.gov (United States)

    Markowski, Adam S

    2007-04-11

    The European Union regulations require safety and health protection of workers who are potentially at risk from explosive atmosphere areas. According to the requirements, the operators of installations where potentially explosive atmosphere can occur are obliged to produce an explosion protection document. The key objective of this document is the assessment of explosion risks. This paper is concerned with the so-called explosion layer of protection analysis (exLOPA), which allows for semi-quantitative explosion risk assessment for process plants where explosive atmospheres occur. The exLOPA is based on the original work of CCPS for LOPA but takes into account some typical factors appropriate for explosion, like the probability that an explosive atmosphere will occur, probability that sources of ignition will be present and become effective as well as the probability of failure on demand for appropriate explosion prevention and mitigation means.

  3. AcEST: BP917025 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000094_H07 471 Adiantum capillus-veneris mRNA. clone: YMU001_000094_H07. BP917025 - Show BP917025...is mRNA. clone: YMU001_000094_H07. Accession BP917025 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP917025|Adiantum capillus-ven...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917025

  4. AcEST: BP919150 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_G08 485 Adiantum capillus-veneris mRNA. clone: YMU001_000121_G08. BP919150 - Show BP91...is mRNA. clone: YMU001_000121_G08. Accession BP919150 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91

  5. AcEST: BP919955 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_B09 462 Adiantum capillus-veneris mRNA. clone: YMU001_000131_B09. BP919955 - Show BP91995...is mRNA. clone: YMU001_000131_B09. Accession BP919955 Tissue type prothallium Developmental stage - Contig I...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919955|Adiantum capill... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91995

  6. AcEST: BP918406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B06 468 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B06. BP918406 - Show BP9184...is mRNA. clone: YMU001_000113_B06. Accession BP918406 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-vene...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-veneris m

  7. AcEST: BP911840 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G07 495 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G07. BP911840 - Show BP91184...is mRNA. clone: YMU001_000009_G07. Accession BP911840 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91184...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP911840|Adiantum capillu

  8. AcEST: BP920154 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F09 487 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F09. BP920154 - Show BP92015...is mRNA. clone: YMU001_000133_F09. Accession BP920154 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920154|Adia...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920154|Adiantum

  9. AcEST: BP920186 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A11 504 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A11. BP920186 - Show BP92018...is mRNA. clone: YMU001_000134_A11. Accession BP920186 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92018...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920186|Adiantu

  10. AcEST: BP918011 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_E11 519 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E11. BP918011 - Show BP91801...is mRNA. clone: YMU001_000108_E11. Accession BP918011 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiant...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiantum cap

  11. AcEST: BP919841 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G06 496 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G06. BP919841 - Show BP91984...is mRNA. clone: YMU001_000129_G06. Accession BP919841 Tissue type prothallium Developmental stage - Contig I...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919841|Adiantum ca...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919841|Adiantum capi

  12. AcEST: BP919856 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_A02 514 Adiantum capillus-veneris mRNA. clone: YMU001_000130_A02. BP919856 - Show BP91985...is mRNA. clone: YMU001_000130_A02. Accession BP919856 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91985... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919856|Adiantum c

  13. AcEST: BP914001 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G04 493 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G04. BP914001 - Show BP91400...is mRNA. clone: YMU001_000038_G04. Accession BP914001 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914001|...ic Acids Res. 25:3389-3402. Query= BP914001|Adiantum capillus-veneris mRNA, clone

  14. The Quiet Explosion

    Science.gov (United States)

    2008-07-01

    A European-led team of astronomers are providing hints that a recent supernova may not be as normal as initially thought. Instead, the star that exploded is now understood to have collapsed into a black hole, producing a weak jet, typical of much more violent events, the so-called gamma-ray bursts. The object, SN 2008D, is thus probably among the weakest explosions that produce very fast moving jets. This discovery represents a crucial milestone in the understanding of the most violent phenomena observed in the Universe. Black Hole ESO PR Photo 23a/08 A Galaxy and two Supernovae These striking results, partly based on observations with ESO's Very Large Telescope, will appear tomorrow in Science Express, the online version of Science. Stars that were at birth more massive than about 8 times the mass of our Sun end their relatively short life in a cosmic, cataclysmic firework lighting up the Universe. The outcome is the formation of the densest objects that exist, neutron stars and black holes. When exploding, some of the most massive stars emit a short cry of agony, in the form of a burst of very energetic light, X- or gamma-rays. In the early afternoon (in Europe) of 9 January 2008, the NASA/STFC/ASI Swift telescope discovered serendipitously a 5-minute long burst of X-rays coming from within the spiral galaxy NGC 2770, located 90 million light-years away towards the Lynx constellation. The Swift satellite was studying a supernova that had exploded the previous year in the same galaxy, but the burst of X-rays came from another location, and was soon shown to arise from a different supernova, named SN 2008D. Researchers at the Italian National Institute for Astrophysics (INAF), the Max-Planck Institute for Astrophysics (MPA), ESO, and at various other institutions have observed the supernova at great length. The team is led by Paolo Mazzali of INAF's Padova Observatory and MPA. "What made this event very interesting," says Mazzali, "is that the X-ray signal was very

  15. Molecular Outflows: Explosive versus Protostellar

    Energy Technology Data Exchange (ETDEWEB)

    Zapata, Luis A.; Rodríguez, Luis F.; Palau, Aina; Loinard, Laurent [Instituto de Radioastronomía y Astrofísica, UNAM, Apdo. Postal 3-72 (Xangari), 58089 Morelia, Michoacán, México (Mexico); Schmid-Burgk, Johannes [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121, Bonn (Germany)

    2017-02-10

    With the recent recognition of a second, distinctive class of molecular outflows, namely the explosive ones not directly connected to the accretion–ejection process in star formation, a juxtaposition of the morphological and kinematic properties of both classes is warranted. By applying the same method used in Zapata et al., and using {sup 12}CO( J = 2-1) archival data from the Submillimeter Array, we contrast two well-known explosive objects, Orion KL and DR21, to HH 211 and DG Tau B, two flows representative of classical low-mass protostellar outflows. At the moment, there are only two well-established cases of explosive outflows, but with the full availability of ALMA we expect that more examples will be found in the near future. The main results are the largely different spatial distributions of the explosive flows, consisting of numerous narrow straight filament-like ejections with different orientations and in almost an isotropic configuration, the redshifted with respect to the blueshifted components of the flows (maximally separated in protostellar, largely overlapping in explosive outflows), the very-well-defined Hubble flow-like increase of velocity with distance from the origin in the explosive filaments versus the mostly non-organized CO velocity field in protostellar objects, and huge inequalities in mass, momentum, and energy of the two classes, at least for the case of low-mass flows. Finally, all the molecular filaments in the explosive outflows point back to approximately a central position (i.e., the place where its “exciting source” was located), contrary to the bulk of the molecular material within the protostellar outflows.

  16. Growth of Creamed TNT on Thermal Cycling

    Science.gov (United States)

    1978-07-01

    on this page): No Limitation 14. DESCRIPTORS: Explosives ; Trinitrotoluene; Growth; Thermal Cycling; Thermal Expansion; Impurities; Eutectics. T5...Apparatus 2 2. Materials 2 RESULTS 3 Series 1 3 Series 2 4 Series 3 5 Observations from Dilatometer Rprnreig 5 Surface Changes Accompanying Growth 6...filling prematures than similar rounds which have not. It was proposed that this desensitisation might be a result of the explosive expanding

  17. Biodegradation of di-n-butyl phthalate (DnBP) in bioaugmented bioslurry phase reactor.

    Science.gov (United States)

    Shailaja, S; Ramakrishna, M; Venkata Mohan, S; Sarma, P N

    2007-05-01

    Bioremediation of di-n-butyl phthalate (DnBP) in soil was studied with various concentrations in a bioslurry phase batch reactor operated in sequenting batch mode (bioaugmented with effluent treatment plant (ETP) microflora) for a total cycle period of 96h. Process performance during the reactor operation was assessed by monitoring DnBP concentration and biochemical process parameters viz., pH, dissolved oxygen (DO), colony forming units (CFU) and oxygen uptake rate (OUR), during the sequence phase operation. The degradation rate was observed to be rapid at lower substrate concentrations and found to be slow as the substrate concentration increased. The potent bacterial strain was also isolated from the slurry phase reactor. Metabolites formed during the degradation of DnBP in the slurry phase reactor were identified. Studies on the kinetics and half-life of the reaction revealed that the degradation process followed zero-order kinetic model.

  18. Dependence of seismic energy released during destressing blasting on consumption rate of explosives. [Stress relaxation

    Energy Technology Data Exchange (ETDEWEB)

    Mitrega, P.; Syrek, B.

    1987-02-01

    Analyzes efficiency of rock burst prevention by destressing blasting in the Wujek mine. Medium and thick coal seams situated at depths exceeding 690 m are mined with stowing. Longwall faces are about 150 m long, advance rates range from 2 to 3 m/d. Effects of 841 blasting cycles are analyzed. Weight of explosives used in each blasting ranges from 40 to 280 kg. Analyses show that destressing effects of blasting are highest when blasting occurs at regular time intervals. Explosive weight should not be less than 80 kg or more than 150 kg. Using 1 kg explosives per 1 m working face length is recommended. 9 refs.

  19. Sacrificial fragmentation and superheated foaming trigger of explosive volcanism

    Science.gov (United States)

    Lavallée, Yan; Cimarelli, Corrado; Hornby, Adrian; Johnson, Jeffrey; Kendrick, Jackie; von Aulock, Felix; Wadsworth, Fabian; Rhodes, Emma; Kennedy, Ben; Andrews, Benjamin; Chigna, Gustavo; Dingwell, Donald

    2015-04-01

    The most common occurrence of volcanic activity is at lava domes. Active domes tend to experience near sudden episodes of gas-and-ash explosion on a daily basis and sometimes several times per day. This unpredictable behaviour is an expression of magma forced to undergo fragmentation due to gas overpressure. Here, Examination of dome activity reveals that gas-and-ash explosions are concordant with inflation/deflation cycles that are faster than during simple outgassing episodes. Although frequent, these gas-and-ash explosions usually leave the dome intact as strain is almost entirely accommodated along repeatedly activated marginal faults, as seen at Santiaguito, Guatemala. We present petrological evidence that gas-and-ash eruptions are the product of fragmentation due to "superheated foaming" along fault zones. Textural analysis reveals chemically heterogeneous melt filaments emerging from crystals in the ash generated by fragmentation in these events. The same texture is observed in high-velocity, rotary-shear experiments on Santiaguito dome lava. The frictional melting is experimentally generated after mere centimetres of slip of these lavas, and yields foaming of the interstitial melt adjacent to the slip zone. Rapid and intense local frictional heating can explain both the foaming and the fragmentation cycles of these magmas. Gas-and-ash explosions exhibited in the dome at Santiaguito are hence controlled by the inevitable frictional heating which results from tenacious strain localisation, whereby lava is "sacrificially" fragmented along faults in order to preserve the bulk of the dome. We discuss how this new fragmentation trigger may underline the most common type of explosive activity.

  20. Thickened aqueous slurry explosive composition

    Energy Technology Data Exchange (ETDEWEB)

    Craig, J.F.M.; Matts, T.C.; Seto, P.F.L.

    1979-01-04

    A thickened slurry explosive composition consists of water, inorganic oxidizing salt, fuel, and thickener wherein the thickener is a mixture of an unmodified guar gum and a hydroxypropyl-modified guar gum. The thickener mixture improves the stability and rheologic properties of the explosive. The preferred thickener mixture contains from 15 to 85% by weight of unmodified guar to 15 to 85% by weight of hydroxypropyl-modified guar and the composition preferably comprises 0.2% to 2.0% by weight of the thickener mixture. The thickener mixture is especially effective in explosive compositions sensitized with gas bubbles or with water-soluble organic nitrate for example, ethylene glycol mononitrate, propylene glycol mononitrate, ethanolamine nitrate, propanolamine nitrate, methylamine nitrate, ethylamine nitrate, ethylenediamine dinitrate, urea nitrate, or aniline nitrate. 14 claims.

  1. Optimal dynamic detection of explosives

    Energy Technology Data Exchange (ETDEWEB)

    Moore, David Steven [Los Alamos National Laboratory; Mcgrane, Shawn D [Los Alamos National Laboratory; Greenfield, Margo T [Los Alamos National Laboratory; Scharff, R J [Los Alamos National Laboratory; Rabitz, Herschel A [PRINCETON UNIV; Roslund, J [PRINCETON UNIV

    2009-01-01

    The detection of explosives is a notoriously difficult problem, especially at stand-off distances, due to their (generally) low vapor pressure, environmental and matrix interferences, and packaging. We are exploring optimal dynamic detection to exploit the best capabilities of recent advances in laser technology and recent discoveries in optimal shaping of laser pulses for control of molecular processes to significantly enhance the standoff detection of explosives. The core of the ODD-Ex technique is the introduction of optimally shaped laser pulses to simultaneously enhance sensitivity of explosives signatures while reducing the influence of noise and the signals from background interferents in the field (increase selectivity). These goals are being addressed by operating in an optimal nonlinear fashion, typically with a single shaped laser pulse inherently containing within it coherently locked control and probe sub-pulses. With sufficient bandwidth, the technique is capable of intrinsically providing orthogonal broad spectral information for data fusion, all from a single optimal pulse.

  2. Experiments in gasdynamics of explosions.

    Science.gov (United States)

    Oppenheim, A. K.; Soloukhin, R. I.

    1973-01-01

    Various topics concerning recent accomplishments in experimental studies of gasdynamics of explosions are reviewed. Detonations, shocks, and blast waves form these topics. The most important feature of current studies is the particular attention paid to transient processes and the concomitant progress made in the development of novel experimental means for the study of such processes. The most exciting prospects for the future are associated with possibilities of exploiting knowledge of explosion phenomena for the development of such interesting devices as the gasdynamic laser and the apparatus based on the use of lasers to achieve controlled thermonuclear reaction.

  3. Intravesical explosion during transurethral electrosurgery.

    Science.gov (United States)

    Georgios, Kallinikas; Evangelos, Boulinakis; Helai, Habib; Ioannis, Gerzelis

    2015-05-01

    Intravesical explosion is a very rare complication of transurethral resection of prostate and transurethral resection of bladder tumour operations. In vitro studies have shown that the gases produced during the procedure could result in a blast once they are mixed with air from the atmosphere. A 79-year-old male experienced an explosion in his bladder while undergoing a transurethral resection of bladder tumour. The case is presented as well as the way that it was treated as an emergency. Precautions of such events are finally suggested. © The Author(s) 2015 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  4. Anti-tumor effects of fibroblast growth factor-binding protein (FGF-BP knockdown in colon carcinoma

    Directory of Open Access Journals (Sweden)

    Schulze Daniel

    2011-11-01

    Full Text Available Abstract Background Fibroblast growth factors FGF-1 and FGF-2 are often upregulated in tumors, but tightly bound to heparan sulphate proteoglycans of the extracellular matrix (ECM. One mechanism of their bioactivation relies on the FGF-binding protein (FGF-BP which, upon reversible binding to FGF-1 or -2, leads to their release from the ECM. FGF-BP increases tumorigenicity and is highly expressed in tumors like colon carcinoma. In this paper, we analyse cellular and molecular consequences of RNAi-mediated FGF-BP knockdown in colon carcinoma, and explore the therapeutic effects of the nanoparticle-mediated delivery of small interfering RNAs (siRNAs for FGF-BP targeting. Results Employing stable RNAi cells, we establish a dose-dependence of cell proliferation on FGF-BP expression levels. Decreased proliferation is mirrored by alterations in cell cycle distribution and upregulation of p21, which is relevant for mediating FGF-BP effects. While inhibition of proliferation is mainly associated with reduced Akt and increased GSK3β activation, antibody array-based analyses also reveal other alterations in MAPK signalling. Additionally, we demonstrate induction of apoptosis, mediated through caspase-3/7 activation, and alterations in redox status upon FGF-BP knockdown. These effects are based on the upregulation of Bad, Bax and HIF-1α, and the downregulation of catalase. In a therapeutic FGF-BP knockdown approach based on RNAi, we employ polymer-based nanoparticles for the in vivo delivery of siRNAs into established wildtype colon carcinoma xenografts. We show that the systemic treatment of mice leads to the inhibition of tumor growth based on FGF-BP knockdown. Conclusions FGF-BP is integrated in a complex network of cytoprotective effects, and represents a promising therapeutic target for RNAi-based knockdown approaches.

  5. Air Monitoring Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  6. Waste Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  7. Surface Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  8. Air Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  9. Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  10. Sediment Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  11. Pulmonary contusion and hemothorax due to explosion

    National Research Council Canada - National Science Library

    Baeza-Herrera, Carlos; Sanjuán-Fabián, Héctor; Medellín-Sierra, Ulises Darío; Nájera-Garduño, Heladio; García-Cabello, Luis Manuel

    2006-01-01

    .... Such is the case of gunpowder explosive objects used during celebration holidays. We present a 14-year-old male who suffered a pulmonary contusion as a consequence of an explosion of "huevo de codorniz...

  12. AcEST: BP916227 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_G08 97 Adiantum capillus-veneris mRNA. clone: YMU001_000084_G08. BP916227 - Show BP91... mRNA. clone: YMU001_000084_G08. Accession BP916227 Tissue type prothallium Developmental stage - Contig ID

  13. AcEST: BP920020 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_B05 91 Adiantum capillus-veneris mRNA. clone: YMU001_000132_B05. BP920020 - Show BP920020... mRNA. clone: YMU001_000132_B05. Accession BP920020 Tissue type prothallium Developmental stage - Contig ID

  14. AcEST: BP911846 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_H02 62 Adiantum capillus-veneris mRNA. clone: YMU001_000009_H02. BP911846 - Show BP91184... mRNA. clone: YMU001_000009_H02. Accession BP911846 Tissue type prothallium Developmental stage - Contig ID

  15. AcEST: BP918019 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F08 47 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F08. BP918019 - Show BP91801... mRNA. clone: YMU001_000108_F08. Accession BP918019 Tissue type prothallium Developmental stage - Contig ID

  16. AcEST: BP919947 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A11 35 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A11. BP919947 - Show BP91994... mRNA. clone: YMU001_000131_A11. Accession BP919947 Tissue type prothallium Developmental stage - Contig ID

  17. Experimental Investigations of Multiphase Explosions

    Science.gov (United States)

    Carney, Joel R.; Lightstone, James M.; McGrath, Thomas P.

    2009-12-01

    The addition of solid fuel particles to explosive formulations generally reduces the detonation velocity, but can enhance the blast performance if prompt combustion of the particles occurs in the detonation products and surrounding air early enough to support the shock. The degree to which fuel particles burn heavily depends on their dispersal throughout the explosion field and access to oxidizers. To distinguish the factors affecting the dispersal of fuel particles from those controlling their combustion, we began by analyzing the dispersal of equivalent mock inert particles. Solid glass spheres embedded in detonating small explosive charges were tracked using high-speed digital shadowgraphy. Two different particle sizes, 3 and 30 μm, and different mass fractions in the explosive compositions were considered. Shadowgraphs and pressure measurements were compared to the predictions of a newly developed multiphase numerical model. Reactive aluminum particles in the range of 1 to 120 μm in diameter were also analyzed. During the first 50 μs of the expansion, the general trend for both reactive and inert particles is for the smaller particles to expand near or beyond the leading shock wave to a greater extent than the larger particles. Expansion beyond the initial shock from the detonation is presumed to occur when particles agglomerate. The results are consistent with the predictions of the numerical models, highlighting the role of simple factors such as particle size and density in the early time expansion and mixing of fuels for enhanced blast applications.

  18. Explosive micro-bubble actuator

    NARCIS (Netherlands)

    van den Broek, D.M.; Elwenspoek, Michael Curt

    2007-01-01

    Explosive evaporation occurs when a thin layer of liquid reaches a very high temperature in a very short time. At these temperatures homogeneous nucleation takes place. The nucleated bubbles almost instantly coalesce forming a vapour film followed by rapid growth due to the pressure impulse and

  19. Risperidone and Explosive Aggressive Autism.

    Science.gov (United States)

    Horrigan, Joseph P.; Barnhill, L. Jarrett

    1997-01-01

    In this study, 11 males with autism and mental retardation were administered risperidone. Substantial clinical improvement was noted almost immediately; patients with aggression, self-injury, explosivity, and poor sleep hygiene were most improved. The modal dose for optimal response was 0.5 mg bid. Weight gain was a significant side effect.…

  20. Lead-free primary explosives

    Science.gov (United States)

    Huynh, My Hang V.

    2010-06-22

    Lead-free primary explosives of the formula (cat).sub.Y[M.sup.II(T).sub.X(H.sub.2O).sub.6-X].sub.Z, where T is 5-nitrotetrazolate, and syntheses thereof are described. Substantially stoichiometric equivalents of the reactants lead to high yields of pure compositions thereby avoiding dangerous purification steps.

  1. The Core-Collapse Supernova Explosion Mechanism

    Science.gov (United States)

    Müller, Bernhard

    2017-11-01

    The explosion mechanism of core-collapse supernovae is a long-standing problem in stellar astrophysics. We briefly outline the main contenders for a solution and review recent efforts to model core-collapse supernova explosions by means of multi-dimensional simulations. Focusing on the neutrino-driven mechanism, we summarize currents efforts to predict supernova explosion and remnant properties.

  2. 30 CFR 7.100 - Explosion tests.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Explosion tests. 7.100 Section 7.100 Mineral... Underground Coal Mines Where Permissible Electric Equipment is Required § 7.100 Explosion tests. (a) Test... agree. (ii) Remove all parts that do not contribute to the operation or ensure the explosion-proof...

  3. Explosion Power and Pressure Desensitization Resisting Property of Emulsion Explosives Sensitized by MgH2

    Science.gov (United States)

    Cheng, Yangfan; Ma, Honghao; Liu, Rong; Shen, Zhaowu

    2014-07-01

    Due to low detonation power and pressure desensitization problems that traditional emulsion explosives encounter in utilization, a hydrogen-based emulsion explosives was devised. This type of emulsion explosives is sensitized by hydrogen-containing material MgH2, and MgH2 plays a double role as a sensitizer and an energetic material in emulsion explosives. Underwater explosion experiments and shock wave desensitization experiments show that an MgH2 emulsion explosives has excellent detonation characteristics and is resistant to pressure desensitization. The pressure desensitization-resistant mechanism of MgH2 emulsion explosives was investigated using scanning electron microscopy.

  4. 53BP1 mediates the fusion of mammalian telomeres rendered dysfunctional by DNA-PKcs loss or inhibition.

    Directory of Open Access Journals (Sweden)

    Ivana Rybanska-Spaeder

    Full Text Available Telomere dysfunction promotes genomic instability and carcinogenesis via inappropriate end-to-end chromosomal rearrangements, or telomere fusions. Previous work indicates that the DNA Damage Response (DDR factor 53BP1 promotes the fusion of telomeres rendered dysfunctional by loss of TRF2, but is dispensable for the fusion of telomeres lacking Pot1 or critically shortened (in telomerase-deficient mice. Here, we examine a role for 53BP1 at telomeres rendered dysfunctional by loss or catalytic inhibition of DNA-PKcs. Using mouse embryonic fibroblasts lacking 53BP1 and/or DNA-PKcs, we show that 53BP1 deficiency suppresses G1-generated telomere fusions that normally accumulate in DNA-PKcs-deficient fibroblasts with passage. Likewise, we find that 53BP1 promotes telomere fusions during the replicative phases of the cell cycle in cells treated with the specific DNA-PKcs inhibitor NU7026. However, telomere fusions are not fully abrogated in DNA-PKcs-inhibited 53BP1-deficient cells, but occur with a frequency approximately 10-fold lower than in control 53BP1-proficient cells. Treatment with PARP inhibitors or PARP1 depletion abrogates residual fusions, while Ligase IV depletion has no measurable effect, suggesting that PARP1-dependent alternative end-joining operates at low efficiency at 53BP1-deficient, DNA-PKcs-inhibited telomeres. Finally, we have also examined the requirement for DDR factors ATM, MDC1 or H2AX in this context. We find that ATM loss or inhibition has no measurable effect on the frequency of NU7026-induced fusions in wild-type MEFs. Moreover, analysis of MEFs lacking both ATM and 53BP1 indicates that ATM is also dispensable for telomere fusions via PARP-dependent end-joining. In contrast, loss of either MDC1 or H2AX abrogates telomere fusions in response to DNA-PKcs inhibition, suggesting that these factors operate upstream of both 53BP1-dependent and -independent telomere rejoining. Together, these experiments define a novel

  5. AcEST: BP917117 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000096_B11 125 Adiantum capillus-veneris mRNA. clone: YMU001_000096_B11. BP917117... CL2704Contig1 Show BP917117 Clone id YMU001_000096_B11 Library YMU01 Length 125 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000096_B11. Accession BP917117 Tissue type prothallium Developmental stag...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917117...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917117

  6. AcEST: BP917177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_C05 471 Adiantum capillus-veneris mRNA. clone: YMU001_000097_C05. BP917177 - Show BP91717...is mRNA. clone: YMU001_000097_C05. Accession BP917177 Tissue type prothallium Developmental stage - Contig I...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917177|Adiantum capillus-veneris mRNA, clone: YMU...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917

  7. AcEST: BP919878 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C01 531 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C01. BP919878 - Show BP91987...is mRNA. clone: YMU001_000130_C01. Accession BP919878 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP919878|Adiantum capillus-veneris mRNA, clone: YMU001_000130_C01. (505 lette...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919878|Adiantum

  8. AcEST: BP919872 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_B06 364 Adiantum capillus-veneris mRNA. clone: YMU001_000130_B06. BP919872 - Show BP91987...is mRNA. clone: YMU001_000130_B06. Accession BP919872 Tissue type prothallium Developmental stage - Contig I... 25:3389-3402. Query= BP919872|Adiantum capillus-veneris mRNA, clone: YMU001_000130_B06. (364 letters) Datab...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919872|Adiantum capillus-veneris mRNA,

  9. AcEST: BP919870 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_B04 458 Adiantum capillus-veneris mRNA. clone: YMU001_000130_B04. BP91987...0 CL4204Contig1 Show BP919870 Clone id YMU001_000130_B04 Library YMU01 Length 458 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000130_B04. Accession BP919870 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91987...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91987

  10. AcEST: BP919871 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_B05 455 Adiantum capillus-veneris mRNA. clone: YMU001_000130_B05. BP91987...1 CL1328Contig1 Show BP919871 Clone id YMU001_000130_B05 Library YMU01 Length 455 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000130_B05. Accession BP919871 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919871|A...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919871|Adiantum capillus-v

  11. AcEST: BP919875 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_B10 534 Adiantum capillus-veneris mRNA. clone: YMU001_000130_B10. BP919875 - Show BP91987...is mRNA. clone: YMU001_000130_B10. Accession BP919875 Tissue type prothallium Developmental stage - Contig I...eic Acids Res. 25:3389-3402. Query= BP919875|Adiantum capillus-veneris mRNA, clone: YMU001_000130_B10. (534 ...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919875|Adiantum

  12. AcEST: BP919877 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_B12 476 Adiantum capillus-veneris mRNA. clone: YMU001_000130_B12. BP91987...7 CL1479Contig1 Show BP919877 Clone id YMU001_000130_B12 Library YMU01 Length 476 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000130_B12. Accession BP919877 Tissue type prothallium Developmental stag...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91987...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91987

  13. AcEST: BP919876 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_B11 550 Adiantum capillus-veneris mRNA. clone: YMU001_000130_B11. BP919876 - Show BP91987...is mRNA. clone: YMU001_000130_B11. Accession BP919876 Tissue type prothallium Developmental stage - Contig I...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919876|Adiantum capillus-veneris mRNA, clone:...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91987

  14. AcEST: BP919874 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_B09 480 Adiantum capillus-veneris mRNA. clone: YMU001_000130_B09. BP919874 - Show BP91987...is mRNA. clone: YMU001_000130_B09. Accession BP919874 Tissue type prothallium Developmental stage - Contig I... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919874|Adian...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919874|Adiantum capillus-veneris mRNA, clone:

  15. AcEST: BP919879 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C02. BP919879 - Show BP91987...is mRNA. clone: YMU001_000130_C02. Accession BP919879 Tissue type prothallium Developmental stage - Contig I...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91987...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919879|Adiantum capi

  16. AcEST: BP912760 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_E11 589 Adiantum capillus-veneris mRNA. clone: YMU001_000022_E11. BP912760 - Show BP912760...is mRNA. clone: YMU001_000022_E11. Accession BP912760 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912760|Adiantum capillus-veneris...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91276

  17. AcEST: BP919294 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000123_D08 374 Adiantum capillus-veneris mRNA. clone: YMU001_000123_D08. BP919294 - Show BP91929...is mRNA. clone: YMU001_000123_D08. Accession BP919294 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP919294|Adiantum capillus-veneris mRNA, clone: YMU001_000...Res. 25:3389-3402. Query= BP919294|Adiantum capillus-veneris mRNA, clone: YMU001_000123_D08. (374 letters) D

  18. AcEST: BP919290 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000123_D04 586 Adiantum capillus-veneris mRNA. clone: YMU001_000123_D04. BP91929...0 CL1106Contig1 Show BP919290 Clone id YMU001_000123_D04 Library YMU01 Length 586 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000123_D04. Accession BP919290 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919290|Adiantum capillus-vene...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91929

  19. AcEST: BP911929 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000010_H05 433 Adiantum capillus-veneris mRNA. clone: YMU001_000010_H05. BP911929 - Show BP911929...is mRNA. clone: YMU001_000010_H05. Accession BP911929 Tissue type prothallium Developmental stage - Contig I...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911929... programs, Nucleic Acids Res. 25:3389-3402. Query= BP911929|Adiantum capillus-ven

  20. AcEST: BP919299 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000123_E01 548 Adiantum capillus-veneris mRNA. clone: YMU001_000123_E01. BP919299 - Show BP91929...is mRNA. clone: YMU001_000123_E01. Accession BP919299 Tissue type prothallium Developmental stage - Contig I...s Res. 25:3389-3402. Query= BP919299|Adiantum capillus-veneris mRNA, clone: YMU00...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91929

  1. AcEST: BP919296 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000123_D10 448 Adiantum capillus-veneris mRNA. clone: YMU001_000123_D10. BP919296 - Show BP91929...is mRNA. clone: YMU001_000123_D10. Accession BP919296 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP919296|Adiantum capillus-veneris mRNA, clone: YMU001_000123_D10. (448 le...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91929

  2. AcEST: BP919293 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000123_D07 518 Adiantum capillus-veneris mRNA. clone: YMU001_000123_D07. BP919293 - Show BP91929...is mRNA. clone: YMU001_000123_D07. Accession BP919293 Tissue type prothallium Developmental stage - Contig I... 25:3389-3402. Query= BP919293|Adiantum capillus-veneris mRNA, clone: YMU001_000123_D07. (518 letters) Datab.... 25:3389-3402. Query= BP919293|Adiantum capillus-veneris mRNA, clone: YMU001_000

  3. AcEST: BP919291 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000123_D05 502 Adiantum capillus-veneris mRNA. clone: YMU001_000123_D05. BP919291 - Show BP91929...is mRNA. clone: YMU001_000123_D05. Accession BP919291 Tissue type prothallium Developmental stage - Contig I...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919291|A...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919291|Adiantum capillus-veneris mRNA, c

  4. AcEST: BP915155 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_B08 468 Adiantum capillus-veneris mRNA. clone: YMU001_000067_B08. BP91515...5 CL2592Contig1 Show BP915155 Clone id YMU001_000067_B08 Library YMU01 Length 468 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000067_B08. Accession BP915155 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915155|Adiantum capillus-ven...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915

  5. AcEST: BP915815 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000077_C11 552 Adiantum capillus-veneris mRNA. clone: YMU001_000077_C11. BP915815... CL3742Contig1 Show BP915815 Clone id YMU001_000077_C11 Library YMU01 Length 552 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000077_C11. Accession BP915815 Tissue type prothallium Developmental stag...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP915815|Adiantum capillus-veneris mRNA, clone: YMU001... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915815|Adiant

  6. AcEST: BP915615 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000073_F08 475 Adiantum capillus-veneris mRNA. clone: YMU001_000073_F08. BP915615... CL3512Contig1 Show BP915615 Clone id YMU001_000073_F08 Library YMU01 Length 475 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000073_F08. Accession BP915615 Tissue type prothallium Developmental stag...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915615|Adiantum capill...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915615|Adiantum capillus-veneris mRNA, clon

  7. AcEST: BP913607 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000032_B07 628 Adiantum capillus-veneris mRNA. clone: YMU001_000032_B07. BP913607 - Show BP91360...is mRNA. clone: YMU001_000032_B07. Accession BP913607 Tissue type prothallium Developmental stage - Contig I...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91360...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91360

  8. AcEST: BP918360 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_F01 506 Adiantum capillus-veneris mRNA. clone: YMU001_000112_F01. BP918360... CL1181Contig1 Show BP918360 Clone id YMU001_000112_F01 Library YMU01 Length 506 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000112_F01. Accession BP918360 Tissue type prothallium Developmental stag...s. 25:3389-3402. Query= BP918360|Adiantum capillus-veneris mRNA, clone: YMU001_000112_F01. (506 letters) Dat...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918360

  9. AcEST: BP913606 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000032_B05 546 Adiantum capillus-veneris mRNA. clone: YMU001_000032_B05. BP913606 - Show BP91360...is mRNA. clone: YMU001_000032_B05. Accession BP913606 Tissue type prothallium Developmental stage - Contig I...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913606|Adiantum capillus-veneris mRNA, clo...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913606|Adiantum capillus-ve

  10. AcEST: BP919360 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_B12 514 Adiantum capillus-veneris mRNA. clone: YMU001_000124_B12. BP919360 - Show BP919360...is mRNA. clone: YMU001_000124_B12. Accession BP919360 Tissue type prothallium Developmental stage - Contig I...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919360|Adiantum...HG +D+ Sbjct: 301 ADIKIKSEPQTAPQPQQSPHGSSHSSRSGSGSGSHSSMASDGSLRRKSSDSLDSHGAQDD 360 Query: 310 LQNLDRLDANPYRS... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919360|Adiantum capillus-veneris mRNA,

  11. AcEST: BP913605 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000032_B03 520 Adiantum capillus-veneris mRNA. clone: YMU001_000032_B03. BP913605 - Show BP91360...is mRNA. clone: YMU001_000032_B03. Accession BP913605 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91360...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91360

  12. AcEST: BP913604 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000032_B02 433 Adiantum capillus-veneris mRNA. clone: YMU001_000032_B02. BP913604 - Show BP91360...is mRNA. clone: YMU001_000032_B02. Accession BP913604 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP913604|Adiantum capillus-veneris mRNA, clone: YMU001_000...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91360

  13. AcEST: BP914360 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_A08 544 Adiantum capillus-veneris mRNA. clone: YMU001_000058_A08. BP914360... CL3111Contig1 Show BP914360 Clone id YMU001_000058_A08 Library YMU01 Length 544 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000058_A08. Accession BP914360 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914360|Adiantum capillus-vener...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914360

  14. AcEST: BP913603 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000032_B01 528 Adiantum capillus-veneris mRNA. clone: YMU001_000032_B01. BP913603 - Show BP91360...is mRNA. clone: YMU001_000032_B01. Accession BP913603 Tissue type prothallium Developmental stage - Contig I... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913603|Adiantum capillus-veneris mRNA, clone: YM...ds Res. 25:3389-3402. Query= BP913603|Adiantum capillus-veneris mRNA, clone: YMU0

  15. AcEST: BP913608 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000032_B08 199 Adiantum capillus-veneris mRNA. clone: YMU001_000032_B08. BP91360...8 CL2399Contig1 Show BP913608 Clone id YMU001_000032_B08 Library YMU01 Length 199 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000032_B08. Accession BP913608 Tissue type prothallium Developmental stag...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913608|Adiantu... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913608|Adiantum capillus-veneris mRNA, clone: YM

  16. AcEST: BP920360 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000136_B12 571 Adiantum capillus-veneris mRNA. clone: YMU001_000136_B12. BP920360... CL4062Contig1 Show BP920360 Clone id YMU001_000136_B12 Library YMU01 Length 571 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000136_B12. Accession BP920360 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920360...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920360|Adiantum capillus-veneris mRNA, clone: YMU00

  17. AcEST: BP915360 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000070_F03 255 Adiantum capillus-veneris mRNA. clone: YMU001_000070_F03. BP915360 - Show BP915360...is mRNA. clone: YMU001_000070_F03. Accession BP915360 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP915360|Adiantum capillus-veneris mRNA, clone: YMU001...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915360

  18. AcEST: BP913360 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_D06 508 Adiantum capillus-veneris mRNA. clone: YMU001_000029_D06. BP913360 - Show BP913360...is mRNA. clone: YMU001_000029_D06. Accession BP913360 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913360|Adiantum capillus-v...grams, Nucleic Acids Res. 25:3389-3402. Query= BP913360|Adiantum capillus-veneris mRNA, clone: YMU001_000029

  19. AcEST: BP917360 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000099_H03 153 Adiantum capillus-veneris mRNA. clone: YMU001_000099_H03. BP917360 - Show BP917360...is mRNA. clone: YMU001_000099_H03. Accession BP917360 Tissue type prothallium Developmental stage - Contig I...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP917360|Adiantum capillus-veneris mRNA, clone: YMU001_00009... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917360|Adiantum c

  20. AcEST: BP913600 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000032_A10 231 Adiantum capillus-veneris mRNA. clone: YMU001_000032_A10. BP913600 - Show BP91360...is mRNA. clone: YMU001_000032_A10. Accession BP913600 Tissue type prothallium Developmental stage - Contig I... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91360...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913600

  1. AcEST: BP916360 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000086_G10 437 Adiantum capillus-veneris mRNA. clone: YMU001_000086_G10. BP916360... CL1975Contig1 Show BP916360 Clone id YMU001_000086_G10 Library YMU01 Length 437 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000086_G10. Accession BP916360 Tissue type prothallium Developmental stag...cleic Acids Res. 25:3389-3402. Query= BP916360|Adiantum capillus-veneris mRNA, cl...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP916360|Adiantum capillus-veneris mRNA, clone: YMU001

  2. AcEST: BP913848 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000037_A10 537 Adiantum capillus-veneris mRNA. clone: YMU001_000037_A10. BP91...3848 CL119Contig2 Show BP913848 Clone id YMU001_000037_A10 Library YMU01 Length 537 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000037_A10. Accession BP913848 Tissue type prothallium Developmental stage...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913848|Adiantum capillus-veneris mRNA, clone: YMU00... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9138

  3. AcEST: BP914836 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000063_D09 466 Adiantum capillus-veneris mRNA. clone: YMU001_000063_D09. BP914836 - Show BP91...is mRNA. clone: YMU001_000063_D09. Accession BP914836 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914836|Adiantum capi...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914836|Adiantum capillus-veneris mR

  4. AcEST: BP917633 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000103_D11 126 Adiantum capillus-veneris mRNA. clone: YMU001_000103_D11. BP917633 - Show BP91...is mRNA. clone: YMU001_000103_D11. Accession BP917633 Tissue type prothallium Developmental stage - Contig I...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917633|Adiantum capillus-veneris

  5. AcEST: BP914018 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_H10 551 Adiantum capillus-veneris mRNA. clone: YMU001_000038_H10. BP91...4018 CL2047Contig1 Show BP914018 Clone id YMU001_000038_H10 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000038_H10. Accession BP914018 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914018|Adiantum capillus-veneris mRNA...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914018|Adiantum capill

  6. AcEST: BP918209 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_G08 518 Adiantum capillus-veneris mRNA. clone: YMU001_000110_G08. BP918209 - Show BP91...is mRNA. clone: YMU001_000110_G08. Accession BP918209 Tissue type prothallium Developmental stage - Contig I...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918209|Adiantum capillus-veneris mRNA, clone

  7. AcEST: BP918186 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E07 514 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E07. BP918186 - Show BP91...is mRNA. clone: YMU001_000110_E07. Accession BP918186 Tissue type prothallium Developmental stage - Contig I... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918186|A

  8. AcEST: BP911679 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000007_H05 467 Adiantum capillus-veneris mRNA. clone: YMU001_000007_H05. BP911679 - Show BP91...is mRNA. clone: YMU001_000007_H05. Accession BP911679 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP911679|Adiantum capillus-veneris mRNA, cl...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911

  9. AcEST: BP916203 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_E04 493 Adiantum capillus-veneris mRNA. clone: YMU001_000084_E04. BP916203 - Show BP91...is mRNA. clone: YMU001_000084_E04. Accession BP916203 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP916203|Adiantum capillus-veneris mRNA, clone: YMU001_000084_E04. (493 lette...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916203|Adiantum capillus-veneris mRNA, clone: YMU

  10. AcEST: BP913152 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_A11 442 Adiantum capillus-veneris mRNA. clone: YMU001_000027_A11. BP91...3152 CL3267Contig1 Show BP913152 Clone id YMU001_000027_A11 Library YMU01 Length 442 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000027_A11. Accession BP913152 Tissue type prothallium Developmental stag...Nucleic Acids Res. 25:3389-3402. Query= BP913152|Adiantum capillus-veneris mRNA, ...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913152|Adiantum ca

  11. AcEST: BP917884 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000106_G10 288 Adiantum capillus-veneris mRNA. clone: YMU001_000106_G10. BP917884 - Show BP91...is mRNA. clone: YMU001_000106_G10. Accession BP917884 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917884|Adiantum capillus-veneris mRNA, clone: Y...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP917884|Adiantum capillus-veneris mRNA, clone: YMU001_0

  12. AcEST: BP913824 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000035_G03 382 Adiantum capillus-veneris mRNA. clone: YMU001_000035_G03. BP913824 - Show BP91...is mRNA. clone: YMU001_000035_G03. Accession BP913824 Tissue type prothallium Developmental stage - Contig I... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913824|Adiantum capillus-ven...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913824|Adiantum capil

  13. AcEST: BP914395 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_D09 492 Adiantum capillus-veneris mRNA. clone: YMU001_000058_D09. BP914395 - Show BP91...is mRNA. clone: YMU001_000058_D09. Accession BP914395 Tissue type prothallium Developmental stage - Contig I...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914395|Adiantum ...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91

  14. AcEST: BP912582 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_E12 502 Adiantum capillus-veneris mRNA. clone: YMU001_000020_E12. BP91...2582 CL3877Contig1 Show BP912582 Clone id YMU001_000020_E12 Library YMU01 Length 502 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000020_E12. Accession BP912582 Tissue type prothallium Developmental stag...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...grams, Nucleic Acids Res. 25:3389-3402. Query= BP912582|Adiantum capillus-veneris

  15. AcEST: BP916834 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000092_C07 418 Adiantum capillus-veneris mRNA. clone: YMU001_000092_C07. BP916834 - Show BP91...is mRNA. clone: YMU001_000092_C07. Accession BP916834 Tissue type prothallium Developmental stage - Contig I...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91

  16. AcEST: BP919190 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_C07 508 Adiantum capillus-veneris mRNA. clone: YMU001_000122_C07. BP91...llus-veneris mRNA. clone: YMU001_000122_C07. Accession BP919190 Tissue type prothallium Developmental stage ...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...ams, Nucleic Acids Res. 25:3389-3402. Query= BP919190|Adiantum capillus-veneris m...9190 CL10Contig1 Show BP919190 Clone id YMU001_000122_C07 Library YMU01 Length 508 Definition Adiantum capi

  17. AcEST: BP912371 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_C10 541 Adiantum capillus-veneris mRNA. clone: YMU001_000018_C10. BP912371 - Show BP91...is mRNA. clone: YMU001_000018_C10. Accession BP912371 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP912371|Adiantum capillus-veneris mRNA, clone: YMU001_000018_C10. (541 lett...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912371|Adiantum capi

  18. AcEST: BP919170 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_A09 536 Adiantum capillus-veneris mRNA. clone: YMU001_000122_A09. BP91...9170 CL1421Contig1 Show BP919170 Clone id YMU001_000122_A09 Library YMU01 Length 536 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000122_A09. Accession BP919170 Tissue type prothallium Developmental stag...ucleic Acids Res. 25:3389-3402. Query= BP919170|Adiantum capillus-veneris mRNA, c... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919170|Adiant

  19. AcEST: BP917190 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_D09 473 Adiantum capillus-veneris mRNA. clone: YMU001_000097_D09. BP917190 - Show BP91...is mRNA. clone: YMU001_000097_D09. Accession BP917190 Tissue type prothallium Developmental stage - Contig I...eic Acids Res. 25:3389-3402. Query= BP917190|Adiantum capillus-veneris mRNA, clon...leic Acids Res. 25:3389-3402. Query= BP917190|Adiantum capillus-veneris mRNA, clo

  20. AcEST: BP918649 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000115_H08 525 Adiantum capillus-veneris mRNA. clone: YMU001_000115_H08. BP918649 - Show BP91...is mRNA. clone: YMU001_000115_H08. Accession BP918649 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918649|Adiantum capillus-veneris mRNA,

  1. AcEST: BP918180 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E01 492 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E01. BP91...8180 CL642Contig1 Show BP918180 Clone id YMU001_000110_E01 Library YMU01 Length 492 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000110_E01. Accession BP918180 Tissue type prothallium Developmental stage... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918180|Adiantum capil... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91

  2. AcEST: BP915008 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_D10 581 Adiantum capillus-veneris mRNA. clone: YMU001_000065_D10. BP915008 - Show BP91...is mRNA. clone: YMU001_000065_D10. Accession BP915008 Tissue type prothallium Developmental stage - Contig I...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP915008|Adiantum capillus-veneris mRNA, clone: YMU001_0000...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915008|Adiant

  3. AcEST: BP916391 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_B10 517 Adiantum capillus-veneris mRNA. clone: YMU001_000087_B10. BP91...6391 CL3244Contig1 Show BP916391 Clone id YMU001_000087_B10 Library YMU01 Length 517 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_B10. Accession BP916391 Tissue type prothallium Developmental stag...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP916391|Adiantum capillus-veneris mRNA, clone: YMU001_... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916391|Adiantum c

  4. AcEST: BP918225 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_A03 454 Adiantum capillus-veneris mRNA. clone: YMU001_000111_A03. BP91...8225 CL1144Contig1 Show BP918225 Clone id YMU001_000111_A03 Library YMU01 Length 454 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000111_A03. Accession BP918225 Tissue type prothallium Developmental stag...cleic Acids Res. 25:3389-3402. Query= BP918225|Adiantum capillus-veneris mRNA, cl...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918225|Adiantum capillus-veneris mRNA, clo

  5. AcEST: BP914418 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_F10 558 Adiantum capillus-veneris mRNA. clone: YMU001_000058_F10. BP914418 - Show BP91...is mRNA. clone: YMU001_000058_F10. Accession BP914418 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914418|Adiantum capillus-veneris m...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914418|Adiantum capillus-veneris mRNA, clone:

  6. AcEST: BP917820 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_H03 480 Adiantum capillus-veneris mRNA. clone: YMU001_000105_H03. BP91...7820 CL2138Contig1 Show BP917820 Clone id YMU001_000105_H03 Library YMU01 Length 480 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_H03. Accession BP917820 Tissue type prothallium Developmental stag...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917820...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91782

  7. AcEST: BP919866 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_A12 529 Adiantum capillus-veneris mRNA. clone: YMU001_000130_A12. BP91...9866 CL2968Contig1 Show BP919866 Clone id YMU001_000130_A12 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000130_A12. Accession BP919866 Tissue type prothallium Developmental stag...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919866|Adiantum capillus-veneris mRNA, clone: YMU001_...rams, Nucleic Acids Res. 25:3389-3402. Query= BP919866|Adiantum capillus-veneris

  8. AcEST: BP917824 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_H08 518 Adiantum capillus-veneris mRNA. clone: YMU001_000105_H08. BP917824 - Show BP91...is mRNA. clone: YMU001_000105_H08. Accession BP917824 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9178

  9. AcEST: BP912667 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000021_E06 654 Adiantum capillus-veneris mRNA. clone: YMU001_000021_E06. BP912667 - Show BP91...is mRNA. clone: YMU001_000021_E06. Accession BP912667 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP912667|Adiantum capillus-veneris mRNA, clone: YMU001_000021_E06. (654 letters) Dat...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912667|Adi

  10. AcEST: BP916878 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000093_B03 521 Adiantum capillus-veneris mRNA. clone: YMU001_000093_B03. BP916878 - Show BP91...is mRNA. clone: YMU001_000093_B03. Accession BP916878 Tissue type prothallium Developmental stage - Contig I... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916878|A

  11. AcEST: BP918623 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000115_F04 410 Adiantum capillus-veneris mRNA. clone: YMU001_000115_F04. BP918623 - Show BP91...is mRNA. clone: YMU001_000115_F04. Accession BP918623 Tissue type prothallium Developmental stage - Contig I... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918623|Adiantum capillus-veneris mRNA, clone: YM

  12. AcEST: BP919444 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000125_B09 425 Adiantum capillus-veneris mRNA. clone: YMU001_000125_B09. BP91...9444 CL1131Contig1 Show BP919444 Clone id YMU001_000125_B09 Library YMU01 Length 425 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000125_B09. Accession BP919444 Tissue type prothallium Developmental stag...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919444...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP919444|Adiantum capillus-vener

  13. AcEST: BP918160 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_C05 370 Adiantum capillus-veneris mRNA. clone: YMU001_000110_C05. BP91...8160 CL598Contig1 Show BP918160 Clone id YMU001_000110_C05 Library YMU01 Length 370 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000110_C05. Accession BP918160 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918160|Adiantum capillus-ve... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918160|Adiantum c

  14. AcEST: BP914580 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000060_F02 476 Adiantum capillus-veneris mRNA. clone: YMU001_000060_F02. BP91...4580 CL2282Contig1 Show BP914580 Clone id YMU001_000060_F02 Library YMU01 Length 476 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000060_F02. Accession BP914580 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914580|Adian...ids Res. 25:3389-3402. Query= BP914580|Adiantum capillus-veneris mRNA, clone: YMU001_000060_F02. (457 letter

  15. AcEST: BP917631 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000103_D09 348 Adiantum capillus-veneris mRNA. clone: YMU001_000103_D09. BP917631 - Show BP91...is mRNA. clone: YMU001_000103_D09. Accession BP917631 Tissue type prothallium Developmental stage - Contig I...997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...eic Acids Res. 25:3389-3402. Query= BP917631|Adiantum capillus-veneris mRNA, clone: YMU001_000103_D09. (348

  16. AcEST: BP919820 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_E07 516 Adiantum capillus-veneris mRNA. clone: YMU001_000129_E07. BP919820 - Show BP91...is mRNA. clone: YMU001_000129_E07. Accession BP919820 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919820|A

  17. AcEST: BP912140 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_E11 481 Adiantum capillus-veneris mRNA. clone: YMU001_000015_E11. BP912140 - Show BP91...is mRNA. clone: YMU001_000015_E11. Accession BP912140 Tissue type prothallium Developmental stage - Contig I...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9121

  18. AcEST: BP913383 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_F06 535 Adiantum capillus-veneris mRNA. clone: YMU001_000029_F06. BP913383 - Show BP91...is mRNA. clone: YMU001_000029_F06. Accession BP913383 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP913383|Adiantum capillus-veneris mRNA, clone: YMU001_000029_F06. (535 let...Res. 25:3389-3402. Query= BP913383|Adiantum capillus-veneris mRNA, clone: YMU001_

  19. AcEST: BP914140 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_D03 527 Adiantum capillus-veneris mRNA. clone: YMU001_000042_D03. BP914140 - Show BP91...is mRNA. clone: YMU001_000042_D03. Accession BP914140 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914140|Adiantum capillus-

  20. AcEST: BP919383 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E04 492 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E04. BP91...9383 CL225Contig1 Show BP919383 Clone id YMU001_000124_E04 Library YMU01 Length 492 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000124_E04. Accession BP919383 Tissue type prothallium Developmental stage... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91

  1. AcEST: BP919468 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000125_D10 525 Adiantum capillus-veneris mRNA. clone: YMU001_000125_D10. BP919468 - Show BP91...is mRNA. clone: YMU001_000125_D10. Accession BP919468 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919468|Adiantum capillus-veneris

  2. AcEST: BP919679 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_H04 521 Adiantum capillus-veneris mRNA. clone: YMU001_000127_H04. BP919679 - Show BP91...is mRNA. clone: YMU001_000127_H04. Accession BP919679 Tissue type prothallium Developmental stage - Contig I...s, Nucleic Acids Res. 25:3389-3402. Query= BP919679|Adiantum capillus-veneris mRNA, clone: YMU001_000127_H04... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919679|Adiantum c

  3. AcEST: BP913446 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000030_D01 119 Adiantum capillus-veneris mRNA. clone: YMU001_000030_D01. BP913446 - Show BP91...is mRNA. clone: YMU001_000030_D01. Accession BP913446 Tissue type prothallium Developmental stage - Contig I...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91

  4. AcEST: BP918227 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_A05 484 Adiantum capillus-veneris mRNA. clone: YMU001_000111_A05. BP918227 - Show BP91...is mRNA. clone: YMU001_000111_A05. Accession BP918227 Tissue type prothallium Developmental stage - Contig I...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918227|Adiantum capillus-veneris m

  5. AcEST: BP914810 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000063_B04 529 Adiantum capillus-veneris mRNA. clone: YMU001_000063_B04. BP914810 - Show BP91...is mRNA. clone: YMU001_000063_B04. Accession BP914810 Tissue type prothallium Developmental stage - Contig I...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914810|Adiantum capillus-vene

  6. AcEST: BP916458 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_H07 567 Adiantum capillus-veneris mRNA. clone: YMU001_000087_H07. BP91...6458 CL1357Contig1 Show BP916458 Clone id YMU001_000087_H07 Library YMU01 Length 567 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_H07. Accession BP916458 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916458|Adiantum capillus-vener...ams, Nucleic Acids Res. 25:3389-3402. Query= BP916458|Adiantum capillus-veneris m

  7. AcEST: BP913846 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000037_A07 572 Adiantum capillus-veneris mRNA. clone: YMU001_000037_A07. BP91...3846 CL1384Contig1 Show BP913846 Clone id YMU001_000037_A07 Library YMU01 Length 572 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000037_A07. Accession BP913846 Tissue type prothallium Developmental stag...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913846|...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913846|Adiantum capillus-veneris mRN

  8. AcEST: BP914434 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_H02 510 Adiantum capillus-veneris mRNA. clone: YMU001_000058_H02. BP914434 - Show BP91...is mRNA. clone: YMU001_000058_H02. Accession BP914434 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914434|Adiantum c...eic Acids Res. 25:3389-3402. Query= BP914434|Adiantum capillus-veneris mRNA, clone: YMU001_000058_H02. (510

  9. AcEST: BP915468 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_H11 539 Adiantum capillus-veneris mRNA. clone: YMU001_000071_H11. BP915468 - Show BP91...is mRNA. clone: YMU001_000071_H11. Accession BP915468 Tissue type prothallium Developmental stage - Contig I...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP915468|Adiantum capillus-veneris mRNA, clone: YMU001_0...Nucleic Acids Res. 25:3389-3402. Query= BP915468|Adiantum capillus-veneris mRNA, clone: YMU001_000071_H11. (

  10. AcEST: BP912351 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_B01 572 Adiantum capillus-veneris mRNA. clone: YMU001_000018_B01. BP912351 - Show BP91...is mRNA. clone: YMU001_000018_B01. Accession BP912351 Tissue type prothallium Developmental stage - Contig I...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912351|Adiantum capillus-veneris mRNA, clon...Res. 25:3389-3402. Query= BP912351|Adiantum capillus-veneris mRNA, clone: YMU001_000018_B01. (572 letters) D

  11. AcEST: BP914391 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_D05 573 Adiantum capillus-veneris mRNA. clone: YMU001_000058_D05. BP914391 - Show BP91...is mRNA. clone: YMU001_000058_D05. Accession BP914391 Tissue type prothallium Developmental stage - Contig I... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914391|Adia...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914391|Adiantum capillus-veneris mRNA, clone:

  12. AcEST: BP912601 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_G08 479 Adiantum capillus-veneris mRNA. clone: YMU001_000020_G08. BP912601 - Show BP91...is mRNA. clone: YMU001_000020_G08. Accession BP912601 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP912601|Adiantum capillus-veneris m...ids Res. 25:3389-3402. Query= BP912601|Adiantum capillus-veneris mRNA, clone: YMU

  13. AcEST: BP917239 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000098_B01 229 Adiantum capillus-veneris mRNA. clone: YMU001_000098_B01. BP917239 - Show BP91...is mRNA. clone: YMU001_000098_B01. Accession BP917239 Tissue type prothallium Developmental stage - Contig I...s Res. 25:3389-3402. Query= BP917239|Adiantum capillus-veneris mRNA, clone: YMU001_000098_B01. (229 letters)...Acids Res. 25:3389-3402. Query= BP917239|Adiantum capillus-veneris mRNA, clone: YMU001_000098_B01. (229 lett

  14. AcEST: BP916371 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_A02 468 Adiantum capillus-veneris mRNA. clone: YMU001_000087_A02. BP91...6371 CL738Contig1 Show BP916371 Clone id YMU001_000087_A02 Library YMU01 Length 468 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000087_A02. Accession BP916371 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916371|Adiantum capillus-vener...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916371|Adiantum capillus-veneris mRNA, clone: YMU

  15. AcEST: BP919424 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000125_A01 525 Adiantum capillus-veneris mRNA. clone: YMU001_000125_A01. BP91...llus-veneris mRNA. clone: YMU001_000125_A01. Accession BP919424 Tissue type prothallium Developmental stage ...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP919424|Adiantum capillus-veneris mRNA, clone: YMU001_0001... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919424|Adiantum capillus-veneri...9424 CL92Contig1 Show BP919424 Clone id YMU001_000125_A01 Library YMU01 Length 525 Definition Adiantum capi

  16. AcEST: BP919699 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_B05 619 Adiantum capillus-veneris mRNA. clone: YMU001_000128_B05. BP919699 - Show BP91...is mRNA. clone: YMU001_000128_B05. Accession BP919699 Tissue type prothallium Developmental stage - Contig I...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919699

  17. AcEST: BP919217 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E10 547 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E10. BP91...9217 CL1907Contig1 Show BP919217 Clone id YMU001_000122_E10 Library YMU01 Length 547 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000122_E10. Accession BP919217 Tissue type prothallium Developmental stag... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919217|Adiantum capillus-ven...ds Res. 25:3389-3402. Query= BP919217|Adiantum capillus-veneris mRNA, clone: YMU001_000122_E10. (547 letters

  18. AcEST: BP915196 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_F07 504 Adiantum capillus-veneris mRNA. clone: YMU001_000067_F07. BP915196 - Show BP91...is mRNA. clone: YMU001_000067_F07. Accession BP915196 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP915196|Adiantum capillus-veneris mRNA, cl...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91

  19. AcEST: BP919428 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000125_A05 258 Adiantum capillus-veneris mRNA. clone: YMU001_000125_A05. BP919428 - Show BP91...is mRNA. clone: YMU001_000125_A05. Accession BP919428 Tissue type prothallium Developmental stage - Contig I...ds Res. 25:3389-3402. Query= BP919428|Adiantum capillus-veneris mRNA, clone: YMU001_000125_A05. (258 letters... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919428|Adiantum capillus-veneris mRNA,

  20. AcEST: BP915866 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000078_E10 396 Adiantum capillus-veneris mRNA. clone: YMU001_000078_E10. BP915866 - Show BP91...is mRNA. clone: YMU001_000078_E10. Accession BP915866 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915866|Adiantum capillus-veneris mRNA, clone...eic Acids Res. 25:3389-3402. Query= BP915866|Adiantum capillus-veneris mRNA, clone: YMU001_000078_E10. (396

  1. AcEST: BP915840 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000077_G04 452 Adiantum capillus-veneris mRNA. clone: YMU001_000077_G04. BP915840 - Show BP91...is mRNA. clone: YMU001_000077_G04. Accession BP915840 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP915840|Adiantum capillus-veneris mRNA, clone: YMU...1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91

  2. AcEST: BP919907 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_E10 478 Adiantum capillus-veneris mRNA. clone: YMU001_000130_E10. BP919907 - Show BP91...is mRNA. clone: YMU001_000130_E10. Accession BP919907 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP919907|Adiantum capillus-veneris m...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91

  3. AcEST: BP913868 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000037_C06 506 Adiantum capillus-veneris mRNA. clone: YMU001_000037_C06. BP913868 - Show BP91...is mRNA. clone: YMU001_000037_C06. Accession BP913868 Tissue type prothallium Developmental stage - Contig I...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...leic Acids Res. 25:3389-3402. Query= BP913868|Adiantum capillus-veneris mRNA, clone: YMU001_000037_C06. (506

  4. AcEST: BP912814 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000023_B10 584 Adiantum capillus-veneris mRNA. clone: YMU001_000023_B10. BP912814 - Show BP91...is mRNA. clone: YMU001_000023_B10. Accession BP912814 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912814|Adiantum cap...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912814|Adiantum capi

  5. AcEST: BP916018 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000082_A07 337 Adiantum capillus-veneris mRNA. clone: YMU001_000082_A07. BP916018 - Show BP91...is mRNA. clone: YMU001_000082_A07. Accession BP916018 Tissue type prothallium Developmental stage - Contig I...1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...s Res. 25:3389-3402. Query= BP916018|Adiantum capillus-veneris mRNA, clone: YMU00

  6. AcEST: BP917402 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_D05 495 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D05. BP91...7402 CL4144Contig1 Show BP917402 Clone id YMU001_000100_D05 Library YMU01 Length 495 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_D05. Accession BP917402 Tissue type prothallium Developmental stag... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917402|Adia

  7. AcEST: BP916186 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_C10 463 Adiantum capillus-veneris mRNA. clone: YMU001_000084_C10. BP91...llus-veneris mRNA. clone: YMU001_000084_C10. Accession BP916186 Tissue type prothallium Developmental stage ...programs, Nucleic Acids Res. 25:3389-3402. Query= BP916186|Adiantum capillus-vene...programs, Nucleic Acids Res. 25:3389-3402. Query= BP916186|Adiantum capillus-veneris mRNA, clone: YMU001_000...6186 CL10Contig1 Show BP916186 Clone id YMU001_000084_C10 Library YMU01 Length 463 Definition Adiantum capi

  8. AcEST: BP916854 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000092_F04 355 Adiantum capillus-veneris mRNA. clone: YMU001_000092_F04. BP91...6854 CL1927Contig1 Show BP916854 Clone id YMU001_000092_F04 Library YMU01 Length 355 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000092_F04. Accession BP916854 Tissue type prothallium Developmental stag...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916854|Adiantum... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91

  9. AcEST: BP913366 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_D12 523 Adiantum capillus-veneris mRNA. clone: YMU001_000029_D12. BP91336...6 CL3662Contig1 Show BP913366 Clone id YMU001_000029_D12 Library YMU01 Length 523 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000029_D12. Accession BP913366 Tissue type prothallium Developmental stag...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91336...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913366|Adiantum capillus-veneris

  10. AcEST: BP912336 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000017_H08 357 Adiantum capillus-veneris mRNA. clone: YMU001_000017_H08. BP912336 - Show BP912336...is mRNA. clone: YMU001_000017_H08. Accession BP912336 Tissue type prothallium Developmental stage - Contig I... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912336...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP912336|Adiantum capillus-veneris mRNA, clone: YMU001_0

  11. AcEST: BP917336 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000099_E08 168 Adiantum capillus-veneris mRNA. clone: YMU001_000099_E08. BP917336 - Show BP917336...is mRNA. clone: YMU001_000099_E08. Accession BP917336 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP917336|Adiantum capillus-veneris mRNA, clone: YMU001_000099_E08. (16...ms, Nucleic Acids Res. 25:3389-3402. Query= BP917336|Adiantum capillus-veneris mRNA, clone: YMU001_000099_E0

  12. AcEST: BP921336 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000148_F04 482 Adiantum capillus-veneris mRNA. clone: YMU001_000148_F04. BP921336... CL35Contig1 Show BP921336 Clone id YMU001_000148_F04 Library YMU01 Length 482 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000148_F04. Accession BP921336 Tissue type prothallium Developmental stage ... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921336|Adiantum c...rams, Nucleic Acids Res. 25:3389-3402. Query= BP921336|Adiantum capillus-veneris mRNA, clone: YMU001_000148_

  13. AcEST: BP913368 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_E02 560 Adiantum capillus-veneris mRNA. clone: YMU001_000029_E02. BP91336...8 CL2735Contig1 Show BP913368 Clone id YMU001_000029_E02 Library YMU01 Length 560 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000029_E02. Accession BP913368 Tissue type prothallium Developmental stag...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913368|Adiantum capillus-...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913368|Adiantum capillus-veneris mRNA, clone

  14. AcEST: BP913365 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_D11 571 Adiantum capillus-veneris mRNA. clone: YMU001_000029_D11. BP91336...5 CL3850Contig1 Show BP913365 Clone id YMU001_000029_D11 Library YMU01 Length 571 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000029_D11. Accession BP913365 Tissue type prothallium Developmental stag...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91336...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913365|Adiantum cap

  15. AcEST: BP916336 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000086_E08 286 Adiantum capillus-veneris mRNA. clone: YMU001_000086_E08. BP916336 - Show BP916336...is mRNA. clone: YMU001_000086_E08. Accession BP916336 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916336|Adiantum capillus-veneris mRNA, clone: Y...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916336|A

  16. AcEST: BP915336 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000070_C12 256 Adiantum capillus-veneris mRNA. clone: YMU001_000070_C12. BP915336... CL2234Contig1 Show BP915336 Clone id YMU001_000070_C12 Library YMU01 Length 256 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000070_C12. Accession BP915336 Tissue type prothallium Developmental stag...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915336|Adiantum capillus-veneris mRNA, clone: ...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915336|Adiantum capillus-vene

  17. AcEST: BP913361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_D07 385 Adiantum capillus-veneris mRNA. clone: YMU001_000029_D07. BP913361 - Show BP91336...is mRNA. clone: YMU001_000029_D07. Accession BP913361 Tissue type prothallium Developmental stage - Contig I...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913361|Adiantu...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913361|Adiantum capillus-veneris ...17 PE=4 SV=1 Length = 592 Score = 134 bits (336), Expect = 3e-30 Identities = 61/97 (62%), Positives = 75/97

  18. AcEST: BP911838 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G05 504 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G05. BP911838 - Show BP9...is mRNA. clone: YMU001_000009_G05. Accession BP911838 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911838|...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911838|Adiantum ca... (Hsp70/Hs... 65 2e-09 tr|P90647|P90647_ACACA Transformation-sensitive protein homolog ... 64 4e-09 tr|B0JN3

  19. AcEST: BP921694 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000153_A09 574 Adiantum capillus-veneris mRNA. clone: YMU001_000153_A09. BP9...21694 CL1093Contig1 Show BP921694 Clone id YMU001_000153_A09 Library YMU01 Length 574 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000153_A09. Accession BP921694 Tissue type prothallium Developmental stag...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921694|Adiantum capi... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921694|Adiantum c

  20. AcEST: BP918933 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000119_C01 478 Adiantum capillus-veneris mRNA. clone: YMU001_000119_C01. BP9...18933 CL1533Contig1 Show BP918933 Clone id YMU001_000119_C01 Library YMU01 Length 478 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000119_C01. Accession BP918933 Tissue type prothallium Developmental stag...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918933|Adiantum capillu

  1. AcEST: BP921220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B06 550 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B06. BP921220 - Show BP921220...is mRNA. clone: YMU001_000147_B06. Accession BP921220 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921220|Adiantum capillus-veneris mRNA, clone...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921220|Adiantum capillus-veneris mRNA, c

  2. AcEST: BP915220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_H10 510 Adiantum capillus-veneris mRNA. clone: YMU001_000067_H10. BP915220 - Show BP915220...is mRNA. clone: YMU001_000067_H10. Accession BP915220 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915220...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915220|Adiantum capillus-veneris mRNA, clone: YMU

  3. AcEST: BP917220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_G09 125 Adiantum capillus-veneris mRNA. clone: YMU001_000097_G09. BP917220 - Show BP917220...is mRNA. clone: YMU001_000097_G09. Accession BP917220 Tissue type prothallium Developmental stage - Contig I...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917220...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917220|Adiantum capillus-veneris

  4. AcEST: BP912209 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D06 540 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D06. BP912209 - Show BP91220...is mRNA. clone: YMU001_000016_D06. Accession BP912209 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912209|Adiantum capillus-veneris... programs, Nucleic Acids Res. 25:3389-3402. Query= BP912209|Adiantum capillus-veneris mRNA, clone: YMU001_00

  5. AcEST: BP912207 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D04 249 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D04. BP912207 - Show BP91220...is mRNA. clone: YMU001_000016_D04. Accession BP912207 Tissue type prothallium Developmental stage - Contig I...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91220...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91220

  6. AcEST: BP913220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_G12 489 Adiantum capillus-veneris mRNA. clone: YMU001_000027_G12. BP913220 - Show BP913220...is mRNA. clone: YMU001_000027_G12. Accession BP913220 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP913220|Adiantum capillus-veneris...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913220

  7. AcEST: BP912220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_E08 357 Adiantum capillus-veneris mRNA. clone: YMU001_000016_E08. BP912220 - Show BP912220...is mRNA. clone: YMU001_000016_E08. Accession BP912220 Tissue type prothallium Developmental stage - Contig I...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912220...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912220

  8. AcEST: BP912200 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_C08 572 Adiantum capillus-veneris mRNA. clone: YMU001_000016_C08. BP91220...0 CL3270Contig1 Show BP912200 Clone id YMU001_000016_C08 Library YMU01 Length 572 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_C08. Accession BP912200 Tissue type prothallium Developmental stag...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912200|Adiantum capillus-veneris mRNA, clo...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP912200|Adiantum capillus-vener

  9. AcEST: BP912206 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D03 484 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D03. BP912206 - Show BP91220...is mRNA. clone: YMU001_000016_D03. Accession BP912206 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912206|Adiantum capi...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91220

  10. AcEST: BP919675 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_G12 532 Adiantum capillus-veneris mRNA. clone: YMU001_000127_G12. BP919675 - Show BP91967...is mRNA. clone: YMU001_000127_G12. Accession BP919675 Tissue type prothallium Developmental stage - Contig I...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91967...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919675|Adiantum capillus-veneris mRNA, clone:

  11. AcEST: BP919671 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_G08 312 Adiantum capillus-veneris mRNA. clone: YMU001_000127_G08. BP91967...1 CL2222Contig1 Show BP919671 Clone id YMU001_000127_G08 Library YMU01 Length 312 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000127_G08. Accession BP919671 Tissue type prothallium Developmental stag...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919671|Adian...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91967

  12. AcEST: BP911967 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_D07 567 Adiantum capillus-veneris mRNA. clone: YMU001_000011_D07. BP911967 - Show BP911967...is mRNA. clone: YMU001_000011_D07. Accession BP911967 Tissue type prothallium Developmental stage - Contig I...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911967|Adiantum capillus-veneris mRNA, clone:...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911967|Adiantum cap

  13. AcEST: BP919676 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_H01 519 Adiantum capillus-veneris mRNA. clone: YMU001_000127_H01. BP919676 - Show BP91967...is mRNA. clone: YMU001_000127_H01. Accession BP919676 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91967...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91967

  14. AcEST: BP919678 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_H03 321 Adiantum capillus-veneris mRNA. clone: YMU001_000127_H03. BP919678 - Show BP91967...is mRNA. clone: YMU001_000127_H03. Accession BP919678 Tissue type prothallium Developmental stage - Contig I...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919678|Adiantum capillus-vene...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91967

  15. AcEST: BP919670 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_G07 482 Adiantum capillus-veneris mRNA. clone: YMU001_000127_G07. BP919670 - Show BP91967...is mRNA. clone: YMU001_000127_G07. Accession BP919670 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91967...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91967

  16. AcEST: BP919677 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_H02 601 Adiantum capillus-veneris mRNA. clone: YMU001_000127_H02. BP919677 - Show BP91967...is mRNA. clone: YMU001_000127_H02. Accession BP919677 Tissue type prothallium Developmental stage - Contig I...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91967...ucleic Acids Res. 25:3389-3402. Query= BP919677|Adiantum capillus-veneris mRNA, clone: YMU001_000127_H02. (5

  17. AcEST: BP919958 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_C03 356 Adiantum capillus-veneris mRNA. clone: YMU001_000131_C03. BP919958 - Show BP91995...is mRNA. clone: YMU001_000131_C03. Accession BP919958 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP919958|Adiantum capillus-veneris mRNA, clone: YMU001_000131_C03. (356 lett...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91995

  18. AcEST: BP911995 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_G09 447 Adiantum capillus-veneris mRNA. clone: YMU001_000011_G09. BP911995... CL245Contig1 Show BP911995 Clone id YMU001_000011_G09 Library YMU01 Length 447 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000011_G09. Accession BP911995 Tissue type prothallium Developmental stage...grams, Nucleic Acids Res. 25:3389-3402. Query= BP911995|Adiantum capillus-veneris..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911995

  19. AcEST: BP919959 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_C04 203 Adiantum capillus-veneris mRNA. clone: YMU001_000131_C04. BP91995...9 CL3464Contig1 Show BP919959 Clone id YMU001_000131_C04 Library YMU01 Length 203 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_C04. Accession BP919959 Tissue type prothallium Developmental stag...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91995...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919959|Adiantum

  20. AcEST: BP919957 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_B12 562 Adiantum capillus-veneris mRNA. clone: YMU001_000131_B12. BP919957 - Show BP91995...is mRNA. clone: YMU001_000131_B12. Accession BP919957 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919957|Adiantum capillus-veneris mRNA, clone: YMU0... Res. 25:3389-3402. Query= BP919957|Adiantum capillus-veneris mRNA, clone: YMU001

  1. AcEST: BP919952 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_B06 424 Adiantum capillus-veneris mRNA. clone: YMU001_000131_B06. BP919952 - Show BP91995...is mRNA. clone: YMU001_000131_B06. Accession BP919952 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919952|Adiantum...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919952|Adiantum capillus-veneris mRNA, clone:

  2. AcEST: BP919950 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_B03 423 Adiantum capillus-veneris mRNA. clone: YMU001_000131_B03. BP919950 - Show BP91995...is mRNA. clone: YMU001_000131_B03. Accession BP919950 Tissue type prothallium Developmental stage - Contig I...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919950|Adiantu...cleic Acids Res. 25:3389-3402. Query= BP919950|Adiantum capillus-veneris mRNA, clone: YMU001_000131_B03. (42

  3. AcEST: BP919954 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_B08 462 Adiantum capillus-veneris mRNA. clone: YMU001_000131_B08. BP91995...4 CL3148Contig1 Show BP919954 Clone id YMU001_000131_B08 Library YMU01 Length 462 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_B08. Accession BP919954 Tissue type prothallium Developmental stag...programs, Nucleic Acids Res. 25:3389-3402. Query= BP919954|Adiantum capillus-vene...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919954|Adiantum capillus-veneris mRNA, clo

  4. AcEST: BP919956 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_B11 358 Adiantum capillus-veneris mRNA. clone: YMU001_000131_B11. BP919956 - Show BP91995...is mRNA. clone: YMU001_000131_B11. Accession BP919956 Tissue type prothallium Developmental stage - Contig I...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91995...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91995

  5. AcEST: BP921010 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E04 526 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E04. BP921010 - Show BP921010...is mRNA. clone: YMU001_000144_E04. Accession BP921010 Tissue type prothallium Developmental stage - Contig I...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921010|Adiantum capillus-veneris mRNA...programs, Nucleic Acids Res. 25:3389-3402. Query= BP921010|Adiantum capillus-veneris mRNA, clone: YMU001_000...002030-PA (Fragment) OS=Anopheles gambiae GN=AGAP002030 PE=4 SV=4 Length = 2210 S

  6. AcEST: BP918489 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000114_B02 201 Adiantum capillus-veneris mRNA. clone: YMU001_000114_B02. BP918489 - Show BP9184...is mRNA. clone: YMU001_000114_B02. Accession BP918489 Tissue type prothallium Developmental stage - Contig I...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918489|Adiantum capillus-veneris m

  7. AcEST: BP918402 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B01. BP9184...02 CL402Contig1 Show BP918402 Clone id YMU001_000113_B01 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000113_B01. Accession BP918402 Tissue type prothallium Developmental stage...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918402|A

  8. AcEST: BP918412 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B12 606 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B12. BP918412 - Show BP9184...is mRNA. clone: YMU001_000113_B12. Accession BP918412 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918412|Adiantum capillus-veneris mRNA, clone: YMU0

  9. AcEST: BP913184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_D12 485 Adiantum capillus-veneris mRNA. clone: YMU001_000027_D12. BP913184... CL748Contig1 Show BP913184 Clone id YMU001_000027_D12 Library YMU01 Length 485 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000027_D12. Accession BP913184 Tissue type prothallium Developmental stage...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913184|Ad...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP913184|Adiantum capillus-ve

  10. AcEST: BP918421 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C09 541 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C09. BP9184...21 CL2140Contig1 Show BP918421 Clone id YMU001_000113_C09 Library YMU01 Length 541 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_C09. Accession BP918421 Tissue type prothallium Developmental stag...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918421|Adiantum capillus-ve

  11. AcEST: BP915184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_E05 573 Adiantum capillus-veneris mRNA. clone: YMU001_000067_E05. BP915184 - Show BP915184...is mRNA. clone: YMU001_000067_E05. Accession BP915184 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915184|Adiantum capillus-veneris mRN...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP915184|Adiantum capillus-veneris mRNA, clone: YMU0

  12. AcEST: BP918451 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_F06 261 Adiantum capillus-veneris mRNA. clone: YMU001_000113_F06. BP918451 - Show BP9184...is mRNA. clone: YMU001_000113_F06. Accession BP918451 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918451|Adiantum capillus-veneris mRNA, clone: YMU001_...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918451|Adiantum capillus-veneris mRNA, clo

  13. AcEST: BP918444 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E11 570 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E11. BP918444 - Show BP9184...is mRNA. clone: YMU001_000113_E11. Accession BP918444 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918444|Adiantum capillus...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918444|Adiantum capillus-veneris mRNA, clone

  14. AcEST: BP918475 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_H07 490 Adiantum capillus-veneris mRNA. clone: YMU001_000113_H07. BP918475 - Show BP9184...is mRNA. clone: YMU001_000113_H07. Accession BP918475 Tissue type prothallium Developmental stage - Contig I...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918475|Adiantum capillus-vene...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  15. AcEST: BP918435 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E01 558 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E01. BP918435 - Show BP9184...is mRNA. clone: YMU001_000113_E01. Accession BP918435 Tissue type prothallium Developmental stage - Contig I...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP918435|Adiantum capillus-veneris mRNA, clone: YMU001_0... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  16. AcEST: BP918479 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000114_A04 521 Adiantum capillus-veneris mRNA. clone: YMU001_000114_A04. BP918479 - Show BP9184...is mRNA. clone: YMU001_000114_A04. Accession BP918479 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  17. AcEST: BP911848 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_H04 372 Adiantum capillus-veneris mRNA. clone: YMU001_000009_H04. BP911848 - Show BP91184...is mRNA. clone: YMU001_000009_H04. Accession BP911848 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911848|Adiantum capillus-veneris...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911848|Adiantum capillus-ve

  18. AcEST: BP918425 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D02 396 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D02. BP9184...25 CL2176Contig1 Show BP918425 Clone id YMU001_000113_D02 Library YMU01 Length 396 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_D02. Accession BP918425 Tissue type prothallium Developmental stag...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918425|Ad...ic Acids Res. 25:3389-3402. Query= BP918425|Adiantum capillus-veneris mRNA, clone

  19. AcEST: BP918468 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_G12 202 Adiantum capillus-veneris mRNA. clone: YMU001_000113_G12. BP918468 - Show BP9184...is mRNA. clone: YMU001_000113_G12. Accession BP918468 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918468|Ad...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918468|Adiantum capillus

  20. AcEST: BP918411 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B11 488 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B11. BP9184...11 CL3724Contig1 Show BP918411 Clone id YMU001_000113_B11 Library YMU01 Length 488 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_B11. Accession BP918411 Tissue type prothallium Developmental stag...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918411|Adiantum capillus-...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  1. AcEST: BP918431 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D08 339 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D08. BP9184...31 CL1749Contig1 Show BP918431 Clone id YMU001_000113_D08 Library YMU01 Length 339 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_D08. Accession BP918431 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918431|Adiantum capillus-v...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  2. AcEST: BP918449 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_F04 232 Adiantum capillus-veneris mRNA. clone: YMU001_000113_F04. BP918449 - Show BP9184...is mRNA. clone: YMU001_000113_F04. Accession BP918449 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918449|Adiantum cap...s. 25:3389-3402. Query= BP918449|Adiantum capillus-veneris mRNA, clone: YMU001_000113_F04. (232 letters) Dat

  3. AcEST: BP918459 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_G02 467 Adiantum capillus-veneris mRNA. clone: YMU001_000113_G02. BP918459 - Show BP9184...is mRNA. clone: YMU001_000113_G02. Accession BP918459 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918459|Adiantum c..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  4. AcEST: BP911842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G09 574 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G09. BP91184...2 CL578Contig1 Show BP911842 Clone id YMU001_000009_G09 Library YMU01 Length 574 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000009_G09. Accession BP911842 Tissue type prothallium Developmental stage...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911842|...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91184

  5. AcEST: BP918184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E05 469 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E05. BP918184... CL72Contig1 Show BP918184 Clone id YMU001_000110_E05 Library YMU01 Length 469 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000110_E05. Accession BP918184 Tissue type prothallium Developmental stage ...ic Acids Res. 25:3389-3402. Query= BP918184|Adiantum capillus-veneris mRNA, clone... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918184|Adiantum capillus-veneris mRNA, clone: YM

  6. AcEST: BP911843 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G10 434 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G10. BP911843 - Show BP91184...is mRNA. clone: YMU001_000009_G10. Accession BP911843 Tissue type prothallium Developmental stage - Contig I...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91184...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP911843|Adiantum capillus-veneris mRNA, clone: YMU0

  7. AcEST: BP911847 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_H03 495 Adiantum capillus-veneris mRNA. clone: YMU001_000009_H03. BP911847 - Show BP91184...is mRNA. clone: YMU001_000009_H03. Accession BP911847 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911847|...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911847|Adiantum capillus-veneris...ogen synthase kinase-3 beta OS=Homo sa... 80 7e-15 sp|P51136|GSK3_DICDI Glycogen synthase kinase-3 OS=Dictyo

  8. AcEST: BP917184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_D02 514 Adiantum capillus-veneris mRNA. clone: YMU001_000097_D02. BP917184 - Show BP917184...is mRNA. clone: YMU001_000097_D02. Accession BP917184 Tissue type prothallium Developmental stage - Contig I...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917184...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917184|Adiantum capillus-veneris mRNA, clone: Y

  9. AcEST: BP912184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_B04 515 Adiantum capillus-veneris mRNA. clone: YMU001_000016_B04. BP912184... CL719Contig1 Show BP912184 Clone id YMU001_000016_B04 Library YMU01 Length 515 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000016_B04. Accession BP912184 Tissue type prothallium Developmental stage...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912184...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912184

  10. AcEST: BP918416 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C04 557 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C04. BP918416 - Show BP9184...is mRNA. clone: YMU001_000113_C04. Accession BP918416 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918416|Adiantum capillus-veneris mRNA, clone: YMU001_000113_C0...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  11. AcEST: BP918458 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_G01 479 Adiantum capillus-veneris mRNA. clone: YMU001_000113_G01. BP9184...58 CL2714Contig1 Show BP918458 Clone id YMU001_000113_G01 Library YMU01 Length 479 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_G01. Accession BP918458 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918458|Adian...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918458|Adiantum capillus-v

  12. AcEST: BP919184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_B11 566 Adiantum capillus-veneris mRNA. clone: YMU001_000122_B11. BP919184 - Show BP919184...is mRNA. clone: YMU001_000122_B11. Accession BP919184 Tissue type prothallium Developmental stage - Contig I...eic Acids Res. 25:3389-3402. Query= BP919184|Adiantum capillus-veneris mRNA, clone: YMU001_000122_B11. (566 ...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919184|Adiantum capillu

  13. AcEST: BP918441 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E08 487 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E08. BP9184...41 CL3521Contig1 Show BP918441 Clone id YMU001_000113_E08 Library YMU01 Length 487 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_E08. Accession BP918441 Tissue type prothallium Developmental stag...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918441|Adiant...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918441|Adiantum capillus-vener

  14. AcEST: BP912065 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_F05 374 Adiantum capillus-veneris mRNA. clone: YMU001_000012_F05. BP912065 - Show BP912065...is mRNA. clone: YMU001_000012_F05. Accession BP912065 Tissue type prothallium Developmental stage - Contig I...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912065|Adiantum capillus-veneris mRNA, clone: YMU...programs, Nucleic Acids Res. 25:3389-3402. Query= BP912065|Adiantum capillus-vene

  15. AcEST: BP920655 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000139_G12 534 Adiantum capillus-veneris mRNA. clone: YMU001_000139_G12. BP92065...5 CL2395Contig1 Show BP920655 Clone id YMU001_000139_G12 Library YMU01 Length 534 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000139_G12. Accession BP920655 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920655|Adiantum capillus-veneris mRNA, clone: YMU001_0001...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920655|Adiantum ca

  16. AcEST: BP920657 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000139_H02 176 Adiantum capillus-veneris mRNA. clone: YMU001_000139_H02. BP92065...7 CL2700Contig1 Show BP920657 Clone id YMU001_000139_H02 Library YMU01 Length 176 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000139_H02. Accession BP920657 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92065...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920657|Adiantum capillus-veneris mRNA

  17. AcEST: BP920656 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000139_H01 499 Adiantum capillus-veneris mRNA. clone: YMU001_000139_H01. BP920656 - Show BP92065...is mRNA. clone: YMU001_000139_H01. Accession BP920656 Tissue type prothallium Developmental stage - Contig I... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920656|Adiantum capil...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92065

  18. AcEST: BP920654 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000139_G11 329 Adiantum capillus-veneris mRNA. clone: YMU001_000139_G11. BP920654 - Show BP92065...is mRNA. clone: YMU001_000139_G11. Accession BP920654 Tissue type prothallium Developmental stage - Contig I...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92065...grams, Nucleic Acids Res. 25:3389-3402. Query= BP920654|Adiantum capillus-veneris mRNA, clone: YMU001_000139

  19. AcEST: BP920659 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000139_H05 537 Adiantum capillus-veneris mRNA. clone: YMU001_000139_H05. BP92065...9 CL3578Contig1 Show BP920659 Clone id YMU001_000139_H05 Library YMU01 Length 537 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000139_H05. Accession BP920659 Tissue type prothallium Developmental stag...Nucleic Acids Res. 25:3389-3402. Query= BP920659|Adiantum capillus-veneris mRNA, ...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920659|

  20. AcEST: BP920652 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000139_G07 435 Adiantum capillus-veneris mRNA. clone: YMU001_000139_G07. BP920652 - Show BP92065...is mRNA. clone: YMU001_000139_G07. Accession BP920652 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92065... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920652|Adian

  1. AcEST: BP915489 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_C03 508 Adiantum capillus-veneris mRNA. clone: YMU001_000072_C03. BP915489 - Show BP915489...is mRNA. clone: YMU001_000072_C03. Accession BP915489 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP915489|Adiantum capillus-veneris mRNA, clone: YMU001_000072_C03. (508 l...Nucleic Acids Res. 25:3389-3402. Query= BP915489|Adiantum capillus-veneris mRNA, clone: YMU001_000072_C03. (

  2. AcEST: BP920158 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G02 530 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G02. BP92015...8 CL188Contig1 Show BP920158 Clone id YMU001_000133_G02 Library YMU01 Length 530 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_G02. Accession BP920158 Tissue type prothallium Developmental stage.... 25:3389-3402. Query= BP920158|Adiantum capillus-veneris mRNA, clone: YMU001_000133_G02. (530 letters) Data... programs, Nucleic Acids Res. 25:3389-3402. Query= BP920158|Adiantum capillus-ven

  3. AcEST: BP920150 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F04 550 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F04. BP920150 - Show BP92015...is mRNA. clone: YMU001_000133_F04. Accession BP920150 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920150|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F04. (550 lette...c Acids Res. 25:3389-3402. Query= BP920150|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F04. (550 le

  4. AcEST: BP920157 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G01 550 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G01. BP92015...7 CL541Contig1 Show BP920157 Clone id YMU001_000133_G01 Library YMU01 Length 550 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_G01. Accession BP920157 Tissue type prothallium Developmental stage...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920157|Adiantum capillus-veneris mRNA,...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920157|Adiantum capillus-veneris

  5. AcEST: BP920153 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F08 540 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F08. BP920153 - Show BP92015...is mRNA. clone: YMU001_000133_F08. Accession BP920153 Tissue type prothallium Developmental stage - Contig I...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920153|Adiantum capillus-veneris mRNA, clone: YMU...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920153|Adiantum capillus-ve

  6. AcEST: BP920152 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F06 457 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F06. BP920152 - Show BP92015...is mRNA. clone: YMU001_000133_F06. Accession BP920152 Tissue type prothallium Developmental stage - Contig I...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920152|Adiantu...Res. 25:3389-3402. Query= BP920152|Adiantum capillus-veneris mRNA, clone: YMU001_

  7. AcEST: BP920156 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F12 587 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F12. BP92015...6 CL200Contig1 Show BP920156 Clone id YMU001_000133_F12 Library YMU01 Length 587 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_F12. Accession BP920156 Tissue type prothallium Developmental stage...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920156...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920156|Adiantum

  8. AcEST: BP920159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G03 420 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G03. BP920159 - Show BP92015...is mRNA. clone: YMU001_000133_G03. Accession BP920159 Tissue type prothallium Developmental stage - Contig I... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92015... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92015

  9. AcEST: BP920163 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G08 372 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G08. BP92016...3 CL2472Contig1 Show BP920163 Clone id YMU001_000133_G08 Library YMU01 Length 372 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_G08. Accession BP920163 Tissue type prothallium Developmental stag...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920163|Adiantum cap... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920163|Adiantum capillus-veneris mRNA, clone: YM

  10. AcEST: BP920167 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H01 152 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H01. BP920167 - Show BP92016...is mRNA. clone: YMU001_000133_H01. Accession BP920167 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP920167|Adiantum capillus-veneris mRNA, clone: YMU...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920167

  11. AcEST: BP920168 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H02 390 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H02. BP920168 - Show BP92016...is mRNA. clone: YMU001_000133_H02. Accession BP920168 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920168|Adiantum capillus-veneris mRNA,...c Acids Res. 25:3389-3402. Query= BP920168|Adiantum capillus-veneris mRNA, clone: YMU001_000133_H02. (390 le

  12. AcEST: BP920161 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G06. BP920161 - Show BP92016...is mRNA. clone: YMU001_000133_G06. Accession BP920161 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016

  13. AcEST: BP920166 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G12 149 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G12. BP920166 - Show BP92016...is mRNA. clone: YMU001_000133_G12. Accession BP920166 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920166|Adiantum capillus-veneris

  14. AcEST: BP920164 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G09 447 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G09. BP920164 - Show BP92016...is mRNA. clone: YMU001_000133_G09. Accession BP920164 Tissue type prothallium Developmental stage - Contig I...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920164|A...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920164|Adiantum cap

  15. AcEST: BP920165 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G11 301 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G11. BP920165 - Show BP92016...is mRNA. clone: YMU001_000133_G11. Accession BP920165 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920165...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016

  16. AcEST: BP920169 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H03. BP920169 - Show BP92016...is mRNA. clone: YMU001_000133_H03. Accession BP920169 Tissue type prothallium Developmental stage - Contig I...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920169|Adiantum cap

  17. AcEST: BP917100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_H06 514 Adiantum capillus-veneris mRNA. clone: YMU001_000095_H06. BP917100 - Show BP917100...is mRNA. clone: YMU001_000095_H06. Accession BP917100 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917100|... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917100

  18. AcEST: BP914100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_H03 542 Adiantum capillus-veneris mRNA. clone: YMU001_000039_H03. BP914100 - Show BP914100...is mRNA. clone: YMU001_000039_H03. Accession BP914100 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP914100|Adiantum capillus-veneris mRNA, clone: YMU001_000039_H...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914100

  19. AcEST: BP912100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_B06 447 Adiantum capillus-veneris mRNA. clone: YMU001_000015_B06. BP912100 - Show BP912100...is mRNA. clone: YMU001_000015_B06. Accession BP912100 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP912100|Adiantum capillus-veneris mRNA, clone: YMU001_00...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912100|Adiantum capi

  20. AcEST: BP919100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_C03 561 Adiantum capillus-veneris mRNA. clone: YMU001_000121_C03. BP919100 - Show BP919100...is mRNA. clone: YMU001_000121_C03. Accession BP919100 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP919100|Adiantum capillus-veneris mRNA, clone: YMU001_000121_C03. (5...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919100

  1. AcEST: BP916100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000083_B04 427 Adiantum capillus-veneris mRNA. clone: YMU001_000083_B04. BP916100... CL115Contig1 Show BP916100 Clone id YMU001_000083_B04 Library YMU01 Length 427 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000083_B04. Accession BP916100 Tissue type prothallium Developmental stage...s, Nucleic Acids Res. 25:3389-3402. Query= BP916100|Adiantum capillus-veneris mRN... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916100

  2. AcEST: BP921006 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D12 494 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D12. BP921006 - Show BP92100...is mRNA. clone: YMU001_000144_D12. Accession BP921006 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921006|Adiantum capillus-...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP921006|Adiantum capillus-veneris mRNA, clone: YMU001_

  3. AcEST: BP920183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A07 427 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A07. BP920183 - Show BP92018...is mRNA. clone: YMU001_000134_A07. Accession BP920183 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920183...programs, Nucleic Acids Res. 25:3389-3402. Query= BP920183|Adiantum capillus-veneris mRNA, clone: YMU001_000

  4. AcEST: BP920180 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A04 428 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A04. BP920180 - Show BP92018...is mRNA. clone: YMU001_000134_A04. Accession BP920180 Tissue type prothallium Developmental stage - Contig I... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920180|Adia... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92018

  5. AcEST: BP920184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A08 470 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A08. BP920184 - Show BP92018...is mRNA. clone: YMU001_000134_A08. Accession BP920184 Tissue type prothallium Developmental stage - Contig I...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP920184|Adiantum capillus-veneri...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920184|Adiantum capill

  6. AcEST: BP912018 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_B01 519 Adiantum capillus-veneris mRNA. clone: YMU001_000012_B01. BP912018 - Show BP912018...is mRNA. clone: YMU001_000012_B01. Accession BP912018 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912018.... 25:3389-3402. Query= BP912018|Adiantum capillus-veneris mRNA, clone: YMU001_000012_B01. (519 letters) Data

  7. AcEST: BP920187 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A12 506 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A12. BP920187 - Show BP92018...is mRNA. clone: YMU001_000134_A12. Accession BP920187 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP920187|Adiantum capillus-vene...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP920187|Adiantum capillus-veneris mRNA, clone: YMU001_00013

  8. AcEST: BP913801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000035_D11 562 Adiantum capillus-veneris mRNA. clone: YMU001_000035_D11. BP913801... CL482Contig1 Show BP913801 Clone id YMU001_000035_D11 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000035_D11. Accession BP913801 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum capillus-veneris mRNA, clone: YMU0

  9. AcEST: BP918013 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F01 490 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F01. BP918013 - Show BP91801...is mRNA. clone: YMU001_000108_F01. Accession BP918013 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...idylinositol-4-phosphate 5-kinase 1 OS=Oryza sativa subsp. japonica GN=PIPK1 PE=2 SV=2 Length = 801 Score = ..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  10. AcEST: BP920801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000141_G10 454 Adiantum capillus-veneris mRNA. clone: YMU001_000141_G10. BP920801... CL819Contig1 Show BP920801 Clone id YMU001_000141_G10 Library YMU01 Length 454 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000141_G10. Accession BP920801 Tissue type prothallium Developmental stage... Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-veneris mRNA, clone: ...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-

  11. AcEST: BP918017 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F05 267 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F05. BP918017 - Show BP91801...is mRNA. clone: YMU001_000108_F05. Accession BP918017 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris m...cleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F05. (26

  12. AcEST: BP918018 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F06 436 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F06. BP918018 - Show BP91801...is mRNA. clone: YMU001_000108_F06. Accession BP918018 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918018|Adiantum capillus-veneris mRNA, clone: YM...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  13. AcEST: BP912801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000023_A07 527 Adiantum capillus-veneris mRNA. clone: YMU001_000023_A07. BP912801 - Show BP912801...is mRNA. clone: YMU001_000023_A07. Accession BP912801 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912801...es. 25:3389-3402. Query= BP912801|Adiantum capillus-veneris mRNA, clone: YMU001_0

  14. AcEST: BP918012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_E12 547 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E12. BP918012 - Show BP91801...is mRNA. clone: YMU001_000108_E12. Accession BP918012 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108_E1

  15. AcEST: BP911801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_C12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000009_C12. BP911801 - Show BP911801...is mRNA. clone: YMU001_000009_C12. Accession BP911801 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911801.... 25:3389-3402. Query= BP911801|Adiantum capillus-veneris mRNA, clone: YMU001_000

  16. AcEST: BP918801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000117_F03 542 Adiantum capillus-veneris mRNA. clone: YMU001_000117_F03. BP918801 - Show BP918801...is mRNA. clone: YMU001_000117_F03. Accession BP918801 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum capillus-veneris mRNA, clone: YMU0...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum ca

  17. AcEST: BP916801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000091_G06 127 Adiantum capillus-veneris mRNA. clone: YMU001_000091_G06. BP916801... CL2168Contig1 Show BP916801 Clone id YMU001_000091_G06 Library YMU01 Length 127 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000091_G06. Accession BP916801 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP916801|Adiantum capillus-veneris mRNA, clone: YMU0...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916801

  18. AcEST: BP915801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000077_B02 555 Adiantum capillus-veneris mRNA. clone: YMU001_000077_B02. BP915801 - Show BP915801...is mRNA. clone: YMU001_000077_B02. Accession BP915801 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP915801|Adiantum capillus-veneris mRNA, clone: YMU001_000077_B02. ...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915801|A

  19. AcEST: BP918015 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F03 437 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F03. BP918015 - Show BP91801...is mRNA. clone: YMU001_000108_F03. Accession BP918015 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP918015|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F03. (437 letters) Data...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  20. AcEST: BP921801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_C09 317 Adiantum capillus-veneris mRNA. clone: YMU001_000154_C09. BP921801 - Show BP921801...is mRNA. clone: YMU001_000154_C09. Accession BP921801 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921801|Ad...c Acids Res. 25:3389-3402. Query= BP921801|Adiantum capillus-veneris mRNA, clone: YMU001_000154_C09. (317 le

  1. AcEST: BP911984 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_F07 566 Adiantum capillus-veneris mRNA. clone: YMU001_000011_F07. BP911984... CL2332Contig1 Show BP911984 Clone id YMU001_000011_F07 Library YMU01 Length 566 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_F07. Accession BP911984 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911984|Adiantum capillus-veneris mR...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911984

  2. AcEST: BP919847 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H01 512 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H01. BP919847 - Show BP91984...is mRNA. clone: YMU001_000129_H01. Accession BP919847 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91984...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919847|Adiantum capillus-veneris mRNA, clone: YMU0

  3. AcEST: BP919842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G07 567 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G07. BP919842 - Show BP91984...is mRNA. clone: YMU001_000129_G07. Accession BP919842 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris m...c Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G07. (567 le

  4. AcEST: BP919849 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H04 454 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H04. BP919849 - Show BP91984...is mRNA. clone: YMU001_000129_H04. Accession BP919849 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP919849|Adiantum capillus-veneris mRNA, clone: YMU001_00...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP919849|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  5. AcEST: BP919845 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G11 376 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G11. BP919845 - Show BP91984...is mRNA. clone: YMU001_000129_G11. Accession BP919845 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP919845|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G1...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919845|Adiantum capillus

  6. AcEST: BP919843 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G09 473 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G09. BP91984...3 CL2697Contig1 Show BP919843 Clone id YMU001_000129_G09 Library YMU01 Length 473 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_G09. Accession BP919843 Tissue type prothallium Developmental stag...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919843|Ad...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919843|Adiantum capillus-veneris

  7. AcEST: BP919840 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G05 476 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G05. BP919840 - Show BP91984...is mRNA. clone: YMU001_000129_G05. Accession BP919840 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP919840|Adiantum capillus-veneris mRNA, clone: YMU001_...es. 25:3389-3402. Query= BP919840|Adiantum capillus-veneris mRNA, clone: YMU001_0

  8. AcEST: BP920064 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_F03 528 Adiantum capillus-veneris mRNA. clone: YMU001_000132_F03. BP920064 - Show BP92006...is mRNA. clone: YMU001_000132_F03. Accession BP920064 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92006...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920064|Adiantum capillus-veneris mRNA, clon

  9. AcEST: BP920063 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_F02 447 Adiantum capillus-veneris mRNA. clone: YMU001_000132_F02. BP92006...3 CL3872Contig1 Show BP920063 Clone id YMU001_000132_F02 Library YMU01 Length 447 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000132_F02. Accession BP920063 Tissue type prothallium Developmental stag... Acids Res. 25:3389-3402. Query= BP920063|Adiantum capillus-veneris mRNA, clone: ...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920063|Ad

  10. AcEST: BP920060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E11 498 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E11. BP92006...0 CL3922Contig1 Show BP920060 Clone id YMU001_000132_E11 Library YMU01 Length 498 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000132_E11. Accession BP920060 Tissue type prothallium Developmental stag...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92006...s Res. 25:3389-3402. Query= BP920060|Adiantum capillus-veneris mRNA, clone: YMU00

  11. AcEST: BP912006 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_H11 529 Adiantum capillus-veneris mRNA. clone: YMU001_000011_H11. BP912006... CL1611Contig1 Show BP912006 Clone id YMU001_000011_H11 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_H11. Accession BP912006 Tissue type prothallium Developmental stag... Res. 25:3389-3402. Query= BP912006|Adiantum capillus-veneris mRNA, clone: YMU001_000011_H11. (529 letters) ...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912006

  12. AcEST: BP920069 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_F08 472 Adiantum capillus-veneris mRNA. clone: YMU001_000132_F08. BP920069 - Show BP92006...is mRNA. clone: YMU001_000132_F08. Accession BP920069 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920069|Adiantum capillus-v... Nucleic Acids Res. 25:3389-3402. Query= BP920069|Adiantum capillus-veneris mRNA, clone: YMU001_000132_F08.

  13. AcEST: BP920065 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_F04 467 Adiantum capillus-veneris mRNA. clone: YMU001_000132_F04. BP92006...5 CL2488Contig1 Show BP920065 Clone id YMU001_000132_F04 Library YMU01 Length 467 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000132_F04. Accession BP920065 Tissue type prothallium Developmental stag...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920065|Adiantum capillus...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92006

  14. AcEST: BP919984 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_F01 435 Adiantum capillus-veneris mRNA. clone: YMU001_000131_F01. BP919984 - Show BP91998...is mRNA. clone: YMU001_000131_F01. Accession BP919984 Tissue type prothallium Developmental stage - Contig I...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91998...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91998

  15. AcEST: BP919989 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_F06 482 Adiantum capillus-veneris mRNA. clone: YMU001_000131_F06. BP919989 - Show BP91998...is mRNA. clone: YMU001_000131_F06. Accession BP919989 Tissue type prothallium Developmental stage - Contig I...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP919989|Adiantum capillus-ve... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919989|Adiantum capillus-veneris mRNA,

  16. AcEST: BP919988 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_F05 436 Adiantum capillus-veneris mRNA. clone: YMU001_000131_F05. BP919988 - Show BP91998...is mRNA. clone: YMU001_000131_F05. Accession BP919988 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP919988|Adiantum capillus-veneris mRNA, clone: YMU001_000...s. 25:3389-3402. Query= BP919988|Adiantum capillus-veneris mRNA, clone: YMU001_000131_F05. (436 letters) Dat

  17. AcEST: BP919986 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_F03 385 Adiantum capillus-veneris mRNA. clone: YMU001_000131_F03. BP919986 - Show BP91998...is mRNA. clone: YMU001_000131_F03. Accession BP919986 Tissue type prothallium Developmental stage - Contig I...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919986|Adiantum capillus-veneris mRNA, cl...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91998

  18. AcEST: BP911998 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_H01 514 Adiantum capillus-veneris mRNA. clone: YMU001_000011_H01. BP911998... CL4092Contig1 Show BP911998 Clone id YMU001_000011_H01 Library YMU01 Length 514 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_H01. Accession BP911998 Tissue type prothallium Developmental stag...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911998|Adiantum capillus-veneris mRNA, clone: ...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911998|Adiantum capil

  19. AcEST: BP918850 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000118_C02 510 Adiantum capillus-veneris mRNA. clone: YMU001_000118_C02. BP91885...0 CL348Contig1 Show BP918850 Clone id YMU001_000118_C02 Library YMU01 Length 510 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000118_C02. Accession BP918850 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918850|Adiantum capillus-veneris mRNA, clo...ic Acids Res. 25:3389-3402. Query= BP918850|Adiantum capillus-veneris mRNA, clone

  20. AcEST: BP918855 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000118_C10 591 Adiantum capillus-veneris mRNA. clone: YMU001_000118_C10. BP918855 - Show BP91885...is mRNA. clone: YMU001_000118_C10. Accession BP918855 Tissue type prothallium Developmental stage - Contig I...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91885...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918855|A

  1. AcEST: BP918856 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000118_C11 377 Adiantum capillus-veneris mRNA. clone: YMU001_000118_C11. BP91885...6 CL2734Contig1 Show BP918856 Clone id YMU001_000118_C11 Library YMU01 Length 377 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000118_C11. Accession BP918856 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918856|Adiantum capillus-veneris mRNA...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918856|Adiantum capillus-v

  2. AcEST: BP918854 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000118_C07 297 Adiantum capillus-veneris mRNA. clone: YMU001_000118_C07. BP918854 - Show BP91885...is mRNA. clone: YMU001_000118_C07. Accession BP918854 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918854|Adiantum capillus-veneris mRNA,..., Nucleic Acids Res. 25:3389-3402. Query= BP918854|Adiantum capillus-veneris mRNA

  3. AcEST: BP911885 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000010_D05 465 Adiantum capillus-veneris mRNA. clone: YMU001_000010_D05. BP911885 - Show BP911885...is mRNA. clone: YMU001_000010_D05. Accession BP911885 Tissue type prothallium Developmental stage - Contig I...ds Res. 25:3389-3402. Query= BP911885|Adiantum capillus-veneris mRNA, clone: YMU0...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP911885|Adiantum capillus-veneris mRNA, clone: YMU001

  4. AcEST: BP918852 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000118_C05 421 Adiantum capillus-veneris mRNA. clone: YMU001_000118_C05. BP918852 - Show BP91885...is mRNA. clone: YMU001_000118_C05. Accession BP918852 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918852|Adiantum capillus-... programs, Nucleic Acids Res. 25:3389-3402. Query= BP918852|Adiantum capillus-ven

  5. AcEST: BP918858 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000118_D01 490 Adiantum capillus-veneris mRNA. clone: YMU001_000118_D01. BP91885...8 CL1376Contig1 Show BP918858 Clone id YMU001_000118_D01 Library YMU01 Length 490 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000118_D01. Accession BP918858 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91885...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91885

  6. AcEST: BP911985 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_F08 421 Adiantum capillus-veneris mRNA. clone: YMU001_000011_F08. BP911985 - Show BP911985...is mRNA. clone: YMU001_000011_F08. Accession BP911985 Tissue type prothallium Developmental stage - Contig I...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91198...rams, Nucleic Acids Res. 25:3389-3402. Query= BP911985|Adiantum capillus-veneris

  7. AcEST: BP919857 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_A03 501 Adiantum capillus-veneris mRNA. clone: YMU001_000130_A03. BP91985...7 CL3173Contig1 Show BP919857 Clone id YMU001_000130_A03 Library YMU01 Length 501 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000130_A03. Accession BP919857 Tissue type prothallium Developmental stag...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91985...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919857|Ad

  8. AcEST: BP919858 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_A04 328 Adiantum capillus-veneris mRNA. clone: YMU001_000130_A04. BP919858 - Show BP91985...is mRNA. clone: YMU001_000130_A04. Accession BP919858 Tissue type prothallium Developmental stage - Contig I...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91985...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919858|Adiantum capillu

  9. AcEST: BP919850 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H05 430 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H05. BP91985...0 CL2052Contig1 Show BP919850 Clone id YMU001_000129_H05 Library YMU01 Length 430 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_H05. Accession BP919850 Tissue type prothallium Developmental stag...ucleic Acids Res. 25:3389-3402. Query= BP919850|Adiantum capillus-veneris mRNA, c...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919850|Adiantum capillus-veneris mRNA, clone: YMU

  10. AcEST: BP919852 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H07 499 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H07. BP919852 - Show BP91985...is mRNA. clone: YMU001_000129_H07. Accession BP919852 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP919852|Adiantum capillus-veneris mRNA...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919852|Adiantum capillus-veneris mRNA, clo

  11. AcEST: BP912400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_F03 584 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F03. BP912400 - Show BP912400...is mRNA. clone: YMU001_000018_F03. Accession BP912400 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP912400|Adiantum capillus-veneris mRNA, clone: YMU001_000018_F03. (... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912400...ASYGVFEGEGEYYGGRE 1233 Query: 400 GPSRTQWFRASPDGTQREIKGATGDRYTCQTEDLDAFLCVSYEPVRS

  12. AcEST: BP914004 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G07 450 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G07. BP914004 - Show BP91400...is mRNA. clone: YMU001_000038_G07. Accession BP914004 Tissue type prothallium Developmental stage - Contig I...leic Acids Res. 25:3389-3402. Query= BP914004|Adiantum capillus-veneris mRNA, clo...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914004|Adiantum capillus-veneris mRN

  13. AcEST: BP914007 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G10 543 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G10. BP914007 - Show BP91400...is mRNA. clone: YMU001_000038_G10. Accession BP914007 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91400...eic Acids Res. 25:3389-3402. Query= BP914007|Adiantum capillus-veneris mRNA, clone: YMU001_000038_G10. (543

  14. AcEST: BP915400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_B04 438 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B04. BP915400 - Show BP915400...is mRNA. clone: YMU001_000071_B04. Accession BP915400 Tissue type prothallium Developmental stage - Contig I... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915400...ucleic Acids Res. 25:3389-3402. Query= BP915400|Adiantum capillus-veneris mRNA, c

  15. AcEST: BP914005 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G08 416 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G08. BP914005 - Show BP91400...is mRNA. clone: YMU001_000038_G08. Accession BP914005 Tissue type prothallium Developmental stage - Contig I...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91400...s Res. 25:3389-3402. Query= BP914005|Adiantum capillus-veneris mRNA, clone: YMU001_000038_G08. (416 letters)

  16. AcEST: BP914000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G03 555 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G03. BP914000 - Show BP91400...is mRNA. clone: YMU001_000038_G03. Accession BP914000 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP914000|Adiantum capillus-veneris mRNA, clone: YMU001_000038_G03. (5...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914000|Adiantum capil

  17. AcEST: BP920400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000136_F07 401 Adiantum capillus-veneris mRNA. clone: YMU001_000136_F07. BP920400 - Show BP920400...is mRNA. clone: YMU001_000136_F07. Accession BP920400 Tissue type prothallium Developmental stage - Contig I...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920400|Adi...ery: 234 EVEDYAVRLERGLNHYGRWDSLLTRLAIDNGDCSKISSEDL 356 E+ Y + G N+ D+ +TRL I D SK+ +DL Sbjct: 400 EIAPYIITAL...ids Res. 25:3389-3402. Query= BP920400|Adiantum capillus-veneris mRNA, clone: YMU001_000136_F07. (401 letter

  18. AcEST: BP921400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000149_D08 322 Adiantum capillus-veneris mRNA. clone: YMU001_000149_D08. BP921400 - Show BP921400...is mRNA. clone: YMU001_000149_D08. Accession BP921400 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921400|Adiant...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP921400|Adiantum capillus-v

  19. AcEST: BP917400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_D03 356 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D03. BP917400 - Show BP917400...is mRNA. clone: YMU001_000100_D03. Accession BP917400 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP917400|Adiantum capillus-veneris mRNA, clone: YMU001_000100_D03. (356 l...cids Res. 25:3389-3402. Query= BP917400|Adiantum capillus-veneris mRNA, clone: YMU001_000100_D03. (356 lette

  20. AcEST: BP914400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_E03 571 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E03. BP914400 - Show BP914400...is mRNA. clone: YMU001_000058_E03. Accession BP914400 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914400|Adiantum capillus-veneris mRNA, clone... OS=Rattus norvegicus GN=Acsl6 PE=1 SV=1 Length = 697 Score = 158 bits (400), Expect = 2e-38 Identities = 70...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914400

  1. AcEST: BP918239 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_B06 534 Adiantum capillus-veneris mRNA. clone: YMU001_000111_B06. BP918239 - Show BP918239...is mRNA. clone: YMU001_000111_B06. Accession BP918239 Tissue type prothallium Developmental stage - Contig I...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918239...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918239|Adiantum capillus

  2. AcEST: BP920145 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E11 274 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E11. BP920145 - Show BP92014...is mRNA. clone: YMU001_000133_E11. Accession BP920145 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E11.... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adian

  3. AcEST: BP920140 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E03 489 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E03. BP92014...0 CL2574Contig1 Show BP920140 Clone id YMU001_000133_E03 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E03. Accession BP920140 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920140|Adian... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  4. AcEST: BP920144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E09 265 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E09. BP920144 - Show BP92014...is mRNA. clone: YMU001_000133_E09. Accession BP920144 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920144|Adiantum capillus-veneris mRNA, clone: YMU001...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  5. AcEST: BP920142 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E05 486 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E05. BP920142 - Show BP92014...is mRNA. clone: YMU001_000133_E05. Accession BP920142 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris ...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  6. AcEST: BP920141 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E04 528 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E04. BP920141 - Show BP92014...is mRNA. clone: YMU001_000133_E04. Accession BP920141 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (528 lette...cleic Acids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (52

  7. AcEST: BP920143 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E07 533 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E07. BP92014...3 CL2377Contig1 Show BP920143 Clone id YMU001_000133_E07 Library YMU01 Length 533 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E07. Accession BP920143 Tissue type prothallium Developmental stag...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E0...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum

  8. AcEST: BP920148 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F02 429 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F02. BP92014...8 CL3819Contig1 Show BP920148 Clone id YMU001_000133_F02 Library YMU01 Length 429 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F02. Accession BP920148 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920148|Adiantum capillus-vener...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  9. AcEST: BP920147 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F01 365 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F01. BP920147 - Show BP92014...is mRNA. clone: YMU001_000133_F01. Accession BP920147 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920147|Adiantum capillus-veneris mRNA, clone: YMU001_...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201

  10. AcEST: BP921021 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_F03 449 Adiantum capillus-veneris mRNA. clone: YMU001_000144_F03. BP921021... CL4025Contig1 Show BP921021 Clone id YMU001_000144_F03 Library YMU01 Length 449 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_F03. Accession BP921021 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP921021|Adiantum capillus-veneris mRNA, clone: Y...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921021|Adiantum capillus-veneris mRN

  11. AcEST: BP921211 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A08 189 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A08. BP921211 - Show BP92121...is mRNA. clone: YMU001_000147_A08. Accession BP921211 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921211|Adiantum capillus-veneris... 25:3389-3402. Query= BP921211|Adiantum capillus-veneris mRNA, clone: YMU001_000147_A08. (189 letters) Datab

  12. AcEST: BP921521 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000150_H10 495 Adiantum capillus-veneris mRNA. clone: YMU001_000150_H10. BP921521... CL1722Contig1 Show BP921521 Clone id YMU001_000150_H10 Library YMU01 Length 495 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000150_H10. Accession BP921521 Tissue type prothallium Developmental stag... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921521...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921521|Adia

  13. AcEST: BP921219 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B05 600 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B05. BP92121...9 CL3191Contig1 Show BP921219 Clone id YMU001_000147_B05 Library YMU01 Length 600 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000147_B05. Accession BP921219 Tissue type prothallium Developmental stag...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921219|Adiantum capillus-...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92121

  14. AcEST: BP921216 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B01 347 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B01. BP921216 - Show BP92121...is mRNA. clone: YMU001_000147_B01. Accession BP921216 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP921216|Adiantum capillus-veneris mRNA, clone: YMU001_00...tities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 116 LLQTLIVTGYISFDEHLHNPHLSKHSALHITK 21 L LI...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92121

  15. AcEST: BP921821 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_E10 497 Adiantum capillus-veneris mRNA. clone: YMU001_000154_E10. BP921821 - Show BP921821...is mRNA. clone: YMU001_000154_E10. Accession BP921821 Tissue type prothallium Developmental stage - Contig I...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921821|Adiantum capill...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921821|Adiantum capillus-veneris mRNA, clone: Y...ct: 159 PTSLIQPSIVTSKKEETGIDEIIRGMRDLQIKFAKLEEKGQSPRISTKQKPRLMEGVVHR 218 Query: 237 CIWCDSTDHGRRDC 196 C+WCD+ DH RR+C Sbjct: 21

  16. AcEST: BP915189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_E11 575 Adiantum capillus-veneris mRNA. clone: YMU001_000067_E11. BP915189... CL2116Contig1 Show BP915189 Clone id YMU001_000067_E11 Library YMU01 Length 575 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000067_E11. Accession BP915189 Tissue type prothallium Developmental stag...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915189...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915189|Adiantum capillus-veneris mRNA, clone: Y

  17. AcEST: BP919948 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A12 489 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A12. BP919948 - Show BP91994...is mRNA. clone: YMU001_000131_A12. Accession BP919948 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919948|Adia...leic Acids Res. 25:3389-3402. Query= BP919948|Adiantum capillus-veneris mRNA, clone: YMU001_000131_A12. (489

  18. AcEST: BP911994 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_G08 559 Adiantum capillus-veneris mRNA. clone: YMU001_000011_G08. BP911994... CL4209Contig1 Show BP911994 Clone id YMU001_000011_G08 Library YMU01 Length 559 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_G08. Accession BP911994 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911994|Adiantum ... programs, Nucleic Acids Res. 25:3389-3402. Query= BP911994|Adiantum capillus-veneris mRNA, clone: YMU001_00

  19. AcEST: BP919949 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_B01 318 Adiantum capillus-veneris mRNA. clone: YMU001_000131_B01. BP91994...9 CL2311Contig1 Show BP919949 Clone id YMU001_000131_B01 Library YMU01 Length 318 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_B01. Accession BP919949 Tissue type prothallium Developmental stag...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91994...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91994

  20. AcEST: BP919943 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_H11 517 Adiantum capillus-veneris mRNA. clone: YMU001_000130_H11. BP919943 - Show BP91994...is mRNA. clone: YMU001_000130_H11. Accession BP919943 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP919943|Adiantum capillus-veneris mRNA, clone: YMU001_000130_H11. (493 le... Res. 25:3389-3402. Query= BP919943|Adiantum capillus-veneris mRNA, clone: YMU001

  1. AcEST: BP919941 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_H09 463 Adiantum capillus-veneris mRNA. clone: YMU001_000130_H09. BP91994...1 CL396Contig1 Show BP919941 Clone id YMU001_000130_H09 Library YMU01 Length 463 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000130_H09. Accession BP919941 Tissue type prothallium Developmental stage...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919941|Adiantum capi...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91994

  2. AcEST: BP919946 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A10 457 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A10. BP919946 - Show BP91994...is mRNA. clone: YMU001_000131_A10. Accession BP919946 Tissue type prothallium Developmental stage - Contig I...s Res. 25:3389-3402. Query= BP919946|Adiantum capillus-veneris mRNA, clone: YMU00...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919946|A

  3. Sensitivity to friction for primary explosives.

    Science.gov (United States)

    Matyáš, Robert; Šelešovský, Jakub; Musil, Tomáš

    2012-04-30

    The sensitivity to friction for a selection of primary explosives has been studied using a small BAM friction apparatus. The probit analysis was used for the construction of a sensitivity curve for each primary explosive tested. Two groups of primary explosives were chosen for measurement (a) the most commonly used industrially produced primary explosives (e.g. lead azide, tetrazene, dinol, lead styphnate) and (b) the most produced improvised primary explosives (e.g. triacetone triperoxide, hexamethylenetriperoxide diamine, mercury fulminate, acetylides of heavy metals). A knowledge of friction sensitivity is very important for determining manipulation safety for primary explosives. All the primary explosives tested were carefully characterised (synthesis procedure, shape and size of crystals). The sensitivity curves obtained represent a unique set of data, which cannot be found anywhere else in the available literature. Copyright © 2012 Elsevier B.V. All rights reserved.

  4. Spot test kit for explosives detection

    Science.gov (United States)

    Pagoria, Philip F; Whipple, Richard E; Nunes, Peter J; Eckels, Joel Del; Reynolds, John G; Miles, Robin R; Chiarappa-Zucca, Marina L

    2014-03-11

    An explosion tester system comprising a body, a lateral flow membrane swab unit adapted to be removeably connected to the body, a first explosives detecting reagent, a first reagent holder and dispenser operatively connected to the body, the first reagent holder and dispenser containing the first explosives detecting reagent and positioned to deliver the first explosives detecting reagent to the lateral flow membrane swab unit when the lateral flow membrane swab unit is connected to the body, a second explosives detecting reagent, and a second reagent holder and dispenser operatively connected to the body, the second reagent holder and dispenser containing the second explosives detecting reagent and positioned to deliver the second explosives detecting reagent to the lateral flow membrane swab unit when the lateral flow membrane swab unit is connected to the body.

  5. Diverse roles of WDR5-RbBP5-ASH2L-DPY30 (WRAD) complex in ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 42; Issue 1. Diverse roles of WDR5-RbBP5-ASH2L-DPY30 (WRAD) complex in the functions of the SET1 histone methyltransferase family. AAMIR ALI SHWETA TYAGI. Mini-Review Volume 42 Issue 1 ... Keywords. Cell cycle regulation; SET1 family; transcription; WRAD ...

  6. Studying stellar explosions with Athena

    Science.gov (United States)

    O'Brien, P.; Jonker, P.

    Athena is the second large mission selected in the ESA Cosmic Vision plan. With its large collecting area, high spectral-energy resolution (X-IFU instrument) and impressive grasp (WFI instrument), Athena will truly revolutionise X-ray astronomy. The most prodigious sources of high-energy photons are often transitory in nature. Athena will provide the sensitivity and spectral resolution coupled with rapid response to enable the study of the dynamic sky. Potential sources include: distant Gamma-Ray Bursts to probe the reionisation epoch and find missing baryons in the cosmic web; tidal disruption events to reveal dormant supermassive and intermediate-mass black holes; and supernova explosions to understand progenitors and their environments. We illustrate Athenas capabilities and show how it will be able to constrain the nature of explosive transients including gas metallicity and dynamics.

  7. Ranchero Explosive Pulsed Power Experiments

    Energy Technology Data Exchange (ETDEWEB)

    Goforth, J.H.; Atchison, W.L.; Deninger, W.J.; Fowler, C.M.; Herrera, D.H.; King, J.C.; Lopez, E.A.; Oona, H.; Reinovsky, R.E.; Stokes, J.L.; Sena, F.C.; Tabaka, L.J.; Tasker, D.G.; Torres, D.T.; Lindemuth, I.R.; Faehl, R.J.; Keinigs, R.K.; Taylor, A.J.; Rodriguez, G.; Oro, D.M.; Garcia, O.F.; parker, J.V.; Broste, W.B.

    1999-06-27

    The authors are developing the Ranchero high explosive pulsed power (HEPP) system to power cylindrically imploding solid-density liners for hydrodynamics experiments. The near-term goal is to conduct experiments in the regime pertinent to the Atlas Capacitor bank. That is, they will attempt to implode liners of {approximately}50 g mass at velocities approaching 15 km/sec. The basic building block of the HEPP system is a coaxial generator with a 304.8 mm diameter stator, and an initial armature diameter of 152 mm. The armature is expanded by a high explosive (HE) charge detonated simultaneously along its axis. They have reported a variety of experiments conducted with generator modules 43 cm long and have presented an initial design for hydrodynamic liner experiments. In this paper they give a synopsis of their first system test, and a status report on the development of a generator module that is 1.4 m long.

  8. RANCHERO explosive pulsed power experiments

    CERN Document Server

    Goforth, J H; Armijo, E V; Atchison, W L; Bartos, Yu; Clark, D A; Day, R D; Deninger, W J; Faehl, R J; Fowler, C M; García, F P; García, O F; Herrera, D H; Herrera, T J; Keinigs, R K; King, J C; Lindemuth, I R; López, E; Martínez, E C; Martínez, D; McGuire, J A; Morgan, D; Oona, H; Oro, D M; Parker, J V; Randolph, R B; Reinovsky, R E; Rodríguez, G; Stokes, J L; Sena, F C; Tabaka, L J; Tasker, D G; Taylor, A J; Torres, D T; Anderson, H D; Broste, W B; Johnson, J B; Kirbie, H C

    1999-01-01

    The authors are developing the RANCHERO high explosive pulsed power (HEPP) system to power cylindrically imploding solid-density liners for hydrodynamics experiments. Their near-term goal is to conduct experiments in the regime pertinent to the Atlas capacitor bank. That is, they will attempt to implode liners of ~50 g mass at velocities approaching 15 km/sec. The basic building block of the HEPP system is a coaxial generator with a 304.8 mm diameter stator, and an initial armature diameter of 152 mm. The armature is expanded by a high explosive (HE) charge detonated simultaneously along its axis. The authors have reported a variety of experiments conducted with generator modules 43 cm long and have presented an initial design for hydrodynamic liner experiments. In this paper, they give a synopsis of their first system test, and a status report on the development of a generator module that is 1.4 m long. (6 refs).

  9. A mitotic phosphorylation feedback network connects Cdk1, Plk1, 53BP1, and Chk2 to inactivate the G(2/M DNA damage checkpoint.

    Directory of Open Access Journals (Sweden)

    Marcel A T M van Vugt

    2010-01-01

    Full Text Available DNA damage checkpoints arrest cell cycle progression to facilitate DNA repair. The ability to survive genotoxic insults depends not only on the initiation of cell cycle checkpoints but also on checkpoint maintenance. While activation of DNA damage checkpoints has been studied extensively, molecular mechanisms involved in sustaining and ultimately inactivating cell cycle checkpoints are largely unknown. Here, we explored feedback mechanisms that control the maintenance and termination of checkpoint function by computationally identifying an evolutionary conserved mitotic phosphorylation network within the DNA damage response. We demonstrate that the non-enzymatic checkpoint adaptor protein 53BP1 is an in vivo target of the cell cycle kinases Cyclin-dependent kinase-1 and Polo-like kinase-1 (Plk1. We show that Plk1 binds 53BP1 during mitosis and that this interaction is required for proper inactivation of the DNA damage checkpoint. 53BP1 mutants that are unable to bind Plk1 fail to restart the cell cycle after ionizing radiation-mediated cell cycle arrest. Importantly, we show that Plk1 also phosphorylates the 53BP1-binding checkpoint kinase Chk2 to inactivate its FHA domain and inhibit its kinase activity in mammalian cells. Thus, a mitotic kinase-mediated negative feedback loop regulates the ATM-Chk2 branch of the DNA damage signaling network by phosphorylating conserved sites in 53BP1 and Chk2 to inactivate checkpoint signaling and control checkpoint duration.

  10. Explosives Removal from Munitions Wastewaters

    Science.gov (United States)

    1975-01-01

    Rohm and Haas Company, Philadelphia, Pa., 19105 2 Background Generally, pollation in munitions plant waste water stems from washing and steam cleaning...290131 EXPLOSIVES REMOVAL FROM MUNITIONS WST- WATERS B. W. STEVENS, R. P. MCDONNELL ROHM. AND HAAS CO?*ANY, PHILAD2ELPHIA, PENNSYLVANIA R. K. PXDREN...operations. Waste water from a typical TNT manufacturing J21 plant may contain from 40 to 120 ppm of TNT and lesser aimounts of 2,4, DNT. K. Waste

  11. Shell and explosive hydrogen burning

    CERN Document Server

    Boeltzig, A; Cavanna, F; Cristallo, S; Davinson, T; Depalo, R; deBoer, R J; Di Leva, A; Ferraro, F; Imbriani, G; Marigo, P; Terrasi, F; Wiescher, M

    2016-01-01

    The nucleosynthesis of light elements, from helium up to silicon, mainly occurs in Red Giant and Asymptotic Giant Branch stars and Novae. The relative abundances of the synthesized nuclides critically depend on the rates of the nuclear processes involved, often through non-trivial reaction chains, combined with complex mixing mechanisms. In this review, we summarize the contributions made by LUNA experiments in furthering our understanding of nuclear reaction rates necessary for modeling nucleosynthesis in AGB stars and Novae explosions.

  12. Nuclear Explosions 1945-1998

    Energy Technology Data Exchange (ETDEWEB)

    Bergkvist, Nils-Olov; Ferm, Ragnhild

    2000-07-01

    The main part of this report is a list of nuclear explosions conducted by the United States, the Soviet Union, the United Kingdom, France, China, India and Pakistan in 1945-98. The list includes all known nuclear test explosions and is compiled from a variety of sources including officially published information from the USA, Russia and France. The details given for each explosion (date, origin time, location, yield, type, etc.) are often compiled from more than one source because the individual sources do not give complete information. The report includes a short background to nuclear testing and provides brief information on the Comprehensive Nuclear-Test-Ban Treaty and the verification regime now being established to verify compliance with the treaty. It also summarizes nuclear testing country by country. The list should be used with some caution because its compilation from a variety of sources means that some of the data could be incorrect. This report is the result of cooperation between the Defence Research Establishment (FOA) and the Stockholm International Peace Research Institute (SIPRI)

  13. MOF phosphorylation by ATM regulates 53BP1-mediated DSB repair pathway choice

    Science.gov (United States)

    Gupta, Arun; Hunt, Clayton R.; Hegdec, Muralidhar L.; Chakraborty, Sharmistha; Udayakumar, Durga; Horikoshi, Nobuo; Singh1, Mayank; Ramnarain, Deepti B.; Hittelman, Walter N.; Namjoshi, Sarita; Asaithamby, Aroumougame; Hazra, Tapas K.; Ludwig, Thomas; Pandita, Raj K.; Tyler, Jessica K.; Pandita, Tej K.

    2014-01-01

    Cell cycle phase is a critical determinant of the choice between DNA damage repair by non-homologous end joining (NHEJ) or homologous recombination (HR). Here we report that DSBs induce ATM-dependent MOF (a histone H4 acetyl-transferase) phosphorylation (p-T392-MOF) and that phosphorylated MOF co-localizes with γ-H2AX, ATM, and 53BP1 foci. Mutation of the phosphorylation site (MOF-T392A) impedes DNA repair in S- and G2-phase but not G1-phase cells. Expression of MOF-T392A also reverses the reduction in DSB associated 53BP1 seen in wild type S/G2-phase cells, resulting in enhanced 53BP1 and reduced BRCA1 association. Decreased BRCA1 levels at DSB sites correlates with defective repairosome formation, reduced HR repair and decreased cell survival following irradiation. These data support a model whereby ATM mediated MOF-T392 phosphorylation modulates 53BP1 function to facilitate the subsequent recruitment of HR repair proteins, uncovering a regulatory role for MOF in DSB repair pathway choice during S/G2-phase. PMID:24953651

  14. MOF phosphorylation by ATM regulates 53BP1-mediated double-strand break repair pathway choice.

    Science.gov (United States)

    Gupta, Arun; Hunt, Clayton R; Hegde, Muralidhar L; Chakraborty, Sharmistha; Chakraborty, Sharmistha; Udayakumar, Durga; Horikoshi, Nobuo; Singh, Mayank; Ramnarain, Deepti B; Hittelman, Walter N; Namjoshi, Sarita; Asaithamby, Aroumougame; Hazra, Tapas K; Ludwig, Thomas; Pandita, Raj K; Tyler, Jessica K; Pandita, Tej K

    2014-07-10

    Cell-cycle phase is a critical determinant of the choice between DNA damage repair by nonhomologous end-joining (NHEJ) or homologous recombination (HR). Here, we report that double-strand breaks (DSBs) induce ATM-dependent MOF (a histone H4 acetyl-transferase) phosphorylation (p-T392-MOF) and that phosphorylated MOF colocalizes with γ-H2AX, ATM, and 53BP1 foci. Mutation of the phosphorylation site (MOF-T392A) impedes DNA repair in S and G2 phase but not G1 phase cells. Expression of MOF-T392A also blocks the reduction in DSB-associated 53BP1 seen in wild-type S/G2 phase cells, resulting in enhanced 53BP1 and reduced BRCA1 association. Decreased BRCA1 levels at DSB sites correlates with defective repairosome formation, reduced HR repair, and decreased cell survival following irradiation. These data support a model whereby ATM-mediated MOF-T392 phosphorylation modulates 53BP1 function to facilitate the subsequent recruitment of HR repair proteins, uncovering a regulatory role for MOF in DSB repair pathway choice during S/G2 phase. Copyright © 2014 The Authors. Published by Elsevier Inc. All rights reserved.

  15. Data base of chemical explosions in Kazakhstan

    Energy Technology Data Exchange (ETDEWEB)

    Demin, V.N. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Malahova, M.N. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Martysevich, P.N. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Mihaylova, N.N. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Nurmagambetov, A. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Kopnichev, Yu.F. D. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan); Edomin, V.I. [National Nuclear Center of Republic of Kazakhstan Institute of Geophysical Researches (Kazakhstan)

    1996-12-01

    Within the bounds of this report, the following works were done: (1) Information about explosion quarries, located in Southern, Eastern and Northern Kasakstan was summarized. (2) The general information about seismicity of areas of location of explosion quarries was adduced. (3) The system of observation and seismic apparatus, recording the local earthquakes and quarry explosions at the territory of Kazakstan were described. (4) Data base of quarry explosions, that were carried out in Southern, Eastern and Northern Kazakstan during 1995 and first half of 1996 year was adduced. (5) Upon the data of registration of explosions in Southern Kazakstan the correlative dependences between power class of explosions and summary weight of charge were constructed. (6) Seismic records of quarry explosions were adduced. It is necessary to note, that the collection of data about quarry explosions in Kazakstan in present time is very difficult task. Organizations, that makes these explosions, are always suffering reorganizations and sometimes it is actually impossible to receive all the necessary information. Some quarries are situated in remote, almost inaccessible regions, and within the bounds of supplier financing not the every quarry was in success to visit. So the present data base upon the chemical explosions for 1995 is not full and in further it`s expansion is possible.

  16. AcEST: BP921717 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000153_C10 427 Adiantum capillus-veneris mRNA. clone: YMU001_000153_C10. BP921717... CL2111Contig1 Show BP921717 Clone id YMU001_000153_C10 Library YMU01 Length 427 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000153_C10. Accession BP921717 Tissue type prothallium Developmental stag.... 25:3389-3402. Query= BP921717|Adiantum capillus-veneris mRNA, clone: YMU001_000... Expect = 4.1 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -1 Query: 172 LERRWKILILQHKVNQQTIRGW

  17. AcEST: BP917417 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_E10 489 Adiantum capillus-veneris mRNA. clone: YMU001_000100_E10. BP917417... CL856Contig1 Show BP917417 Clone id YMU001_000100_E10 Library YMU01 Length 489 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000100_E10. Accession BP917417 Tissue type prothallium Developmental stage...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917417...Positives = 30/52 (57%) Frame = -2 Query: 176 MLDRSKRPKVESKLLQKRPVCKVFLLALEAPVRKAREEYDQIMLAGKAALGE 21 ++DR+

  18. AcEST: BP917172 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_B10 520 Adiantum capillus-veneris mRNA. clone: YMU001_000097_B10. BP917172 - Show BP91717...is mRNA. clone: YMU001_000097_B10. Accession BP917172 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91717...a GN=At2g31440 PE=2 SV=2 Length = 250 Score = 30.8 bits (68), Expect = 4.0 Identities = 17/50 (34%), Positiv...169 G H FFC SL + T +V +VP+FLI ++A+ F+ I + Sbjct: 123 GHGVAHAVFFCLSLLTPAFGPATFYVERCSKVPFFLISAIIALAFVTIHT 172

  19. AcEST: BP917517 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_G11 472 Adiantum capillus-veneris mRNA. clone: YMU001_000101_G11. BP917517... CL2571Contig1 Show BP917517 Clone id YMU001_000101_G11 Library YMU01 Length 472 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000101_G11. Accession BP917517 Tissue type prothallium Developmental stag...ams, Nucleic Acids Res. 25:3389-3402. Query= BP917517|Adiantum capillus-veneris m...= +3 Query: 81 CAGCDLWACLCTM*NVLRRRREKLSLRPGNA 173 C GC W + + N+ R+RR+ + LRPG A S

  20. AcEST: BP917017 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000094_G05 462 Adiantum capillus-veneris mRNA. clone: YMU001_000094_G05. BP917017 - Show BP917017...is mRNA. clone: YMU001_000094_G05. Accession BP917017 Tissue type prothallium Developmental stage - Contig I...ds Res. 25:3389-3402. Query= BP917017|Adiantum capillus-veneris mRNA, clone: YMU0... Sbjct: 182 SALFGSPVYQNYGTIMAEQKFEPAGFKMSLGLKDTNLALAAAKRVSANLPLAELAKSHFE 241 Query: 226 MMIEKGDVEEDMEELLNC 17...AKGVLRSKVGAGTGVKFTPSLAFVLDKVPDAAREME 110 Query: 187 ELL 179 ELL Sbjct: 111 ELL 11

  1. AcEST: BP917173 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_B11 482 Adiantum capillus-veneris mRNA. clone: YMU001_000097_B11. BP91717...3 CL2027Contig1 Show BP917173 Clone id YMU001_000097_B11 Library YMU01 Length 482 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000097_B11. Accession BP917173 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91717...GVYGIIMAGWASNS 144 >sp|Q2RU33|NUOH_RHORT NADH-quinone oxidoreductase subunit H OS=Rhodospirillum rubrum (strain ATCC 1117

  2. AcEST: BP915150 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_B02 545 Adiantum capillus-veneris mRNA. clone: YMU001_000067_B02. BP915150 - Show BP91515...is mRNA. clone: YMU001_000067_B02. Accession BP915150 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP915150|Adiantum capillus-veneris mRNA, clone: YMU001_000067_B02. (...Sbjct: 395 RFERSDKSRLSHFLVQRALRNIELASFLRWYVAVELYDPAYAKRFYCTYEILEENMMKIA 454 Query: 15...YCTYEILEENMMKIA 452 Query: 159 FDDKG--GGEKLWQGLVRQNELTAQLCRIMRDIKNVKGGTQKKIEKLRQLLTG 7 G G K WQ LVRQ ELTAQLC

  3. AcEST: BP915156 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_B09 512 Adiantum capillus-veneris mRNA. clone: YMU001_000067_B09. BP915156 - Show BP91515...is mRNA. clone: YMU001_000067_B09. Accession BP915156 Tissue type prothallium Developmental stage - Contig I...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915156|Adiantum...uery: 262 CLAKVEDKDSLMVQDNSKLKNLWIQ-LHQKMKKVTRVNIISMDKHELD 402 C ++ +K +LM QDN +L IQ LHQK K I+SM+ + +D Sbjct: 15...50 CKNQLSEKQTLMEQDNIQLNERIIQLLHQKTKHEN--EILSMESNIID 1595 >sp|Q8G1D1|CTAA_BRUS

  4. AcEST: BP915158 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_B12 488 Adiantum capillus-veneris mRNA. clone: YMU001_000067_B12. BP91515...8 CL3728Contig1 Show BP915158 Clone id YMU001_000067_B12 Library YMU01 Length 488 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000067_B12. Accession BP915158 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91515...0.4 bits (67), Expect = 4.5 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +3 Query: 210 EIVVSSYF

  5. AcEST: BP915315 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000070_B02 522 Adiantum capillus-veneris mRNA. clone: YMU001_000070_B02. BP915315... CL2372Contig1 Show BP915315 Clone id YMU001_000070_B02 Library YMU01 Length 522 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000070_B02. Accession BP915315 Tissue type prothallium Developmental stag... Res. 25:3389-3402. Query= BP915315|Adiantum capillus-veneris mRNA, clone: YMU001_000070_B02. (493 letters) ...LQKMGYVPGKGLGKNAQGIVNPIEAKLRKGKGAVG--AYGSERTQ 198 Query: 315 XXXXXXXXXEIEGKSKEAKPKE-QLW----XXXXXXXXXXXKTADDL

  6. AcEST: BP911515 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000005_H02 466 Adiantum capillus-veneris mRNA. clone: YMU001_000005_H02. BP911515 - Show BP911515...is mRNA. clone: YMU001_000005_H02. Accession BP911515 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911515|Adia...5%), Positives = 34/79 (43%), Gaps = 1/79 (1%) Frame = -2 Query: 327 PGSRQLVLQVRTYWFFHLL*SNTDSILSFASGLTVTNSTINEMSATQL-ISTTKHIAYLR 15...MQTSMYWVFYFV----FNIPLFIFGVIKIGIRFSFRTIVYIGLQNGFHFAFAY 169 Query: 150 QPVLTPMQAFFSIILNSLH 94 PV+ P + FF + NSL

  7. AcEST: BP916874 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000093_A11 481 Adiantum capillus-veneris mRNA. clone: YMU001_000093_A11. BP91...llus-veneris mRNA. clone: YMU001_000093_A11. Accession BP916874 Tissue type prothallium Developmental stage ...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res....d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...6874 CL72Contig2 Show BP916874 Clone id YMU001_000093_A11 Library YMU01 Length 481 Definition Adiantum capi

  8. AcEST: BP913150 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_A09 583 Adiantum capillus-veneris mRNA. clone: YMU001_000027_A09. BP91...lus-veneris mRNA. clone: YMU001_000027_A09. Accession BP913150 Tissue type prothallium Developmental stage -...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913150|Adiantu

  9. AcEST: BP917862 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000106_E04 403 Adiantum capillus-veneris mRNA. clone: YMU001_000106_E04. BP91...lus-veneris mRNA. clone: YMU001_000106_E04. Accession BP917862 Tissue type prothallium Developmental stage -... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917862|Adiantum capi

  10. AcEST: BP913611 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000032_B11 511 Adiantum capillus-veneris mRNA. clone: YMU001_000032_B11. BP913611 - Show BP91...is mRNA. clone: YMU001_000032_B11. Accession BP913611 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91...(1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res.

  11. AcEST: BP913336 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_B05 557 Adiantum capillus-veneris mRNA. clone: YMU001_000029_B05. BP913336... CL848Contig1 Show BP913336 Clone id YMU001_000029_B05 Library YMU01 Length 557 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000029_B05. Accession BP913336 Tissue type prothallium Developmental stage...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913336|Adiantum capillus-veneris mRNA, clone:...: 217 PAKLGNESPLDAHMLNSPEALPSNQSRGISNSLSKSGANK 336 P+KL N S NS +P N ++L+ SGAN+ Sbjct: 1114 PSKLTNSSSTGTAGKNS

  12. AcEST: BP915911 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D06 571 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D06. BP9...llus-veneris mRNA. clone: YMU001_000079_D06. Accession BP915911 Tissue type prothallium Developmental stage ...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915911|Adi... Res. 25:3389-3402. Query= BP915911|Adiantum capillus-veneris mRNA, clone: YMU001...GLPGNCGVSVPYPISTSTDCSK 118 >tr|Q2PCB9|Q2PCB9_WHEAT Non-specific lipid-transfer protein OS=Triticum aestivum GN=ltp9

  13. AcEST: BP914798 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000063_A04 571 Adiantum capillus-veneris mRNA. clone: YMU001_000063_A04. BP9...llus-veneris mRNA. clone: YMU001_000063_A04. Accession BP914798 Tissue type prothallium Developmental stage ...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914798|Adiantum capillus... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9..._WHEAT Non-specific lipid-transfer protein OS=Triticum aestivum GN=ltp9.3d PE=3 SV=1 Length = 117 Score = 65

  14. AcEST: BP917008 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000094_F08 458 Adiantum capillus-veneris mRNA. clone: YMU001_000094_F08. BP9...llus-veneris mRNA. clone: YMU001_000094_F08. Accession BP917008 Tissue type prothallium Developmental stage ...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917008|Adiantum c...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9...S=Triticum aestivum GN=ltp9.3d PE=3 SV=1 Length = 117 Score = 65.5 bits (158), Ex

  15. AcEST: BP912545 [AcEST

    Lifescience Database Archive (English)

    Full Text Available aining protein 93 h... 30 4.4 sp|Q5R822|NUP93_PONAB Nuclear pore complex protein Nup9...YMU001_000020_B09 481 Adiantum capillus-veneris mRNA. clone: YMU001_000020_B09. BP9...12545 CL2794Contig1 Show BP912545 Clone id YMU001_000020_B09 Library YMU01 Length 481 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000020_B09. Accession BP912545 Tissue type prothallium Developmental stag...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912545|Adiantum capi

  16. AcEST: BP915496 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_C11 484 Adiantum capillus-veneris mRNA. clone: YMU001_000072_C11. BP9...llus-veneris mRNA. clone: YMU001_000072_C11. Accession BP915496 Tissue type prothallium Developmental stage ...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9...jct: 87 IPNLNPARAAGLPGNCGVSVPYPISTSTDCSK 118 >tr|Q2PCD9|Q2PCD9_WHEAT Non-specific lipid-transfer protein OS=

  17. AcEST: BP921040 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TPQPTAPPTVCPTGPPTVHPSERPTAGP 485 >sp|P50282|MMP9_RAT Matrix metalloproteinase-9 OS=Rattus norvegicus GN=Mmp9...YMU001_000144_H01 455 Adiantum capillus-veneris mRNA. clone: YMU001_000144_H01. BP9...21040 CL3804Contig1 Show BP921040 Clone id YMU001_000144_H01 Library YMU01 Length 455 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_H01. Accession BP921040 Tissue type prothallium Developmental stag..., Nucleic Acids Res. 25:3389-3402. Query= BP921040|Adiantum capillus-veneris mRNA

  18. AcEST: BP914847 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000063_E08 384 Adiantum capillus-veneris mRNA. clone: YMU001_000063_E08. BP9...llus-veneris mRNA. clone: YMU001_000063_E08. Accession BP914847 Tissue type prothallium Developmental stage ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914847|Adian...programs, Nucleic Acids Res. 25:3389-3402. Query= BP914847|Adiantum capillus-veneris mRNA, clone: YMU001_000...LACVVVLCMVVG------APLAQGTVTCGQVTGSLAPCINYL 44 >tr|Q2PCB9|Q2PCB9_WHEAT Non-specific lipid-transfer protein OS

  19. AcEST: BP918148 [AcEST

    Lifescience Database Archive (English)

    Full Text Available LWGLL-SGRGPGLSSGAGARRP 42 >sp|P35832|PTP99_DROME Tyrosine-protein phosphatase 99A OS=Drosophila melanogaster GN=Ptp9...YMU001_000110_B04 474 Adiantum capillus-veneris mRNA. clone: YMU001_000110_B04. BP9...18148 CL245Contig1 Show BP918148 Clone id YMU001_000110_B04 Library YMU01 Length 474 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000110_B04. Accession BP918148 Tissue type prothallium Developmental stage...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918148|Adi

  20. AcEST: BP916056 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000082_E08 455 Adiantum capillus-veneris mRNA. clone: YMU001_000082_E08. BP9...16056 CL3862Contig1 Show BP916056 Clone id YMU001_000082_E08 Library YMU01 Length 455 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000082_E08. Accession BP916056 Tissue type prothallium Developmental stag..._hit_id Q8W207 Definition sp|Q8W207|CSN2_ARATH COP9 signalosome complex subunit 2...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP916056|Adiantum capillus-ve

  1. AcEST: BP914926 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000064_E01 464 Adiantum capillus-veneris mRNA. clone: YMU001_000064_E01. BP9...14926 CL155Contig1 Show BP914926 Clone id YMU001_000064_E01 Library YMU01 Length 464 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000064_E01. Accession BP914926 Tissue type prothallium Developmental stage...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914926|Adiantum capillus-... transport protein sec31 OS=Aspergi... 30 6.7 sp|P50282|MMP9_RAT Matrix metallopr

  2. AcEST: BP912205 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D02 475 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D02. BP91220...5 CL3776Contig1 Show BP912205 Clone id YMU001_000016_D02 Library YMU01 Length 475 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D02. Accession BP912205 Tissue type prothallium Developmental stag...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912205|Adiantum capi...peat-containing protein 3 OS=Homo sapi... 38 0.020 sp|Q12220|UTP12_YEAST U3 small

  3. AcEST: BP912208 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D05 388 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D05. BP91220...8 CL129Contig1 Show BP912208 Clone id YMU001_000016_D05 Library YMU01 Length 388 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000016_D05. Accession BP912208 Tissue type prothallium Developmental stage...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912208|Adiantu...EFDVVLEEVPADKKIAVLKVVRGITGLGLKEAKDLVEAAPKPIKEGVSKDDAEAAK 115 Query: 182 KQLEAAGAKCSVK 220 K+LE AGAK SVK Sbjc

  4. Material procedure quality forecast based on genetic BP neural network

    Science.gov (United States)

    Zheng, Bao-Hua

    2017-07-01

    Material procedure quality forecast plays an important role in quality control. This paper proposes a prediction model based on genetic algorithm (GA) and back propagation (BP) neural network. It can obtain the initial weights and thresholds of optimized BP neural network with the GA global search ability. A material process quality prediction model with the optimized BP neural network is adopted to predict the error of future process to measure the accuracy of process quality. The results show that the proposed method has the advantages of high accuracy and fast convergence rate compared with BP neural network.

  5. AcEST: BP919975 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_E02 472 Adiantum capillus-veneris mRNA. clone: YMU001_000131_E02. BP919975 - Show BP91997...is mRNA. clone: YMU001_000131_E02. Accession BP919975 Tissue type prothallium Developmental stage - Contig I..., Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997...ids Res. 25:3389-3402. Query= BP919975|Adiantum capillus-veneris mRNA, clone: YMU...l, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997

  6. AcEST: BP919972 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_D11 515 Adiantum capillus-veneris mRNA. clone: YMU001_000131_D11. BP919972 - Show BP91997...is mRNA. clone: YMU001_000131_D11. Accession BP919972 Tissue type prothallium Developmental stage - Contig I...Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91997...ller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of

  7. AcEST: BP919973 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_D12 529 Adiantum capillus-veneris mRNA. clone: YMU001_000131_D12. BP919973 - Show BP91997...is mRNA. clone: YMU001_000131_D12. Accession BP919973 Tissue type prothallium Developmental stage - Contig I...inghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new genera...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91997...phen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997

  8. AcEST: BP911997 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_G12 569 Adiantum capillus-veneris mRNA. clone: YMU001_000011_G12. BP911997 - Show BP911997...is mRNA. clone: YMU001_000011_G12. Accession BP911997 Tissue type prothallium Developmental stage - Contig I...tephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP911997|Adiantum capillus-veneris mRNA, clone: YMU001... Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PS

  9. AcEST: BP919970 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_D07 518 Adiantum capillus-veneris mRNA. clone: YMU001_000131_D07. BP91997...0 CL642Contig1 Show BP919970 Clone id YMU001_000131_D07 Library YMU01 Length 518 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000131_D07. Accession BP919970 Tissue type prothallium Developmental stage... Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new gene...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91997

  10. AcEST: BP919979 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_E07 479 Adiantum capillus-veneris mRNA. clone: YMU001_000131_E07. BP919979 - Show BP91997...is mRNA. clone: YMU001_000131_E07. Accession BP919979 Tissue type prothallium Developmental stage - Contig I...er, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new g...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91997...en F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997

  11. AcEST: BP919974 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_E01 417 Adiantum capillus-veneris mRNA. clone: YMU001_000131_E01. BP91997...4 CL205Contig1 Show BP919974 Clone id YMU001_000131_E01 Library YMU01 Length 417 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000131_E01. Accession BP919974 Tissue type prothallium Developmental stage...tephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997... Res. 25:3389-3402. Query= BP919974|Adiantum capillus-veneris mRNA, clone: YMU001

  12. AcEST: BP919977 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_E04 495 Adiantum capillus-veneris mRNA. clone: YMU001_000131_E04. BP919977 - Show BP91997...is mRNA. clone: YMU001_000131_E04. Accession BP919977 Tissue type prothallium Developmental stage - Contig I...ng, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of pr...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919977|...den, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997

  13. AcEST: BP919971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_D09 312 Adiantum capillus-veneris mRNA. clone: YMU001_000131_D09. BP919971 - Show BP91997...is mRNA. clone: YMU001_000131_D09. Accession BP919971 Tissue type prothallium Developmental stage - Contig I... Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of prote...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919971|Adiantum capillus-veneris mRNA...affer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gappe

  14. AcEST: BP920720 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000140_F08 378 Adiantum capillus-veneris mRNA. clone: YMU001_000140_F08. BP920720... CL2798Contig1 Show BP920720 Clone id YMU001_000140_F08 Library YMU01 Length 378 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000140_F08. Accession BP920720 Tissue type prothallium Developmental stag...ort BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Ji...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920720|Adiantum capillus-

  15. AcEST: BP920120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C05 434 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C05. BP920120 - Show BP920120...is mRNA. clone: YMU001_000133_C05. Accession BP920120 Tissue type prothallium Developmental stage - Contig I... E-value 1.5 Report BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920120|Ad...%), Positives = 26/48 (54%) Frame = +1 Query: 208 NPSPKISQKLMQILTKQSCRLQNKLQRIPLK

  16. AcEST: BP918439 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E06 535 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E06. BP9184...39 CL1216Contig1 Show BP918439 Clone id YMU001_000113_E06 Library YMU01 Length 535 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_E06. Accession BP918439 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918439|Adiantum capillus-veneris mRNA,...A Trafficking protein particle complex subunit 5 OS=Plasmodium falciparum PE=3 SV=1 Length = 184 Score = 81.

  17. AcEST: BP918438 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E05 620 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E05. BP918438 - Show BP9184...is mRNA. clone: YMU001_000113_E05. Accession BP918438 Tissue type prothallium Developmental stage - Contig I... Res. 25:3389-3402. Query= BP918438|Adiantum capillus-veneris mRNA, clone: YMU001_000113_E05. (620 letters) ...jct: 125 MMNSGISPDKYTFPFGLSACAKSRAKGNGIQIHGLIVKMGYAKDLFVQNSLVHFYAECGE 184 Query: ...LVKGLEPDEFSVTTALTACAQVGALAQGK 238 Query: 184 QHFENMINHGIVPTVEHV-NCLSELLSRSGCLKEAEKILQSMPASGDVAGWVSLLTACKA 8

  18. AcEST: BP918404 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B04 576 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B04. BP9184...04 CL3745Contig1 Show BP918404 Clone id YMU001_000113_B04 Library YMU01 Length 576 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_B04. Accession BP918404 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918404|Adiantum capillus-v...(39%), Gaps = 4/151 (2%) Frame = +2 Query: 5 QQDRSTIQQPHKASHSQRLKQKN*TLKNFLKVCETDLMTLPIAAGTYIRKSSLCFQPSYN 184

  19. AcEST: BP921843 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_G09 483 Adiantum capillus-veneris mRNA. clone: YMU001_000154_G09. BP921843 - Show BP92184...is mRNA. clone: YMU001_000154_G09. Accession BP921843 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP921843|Adiantum capillus-veneris mRNA, clone: YMU001_000...RLDEAEQLALKGGKK---QIQKLETRIRELEFELEGEQKRNTESVKGLRK 1843 Query: 190 REAELSDLKASQDELVDSIVSCRQCMDKLRMEAVSYKR 30...3 E + +L +E +++ + +DKL+++ SYKR Sbjct: 1844 YERRVKELTYQSEEDRKNVLRLQDLVDKLQVKVKSYKR 1881 >sp|P13541|MYH3_MOUSE

  20. AcEST: BP918456 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_F11 456 Adiantum capillus-veneris mRNA. clone: YMU001_000113_F11. BP9184...56 CL2911Contig1 Show BP918456 Clone id YMU001_000113_F11 Library YMU01 Length 456 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_F11. Accession BP918456 Tissue type prothallium Developmental stag...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918456|Adiantum c...2 +EI+ ++DSDPRAAYFRQA+ G+YIRMA Sbjct: 2184 NEISREIDSDPRAAYFRQAEYGMYIRMA 2211 TrEMBL (release 39.9) Link to B

  1. AcEST: BP918499 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000114_C01 514 Adiantum capillus-veneris mRNA. clone: YMU001_000114_C01. BP9184...99 CL2926Contig1 Show BP918499 Clone id YMU001_000114_C01 Library YMU01 Length 514 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000114_C01. Accession BP918499 Tissue type prothallium Developmental stag...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2...es. 25:3389-3402. Query= BP918499|Adiantum capillus-veneris mRNA, clone: YMU001_0

  2. AcEST: BP918436 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E02 514 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E02. BP918436 - Show BP9184...is mRNA. clone: YMU001_000113_E02. Accession BP918436 Tissue type prothallium Developmental stage - Contig I...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184... + Sbjct: 1782 EVLPIKIKLDYKPKRVDYNLLRQGKTIELMNFFHFEGSEMVLRHVTLRGINGWARLFDTL 1841 ... EQY +D R+L+G+++GA Sbjct: 1842 NDIWTPDVKANQLADFLSGLGPIRSLVNVGAGLADLVLLPIEQYHKD-GRVLRGVQRGAA 1900 Query: 147

  3. AcEST: BP920204 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_C07 410 Adiantum capillus-veneris mRNA. clone: YMU001_000134_C07. BP92020...4 CL2814Contig1 Show BP920204 Clone id YMU001_000134_C07 Library YMU01 Length 410 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000134_C07. Accession BP920204 Tissue type prothallium Developmental stag...port BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, J...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920204|Adiantum capillus

  4. AcEST: BP919980 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_E08 500 Adiantum capillus-veneris mRNA. clone: YMU001_000131_E08. BP91998...0 CL344Contig1 Show BP919980 Clone id YMU001_000131_E08 Library YMU01 Length 500 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000131_E08. Accession BP919980 Tissue type prothallium Developmental stage...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91998...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2

  5. AcEST: BP913636 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000032_E04 520 Adiantum capillus-veneris mRNA. clone: YMU001_000032_E04. BP913636... CL2643Contig1 Show BP913636 Clone id YMU001_000032_E04 Library YMU01 Length 520 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000032_E04. Accession BP913636 Tissue type prothallium Developmental stag...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP913636|Adiantum capillus-veneris mRNA, clone: YMU001_00003...tative phospholipid-transporting ATPase ... 149 8e-36 sp|Q9LNQ4|ALA4_ARATH Putati

  6. AcEST: BP916400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_C07 530 Adiantum capillus-veneris mRNA. clone: YMU001_000087_C07. BP916400... CL3635Contig1 Show BP916400 Clone id YMU001_000087_C07 Library YMU01 Length 530 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_C07. Accession BP916400 Tissue type prothallium Developmental stag...programs, Nucleic Acids Res. 25:3389-3402. Query= BP916400|Adiantum capillus-vene...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25

  7. AcEST: BP913400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_G11 552 Adiantum capillus-veneris mRNA. clone: YMU001_000029_G11. BP913400... CL2174Contig1 Show BP913400 Clone id YMU001_000029_G11 Library YMU01 Length 552 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000029_G11. Accession BP913400 Tissue type prothallium Developmental stag...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913400...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25

  8. AcEST: BP914008 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G11 577 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G11. BP91400...8 CL685Contig1 Show BP914008 Clone id YMU001_000038_G11 Library YMU01 Length 577 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000038_G11. Accession BP914008 Tissue type prothallium Developmental stage...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91400...3.6 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +2 Query: 287 ISADMIKGTWCKQFFNRMQQLRTFSYQGTLFSNLLLSI 400

  9. AcEST: BP912014 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A08 480 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A08. BP912014... CL2421Contig1 Show BP912014 Clone id YMU001_000012_A08 Library YMU01 Length 480 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A08. Accession BP912014 Tissue type prothallium Developmental stag...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912014...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25

  10. AcEST: BP921721 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000153_D02 435 Adiantum capillus-veneris mRNA. clone: YMU001_000153_D02. BP921721... CL638Contig1 Show BP921721 Clone id YMU001_000153_D02 Library YMU01 Length 435 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000153_D02. Accession BP921721 Tissue type prothallium Developmental stage...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP921721|Adiantum capillus-ve...us GN=Papss2 PE=1 SV=1 Length = 621 Score = 112 bits (279), Expect = 9e-25 Identities = 55/119 (46%), Positi

  11. AcEST: BP921217 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B03 574 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B03. BP921217 - Show BP92121...is mRNA. clone: YMU001_000147_B03. Accession BP921217 Tissue type prothallium Developmental stage - Contig I...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92121...containing protei... 100 5e-21 sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-con...... 89 2e-17 sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protei...

  12. AcEST: BP912222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_E10 453 Adiantum capillus-veneris mRNA. clone: YMU001_000016_E10. BP912222 - Show BP912222...is mRNA. clone: YMU001_000016_E10. Accession BP912222 Tissue type prothallium Developmental stage - Contig I...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912222... bits (68), Expect = 2.9 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Frame = -1 Quer...= 14/58 (24%), Positives = 26/58 (44%) Frame = -1 Query: 228 NAGILHRNHLYSSIFFHKDTTYMPISIRVHGDLLFLYVVLRETTFLC

  13. Estimation of body exposure to explosion.

    Science.gov (United States)

    Oliver, William R; Baker, Andrew M; Powell, James D; Cotone, Chris M; Meeker, Jeffrey

    2002-09-01

    An ordnance-disposal expert was killed while disposing of a cache of explosives. The likely position of the body was reconstructed by modeling the explosion as an omnidirectional emission of particles from a model of the explosion site and noting the distribution of particles on a model of a human. The applications and limitations of this method in reconstructing the events and correlation with the injuries noted at autopsy are discussed.

  14. 75 FR 70291 - Commerce in Explosives; List of Explosive Materials (2010R-27T)

    Science.gov (United States)

    2010-11-17

    ... hydrocarbons. Explosive organic nitrate mixtures. Explosive powders. F Flash powder. Fulminate of mercury. Fulminate of silver. Fulminating gold. Fulminating mercury. Fulminating platinum. Fulminating silver. G... fulminate. Mercury oxalate. Mercury tartrate. Metriol trinitrate. Minol-2 . MMAN ; methylamine nitrate...

  15. 77 FR 58410 - Commerce in Explosives; List of Explosive Materials (2012R-10T)

    Science.gov (United States)

    2012-09-20

    ... hydrocarbons. Explosive organic nitrate mixtures. Explosive powders. F Flash powder. ] Fulminate of mercury. Fulminate of silver. Fulminating gold. Fulminating mercury. Fulminating platinum. Fulminating silver. G... fulminate. Mercury oxalate. Mercury tartrate. Metriol trinitrate. Minol-2 . MMAN ; methylamine nitrate...

  16. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    Energy Technology Data Exchange (ETDEWEB)

    Gago-Ferrero, Pablo, E-mail: pablo.gago@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Badia-Fabregat, Marina, E-mail: marina.badia@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Olivares, Alba, E-mail: esalba.olivares@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Pina, Benjamin, E-mail: benjami.pina@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Blanquez, Paqui, E-mail: paqui.blanquez@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Vicent, Teresa, E-mail: teresa.vicent@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Caminal, Gloria, E-mail: gloria.caminal@uab.cat [Unitat de Biocatalisi Aplicada associada al IQAC (CSIC-UAB). Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Diaz-Cruz, M. Silvia, E-mail: silvia.diaz@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); and others

    2012-06-15

    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: Black-Right-Pointing-Pointer Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. Black-Right-Pointing-Pointer BP3 is not degraded under simulated sunlight. Black-Right-Pointing-Pointer Glycoconjugates have been identified as the main intermediate metabolites. Black-Right-Pointing-Pointer Decrease in endocrine activity

  17. High Explosives Research and Development (HERD) Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The purpose is to provide high explosive formulation, chemical analysis, safety and performance testing, processing, X-ray, quality control and loading support for...

  18. Explosives detection technology for commercial aviation security

    Science.gov (United States)

    Schafrik, Robert E.

    1994-03-01

    The threat posed to commercial aviation by small, concealed plastic explosives is particularly onerous. Small amounts of these highly energetic explosives are difficult to reliably detect using current technologies. But they can cause significant damage to an aircraft that can result in the destruction of the aircraft, resulting in loss of life. The key issues regarding explosive detection technologies include: What methods can detect plastic explosives? How do these methods perform in practice? How can the different methods be best employed to counter the terrorist threat?

  19. Theoretical basis of explosion effects using al - granules in bulk explosives

    OpenAIRE

    Dambov, Risto; Nikolic, Miroslav; Dambov, Ilija; Cacarov, Vladimir

    2013-01-01

    Use of bulk explosives such as AN-FO, heavy AN-FO, SLLURY and various Emulsions significantly improves explosive energy efficiency in the rock massif. Many operating engineers have the opportunity to examine and modify the technical characteristics of explosives and technologists especially, in the production of explosives where the main goal is improvement, the energy capacity by adding various components. The question is when is technically and economically most suitable to use ...

  20. Explosive transition in amorphous microwire

    Science.gov (United States)

    Borisenko, I. Yu.; Tulin, V. A.

    2017-11-01

    An amorphous microwire in a glass shell offers a quick thermal response and can be rapidly heated to the crystallization point. When heated by a current pulse with a small amplitude and duration, the wire passes from the amorphous to microcrystalline state. The crystallization of the amorphous state may represent a slow or explosive process depending on the parameters of the pulse. In the latter case, the emission of electromagnetic waves (flash of light) and a sharp rise in the resistance are observed. The rate of propagation of the crystallization front in our experiments has been found to be about 1 m/s.