WorldWideScience

Sample records for bp explosive cycle

  1. Application of genetic BP network to discriminating earthquakes and explosions

    Institute of Scientific and Technical Information of China (English)

    边银菊

    2002-01-01

    In this paper, we develop GA-BP algorithm by combining genetic algorithm (GA) with back propagation (BP) algorithm and establish genetic BP neural network. We also applied BP neural network based on BP algorithm and genetic BP neural network based on GA-BP algorithm to discriminate earthquakes and explosions. The obtained result shows that the discriminating performance of genetic BP network is slightly better than that of BP network.

  2. Research on safety assessment of gas explosion hazard in heading face based on BP neural network

    Institute of Scientific and Technical Information of China (English)

    TIAN Shui-cheng; ZHU Li-jun; CHEN Yong-gang; WANG Li

    2005-01-01

    According to hazard theory and the principle of selecting assessment index,combining the causes and mechanism of gas explosion, established assessment index system of gas explosion in heading face. Based on the method of gray clustering, principle of BP neural network and characters of gas explosion in heading face, safety assessment procedural diagram of BP neural network on gas explosion hazard in heading face is designed. Meanwhile, concrete heading face of the gas explosion hazard is assessed by safety assessment method of BP neural network and grades of comprehensive safety assessment are got. The static and dynamic safety assessment can be achieved by this method. It is practical to improve safety management and to develop safety assessment technology in coalmine.

  3. The risk evaluation of mine coal-dust explosion based on BP neural network

    Institute of Scientific and Technical Information of China (English)

    CHEN Lian-jun; CHENG Wei-min

    2007-01-01

    Introduced the theory of three types of hazardous sources, and it recognized and analysed such three types of hazardous sources as the factor of inherent hazardous source, factor of inducing hazardous source and factor of men, which affect the safety and reliability of coal-dust explosion risk system and then builds up the risk factor indices of coal-dust explosion according to analysis of conditions inducing the coal-dust explosion. It fixes the risk degree of coal-dust explosion risk system by analyzing loss probability and loss scope of risk system and by means of the probabilistic hazard evaluation method and risk matrix method, etc.. According to the feature of strong capability of nonlinear approximation of BP neural network, the paper designed the structure of BP neural network for the risk evaluation of the mine coal-dust explosion with BP neural network. And the weight of the network was finally determined by training the given samples so that the risk degree of samples to be measured could be exactly evaluated and the risk of mine coal-dust explosion could be alarmed in good time.

  4. Optimum performance of explosives in a quasistatic detonation cycle

    Science.gov (United States)

    Baker, Ernest L.; Stiel, Leonard I.

    2017-01-01

    Analyses were conducted on the behavior of explosives in a quasistatic detonation cycle. This type of cycle has been proposed for the determination of the maximum work that can be performed by the explosive. The Jaguar thermochemical equilibrium program enabled the direct analyses of explosive performance at the various steps in the detonation cycle. In all cases the explosive is initially detonated to a point on the Hugoniot curve for the reaction products. The maximum useful work that can be obtained from the explosive is equal to the P-V work on the isentrope for expansion after detonation to atmospheric pressure, minus one-half the square of the particle velocity at the detonation point. This quantity is calculated form the internal energy of the explosive at the initial and final atmospheric temperatures. Cycle efficiencies (net work/ heat added) are also calculated with these procedures. For several explosives including TNT, RDX, and aluminized compositions, maximum work effects were established through the Jaguar calculations for Hugoniot points corresponding to C-J, overdriven, underdriven and constant volume detonations. Detonation to the C-J point is found to result in the maximum net work in all cases.

  5. The historical (218 ± 14 aBP) explosive eruption of Tutupaca volcano (Southern Peru)

    Science.gov (United States)

    Samaniego, Pablo; Valderrama, Patricio; Mariño, Jersy; van Wyk de Vries, Benjamín; Roche, Olivier; Manrique, Nélida; Chédeville, Corentin; Liorzou, Céline; Fidel, Lionel; Malnati, Judicaëlle

    2015-06-01

    The little known Tutupaca volcano (17° 01' S, 70° 21' W), located at the southern end of the Peruvian arc, is a dacitic dome complex that experienced a large explosive eruption during historical times. Based on historic chronicles and our radiometric data, this eruption occurred 218 ± 14 aBP, probably between 1787 and 1802 AD. This eruption was characterised by a large sector collapse that triggered a small debris avalanche (<1 km3) and an associated pyroclastic eruption whose bulk volume was 6.5-7.5 × 107 m3. Both units were emplaced synchronously and spread onto the plain situated to the northeast of Tutupaca volcano. The spatial and temporal relationship between the debris avalanche and the pyroclastic density current deposits, coupled with the petrological similarity between the juvenile fragments in the debris avalanche, the pyroclastic density current deposits and the pre-avalanche domes, indicates that juvenile magma was involved in the sector collapse. Large amounts of hydrothermally altered material are also found in the avalanche deposit. Thus, the ascent of a dacitic magma, coupled with the fact that the Tutupaca dome complex was constructed on top of an older, altered volcanic sequence, probably induced the destabilisation of the hydrothermally active edifice, producing the debris avalanche and its related pyroclastic density currents. This eruption probably represents the youngest debris avalanche in the Andes and was accompanied by one of the larger explosive events to have occurred in Southern Peru during historical times.

  6. SCYL1-BP1 affects cell cycle arrest in human hepatocellular carcinoma cells via Cyclin F and RRM2.

    Science.gov (United States)

    Wang, Yang; Zhi, Qiaoming; Ye, Qin; Zhou, Chengyuan; Zhang, Lei; Yan, Wei; Wu, Qun; Zhang, Di; Li, Pu; Huo, Keke

    2016-01-01

    The cell cycle is regulated via important biological mechanisms. Controlled expression of cell cycle regulatory proteins is crucial to maintain cell cycle progression. However, unbalanced protein expression leads to many diseases, such as cancer. Previous research suggests that SCYL1-BP1 function might be related to cell cycle progression and SCYL1-BP1 dysfunction to diseases through undefined mechanisms. In this research, an unbiased yeast two-hybrid screen was used to find protein(s) with potential biological relevance to SCYL1-BP1 function, and a novel interaction was recognized between SCYL1-BP1 and Cyclin F. This interaction was chosen as a paradigm to study SCYL1-BP1 function in cell cycle progression and its possible role in tumorigenesis. We found that SCYL1-BP1 binds to Cyclin F both in vivo and in vitro. SCYL1-BP1 overexpression promoted expression of the CCNF gene and simultaneously delayed Cyclin F protein degradation. SCYL1-BP1 knockdown reduced the expression of endogenous Cyclin F. It was also demonstrated in functional assays that SCYL1-BP1 overexpression induces G2/M arrest in cultured liver cells. Furthermore, SCYL1-BP1 sustained RRM2 protein expression by reducing its ubiquitination. Thus, we propose that SCYL1- BP1 affects the cell cycle through increasing steady state levels of Cyclin F and RRM2 proteins, thus constituting a dual regulatory circuit. This study provides a possible mechanism for SCYL1-BP1-mediated cell cycle regulation and related diseases.

  7. Grain-size cycles in Salawusu River valley since 150 ka BP

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The palaeo-mobile dune sands and fluvio-lacustrine facies with palaeosols in Milanggouwan stratigraphic section of the Salawusu River valley situated at the southeast of the Mu Us Desert experienced abundant remarkable alternative changes of coarse and fine rhythms in grainsize since 150 ka BP, and the grain-size parameters - Mz, σ, Sk, Kg and SC/I also respond to the situation of multi-fluctuational alternations between peak and valley values. Simultaneity the grainsize eigenvalues - Ф5, Ф16, P25, Ф50, Ф75, Ф84 and Ф95 are respondingly manifested as greatly cadent jumpiness. Hereby, the Milanggouwan section can be divided into 27 grain-size coarse and fine sedimentary cycles, which can be regarded as a real and integreted record of climate-geological process of desert vicissitude resulted from the alternative evolvement of the ancient winter and summer monsoons of East Asia since 150 ka BP.

  8. Sedimentary cycles of trace elements in Salawusu River Valley since 150 ka BP

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The paper makes some analyses on 11 trace elements in the Milanggouwan stratigraphical section in the Salawusu River valley, which is regarded as a prototype geology-palaeoclimate record since 150 ka BP. The results show that the content and variation of trace elements has experienced remarkably regular changes in the pace with coarse and fine sedimentary cycles of palaeo-aeolian sands to its overlying fluvio-lacustrine facies or/and palaeosols. The trace elements with chemical properties of relatively active (V, Sr, Cu, Ni, As) and relatively stable (P, Pb, Rb, Mn, Nb, Zr) are a manifestation of the corresponding 27 changeable cycles between peak and valley values, appearing a multi-fluctuational process line of relative gathering and migration since then. The low numerical value distribution of these two types of trace elements in the aeolian sand facies represents erosion and accumulation under wind force during the cold-dry climate. Whereas their enrichments in both fluvio-lacustrine facies and palaeosols are related to the valley's special low-lying physiognomic position between the Ordos Plateau and the Loess Plateau under the warm and humid climate conditions. The above relatively migrated and gathered change of the trace elements is the result of 27 climatic cycles of cold-dry and warm-humid, which is probably caused by repeated alternations of winter monsoon and summer monsoon in the Mu Us Sandy Land influenced by the climate vicissitudes in northern hemisphere during glacial and interglacial periods since 150 ka BP.

  9. Explosion of limit cycles and chaotic waves in a simple nonlinear chemical system

    DEFF Research Database (Denmark)

    Brøns, Morten; Sturis, Jeppe

    2001-01-01

    A model of an autocatalytic chemical reaction was employed to study the explosion of limit cycles and chaotic waves in a nonlinear chemical system. The bifurcation point was determined using asymptotic analysis and perturbations. Scaling laws for amplitude and period were derived. A strong...

  10. Canard explosion of limit cycles in templator models of self-replication mechanisms

    DEFF Research Database (Denmark)

    Brøns, Morten

    2011-01-01

    Templators are differential equation models for self-replicating chemical systems. Beutel and Peacock-López [J. Chem. Phys. 126, 125104 (2007)]10.1063/1.2716396 have numerically analyzed a model for a cross-catalytic self-replicating system and found two cases of canard explosion, that is......, a substantial change of amplitude of a limit cycle over a very short parameter interval. We show how the model can be reduced to a two-dimensional system and how canard theory for slow-fast equations can be applied to yield analytic information about the canard explosion. In particular, simple expressions...... for the parameter value where the canard explosion occurs are obtained. The connection to mixed-mode oscillations also observed in the model is briefly discussed. © 2011 American Institute of Physics....

  11. Ionization and Coulomb explosion of Xenon clusters by intense, few-cycle laser pulses

    CERN Document Server

    Mathur, D

    2010-01-01

    Intense, ultrashort pulses of 800 nm laser light (12 fs, $\\sim$4 optical cycles) of peak intensity 5$\\times$10$^{14}$ W cm$^{-2}$ have been used to irradiate gas-phase Xe$_n$ clusters ($n$=500-25,000) so as to induce multiple ionization and subsequent Coulomb explosion. Energy distributions of exploding ions are measured in the few-cycle domain that does not allow sufficient time for the cluster to undergo Coulomb-driven expansion. This results in overall dynamics that appear to be significantly different to those in the many-cycle regime. One manifestation is that the maximum ion energies are measured to be much lower than those obtained when longer pulses of the same intensity are used. Ion yields are cluster-size independent but polarization dependent in that they are significantly larger when the polarization is perpendicular to the detection axis than along it. This unexpected behavior is qualitatively rationalized in terms of a spatially anisotropic shielding effect induced by the electronic charge clou...

  12. Cycles of explosive and effusive eruptions at Kīlauea Volcano, Hawai‘i

    Science.gov (United States)

    Swanson, Don; Rose, Timothy R.; Mucek, Adonara E; Garcia, Michael O.; Fiske, Richard S.; Mastin, Larry G.

    2014-01-01

    The subaerial eruptive activity at Kīlauea Volcano (Hawai‘i) for the past 2500 yr can be divided into 3 dominantly effusive and 2 dominantly explosive periods, each lasting several centuries. The prevailing style of eruption for 60% of this time was explosive, manifested by repeated phreatic and phreatomagmatic activity in a deep summit caldera. During dominantly explosive periods, the magma supply rate to the shallow storage volume beneath the summit dropped to only a few percent of that during mainly effusive periods. The frequency and duration of explosive activity are contrary to the popular impression that Kīlauea is almost unceasingly effusive. Explosive activity apparently correlates with the presence of a caldera intersecting the water table. The decrease in magma supply rate may result in caldera collapse, because erupted or intruded magma is not replaced. Glasses with unusually high MgO, TiO2, and K2O compositions occur only in explosive tephra (and one related lava flow) and are consistent with disruption of the shallow reservoir complex during caldera formation. Kīlauea is a complex, modulated system in which melting rate, supply rate, conduit stability (in both mantle and crust), reservoir geometry, water table, and many other factors interact with one another. The hazards associated with explosive activity at Kīlauea’s summit would have major impact on local society if a future dominantly explosive period were to last several centuries. The association of lowered magma supply, caldera formation, and explosive activity might characterize other basaltic volcanoes, but has not been recognized.

  13. Transcriptional repressor E4-binding protein 4 (E4BP4) regulates metabolic hormone fibroblast growth factor 21 (FGF21) during circadian cycles and feeding.

    Science.gov (United States)

    Tong, Xin; Muchnik, Marina; Chen, Zheng; Patel, Manish; Wu, Nan; Joshi, Shree; Rui, Liangyou; Lazar, Mitchell A; Yin, Lei

    2010-11-19

    Fibroblast growth factor 21 (FGF21) is a potent antidiabetic and triglyceride-lowering hormone whose hepatic expression is highly responsive to food intake. FGF21 induction in the adaptive response to fasting has been well studied, but the molecular mechanism responsible for feeding-induced repression remains unknown. In this study, we demonstrate a novel link between FGF21 and a key circadian output protein, E4BP4. Expression of Fgf21 displays a circadian rhythm, which peaks during the fasting phase and is anti-phase to E4bp4, which is elevated during feeding periods. E4BP4 strongly suppresses Fgf21 transcription by binding to a D-box element in the distal promoter region. Depletion of E4BP4 in synchronized Hepa1c1c-7 liver cells augments the amplitude of Fgf21 expression, and overexpression of E4BP4 represses FGF21 secretion from primary mouse hepatocytes. Mimicking feeding effects, insulin significantly increases E4BP4 expression and binding to the Fgf21 promoter through AKT activation. Thus, E4BP4 is a novel insulin-responsive repressor of FGF21 expression during circadian cycles and feeding.

  14. C-terminal binding protein (CtBP activates the expression of E-box clock genes with CLOCK/CYCLE in Drosophila.

    Directory of Open Access Journals (Sweden)

    Taichi Q Itoh

    Full Text Available In Drosophila, CLOCK/CYCLE heterodimer (CLK/CYC is the primary activator of circadian clock genes that contain the E-box sequence in their promoter regions (hereafter referred to as "E-box clock genes". Although extensive studies have investigated the feedback regulation of clock genes, little is known regarding other factors acting with CLK/CYC. Here we show that Drosophila C-terminal binding protein (dCtBP, a transcriptional co-factor, is involved in the regulation of the E-box clock genes. In vivo overexpression of dCtBP in clock cells lengthened or abolished circadian locomotor rhythm with up-regulation of a subset of the E-box clock genes, period (per, vrille (vri, and PAR domain protein 1ε (Pdp1ε. Co-expression of dCtBP with CLK in vitro also increased the promoter activity of per, vri, Pdp1ε and cwo depending on the amount of dCtBP expression, whereas no effect was observed without CLK. The activation of these clock genes in vitro was not observed when we used mutated dCtBP which carries amino acid substitutions in NAD+ domain. These results suggest that dCtBP generally acts as a putative co-activator of CLK/CYC through the E-box sequence.

  15. Integration of BpMADS4 on various linkage groups improves the utilization of the rapid cycle breeding system in apple.

    Science.gov (United States)

    Weigl, Kathleen; Wenzel, Stephanie; Flachowsky, Henryk; Peil, Andreas; Hanke, Magda-Viola

    2015-02-01

    Rapid cycle breeding in apple is a new approach for the rapid introgression of agronomically relevant traits (e.g. disease resistances) from wild apple species into domestic apple cultivars (Malus × domestica Borkh.). This technique drastically shortens the long-lasting juvenile phase of apple. The utilization of early-flowering apple lines overexpressing the BpMADS4 gene of the European silver birch (Betula pendula Roth.) in hybridization resulted in one breeding cycle per year. Aiming for the selection of non-transgenic null segregants at the end of the breeding process, the flower-inducing transgene and the gene of interest (e.g. resistance gene) that will be introgressed by hybridization need to be located on different chromosomes. To improve the flexibility of the existing approach in apple, this study was focused on the development and characterization of eleven additional BpMADS4 overexpressing lines of four different apple cultivars. In nine lines, the flowering gene was mapped to different linkage groups. The differences in introgressed T-DNA sequences and plant genome deletions post-transformation highlighted the unique molecular character of each line. However, transgenic lines demonstrated no significant differences in flower organ development and pollen functionality compared with non-transgenic plants. Hybridization studies using pollen from the fire blight-resistant wild species accession Malus fusca MAL0045 and the apple scab-resistant cultivar 'Regia' indicated that BpMADS4 introgression had no significant effect on the breeding value of each transgenic line.

  16. The late Quaternary Diego Hernandez Formation, Tenerife: Volcanology of a complex cycle of voluminous explosive phonolitic eruptions

    Science.gov (United States)

    Edgar, C. J.; Wolff, J. A.; Olin, P. H.; Nichols, H. J.; Pittari, A.; Cas, R. A. F.; Reiners, P. W.; Spell, T. L.; Martí, J.

    2007-02-01

    The Diego Hernandez Formation (DHF; 600-ca. 180 ka) represents the products of the most recent complete cycle of phonolitic explosive volcanism on Tenerife (Canary Islands, Spain). We provide a revised and detailed stratigraphy, new 40Ar/ 39Ar and (U-Th)/He age determinations for major eruptive units, a summary of new chemical data and an overview of the key characteristics of the cycle, including volume estimates, dispersal patterns, eruption styles, phreatomagmatic influences and caldera collapse episodes. The complex stratigraphy of the DHF is divided into 20 named members, each representing a major eruption, as well as numerous unnamed members of limited present-day exposure. The major eruptions are represented by the Fortaleza (370 ka), Roque (347 ka, 3 km 3), Aldea (319 ka, 3 km 3), Fasnia (309 ka, 13 km 3), Poris (268 ka, 3.5 km 3), Arafo (4 km 3), Caleta (223 ka, 3.5 km 3) and Abrigo (between 196 and 171 ka, 20 km 3) Members. The Aldea, Fasnia and Poris Members consist of highly complex successions of plinian fall, surge and flow deposits and several of the eruptions produced widespread and internally complex ignimbrite sheets. Phreatomagmatism occurred most frequently in the opening phase of the eruptions but also recurred repeatedly throughout many of the sequences. Inferred sources of water include a shallow caldera lake and groundwater, and intermittent phreatomagmatic activity was an important influence on eruption style. Another important factor was conduit and vent instability, which frequently loaded the eruption column with dense lithic debris and occasionally triggered column collapse and ignimbrite formation. Most of the major DHF eruptions were triggered by injection of mafic magma into existing phonolitic magma bodies. Two phonolitic magma types were available for eruption during the lifetime of the DHF, but each was dominant at different times. The results presented here support a caldera collapse rather than a landslide model for the origin

  17. Comprehensive Characterization of Voids and Microstructure in TATB-based Explosives from 10 nm to 1 cm: Effects of Temperature Cycling and Compressive Creep

    Energy Technology Data Exchange (ETDEWEB)

    Willey, T M; Lauderbach, L; Gagliardi, F; Cunningham, B; Lorenz, K T; Lee, J I; van Buuren, T; Call, R; Landt, L; Overturf, G

    2010-02-26

    This paper outlines the characterization of voids and Microstructure in TATB-based Explosives over several orders of magnitude, from sizes on the order of 10 nm to about 1 cm. This is accomplished using ultra small angle x-ray scattering to investigate voids from a few nm to a few microns, ultra small angle neutron scattering for voids from 100 nm to 10 microns, and x-ray computed microtomography to investigate microstructure from a few microns to a few centimeters. The void distributions of LX-17 are outlined, and the microstructure of LX-17 is presented. Temperature cycling and compressive creep cause drastically different damage to the microstructure. Temperature cycling leads to a volume expansion (ratchet growth) in TATB-based explosives, and x-ray scattering techniques that are sensitive to sizes up to a few microns indicated changes to the void volume distribution that had previously accounted for most, but not all of the change in density. This paper presents the microstructural damage larger than a few microns caused by ratchet growth. Temperature cycling leads to void creation in the binder poor regions associated with the interior portion of formulated prills. Conversely, compressive creep causes characteristically different changes to microstructure; fissures form at binder-rich prill boundaries prior to mechanical failure.

  18. Involvement of 53BP1, a p53 Binding Protein, in Chk2 Phosphyorylation of p53 and DNA Damage Cell Cycle Checkpoints

    Science.gov (United States)

    2006-05-01

    cancer postdoctoral fellowship. S.J.E. is an Investigator of the Howard Hughes Medical Institute. Report 53BP1 Oligomerization is Independent of its...Charier G, Couprie J, Alpha-Bazin B, Meyer V, Quemeneur E, Guerois R, Callebaut I, Gilquin B, Zinn -Justin S. The Tudor tandem of 53BP1: a new...Investigator with the Howard Hughes Medical Institute. Supporting Online Material www.sciencemag.org/cgi/content/full/1076182/DC1 Materials and Methods Fig

  19. Underground Explosions

    Science.gov (United States)

    2015-09-09

    continuous media including, thermal effects, electromagnetic and nuclear radiation, as well as the formation of different types of waves (shock...front’, sometimes called “hydrodynamic separation” together with reconstruction of the hydrodynamic flow due to formation of thermal boundary layer...of the charge; or pre-explosion excavation; or some other techniques. For loosening, dilatant , or retarc-producing explosions, the height of the

  20. Autophagy regulates T lymphocyte proliferation through selective degradation of the cell-cycle inhibitor CDKN1B/p27Kip1.

    Science.gov (United States)

    Jia, Wei; He, Ming-Xiao; McLeod, Ian X; Guo, Jian; Ji, Dong; He, You-Wen

    2015-01-01

    The highly conserved cellular degradation pathway, macroautophagy, regulates the homeostasis of organelles and promotes the survival of T lymphocytes. Previous results indicate that Atg3-, Atg5-, or Pik3c3/Vps34-deficient T cells cannot proliferate efficiently. Here we demonstrate that the proliferation of Atg7-deficient T cells is defective. By using an adoptive transfer and Listeria monocytogenes (LM) mouse infection model, we found that the primary immune response against LM is intrinsically impaired in autophagy-deficient CD8(+) T cells because the cell population cannot expand after infection. Autophagy-deficient T cells fail to enter into S-phase after TCR stimulation. The major negative regulator of the cell cycle in T lymphocytes, CDKN1B, is accumulated in autophagy-deficient naïve T cells and CDKN1B cannot be degraded after TCR stimulation. Furthermore, our results indicate that genetic deletion of one allele of CDKN1B in autophagy-deficient T cells restores proliferative capability and the cells can enter into S-phase after TCR stimulation. Finally, we found that natural CDKN1B forms polymers and is physiologically associated with the autophagy receptor protein SQSTM1/p62 (sequestosome 1). Collectively, autophagy is required for maintaining the expression level of CDKN1B in naïve T cells and selectively degrades CDKN1B after TCR stimulation.

  1. A BP net model of optimizing selection for preparation of powdery emulsion explosives%乳化粉状炸药制备的优选BP网络模型

    Institute of Scientific and Technical Information of China (English)

    段宝福; 汪旭光; 宋锦泉

    2003-01-01

    根据BP(Back propgation)神经网络理论,建立了制备乳化粉状炸药模型,采用乳化粉状炸药研制过程中的有关数据,编写程序进行了模型的训练、用训练后的模型对预测样本进行了预测与优选.模型优选结果的性能价格比的预测值为2841.3 (m/s)/((¥)/kg),实验得到该结果的实际性能价格比为2767.4(m/s)/((¥)/kg),相对误差为2.7%.模型还可对具有相同配方的炸药优选制备工艺参数,对部分组分不同的样品优选了工艺参数,模型对这些样品优选的最优工艺参数与实际工艺参数基本一致.

  2. Explosive Start

    Institute of Scientific and Technical Information of China (English)

    FRANCISCO; LITTLE

    2006-01-01

    I ducked involuntarily as the first set of explosions went off and made my way in double time to the street corner, where I had spotted an arcade that could be used for shelter. Running quickly in a crouched, military maneuver while inhaling gunpowder fumes, I was totally oblivious to the laughter and head-shaking coming

  3. Niche explosion.

    Science.gov (United States)

    Normark, Benjamin B; Johnson, Norman A

    2011-05-01

    The following syndrome of features occurs in several groups of phytophagous insects: (1) wingless females, (2) dispersal by larvae, (3) woody hosts, (4) extreme polyphagy, (5) high abundance, resulting in status as economic pests, (6) invasiveness, and (7) obligate parthenogenesis in some populations. If extreme polyphagy is defined as feeding on 20 or more families of hostplants, this syndrome is found convergently in several species of bagworm moths, tussock moths, root weevils, and 5 families of scale insects. We hypothesize that extreme polyphagy in these taxa results from "niche explosion", a positive feedback loop connecting large population size to broad host range. The niche explosion has a demographic component (sometimes called the "amplification effect" in studies of pathogens) as well as a population-genetic component, due mainly to the increased effectiveness of natural selection in larger populations. The frequent origins of parthenogenesis in extreme polyphages are, in our interpretation, a consequence of this increased effectiveness of natural selection and consequent reduced importance of sexuality. The niche explosion hypothesis makes detailed predictions about the comparative genomics and population genetics of extreme polyphages and related specialists. It has a number of potentially important implications, including an explanation for the lack of observed trade-offs between generalists and specialists, a re-interpretation of the ecological correlates of parthenogenesis, and a general expectation that Malthusian population explosions may be amplified by Darwinian effects.

  4. Mechanism of Sea Level Change at the Earth Orbital Parameter Cycles during the Last 2 Ma BP%近2 Ma BP 以来地球轨道参数周期上全球海平面变化机制

    Institute of Scientific and Technical Information of China (English)

    李文宝; 王汝建

    2016-01-01

    stacked RSL and atmospheric CO 2 concentration,sea surface temperature (SST)in middle-high latitudinal oceans and benthic oxygen isotope (δ1 8 O B )record are separately discussed in detail.The results show that:(1)the new stacked RSL has the similar change trend to the original RSL records during the last 2 Ma BP,and the correlation coefficients are all nearly 0.9.Meanwhile,the new stacked RSL also responds well to the global climate change events at the earth orbital parameter cy-cles;(2)The new stacked RSL and LR04-δ1 8 O B have high negative correlation in glacial-interglacial cycles during the last 2 Ma BP,with the correlation coefficient of about 0.81,which is much higher than those of the new stacked RSL with SST and at-mospheric CO 2 concentration;(3)Based on the cross-spectral analytical results between the new stacked RSL and CO 2 ,SST andδ1 8 O B ,individually,the new stacked RSL is nearly in phase withδ1 8 O B ,and both lags SST and CO 2 at the eccentricity band,and lags SST but leads CO 2 at the obliquity band.It is concluded that the polar ice sheet volume was influenced by chan-ges of SST and atmospheric CO 2 concentration,which might be caused by the change of solar insolation and finally influenced the sea level change at the earth orbital parameter cycles.

  5. Explosive Pleuritis

    Directory of Open Access Journals (Sweden)

    Jasdeep K Sharma

    2001-01-01

    Full Text Available The objective of the present paper is to describe the clinical and computed tomography features of 'explosive pleuritis', an entity first named by Braman and Donat in 1986, and to propose a case definition. A case report of a previously healthy, 45-year-old man admitted to hospital with acute onset pleuritic chest pain is presented. The patient arrived at the emergency room at 15:00 in mild respiratory distress; the initial chest x-ray revealed a small right lower lobe effusion. The subsequent clinical course in hospital was dramatic. Within 18 h of admission, he developed severe respiratory distress with oxygen desaturation to 83% on room air and dullness of the right lung field. A repeat chest x-ray, taken the morning after admission, revealed complete opacification of the right hemithorax. A computed tomography scan of the thorax demonstrated a massive pleural effusion with compression of pulmonary tissue and mediastinal shift. Pleural fluid biochemical analysis revealed the following concentrations: glucose 3.5 mmol/L, lactate dehydrogenase 1550 U/L, protein 56.98 g/L, amylase 68 U/L and white blood cell count 600 cells/mL. The pleural fluid cultures demonstrated light growth of coagulase-negative staphylococcus and viridans streptococcus, and very light growth of Candida albicans. Cytology was negative for malignant cells. Thoracotomy was performed, which demonstrated a loculated parapneumonic effusion that required decortication. The patient responded favourably to the empirical administration of intravenous levofloxacin and ceftriaxone, and conservative surgical methods in the management of the empyema. This report also discusses the patient's rapidly progressing pleural effusion and offers a potential case definition for explosive pleuritis. Explosive pleuritis is a medical emergency defined by the rapid development of a pleural effusion involving more than 90% of the hemithorax over 24 h, which causes compression of pulmonary tissue and

  6. Explosive Pleuritis

    Directory of Open Access Journals (Sweden)

    Satish Kumar

    2012-01-01

    Full Text Available Pleural effusions associated with pneumonia (parapneumonic effusions are one of the most common causes of exudative pleural effusions in the world. Approximately 20 to 40% of patients hospitalized with pneumonia will have an accompanying pleural effusion. The term 'Explosive pleuritis' was originally described by Braman and Donat in 1986 as pleural effusions developing within hours of admission. We report a 38 years old male patient with minimal pleural effusion which progressed rapidly within one day to involve almost whole of the hemithorax. There were multiple loculations on ultrasonography of thorax. Pleural fluid was sero-sanguinous and revealed gram positive diplococcic. The patient improved with antibiotics and pigtail catheter drainage.

  7. Leidenfrost explosions

    CERN Document Server

    Moreau, F; Dorbolo, S

    2012-01-01

    We present a fluid dynamics video showing the behavior of Leidenfrost droplets composed by a mixture of water and surfactant (SDS, Sodium Dodecyl sulfate). When a droplet is released on a plate heated above a given temperature a thin layer of vapor isolates the droplet from the plate. The droplet levitates over the plate. This is called the Leidenfrost effect. In this work we study the influence of the addition of a surfactant on the Leidenfrost phenomenon. As the droplet evaporates the concentration of SDS rises up to two orders of magnitude over the Critical Micelle Concentration (CMC). An unexpected and violent explosive behavior is observed. The video presents several explosions taken with a high speed camera (IDT-N4 at 30000 fps). All the presented experiments were performed on a plate heated at 300{\\deg}C. On the other hand, the initial quantity of SDS was tuned in two ways: (i) by varying the initial concentration of SDS and (ii) by varying the initial size of the droplet. By measuring the volume of th...

  8. Explosive Formulation Pilot Plant

    Data.gov (United States)

    Federal Laboratory Consortium — The Pilot Plant for Explosive Formulation supports the development of new explosives that are comprised of several components. This system is particularly beneficial...

  9. Chaotic Explosions

    CERN Document Server

    Altmann, Eduardo G; Tél, Tamás

    2015-01-01

    We investigate chaotic dynamical systems for which the intensity of trajectories might grow unlimited in time. We show that (i) the intensity grows exponentially in time and is distributed spatially according to a fractal measure with an information dimension smaller than that of the phase space,(ii) such exploding cases can be described by an operator formalism similar to the one applied to chaotic systems with absorption (decaying intensities), but (iii) the invariant quantities characterizing explosion and absorption are typically not directly related to each other, e.g., the decay rate and fractal dimensions of absorbing maps typically differ from the ones computed in the corresponding inverse (exploding) maps. We illustrate our general results through numerical simulation in the cardioid billiard mimicking a lasing optical cavity, and through analytical calculations in the baker map.

  10. Understanding vented gas explosions

    Energy Technology Data Exchange (ETDEWEB)

    Lautkaski, R. [VTT Energy, Espoo (Finland). Energy Systems

    1997-12-31

    The report is an introduction to vented gas explosions for nonspecialists, particularly designers of plants for flammable gases and liquids. The phenomena leading to pressure generation in vented gas explosions in empty and congested rooms are reviewed. The four peak model of vented gas explosions is presented with simple methods to predict the values of the individual peaks. Experimental data on the external explosion of dust and gas explosions is discussed. The empirical equation relating the internal and external peak pressures in vented dust explosions is shown to be valid for gas explosion tests in 30 m{sup 3} and 550 m{sup 3} chambers. However, the difficulty of predicting the internal peak pressure in large chambers remains. Methods of explosion relief panel design and principles of vent and equipment layout to reduce explosion overpressures are reviewed. (orig.) 65 refs.

  11. 78 FR 64246 - Commerce in Explosives; List of Explosives Materials

    Science.gov (United States)

    2013-10-28

    ... From the Federal Register Online via the Government Publishing Office ] DEPARTMENT OF JUSTICE Bureau of Alcohol, Tobacco, Firearms, and Explosives Commerce in Explosives; List of Explosives Materials AGENCY: Bureau of Alcohol, Tobacco, Firearms, and Explosives (ATF); Department of Justice. ACTION:...

  12. 75 FR 5545 - Explosives

    Science.gov (United States)

    2010-02-03

    ... storage of explosives incidental to that movement (49 CFR parts 171 to 180 and 397). The Bureau of Alcohol... transporting blasting agents; mixing water gel explosives; storing ammonium nitrate; and storing small...

  13. Cell phone explosion.

    Science.gov (United States)

    Atreya, Alok; Kanchan, Tanuj; Nepal, Samata; Pandey, Bhuwan Raj

    2016-03-01

    Cell phone explosions and resultant burn injuries are rarely reported in the scientific literature. We report a case of cell phone explosion that occurred when a young male was listening to music while the mobile was plugged in for charging.

  14. Photoacoustic Sensing of Explosives

    Science.gov (United States)

    2013-11-01

    NOV 2013 2. REPORT TYPE 3. DATES COVERED 00-00-2013 to 00-00-2013 4. TITLE AND SUBTITLE Photoacoustic Sensing of Explosives 5a. CONTRACT NUMBER...2013www.ll.mit.edu Photoacoustic Sensing of Explosives (PHASE) is a promising new technology that detects trace explosive residues from significant... photoacoustic phenomena resulting from ultraviolet laser excitation. Exposed explosives are excited up to 100 meters away by using PHASE’s

  15. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    Energy Technology Data Exchange (ETDEWEB)

    Kanginakudru, Sriramana, E-mail: skangina@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); DeSmet, Marsha, E-mail: mdesmet@iupui.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Thomas, Yanique, E-mail: ysthomas@umail.iu.edu [Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States); Morgan, Iain M., E-mail: immorgan@vcu.edu [VCU Philips Institute for Oral Health Research, Virginia Commonwealth University, Richmond, Virginia (United States); Androphy, Elliot J., E-mail: eandro@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States)

    2015-04-15

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication.

  16. Explosive Technology Group

    Data.gov (United States)

    Federal Laboratory Consortium — The Explosive Technology Group (ETG) provides diverse technical expertise and an agile, integrated approach to solve complex challenges for all classes of energetic...

  17. Explosions and static electricity

    DEFF Research Database (Denmark)

    Jonassen, Niels M

    1995-01-01

    The paper deals with the problem of electrostatic discharges as causes of ignition of vapor/gas and dust/gas mixtures. A series of examples of static-caused explosions will be discussed. The concepts of explosion limits, the incendiveness of various discharge types and safe voltages are explained...

  18. Prognostic Importance of Cell Cycle Regulators Cyclin D1 (CCND1) and Cyclin-Dependent Kinase Inhibitor 1B (CDKN1B/p27) in Sporadic Gastric Cancers

    Science.gov (United States)

    Minarikova, Petra; Halkova, Tereza; Belsanova, Barbora; Tuckova, Inna; Belina, Frantisek; Dusek, Ladislav; Zavoral, Miroslav

    2016-01-01

    Background. Gastric cancer is known for a notable variety in the course of the disease. Clinical factors, such as tumor stage, grade, and localization, are key in patient survival. It is expected that molecular factors such as somatic mutations and gene amplifications are also underlying tumor biological behavior and may serve as factors for prognosis estimation. Aim. The purpose of this study was to examine gene amplifications from a panel of genes to uncover potential prognostic marker candidates. Methods. A panel of gene amplifications including 71 genes was tested by multiplex ligation-dependent probe amplification (MLPA) technique in 76 gastric cancer samples from a Caucasian population. The correlation of gene amplification status with patient survival was determined by the Kaplan-Meier method. Results. The amplification of two cell cycle regulators, CCND1 and CDKN1B, was identified to have a negative prognostic role. The medial survival of patients with gastric cancer displaying amplification compared to patients without amplification was 192 versus 725 days for CCND1 (P = 0.0012) and 165 versus 611 days for CDKN1B (P = 0.0098). Conclusion. Gene amplifications of CCND1 and CDKN1B are potential candidates to serve as prognostic markers for the stratification of patients based on the estimate of survival in the management of gastric cancer patients.

  19. Intermittent Explosive Disorder

    Directory of Open Access Journals (Sweden)

    Lut Tamam

    2011-09-01

    Full Text Available Intermittent explosive disorder is an impulse control disorder characterized by the occurrence of discrete episodes of failure to resist aggressive impulses that result in violent assault or destruction of property. Though the prevalence intermittent explosive disorder has been reported to be relatively rare in frontier studies on the field, it is now common opinion that intermittent explosive disorder is far more common than previously thought especially in clinical psychiatry settings. Etiological studies displayed the role of both psychosocial factors like childhood traumas and biological factors like dysfunctional neurotransmitter systems and genetics. In differential diagnosis of the disorder, disorders involving agression as a symptom such as alcohol and drug intoxication, antisocial and borderline personality disorders, personality changes due to general medical conditions and behavioral disorder should be considered. A combination of pharmacological and psychotherapeutic approaches are suggested in the treatment of the disorder. This article briefly reviews the historical background, diagnostic criteria, epidemiology, etiology and treatment of intermittent explosive disorder.

  20. Explosive Components Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The 98,000 square foot Explosive Components Facility (ECF) is a state-of-the-art facility that provides a full-range of chemical, material, and performance analysis...

  1. Shock waves & explosions

    CERN Document Server

    Sachdev, PL

    2004-01-01

    Understanding the causes and effects of explosions is important to experts in a broad range of disciplines, including the military, industrial and environmental research, aeronautic engineering, and applied mathematics. Offering an introductory review of historic research, Shock Waves and Explosions brings analytic and computational methods to a wide audience in a clear and thorough way. Beginning with an overview of the research on combustion and gas dynamics in the 1970s and 1980s, the author brings you up to date by covering modeling techniques and asymptotic and perturbative methods and ending with a chapter on computational methods.Most of the book deals with the mathematical analysis of explosions, but computational results are also included wherever they are available. Historical perspectives are provided on the advent of nonlinear science, as well as on the mathematical study of the blast wave phenomenon, both when visualized as a point explosion and when simulated as the expansion of a high-pressure ...

  2. Explosion suppression system

    Science.gov (United States)

    Sapko, Michael J.; Cortese, Robert A.

    1992-01-01

    An explosion suppression system and triggering apparatus therefor are provided for quenching gas and dust explosions. An electrically actuated suppression mechanism which dispenses an extinguishing agent into the path ahead of the propagating flame is actuated by a triggering device which is light powered. This triggering device is located upstream of the propagating flame and converts light from the flame to an electrical actuation signal. A pressure arming device electrically connects the triggering device to the suppression device only when the explosion is sensed by a further characteristic thereof beside the flame such as the pioneer pressure wave. The light powered triggering device includes a solar panel which is disposed in the path of the explosion and oriented between horizontally downward and vertical. Testing mechanisms are also preferably provided to test the operation of the solar panel and detonator as well as the pressure arming mechanism.

  3. Convergence of BP Algorithm for Training MLP with Linear Output

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The capability of multilayer perceptrons (MLPs) for approximating continuous functions with arbitrary accuracy has been demonstrated in the past decades. Back propagation (BP) algorithm is the most popular learning algorithm for training of MLPs. In this paper, a simple iteration formula is used to select the learning rate for each cycle of training procedure, and a convergence result is presented for the BP algorithm for training MLP with a hidden layer and a linear output unit. The monotonicity of the error function is also guaranteed during the training iteration.

  4. Big Data and Cycling

    NARCIS (Netherlands)

    Romanillos, Gustavo; Zaltz Austwick, Martin; Ettema, Dick; De Kruijf, Joost

    2016-01-01

    Big Data has begun to create significant impacts in urban and transport planning. This paper covers the explosion in data-driven research on cycling, most of which has occurred in the last ten years. We review the techniques, objectives and findings of a growing number of studies we have classified

  5. Explosion containment device

    Science.gov (United States)

    Benedick, William B.; Daniel, Charles J.

    1977-01-01

    The disclosure relates to an explosives storage container for absorbing and containing the blast, fragments and detonation products from a possible detonation of a contained explosive. The container comprises a layer of distended material having sufficient thickness to convert a portion of the kinetic energy of the explosion into thermal energy therein. A continuous wall of steel sufficiently thick to absorb most of the remaining kinetic energy by stretching and expanding, thereby reducing the momentum of detonation products and high velocity fragments, surrounds the layer of distended material. A crushable layer surrounds the continuous steel wall and accommodates the stretching and expanding thereof, transmitting a moderate load to the outer enclosure. These layers reduce the forces of the explosion and the momentum of the products thereof to zero. The outer enclosure comprises a continuous pressure wall enclosing all of the layers. In one embodiment, detonation of the contained explosive causes the outer enclosure to expand which indicates to a visual observer that a detonation has occurred.

  6. A real explosion: the requirement of steam explosion pretreatment.

    Science.gov (United States)

    Yu, Zhengdao; Zhang, Bailiang; Yu, Fuqiang; Xu, Guizhuan; Song, Andong

    2012-10-01

    The severity factor is a common term used in steam explosion (SE) pretreatment that describes the combined effects of the temperature and duration of the pretreatment. However, it ignores the duration of the explosion process. This paper describes a new parameter, the explosion power density (EPD), which is independent of the severity factor. Furthermore, we present the adoption of a 5m(3) SE model for a catapult explosion mode, which completes the explosion within 0.0875 s. The explosion duration ratio of this model to a conventional model of the same volume is 1:123. The comparison between the two modes revealed a qualitative change by explosion speed, demonstrating that this real explosion satisfied the two requirements of consistency, and suggested a guiding mechanism for the design of SE devices.

  7. TopBP1 is required at mitosis to reduce transmission of DNA damage to G1 daughter cells

    DEFF Research Database (Denmark)

    Pedersen, Rune Troelsgaard; Kruse, Thomas; Nilsson, Jakob

    2015-01-01

    mitotic entry. In early mitosis, TopBP1 marks sites of and promotes unscheduled DNA synthesis. Moreover, TopBP1 is required for focus formation of the structure-selective nuclease and scaffold protein SLX4 in mitosis. Persistent TopBP1 foci transition into 53BP1 nuclear bodies (NBs) in G1 and precise...... temporal depletion of TopBP1 just before mitotic entry induced formation of 53BP1 NBs in the next cell cycle, showing that TopBP1 acts to reduce transmission of DNA damage to G1 daughter cells. Based on these results, we propose that TopBP1 maintains genome integrity in mitosis by controlling chromatin...

  8. Lake-expanding events in the Tibetan Plateau since 40 kaBP

    Institute of Scientific and Technical Information of China (English)

    贾玉连; 施雅风; 王苏民; 蒋雪中; 李世杰; 王爱军; 李徐生

    2001-01-01

    Since 40 kaBP, the current endorheism on the Tibetan Plateau had experienced at least four lake-expanding events, at 40-28 kaBP, 19-15 kaBP, 13-11 kaBP, 9.0-5.0 kaBP, respectively. The 40-28 kaBP and 9.0-5.0 kaBP lake-expanding events, corresponding to the global warming periods, were mainly determined by the abundant summer monsoon rainfall brought by strong Indian monsoon, aroused by enhanced solar radiation at earth orbital precessional cycle. The 40-28 kaBP lake-expanding event, also called the great lake period or the pan-lake period, for several great lake groups had come into being by the interconnection of the presently isolated and closed lake catchments. The total lake area over the Tibetan Plateau was estimated at least up to 150000 km2, 3.8 times of the present, and the lake supply coefficients were about 3-10. The 9.0-5.0 kaBP lake-expanding, with a total lake area of 68000 km2, less than the above mentioned reflected the Indian monsoon rainfall less than that of 40-28 kaBP. The expanded lak

  9. Explosives Safety Competency Study

    Science.gov (United States)

    2010-07-13

    Munitions Systems Journeyman CDC—AFSC 2W051 Combat Ammunition Planning and Production—AFCOMAC Munitions Systems Craftsman Course—AFSC 2W071 Combat...Ammunition Planning and Production—AFCOMAC Munitions Systems Craftsman Course—AFSC 2W071 Navy Basics of Naval Explosives Hazard Control—AMMO-18 b

  10. Explosions during galaxy formation

    Directory of Open Access Journals (Sweden)

    Hugo Martel

    2001-01-01

    Full Text Available As an idealized model of the e ects of energy release by supernovae during galaxy formation, we consider an explosion at the center of a halo which forms at the intersection of laments in the plane of a cosmological pancake by gravitational instability during pancake collapse. Such halos resemble the virialized objects found in N{body simulations in a CDM universe and, therefore, serve as a convenient, scale{free test{bed model for galaxy formation. ASPH=P3M simulations reveal that such explosions are anisotropic. The energy and metals are channeled into the low density regions, away from the pancake plane. The pancake remains essentially undisturbed, even if the explosion is strong enough to blow away all the gas lo- cated inside the halo at the onset of the explosion and reheat the IGM surrounding the pancake. Infall quickly replenishes this ejected gas and gradually restores the gas fraction as the halo mass continues to grow. Estimates of the collapse epoch and SN energy{release for galaxies of di erent mass in the CDM model can re- late these results to scale{dependent questions of blow{out and blow{away and their implication for early IGM heating and metal enrichment and the creation of dark{matter{dominated dwarf galaxies.

  11. Conventional Weapons Underwater Explosions

    Science.gov (United States)

    1988-12-01

    te that the heat of detonation (the energy available per mass of explosive) is an increasing function of the aluminum content. As shown in Table 2...the heat of detonation of RDX is 6.15 MJ/kg; addition of 30 wt % Al increases this to 10.12 - a factor of 1.64. Fig. 12 indicates a bubble energy

  12. The Information Explosion.

    Science.gov (United States)

    Kuhns, William

    Three facets of the media--events, myths, and sales pitches--constitute the most important lines of force taken by the information bombardment which all of us encounter and are influenced by every day. The focus of this book is on the changes created and hastened by this information explosion of the media bombardment: how we can live with them,…

  13. Portable raman explosives detection

    Energy Technology Data Exchange (ETDEWEB)

    Moore, David Steven [Los Alamos National Laboratory; Scharff, Robert J [Los Alamos National Laboratory

    2008-01-01

    Recent advances in portable Raman instruments have dramatically increased their application to emergency response and forensics, as well as homeland defense. This paper reviews the relevant attributes and disadvantages of portable Raman spectroscopy, both essentially and instrumentally, to the task of explosives detection in the field.

  14. Characteristic Research on Evaporated Explosive Film

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    The evaporation source of evaporated explosive was designed and improved based on the inherent specialties of explosive. The compatibility of explosives and addition agent with evaporation vessels was analyzed. The influence of substrate temperature on explosive was analyzed, the control method of substrate temperature was suggested. The influences of evaporation rate on formation of explosive film and mixed explosive film were confirmed. Optimum evaporation rate for evaporation explosive and the better method for evaporating mixed explosive were presented. The necessary characteristics of the evaporated explosive film were obtained by the research of the differences between the evaporated explosive and other materials.

  15. An iterative method for the canard explosion in general planar systems

    DEFF Research Database (Denmark)

    Brøns, Morten

    2012-01-01

    The canard explosion is the change of amplitude and period of a limit cycle born in a Hopf bifurcation in a very narrow parameter interval. The phenomenon is well understood in singular perturbation problems where a small parameter controls the slow/fast dynamics. However, canard explosions...

  16. An iterative method for the canard explosion in general planar systems

    DEFF Research Database (Denmark)

    Brøns, Morten

    2013-01-01

    The canard explosion is the change of amplitude and period of a limit cycle born in a Hopf bifurcation in a very narrow parameter interval. The phenomenon is well understood in singular perturbation problems where a small parameter controls the slow/fast dynamics. However, canard explosions...

  17. Explosive bulk charge

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Jacob Lee

    2015-04-21

    An explosive bulk charge, including: a first contact surface configured to be selectively disposed substantially adjacent to a structure or material; a second end surface configured to selectively receive a detonator; and a curvilinear side surface joining the first contact surface and the second end surface. The first contact surface, the second end surface, and the curvilinear side surface form a bi-truncated hemispherical structure. The first contact surface, the second end surface, and the curvilinear side surface are formed from an explosive material. Optionally, the first contact surface and the second end surface each have a substantially circular shape. Optionally, the first contact surface and the second end surface consist of planar structures that are aligned substantially parallel or slightly tilted with respect to one another. The curvilinear side surface has one of a smooth curved geometry, an elliptical geometry, and a parabolic geometry.

  18. Imaging Detonations of Explosives

    Science.gov (United States)

    2016-04-01

    of a high- pressure helium tank , a dump valve that exhausts the high- pressure gas to the gun breech, and a 25-mm-diameter, unrifled, 4.9-m-long gun...14. ABSTRACT The techniques and instrumentation presented in this report allow for mapping of temperature, pressure , chemical species, and...measurement in the explosive near- to far-field (0–500 charge diameters) of surface temperatures, peak air-shock pressures , some chemical species

  19. Overview of Explosive Initiators

    Science.gov (United States)

    2015-11-01

    Primary Explosives Lead Azide Lead azide came to prominence around the 1920’s, owing largely to its unique blend of performance and...as its basic nature does not encourage lead azide’s tendency UNCLASSIFIED Approved for public release; distribution is unlimited. 5 toward...fig. 4, top). This fuse is usually a long, flexible plastic or rubber tube filled with a pyrotechnic composition such as black powder, allowing

  20. Explosive Turbulent Magnetic Reconnection

    OpenAIRE

    Higashimori, Katsuaki; Yokoi, Nobumitsu; Hoshino, Masahiro

    2013-01-01

    We report simulation results for turbulent magnetic reconnection obtained using a newly developed Reynolds-averaged magnetohydrodynamics model. We find that the initial Harris current sheet develops in three ways, depending on the strength of turbulence: laminar reconnection, turbulent reconnection, and turbulent diffusion. The turbulent reconnection explosively converts the magnetic field energy into both kinetic and thermal energy of plasmas, and generates open fast reconnection jets. This ...

  1. Interactions of the human MCM-BP protein with MCM complex components and Dbf4.

    Directory of Open Access Journals (Sweden)

    Tin Nguyen

    Full Text Available MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.

  2. Welding of pyroclastic conduit infill: A mechanism for cyclical explosive eruptions

    Science.gov (United States)

    Kolzenburg, S.; Russell, J. K.

    2014-07-01

    Vulcanian-style eruptions are small- to moderate-sized, singular to cyclical events commonly having volcanic explosivity indices of 1-3. They produce pyroclastic flows, disperse tephra over considerable areas, and can occur as precursors to larger (e.g., Plinian) eruptions. The fallout deposits of the 2360 B.P. eruption of Mount Meager, BC, Canada, contain bread-crusted blocks of welded breccia as accessory lithics. They display a range of compaction/welding intensity and provide a remarkable opportunity to constrain the nature and timescales of mechanical processes operating within explosive volcanic conduits during repose periods between eruptive cycles. We address the deformation and porosity/permeability reduction within natural pyroclastic deposits infilling volcanic conduits. We measure the porosity, permeability, and ultrasonic wave velocities for a suite of samples and quantify the strain recorded by pumice clasts. We explore the correlations between the physical properties and deformation fabric. Based on these correlations, we reconstruct the deformation history within the conduit, model the permeability reduction timescales, and outline the implications for the repressurization of the volcanic conduit. Our results highlight a profound directionality in the measured physical properties of these samples related to the deformation-induced fabric. Gas permeability varies drastically with increasing strain and decreasing porosity along the compaction direction of the fabric but varies little along the elongation direction of the fabric. The deformation fabric records a combination of compaction within the conduit and postcompaction stretching associated with subsequent eruption. Model timescales of these processes are in good agreement with repose periods of cyclic vulcanian eruptions.

  3. Nanosensors for trace explosive detection

    OpenAIRE

    2008-01-01

    Selective and sensitive detection of explosives is very important in countering terrorist threats. Detecting trace explosives has become a very complex and expensive endeavor because of a number of factors, such as the wide variety of materials that can be used as explosives, the lack of easily detectable signatures, the vast number of avenues by which these weapons can be deployed, and the lack of inexpensive sensors with high sensitivity and selectivity. High sensitivity and selectivity, co...

  4. Explosive turbulent magnetic reconnection.

    Science.gov (United States)

    Higashimori, K; Yokoi, N; Hoshino, M

    2013-06-21

    We report simulation results for turbulent magnetic reconnection obtained using a newly developed Reynolds-averaged magnetohydrodynamics model. We find that the initial Harris current sheet develops in three ways, depending on the strength of turbulence: laminar reconnection, turbulent reconnection, and turbulent diffusion. The turbulent reconnection explosively converts the magnetic field energy into both kinetic and thermal energy of plasmas, and generates open fast reconnection jets. This fast turbulent reconnection is achieved by the localization of turbulent diffusion. Additionally, localized structure forms through the interaction of the mean field and turbulence.

  5. Ballistic analysis during multiscale explosive eruption at Vesuvius and hazard implications

    Science.gov (United States)

    De Novellis, Vincenzo

    2016-04-01

    Ballistic Projectiles (BP) are rock-basement or magma fragments of variable size and density that are ejected from vents during explosive eruptions and follow almost parabolic trajectories that are influenced by gravity and drag forces before they reach their impact point on the surface. During the past century, numerous observers have described the violent ejection of large blocks and bombs from volcanoes during volcanic explosions. Starting from '40 years of last century, several authors developed a mathematical expression relating initial velocity and trajectory angle of ejected blocks to the range, taking into account air drag and assuming a constant drag coefficient; but only in the last 30 years was developed the first mathematical algorithm for ballistic trajectories in the volcanological literature that considered variations in drag coefficient with Reynolds number. Finally, with 21st century computer power, ballistic computation should be available to anyone as a back-of-the-envelope indicator of explosive power by a user-friendly computer program. At Mt. Vesuvius a series of explosion events accompanied eruptive mechanism stages during its history. In particular the explosive eruptive events at Vesuvius was affected by 3 types of energy activity: i) a normal strombolian activity that consists of rhythmic, mild to moderate explosions lasting a few seconds that eject scoriaceous lapilli and bombs, ash and lithic blocks; ii) a vulcanian or violent explosions characterized by short-lived events involving more than one vent, defined as strombolian paroxysms; iii) from sublinian to plinian activity, that have been the most powerful events observed at Mt. Vesuvius; on the other hand plinian was indicated as the energetic term to define the most famous eruption of 79 AD. In this study, an eruptive model appropriate for exanimated eruptions, is used to estimate initial conditions (ejection height, take-off angle, velocity) for BP, assuming a broad range of gas

  6. What factors control the superficial lava dome explosivity?

    Science.gov (United States)

    Boudon, Georges; Balcone-Boissard, Hélène; Villemant, Benoit; Morgan, Daniel J.

    2015-04-01

    Dome-forming eruption is a frequent eruptive style; lava domes result from intermittent, slow extrusion of viscous lava. Most dome-forming eruptions produce highly microcrystallized and highly- to almost totally-degassed magmas which have a low explosive potential. During lava dome growth, recurrent collapses of unstable parts are the main destructive process of the lava dome, generating concentrated pyroclastic density currents (C-PDC) channelized in valleys. These C-PDC have a high, but localized, damage potential that largely depends on the collapsed volume. Sometimes, a dilute ash cloud surge develops at the top of the concentrated flow with an increased destructive effect because it may overflow ridges and affect larger areas. In some cases, large lava dome collapses can induce a depressurization of the magma within the conduit, leading to vulcanian explosions. By contrast, violent, laterally directed, explosions may occur at the base of a growing lava dome: this activity generates dilute and turbulent, highly-destructive, pyroclastic density currents (D-PDC), with a high velocity and propagation poorly dependent on the topography. Numerous studies on lava dome behaviors exist, but the triggering of lava dome explosions is poorly understood. Here, seven dome-forming eruptions are investigated: in the Lesser Antilles arc: Montagne Pelée, Martinique (1902-1905, 1929-1932 and 650 y. BP eruptions), Soufrière Hills, Montserrat; in Guatemala, Santiaguito (1929 eruption); in La Chaîne des Puys, France (Puy de Dome and Puy Chopine eruptions). We propose a new model of superficial lava-dome explosivity based upon a textural and geochemical study (vesicularity, microcrystallinity, cristobalite distribution, residual water contents, crystal transit times) of clasts produced by these key eruptions. Superficial explosion of a growing lava dome may be promoted through porosity reduction caused by both vesicle flattening due to gas escape and syn-eruptive cristobalite

  7. Laser machining of explosives

    Science.gov (United States)

    Perry, Michael D.; Stuart, Brent C.; Banks, Paul S.; Myers, Booth R.; Sefcik, Joseph A.

    2000-01-01

    The invention consists of a method for machining (cutting, drilling, sculpting) of explosives (e.g., TNT, TATB, PETN, RDX, etc.). By using pulses of a duration in the range of 5 femtoseconds to 50 picoseconds, extremely precise and rapid machining can be achieved with essentially no heat or shock affected zone. In this method, material is removed by a nonthermal mechanism. A combination of multiphoton and collisional ionization creates a critical density plasma in a time scale much shorter than electron kinetic energy is transferred to the lattice. The resulting plasma is far from thermal equilibrium. The material is in essence converted from its initial solid-state directly into a fully ionized plasma on a time scale too short for thermal equilibrium to be established with the lattice. As a result, there is negligible heat conduction beyond the region removed resulting in negligible thermal stress or shock to the material beyond a few microns from the laser machined surface. Hydrodynamic expansion of the plasma eliminates the need for any ancillary techniques to remove material and produces extremely high quality machined surfaces. There is no detonation or deflagration of the explosive in the process and the material which is removed is rendered inert.

  8. Controlled by Distant Explosions

    Science.gov (United States)

    2007-03-01

    VLT Automatically Takes Detailed Spectra of Gamma-Ray Burst Afterglows Only Minutes After Discovery A time-series of high-resolution spectra in the optical and ultraviolet has twice been obtained just a few minutes after the detection of a gamma-ray bust explosion in a distant galaxy. The international team of astronomers responsible for these observations derived new conclusive evidence about the nature of the surroundings of these powerful explosions linked to the death of massive stars. At 11:08 pm on 17 April 2006, an alarm rang in the Control Room of ESO's Very Large Telescope on Paranal, Chile. Fortunately, it did not announce any catastrophe on the mountain, nor with one of the world's largest telescopes. Instead, it signalled the doom of a massive star, 9.3 billion light-years away, whose final scream of agony - a powerful burst of gamma rays - had been recorded by the Swift satellite only two minutes earlier. The alarm was triggered by the activation of the VLT Rapid Response Mode, a novel system that allows for robotic observations without any human intervention, except for the alignment of the spectrograph slit. ESO PR Photo 17a/07 ESO PR Photo 17a/07 Triggered by an Explosion Starting less than 10 minutes after the Swift detection, a series of spectra of increasing integration times (3, 5, 10, 20, 40 and 80 minutes) were taken with the Ultraviolet and Visual Echelle Spectrograph (UVES), mounted on Kueyen, the second Unit Telescope of the VLT. "With the Rapid Response Mode, the VLT is directly controlled by a distant explosion," said ESO astronomer Paul Vreeswijk, who requested the observations and is lead-author of the paper reporting the results. "All I really had to do, once I was informed of the gamma-ray burst detection, was to phone the staff astronomers at the Paranal Observatory, Stefano Bagnulo and Stan Stefl, to check that everything was fine." The first spectrum of this time series was the quickest ever taken of a gamma-ray burst afterglow

  9. Active Water Explosion Suppression System

    Science.gov (United States)

    2002-06-01

    efficient in eliminating the heat of detonation , thereby eliminating the heat of combustion and the associated burning of explosive by-products in the...efficiency in eliminating the heat of detonation . In any case, the net effect of the water absorbing the detonation energy of the explosive is a major

  10. Introduction to High Explosives Science

    Energy Technology Data Exchange (ETDEWEB)

    Skidmore, Cary Bradford [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Preston, Daniel N. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-11-17

    These are a set of slides for educational outreach to children on high explosives science. It gives an introduction to the elements involved in this science: carbon, hydrogen, nitrogen, and oxygen. Combined, these form the molecule HMX. Many pictures are also included to illustrate explosions.

  11. The Scaled Thermal Explosion Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Wardell, J F; Maienschein, J L

    2002-07-05

    We have developed the Scaled Thermal Explosion Experiment (STEX) to provide a database of reaction violence from thermal explosion for explosives of interest. Such data are needed to develop, calibrate, and validate predictive capability for thermal explosions using simulation computer codes. A cylinder of explosive 25, 50 or 100 mm in diameter, is confined in a steel cylinder with heavy end caps, and heated under controlled conditions until reaction. Reaction violence is quantified through non-contact micropower impulse radar measurements of the cylinder wall velocity and by strain gauge data at reaction onset. Here we describe the test concept, design and diagnostic recording, and report results with HMX- and RDX-based energetic materials.

  12. The interaction of explosively generated plasma with explosives

    Science.gov (United States)

    Tasker, Douglas G.; Whitley, Von H.; Johnson, Carl E.

    2017-01-01

    It has been shown that the temperature of explosively generated plasma (EGP) is of the order of 1 eV and plasma ejecta can be focused to achieve velocities as high as 25 km/s. Proof-of-principle tests were performed to determine if EGP could be used for explosive ordnance demolition and other applications. The goals were: to benignly disable ordnance containing relatively sensitive high performance explosives (PBX-9501); and to investigate the possibility of interrupting an ongoing detonation in a powerful high explosive (again PBX-9501) with EGP. Experiments were performed to establish the optimum sizes of plasma generators for the benign deactivation of high explosives, i.e., the destruction of the ordnance without initiating a detonation or comparable violent event. These experiments were followed by attempts to interrupt an ongoing detonation by the benign disruption of the unreacted explosive in its path. The results were encouraging. First, it was demonstrated that high explosives could be destroyed without the initiation of a detonation or high order reaction. Second, ongoing detonations were successfully interrupted with EGP. [LA-UR-15-25350

  13. Explosion risks from nanomaterials

    Science.gov (United States)

    Bouillard, Jacques; Vignes, Alexis; Dufaud, Olivier; Perrin, Laurent; Thomas, Dominique

    2009-05-01

    Emerging nanomanufactured products are being incorporated in a variety of consumer products ranging from closer body contact products (i.e. cosmetics, sunscreens, toothpastes, pharmaceuticals, clothing) to more remote body-contact products (electronics, plastics, tires, automotive and aeronautical), hence posing potential health and environmental risks. The new field of nanosafety has emerged and needs to be explored now rather than after problems becomes so ubiquitous and difficult to treat that their trend become irreversible. Such endeavour necessitates a transdisciplinary approach. A commonly forgotten and/or misunderstood risk is that of explosion/detonation of nanopowders, due to their high specific active surface areas. Such risk is emphasized and illustrated with the present development of an appropriate risk analysis. For this particular risk, a review of characterization methods and their limitations with regard to nanopowders is presented and illustrated for a few organic and metallic nanopowders.

  14. Mixing in explosions

    Energy Technology Data Exchange (ETDEWEB)

    Kuhl, A.L.

    1993-12-01

    Explosions always contain embedded turbulent mixing regions, for example: boundary layers, shear layers, wall jets, and unstable interfaces. Described here is one particular example of the latter, namely, the turbulent mixing occurring in the fireball of an HE-driven blast wave. The evolution of the turbulent mixing was studied via two-dimensional numerical simulations of the convective mixing processes on an adaptive mesh. Vorticity was generated on the fireball interface by baroclinic effects. The interface was unstable, and rapidly evolved into a turbulent mixing layer. Four phases of mixing were observed: (1) a strong blast wave phase; (2) and implosion phase; (3) a reshocking phase; and (4) an asymptotic mixing phase. The flowfield was azimuthally averaged to evaluate the mean and r.m.s. fluctuation profiles across the mixing layer. The vorticity decayed due to a cascade process. This caused the corresponding enstrophy parameter to increase linearly with time -- in agreement with homogeneous turbulence calculations of G.K. Batchelor.

  15. Direct imaging of explosives

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, E.A.; Moler, R.B.; Saunders, A.W.; Trower, W.P. E-mail: trower@naxs.net

    2000-11-15

    Any technique that can detect nitrogen concentrations can screen for concealed explosives. However, such a technique would have to be insensitive to metal, both encasing and incidental. If images of the nitrogen concentrations could be captured, then, since form follows function, a robust screening technology could be developed. However these images would have to be sensitive to the surface densities at or below that of the nitrogen contained in buried anti-personnel mines or of the SEMTEX that brought down Pan Am 103, {approx}200 g. Although the ability to image in three-dimensions would somewhat reduce false positives, capturing collateral images of carbon and oxygen would virtually assure that nitrogenous non-explosive material like fertilizer, Melmac[reg] dinnerware, and salami could be eliminated. We are developing such an instrument, the Nitrogen Camera, which has met experimentally these criteria with the exception of providing oxygen images, which awaits the availability of a sufficiently energetic light source. Our Nitrogen Camera technique uses an electron accelerator to produce photonuclear reactions whose unique decays it registers. Clearly if our Nitrogen Camera is made mobile, it could be effective in detecting buried mines, either in an active battlefield situation or in the clearing of abandoned military munitions. Combat operations require that a swathe the width of an armored vehicle, 5 miles deep, be screened in an hour, which is within our camera's scanning speed. Detecting abandoned munitions is technically easier as it is free from the onerous speed requirement. We describe here our Nitrogen Camera and show its 180 pixel intensity images of elemental nitrogen in a 200 g mine simulant and in a 125 g stick of SEMTEX. We also report on our progress in creating a lorry transportable 70 MeV electron racetrack microtron, the principal enabling technology that will allow our Nitrogen Camera to be deployed in the field.

  16. Direct imaging of explosives.

    Science.gov (United States)

    Knapp, E A; Moler, R B; Saunders, A W; Trower, W P

    2000-01-01

    Any technique that can detect nitrogen concentrations can screen for concealed explosives. However, such a technique would have to be insensitive to metal, both encasing and incidental. If images of the nitrogen concentrations could be captured, then, since form follows function, a robust screening technology could be developed. However these images would have to be sensitive to the surface densities at or below that of the nitrogen contained in buried anti-personnel mines or of the SEMTEX that brought down Pan Am 103, approximately 200 g. Although the ability to image in three-dimensions would somewhat reduce false positives, capturing collateral images of carbon and oxygen would virtually assure that nitrogenous non-explosive material like fertilizer, Melmac dinnerware, and salami could be eliminated. We are developing such an instrument, the Nitrogen Camera, which has met experimentally these criteria with the exception of providing oxygen images, which awaits the availability of a sufficiently energetic light source. Our Nitrogen Camera technique uses an electron accelerator to produce photonuclear reactions whose unique decays it registers. Clearly if our Nitrogen Camera is made mobile, it could be effective in detecting buried mines, either in an active battlefield situation or in the clearing of abandoned military munitions. Combat operations require that a swathe the width of an armored vehicle, 5 miles deep, be screened in an hour, which is within our camera's scanning speed. Detecting abandoned munitions is technically easier as it is free from the onerous speed requirement. We describe here our Nitrogen Camera and show its 180 pixel intensity images of elemental nitrogen in a 200 g mine simulant and in a 125 g stick of SEMTEX. We also report on our progress in creating a lorry transportable 70 MeV electron racetrack microtron, the principal enabling technology that will allow our Nitrogen Camera to be deployed in the field.

  17. BP Spill Sampling and Monitoring Data

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset analyzes waste from the the British Petroleum Deepwater Horizon Rig Explosion Emergency Response, providing opportunity to query data sets by metadata...

  18. Shock desensitizing of solid explosive

    Energy Technology Data Exchange (ETDEWEB)

    Davis, William C [Los Alamos National Laboratory

    2010-01-01

    Solid explosive can be desensitized by a shock wave too weak to initiate it promptly, and desensitized explosive does not react although its chemical composition is almost unchanged. A strong second shock does not cause reaction until it overtakes the first shock. The first shock, if it is strong enough, accelerates very slowly at first, and then more rapidly as detonation approaches. These facts suggest that there are two competing reactions. One is the usual explosive goes to products with the release of energy, and the other is explosive goes to dead explosive with no chemical change and no energy release. The first reaction rate is very sensitive to the local state, and the second is only weakly so. At low pressure very little energy is released and the change to dead explosive dominates. At high pressure, quite the other way, most of the explosive goes to products. Numerous experiments in both the initiation and the full detonation regimes are discussed and compared in testing these ideas.

  19. Degassing Processes at Persistently Active Explosive Volcanoes

    Science.gov (United States)

    Smekens, Jean-Francois

    Among volcanic gases, sulfur dioxide (SO2) is by far the most commonly measured. More than a monitoring proxy for volcanic degassing, SO 2 has the potential to alter climate patterns. Persistently active explosive volcanoes are characterized by short explosive bursts, which often occur at periodic intervals numerous times per day, spanning years to decades. SO 2 emissions at those volcanoes are poorly constrained, in large part because the current satellite monitoring techniques are unable to detect or quantify plumes of low concentration in the troposphere. Eruption plumes also often show high concentrations of ash and/or aerosols, which further inhibit the detection methods. In this work I focus on quantifying volcanic gas emissions at persistently active explosive volcanoes and their variations over short timescales (minutes to hours), in order to document their contribution to natural SO2 flux as well as investigate the physical processes that control their behavior. In order to make these measurements, I first develop and assemble a UV ground-based instrument, and validate it against an independently measured source of SO2 at a coal-burning power plant in Arizona. I establish a measurement protocol and demonstrate that the instrument measures SO 2 fluxes with explosions with periods of minutes to hours for the past several decades. Semeru produces an average of 21-71 tons of SO2 per day, amounting to a yearly output of 8-26 Mt. Using the Semeru data, along with a 1-D transient numerical model of magma ascent, I test the validity of a model in which a viscous plug at the top of the conduit produces cycles of eruption and gas release. I find that it can be a valid hypothesis to explain the observed patterns of degassing at Semeru. Periodic behavior in such a system occurs for a very narrow range of conditions, for which the mass balance between magma flux and open-system gas escape repeatedly generates a viscous plug, pressurizes the magma beneath the plug, and

  20. Interoperability of wearable cuffless BP measuring devices.

    Science.gov (United States)

    Liu, Jing; Zhang, Yuan-Ting

    2014-01-01

    While a traditional cuff-based Blood Pressure (BP) measuring device can only take a snap shot of BP, real-time and continuous measurement of BP without an occluding cuff is preferred which usually use the pulse transit time (PTT) in combination with other physiological parameters to estimate or track BP over a certain period of time after an initial calibration. This article discusses some perspectives of interoperability of wearable medical devices, based on IEEE P1708 draft standard that focuses on the objective performance evaluation of wearable cuffless BP measuring devices. The ISO/IEEE 11073 family of standards, supporting the plug-and play feature, is intended to enable medical devices to interconnect and interoperate with other medical devices and with computerized healthcare information systems in a manner suitable for the clinical environment. In this paper, the possible adoption of ISO/IEEE 11073 for the interoperability of wearable cuffless BP devices is proposed. In the consideration of the difference of the continuous and cuffless BP measuring methods from the conventional ones, the existing device specialization standards of ISO/IEEE 11073 cannot be directly followed when designing the cuffless BP device. Specifically, this paper discusses how the domain information model (DIM), in which vital sign information is abstracted as objects, is used to structure the information about the device and that generated from the device. Though attention should also be paid to adopt the communication standards for other parts for the communication system, applying communication standards that enable plug-and-play feature allows achieving the interoperability of different cuffless BP measuring devices with possible different configurations.

  1. Active explosion barrier performance against methane and coal dust explosions

    Institute of Scientific and Technical Information of China (English)

    J J L du Plessis

    2015-01-01

    Preventing the propagation of methane or coal dust explosions through the use of active explosion-suppression systems remains one of the most underutilised explosion controls in underground coal mines. As part of the effort to develop better technologies to safeguard mines, the use of active barrier systems was investigated at Kloppersbos in South Africa. The system is designed to meet the requirements of the European Standard (EN 14591-4 2007) as well as the Mine Safety Standardisation in the Ministry of Coal Industry, Coal Industrial l Standard of the Peoples Republic of China (MT 694-1997). From the tests conducted, it can be concluded that the ExploSpot System was successful in stopping flame propagation for both methane and methane and coal dust hybrid explosions when ammonium phosphate powder was used as the suppression material. The use of this barrier will provide coal mine management with an additional explosion control close to the point of ignition and may find application within longwall faces further protecting mines against the risk of an explosion propagating throughout a mine.

  2. [Causation, prevention and treatment of dust explosion].

    Science.gov (United States)

    Dong, Maolong; Jia, Wenbin; Wang, Hongtao; Han, Fei; Li, Xiao-Qiang; Hu, Dahai

    2014-10-01

    With the development of industrial technology, dust explosion accidents have increased, causing serious losses of people's lives and property. With the development of economy, we should lay further emphasis on causation, prevention, and treatment of dust explosion. This article summarizes the background, mechanism, prevention, and treatment of dust explosion, which may provide some professional knowledge and reference for the treatment of dust explosion.

  3. Synchronizing crisis responses after a transgression: An analysis of BP's enacted crisis response to the Deepwater Horizon crisis in 2010

    OpenAIRE

    Diers, AR; Donohue, J

    2013-01-01

    Purpose: With the explosion of the Deepwater Horizon oil well in the Gulf of Mexico on April 20, 2010 and until the well was officially "killed" on September 19, 2010, British Petroleum (BP) did not merely experience a crisis but a five-month marathon of sustained, multi-media engagement. Whereas traditional public relations theory teaches us that an organization should synchronize its messages across channels, there are no models to understand how an organization may strategically coordinate...

  4. Short-term seismic quiescence immediately preceding explosions during the 2011 eruption of Telica Volcano, Nicaragua

    Science.gov (United States)

    Rodgers, M.; Roman, D. C.; Geirsson, H.; La Femina, P. C.; Muñoz, A.; Tenorio, V.

    2013-12-01

    Telica Volcano, Nicaragua, experienced a VEI 2 eruptive episode from March-June 2011. The eruption consisted of numerous small to moderate ash explosions, many of which were observed visually and recorded by a local broadband seismic network (the TESAND network). Seismicity at Telica during both background and eruptive periods is characterized by generally high and variable rates of low-magnitude volcano-seismic events. Explosions at Telica are also detected seismically and distinguished from volcanic earthquakes by the length of the seismic signal, their emergent nature and 'cigar-shaped' envelope, and broadband spectral content. During the month of May 2011, we identified 16 explosion events on a seismometer located 0.5 km from the crater vent, some of which correlate with visually observed explosions. From May 1-12, ten explosions are apparent in continuous seismic data. During this period, the rate of volcano-seismic events is relatively low (0-20 events/hour with an average of 4 events per hour). Prior to eight of the 10 explosions, there were no detected seismic events within one hour of the explosion. From May 13-31, seven explosions were identified in the continuous seismic data. During this period, the rate of volcano-seismic events is relatively high (0-48 events per hour, with an average of 18 events per hour). In the hour preceding all seven explosions, there were no detected volcano-seismic events. Visual inspection of the continuous seismic data confirms that a strong decrease in the number of volcano-seismic events immediately preceded most of the 2011 explosions at Telica Volcano. We suggest that the apparent short-term decrease in seismicity before explosions at Telica is related to a cycle of pressure buildup and release in the shallow magmatic-hydrothermal system, with an increase in pressure prior to the explosions both resulting from and reflecting constriction of gas pathways.

  5. Suppression of stratified explosive interactions

    Energy Technology Data Exchange (ETDEWEB)

    Meeks, M.K.; Shamoun, B.I.; Bonazza, R.; Corradini, M.L. [Wisconsin Univ., Madison, WI (United States). Dept. of Nuclear Engineering and Engineering Physics

    1998-01-01

    Stratified Fuel-Coolant Interaction (FCI) experiments with Refrigerant-134a and water were performed in a large-scale system. Air was uniformly injected into the coolant pool to establish a pre-existing void which could suppress the explosion. Two competing effects due to the variation of the air flow rate seem to influence the intensity of the explosion in this geometrical configuration. At low flow rates, although the injected air increases the void fraction, the concurrent agitation and mixing increases the intensity of the interaction. At higher flow rates, the increase in void fraction tends to attenuate the propagated pressure wave generated by the explosion. Experimental results show a complete suppression of the vapor explosion at high rates of air injection, corresponding to an average void fraction of larger than 30%. (author)

  6. Detonation probabilities of high explosives

    Energy Technology Data Exchange (ETDEWEB)

    Eisenhawer, S.W.; Bott, T.F.; Bement, T.R.

    1995-07-01

    The probability of a high explosive violent reaction (HEVR) following various events is an extremely important aspect of estimating accident-sequence frequency for nuclear weapons dismantlement. In this paper, we describe the development of response curves for insults to PBX 9404, a conventional high-performance explosive used in US weapons. The insults during dismantlement include drops of high explosive (HE), strikes of tools and components on HE, and abrasion of the explosive. In the case of drops, we combine available test data on HEVRs and the results of flooring certification tests to estimate the HEVR probability. For other insults, it was necessary to use expert opinion. We describe the expert solicitation process and the methods used to consolidate the responses. The HEVR probabilities obtained from both approaches are compared.

  7. Explosive Blast Neuropathology and Seizures

    Directory of Open Access Journals (Sweden)

    S. Krisztian eKovacs

    2014-04-01

    Full Text Available Traumatic brain injury (TBI due to explosive blast exposure is a leading combat casualty. It is also implicated as a key contributor to war related mental health diseases. A clinically important consequence of all types of TBI is a high risk for development of seizures and epilepsy. Seizures have been reported in patients who have suffered blast injuries in the Global War on Terror but the exact prevalence is unknown. The occurrence of seizures supports the contention that explosive blast leads to both cellular and structural brain pathology. Unfortunately, the exact mechanism by which explosions cause brain injury is unclear, which complicates development of meaningful therapies and mitigation strategies. To help improve understanding, detailed neuropathological analysis is needed. For this, histopathological techniques are extremely valuable and indispensable. In the following we will review the pathological results, including those from immunohistochemical and special staining approaches, from recent preclinical explosive blast studies.

  8. Simulation Analysis of Indoor Gas Explosion Damage

    Institute of Scientific and Technical Information of China (English)

    钱新明; 陈林顺; 冯长根

    2003-01-01

    The influence factors and process of indoor gas explosion are studied with AutoReaGas explosion simulator. The result shows that venting pressure has great influence on the indoor gas explosion damage. The higher the venting pressure is, the more serious the hazard consequence will be. The ignition location has also evident effect on the gas explosion damage. The explosion static overpressure would not cause major injury to person and serious damage to structure in the case of low venting pressure (lower than 2 kPa). The high temperature combustion after the explosion is the major factor to person injury in indoor gas explosion accidents.

  9. Furball Explosive Breakout Test

    Energy Technology Data Exchange (ETDEWEB)

    Carroll, Joshua David [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-08-05

    For more than 30 years the Onionskin test has been the primary way to study the surface breakout of a detonation wave. Currently the Onionskin test allows for only a small, one dimensional, slice of the explosive in question to be observed. Asymmetrical features are not observable with the Onionskin test and its one dimensional view. As a result, in 2011, preliminary designs for the Hairball and Furball were developed then tested. The Hairball used shorting pins connected to an oscilloscope to determine the arrival time at 24 discrete points. This limited number of data points, caused by the limited number of oscilloscope channels, ultimately led to the Hairball’s demise. Following this, the Furball was developed to increase the number of data points collected. Instead of shorting pins the Furball uses fiber optics imaged by a streak camera to determine the detonation wave arrival time for each point. The original design was able to capture the detonation wave’s arrival time at 205 discrete points with the ability to increase the number of data points if necessary.

  10. Disaster management following explosion.

    Science.gov (United States)

    Sharma, B R

    2008-01-01

    Explosions and bombings remain the most common deliberate cause of disasters involving large numbers of casualties, especially as instruments of terrorism. These attacks are virtually always directed against the untrained and unsuspecting civilian population. Unlike the military, civilians are poorly equipped or prepared to handle the severe emotional, logistical, and medical burdens of a sudden large casualty load, and thus are completely vulnerable to terrorist aims. To address the problem to the maximum benefit of mass disaster victims, we must develop collective forethought and a broad-based consensus on triage and these decisions must reach beyond the hospital emergency department. It needs to be realized that physicians should never be placed in a position of individually deciding to deny treatment to patients without the guidance of a policy or protocol. Emergency physicians, however, may easily find themselves in a situation in which the demand for resources clearly exceeds supply and for this reason, emergency care providers, personnel, hospital administrators, religious leaders, and medical ethics committees need to engage in bioethical decision-making.

  11. The millimetre spectrum of BP Cru

    Science.gov (United States)

    Pestalozzi, Michele; Hobbs, George; Torkelsson, Ulf

    2010-04-01

    In this experiment we attempt to detect the millimetre emission from the high-mass X-ray binary BP Cru. This object is composed of a hypergiant (Wray 977) and a slow spinning X-ray pulsar (GX301-2). The recent ATCA observations of centimeter emission (Pestalozzi et al. 2009, this was the first detection of radio emission towards BP Cru) suggested that radio emission consists of two components, a transient non-thermal one and a persistent thermal one, probably arising from the large stellar wind of Wray 977. As stellar winds often show a positive spectral index, we ask to observe BP Cru at 13 and 7 mm, where we expect fluxes of around 1 mJy. Any detection will allow us to probe the inner parts of the wind and characterise the structure of the stellar wind of BP Cru. For this detection experiment we require 11 hours of observations with ATCA.

  12. BP Investment Exceeds $4 Bln in china

    Institute of Scientific and Technical Information of China (English)

    Wang Ping

    2008-01-01

    @@ British Petroleum (BP) recently signed a series of agreements with China including those in clean energy and wind power generation, during British Prime Minister Gordon Brown's visit to China in mid-January.

  13. Numerical simulation of gas explosions

    Energy Technology Data Exchange (ETDEWEB)

    Van den Berg, A.C.; Van Wingerden, J.M.; Verhagen, T.L.

    1989-08-01

    Recent developments in numerical fluid dynamics and computer technology enable detailed simulation of gas explosions. Prins Maurits Laboratory TNO of the Netherlands Organization for Applied Scientific Research developed the necessary software. This software is a useful tool to develop and evaluate explosion safe installations. One of the possible applications is the design of save offshore rigs. (f.i. to prevent Piper Alpha disasters). The two-dimensional blast model is described and an example is given. 4 figs., 6 refs.

  14. Intraperitoneal explosion following gastric perforation.

    Science.gov (United States)

    Mansfield, Scott K; Borrowdale, Roderick

    2014-04-01

    The object of this study is to report a rare case of explosion during laparotomy where diathermy ignited intraperitoneal gas from a spontaneous stomach perforation. Fortunately, the patient survived but the surgeon experienced a finger burn. A literature review demonstrates other examples of intraoperative explosion where gastrointestinal gases were the fuel source. Lessons learned from these cases provide recommendations to prevent this potentially lethal event from occurring.

  15. A mitotic phosphorylation feedback network connects Cdk1, Plk1, 53BP1, and Chk2 to inactivate the G(2)/M DNA damage checkpoint

    DEFF Research Database (Denmark)

    van Vugt, Marcel A T M; Gardino, Alexandra K; Linding, Rune;

    2010-01-01

    the DNA damage response. We demonstrate that the non-enzymatic checkpoint adaptor protein 53BP1 is an in vivo target of the cell cycle kinases Cyclin-dependent kinase-1 and Polo-like kinase-1 (Plk1). We show that Plk1 binds 53BP1 during mitosis and that this interaction is required for proper inactivation......DNA damage checkpoints arrest cell cycle progression to facilitate DNA repair. The ability to survive genotoxic insults depends not only on the initiation of cell cycle checkpoints but also on checkpoint maintenance. While activation of DNA damage checkpoints has been studied extensively, molecular...... of the DNA damage checkpoint. 53BP1 mutants that are unable to bind Plk1 fail to restart the cell cycle after ionizing radiation-mediated cell cycle arrest. Importantly, we show that Plk1 also phosphorylates the 53BP1-binding checkpoint kinase Chk2 to inactivate its FHA domain and inhibit its kinase activity...

  16. TopBP1 is required at mitosis to reduce transmission of DNA damage to G1 daughter cells.

    Science.gov (United States)

    Pedersen, Rune Troelsgaard; Kruse, Thomas; Nilsson, Jakob; Oestergaard, Vibe H; Lisby, Michael

    2015-08-17

    Genome integrity is critically dependent on timely DNA replication and accurate chromosome segregation. Replication stress delays replication into G2/M, which in turn impairs proper chromosome segregation and inflicts DNA damage on the daughter cells. Here we show that TopBP1 forms foci upon mitotic entry. In early mitosis, TopBP1 marks sites of and promotes unscheduled DNA synthesis. Moreover, TopBP1 is required for focus formation of the structure-selective nuclease and scaffold protein SLX4 in mitosis. Persistent TopBP1 foci transition into 53BP1 nuclear bodies (NBs) in G1 and precise temporal depletion of TopBP1 just before mitotic entry induced formation of 53BP1 NBs in the next cell cycle, showing that TopBP1 acts to reduce transmission of DNA damage to G1 daughter cells. Based on these results, we propose that TopBP1 maintains genome integrity in mitosis by controlling chromatin recruitment of SLX4 and by facilitating unscheduled DNA synthesis.

  17. Equipment Design for Oxidation of 1BP/2BP Using NO_x

    Institute of Scientific and Technical Information of China (English)

    ZHOU; Xian-ming; CHANG; Shang-wen; LI; Gao-liang; LAN; Tian; LIU; Jin-ping; TANG; Hong-bin; HE; Hui

    2013-01-01

    NOx can Oxidize the reductants in 1BP and 2BP feed of Purex process,and can adjust the oxidation state of plutonium as Pu(Ⅳ)to meet the need of 2AF feed.Using NOx in Purex process can reduce the volumn of solid waste effectively,and attract more and more interest of researchers.In this work the oxidation of reductants in 1BP/2BP feed were investigated in glass column as the same-current mode,in

  18. Molecular Outflows: Explosive versus Protostellar

    Science.gov (United States)

    Zapata, Luis A.; Schmid-Burgk, Johannes; Rodríguez, Luis F.; Palau, Aina; Loinard, Laurent

    2017-02-01

    With the recent recognition of a second, distinctive class of molecular outflows, namely the explosive ones not directly connected to the accretion–ejection process in star formation, a juxtaposition of the morphological and kinematic properties of both classes is warranted. By applying the same method used in Zapata et al., and using 12CO(J = 2-1) archival data from the Submillimeter Array, we contrast two well-known explosive objects, Orion KL and DR21, to HH 211 and DG Tau B, two flows representative of classical low-mass protostellar outflows. At the moment, there are only two well-established cases of explosive outflows, but with the full availability of ALMA we expect that more examples will be found in the near future. The main results are the largely different spatial distributions of the explosive flows, consisting of numerous narrow straight filament-like ejections with different orientations and in almost an isotropic configuration, the redshifted with respect to the blueshifted components of the flows (maximally separated in protostellar, largely overlapping in explosive outflows), the very-well-defined Hubble flow-like increase of velocity with distance from the origin in the explosive filaments versus the mostly non-organized CO velocity field in protostellar objects, and huge inequalities in mass, momentum, and energy of the two classes, at least for the case of low-mass flows. Finally, all the molecular filaments in the explosive outflows point back to approximately a central position (i.e., the place where its “exciting source” was located), contrary to the bulk of the molecular material within the protostellar outflows.

  19. THE INFLUENCE OF BARRIERS ON FLAME AND EXPLOSION WAVE IN GAS EXPLOSION

    Institute of Scientific and Technical Information of China (English)

    林柏泉; 周世宁; 张仁贵

    1998-01-01

    This paper researches into the influence of barriers on flame and explosion wave in gasexplosion on the basis of experiment. The result shows that the barrier is very important to thetransmission of flame and explosion wave in gas explosion. When there are barriers, the speed oftransmission would be very fast and shock wave will appear in gas explosion, which would in-crease gas explosion power. The result of research is very important to prevent gas explosion anddecrease the power of it.

  20. Explosion limits for combustible gases

    Institute of Scientific and Technical Information of China (English)

    TONG Min-ming; WU Guo-qing; HAO Ji-fei; DAI Xin-lian

    2009-01-01

    Combustible gases in coal mines are composed of methane, hydrogen, some multi-carbon alkane gases and other gases. Based on a numerical calculation, the explosion limits of combustible gases were studied, showing that these limits are related to the concentrations of different components in the mixture. With an increase of C4H10 and C6H14, the Lower ExplosionLimit (LEL) and Upper Explosion-Limit (UEL) of a combustible gas mixture will decrease clearly. For every 0.1% increase in C4H10 and C6H14, the LEL decreases by about 0.19% and the UEL by about 0.3%. The results also prove that, by increasing the amount of H2, the UEL of a combustible gas mixture will increase considerably. If the level of H2 increases by 0.1%, the UEL will increase by about 0.3%. However, H2 has only a small effect on the LEL of the combustible gas mixture. Our study provides a theoretical foundation for judging the explosion risk of an explosive gas mixture in mines.

  1. Thermodynamic States in Explosion Fields

    Energy Technology Data Exchange (ETDEWEB)

    Kuhl, A L

    2009-10-16

    Here we investigate the thermodynamic states occurring in explosion fields from the detonation of condensed explosives in air. In typical applications, the pressure of expanded detonation products gases is modeled by a Jones-Wilkins-Lee (JWL) function: P{sub JWL} = f(v,s{sub CJ}); constants in that function are fit to cylinder test data. This function provides a specification of pressure as a function of specific volume, v, along the expansion isentrope (s = constant = s{sub CJ}) starting at the Chapman-Jouguet (CJ) state. However, the JWL function is not a fundamental equation of thermodynamics, and therefore gives an incomplete specification of states. For example, explosions inherently involve shock reflections from surfaces; this changes the entropy of the products, and in such situations the JWL function provides no information on the products states. In addition, most explosives are not oxygen balanced, so if hot detonation products mix with air, they after-burn, releasing the heat of reaction via a turbulent combustion process. This raises the temperature of explosion products cloud to the adiabatic flame temperature ({approx}3,000K). Again, the JWL function provides no information on the combustion products states.

  2. Explosion and explosives. Volume 32, Number 5, 1971

    Energy Technology Data Exchange (ETDEWEB)

    1976-01-01

    The following topics are discussed: CMDB propellants with high pressure exponent; the thermal decomposition of phenylnitromethane in 2-propanol; double exposed flash x-ray photographic observation on detonation of coal mining explosions; detonation of condensed multiple components about detonation characteristics of three liquid explosives; synthesis of N,N'-bis (2,4,6-trinitro-3-glycidoxyphenyl)-ethylene dinitramine; resistance characteristics of electric primer containing conductive particles; and formation of Meisenheimer's complex by adding an aqueous sodium hydroxide to the reaction product of epoxy compound with picric acid.

  3. Vegetation and Environment History for the Past 14000 yr BP from Dingnan, Jiangxi Province, South China

    Institute of Scientific and Technical Information of China (English)

    John Richard Dodson; Shirene Hickson; Rachel Khoo; Xiao-Qiang Li; Jemina Toia; Wei-Jian Zhou

    2006-01-01

    A Late Pleistocene-Holocene pollen, phosphorus, and charcoal record was reconstructed from apeatland in southern Jiangxi Province in southern China. The area today has a mountainous and rolling landscape with villages, small towns, and agriculture dominated by rice paddies, vegetable, and fruit gardens, as well as areas of secondary forest and pine re-afforestation. The record opens before 14 300 yr BP, with Alnus woodland dominating the wetland areas and with an open Quercus woodland on the surrounding slopes.The forest area becomes more complex from approximately 12 800 yr BP and further from 9 000 yr BP. At approximately 6 000 yr BP, there is evidence of clearing and, by 4 500-4 000 yr BP, a complete collapse in the wetland Alnus and terrestrial forest as the low-lying areas are converted to rice production. For much of the record, the occurrence of fire around the site was low, although there is evidence of regional fires. Fire was used as a tool in clearing and then used in the annual cycles of stubble burning after rice harvest. Nutrient levels, as reflected by total phosphorus in the sediment, seem to be closely related to forest changes and high values in the surface layers probably result from land-management techniques associated with agriculture. Therefore, human impact greatly altered forest cover, fire frequency, and nutrient dynamics; this has been evident for approximately 6 000 yr BP and then intensifies towards the present day.

  4. Lysine methylation-dependent binding of 53BP1 to the pRb tumor suppressor.

    Science.gov (United States)

    Carr, Simon M; Munro, Shonagh; Zalmas, Lykourgos-Panagiotis; Fedorov, Oleg; Johansson, Catrine; Krojer, Tobias; Sagum, Cari A; Bedford, Mark T; Oppermann, Udo; La Thangue, Nicholas B

    2014-08-01

    The retinoblastoma tumor suppressor protein pRb is a key regulator of cell cycle progression and mediator of the DNA damage response. Lysine methylation at K810, which occurs within a critical Cdk phosphorylation motif, holds pRb in the hypophosphorylated growth-suppressing state. We show here that methyl K810 is read by the tandem tudor domain containing tumor protein p53 binding protein 1 (53BP1). Structural elucidation of 53BP1 in complex with a methylated K810 pRb peptide emphasized the role of the 53BP1 tandem tudor domain in recognition of the methylated lysine and surrounding residues. Significantly, binding of 53BP1 to methyl K810 occurs on E2 promoter binding factor target genes and allows pRb activity to be effectively integrated with the DNA damage response. Our results widen the repertoire of cellular targets for 53BP1 and suggest a previously unidentified role for 53BP1 in regulating pRb tumor suppressor activity.

  5. The Quiet Explosion

    Science.gov (United States)

    2008-07-01

    A European-led team of astronomers are providing hints that a recent supernova may not be as normal as initially thought. Instead, the star that exploded is now understood to have collapsed into a black hole, producing a weak jet, typical of much more violent events, the so-called gamma-ray bursts. The object, SN 2008D, is thus probably among the weakest explosions that produce very fast moving jets. This discovery represents a crucial milestone in the understanding of the most violent phenomena observed in the Universe. Black Hole ESO PR Photo 23a/08 A Galaxy and two Supernovae These striking results, partly based on observations with ESO's Very Large Telescope, will appear tomorrow in Science Express, the online version of Science. Stars that were at birth more massive than about 8 times the mass of our Sun end their relatively short life in a cosmic, cataclysmic firework lighting up the Universe. The outcome is the formation of the densest objects that exist, neutron stars and black holes. When exploding, some of the most massive stars emit a short cry of agony, in the form of a burst of very energetic light, X- or gamma-rays. In the early afternoon (in Europe) of 9 January 2008, the NASA/STFC/ASI Swift telescope discovered serendipitously a 5-minute long burst of X-rays coming from within the spiral galaxy NGC 2770, located 90 million light-years away towards the Lynx constellation. The Swift satellite was studying a supernova that had exploded the previous year in the same galaxy, but the burst of X-rays came from another location, and was soon shown to arise from a different supernova, named SN 2008D. Researchers at the Italian National Institute for Astrophysics (INAF), the Max-Planck Institute for Astrophysics (MPA), ESO, and at various other institutions have observed the supernova at great length. The team is led by Paolo Mazzali of INAF's Padova Observatory and MPA. "What made this event very interesting," says Mazzali, "is that the X-ray signal was very

  6. BP to Increase Production Capacity of PTA at BP Zhuhai Chemical

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    BP has announced a strategic plan for its substantial development in China. It is actively proceeding with its project to increase its production capacity of purified terephthalic acid, or PTA, at the BP Zhuhai Chemical Company Limited facility i n Guangdong, China.

  7. Instrument safety in explosive atmospheres.

    Science.gov (United States)

    Bossert, J A

    1975-01-01

    The current "Energy Crisis" has dramatically increased our potential need for coal, the worlds most abundant fossil fuel. This will probably lead to a greater use of automation and instrumentation in the coal mining industry. The presence of methane in coal mines and in the coal itself plus the presence of coal dust, both of which can form an explosive atmosphere in air, means that the possibility of a gas or coal dust ignition must be considered when designing, purchasing and installing new equipment in this industry. In addition, many metallurgical processes involve the use of potentially explosive substances against which similar safety precautions must be taken. This paper outlines the various methods of protection currently in use and proposed for electrical instruments in explosive atmospheres, with particular emphasis on the work of the International Electrotechnical Commission.

  8. Optimal dynamic detection of explosives

    Energy Technology Data Exchange (ETDEWEB)

    Moore, David Steven [Los Alamos National Laboratory; Mcgrane, Shawn D [Los Alamos National Laboratory; Greenfield, Margo T [Los Alamos National Laboratory; Scharff, R J [Los Alamos National Laboratory; Rabitz, Herschel A [PRINCETON UNIV; Roslund, J [PRINCETON UNIV

    2009-01-01

    The detection of explosives is a notoriously difficult problem, especially at stand-off distances, due to their (generally) low vapor pressure, environmental and matrix interferences, and packaging. We are exploring optimal dynamic detection to exploit the best capabilities of recent advances in laser technology and recent discoveries in optimal shaping of laser pulses for control of molecular processes to significantly enhance the standoff detection of explosives. The core of the ODD-Ex technique is the introduction of optimally shaped laser pulses to simultaneously enhance sensitivity of explosives signatures while reducing the influence of noise and the signals from background interferents in the field (increase selectivity). These goals are being addressed by operating in an optimal nonlinear fashion, typically with a single shaped laser pulse inherently containing within it coherently locked control and probe sub-pulses. With sufficient bandwidth, the technique is capable of intrinsically providing orthogonal broad spectral information for data fusion, all from a single optimal pulse.

  9. Coulomb explosion of "hot spot"

    CERN Document Server

    Oreshkin, V I; Chaikovsky, S A; Artyomov, A P

    2016-01-01

    The study presented in this paper has shown that the generation of hard x rays and high-energy ions, which are detected in pinch implosion experiments, may be associated with the Coulomb explosion of the hot spot that is formed due to the outflow of the material from the pinch cross point. During the process of material outflow, the temperature of the hot spot plasma increases, and conditions arise for the plasma electrons to become continuously accelerated. The runaway of electrons from the hot spot region results in the buildup of positive space charge in this region followed by a Coulomb explosion. The conditions for the hot spot plasma electrons to become continuously accelerated have been revealed and estimates have been obtained for the kinetic energy of the ions generated by the Coulomb explosion.

  10. Evidence for Nearby Supernova Explosions

    CERN Document Server

    Benítez, N; Canelles, M; Benitez, Narciso; Maiz-Apellaniz, Jesus; Canelles, Matilde

    2002-01-01

    Supernova explosions are one of the most energetic--and potentially lethal--phenomena in the Universe. Scientists have speculated for decades about the possible consequences for life on Earth of a nearby supernova, but plausible candidates for such an event were lacking. Here we show that the Scorpius-Centaurus OB association, a group of young stars currently located at~130 parsecs from the Sun, has generated 20 SN explosions during the last 11 Myr, some of them probably as close as 40 pc to our planet. We find that the deposition on Earth of 60Fe atoms produced by these explosions can explain the recent measurements of an excess of this isotope in deep ocean crust samples. We propose that ~2 Myr ago, one of the SNe exploded close enough to Earth to seriously damage the ozone layer, provoking or contributing to the Pliocene-Pleistocene boundary marine extinction.

  11. Explosively Joining Dissimilar Metal Tubes.

    Science.gov (United States)

    1979-11-01

    both steel, photograph (7), and the Ni-Cu specimen, photograph (8) , showed considerable pitting corrosion in the aluminum . 4. The paint was then...for 6061 -T6 aluminum and are: collision angle 5 - 200, collision velocity 270 - 350 m/sec, with an impact pressure of at least 27 Kbar (391 Kpsi...Welded Aluminum Alloy 1 .. 5 rn-i (P0 -I Op. 2si 11 6W TABLE I Explosive2 Cladder Metal Base Metal Explosive Loading (gins/in2 6061 -T6 Al 304 SS TSE- 1004

  12. Intravesical explosion during transurethral electrosurgery.

    Science.gov (United States)

    Georgios, Kallinikas; Evangelos, Boulinakis; Helai, Habib; Ioannis, Gerzelis

    2015-05-01

    Intravesical explosion is a very rare complication of transurethral resection of prostate and transurethral resection of bladder tumour operations. In vitro studies have shown that the gases produced during the procedure could result in a blast once they are mixed with air from the atmosphere. A 79-year-old male experienced an explosion in his bladder while undergoing a transurethral resection of bladder tumour. The case is presented as well as the way that it was treated as an emergency. Precautions of such events are finally suggested.

  13. 46 CFR 188.10-25 - Explosive.

    Science.gov (United States)

    2010-10-01

    ... mixture, the primary purpose of which is to function by explosion; i.e., with substantially instantaneous release of gas and heat. Explosives are discussed in more detail in 49 CFR parts 171-179....

  14. New Source Model for Chemical Explosions

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Xiaoning [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-03-03

    With sophisticated inversion scheme, we recover characteristics of SPE explosions such as corner frequency fc and moment M0, which are used to develop a new source model for chemical explosions.

  15. AcEST: BP919856 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_A02 514 Adiantum capillus-veneris mRNA. clone: YMU001_000130_A02. BP919856 - Show BP91985...is mRNA. clone: YMU001_000130_A02. Accession BP919856 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91985... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919856|Adiantum c

  16. AcEST: BP920173 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H07 454 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H07. BP920173 - Show BP92017...is mRNA. clone: YMU001_000133_H07. Accession BP920173 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP920173|Adiantum capillus-veneris mRNA, clone: YMU001_...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920173|Adiantum capillus

  17. AcEST: BP921101 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000145_F04 489 Adiantum capillus-veneris mRNA. clone: YMU001_000145_F04. BP921101 - Show BP921101...is mRNA. clone: YMU001_000145_F04. Accession BP921101 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921101|Adiantum cap... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921101

  18. AcEST: BP919841 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G06 496 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G06. BP919841 - Show BP91984...is mRNA. clone: YMU001_000129_G06. Accession BP919841 Tissue type prothallium Developmental stage - Contig I...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919841|Adiantum ca...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919841|Adiantum capi

  19. AcEST: BP920154 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F09 487 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F09. BP920154 - Show BP92015...is mRNA. clone: YMU001_000133_F09. Accession BP920154 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920154|Adia...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920154|Adiantum

  20. AcEST: BP919887 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C10 511 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C10. BP919887 - Show BP91988...is mRNA. clone: YMU001_000130_C10. Accession BP919887 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91988...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91988

  1. AcEST: BP914001 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G04 493 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G04. BP914001 - Show BP91400...is mRNA. clone: YMU001_000038_G04. Accession BP914001 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914001|...ic Acids Res. 25:3389-3402. Query= BP914001|Adiantum capillus-veneris mRNA, clone

  2. AcEST: BP919212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E05 508 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E05. BP919212 - Show BP91921...is mRNA. clone: YMU001_000122_E05. Accession BP919212 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919212|Adiantum capillus-ven...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919212|Adiantum capillus-

  3. Statistical estimation of loads from gas explosions

    OpenAIRE

    Høiset, Stian

    1998-01-01

    In the design of structures in the offshore and process industries, the possibility of a gas explosion must always be considered. This is usually incorporated by performing explosion simulations. However, estimations based on such calculations introduce uncertainties in the design process. The main uncertainties in explosion simulations are the assumption of the gas cloud,the location of the ignition point and the properties of the explosion simulator itself. In this thesis, we try to investi...

  4. The behavior limestone under explosive load

    Science.gov (United States)

    Orlov, M. Yu; Orlova, Yu N.; Bogomolov, G. N.

    2016-11-01

    Limestone behavior under explosive loading was investigated. The behavior of the limestone by the action of the three types of explosives, including granular, ammonite and emulsion explosives was studied in detail. The shape and diameter of the explosion craters were obtained. The observed fragments after the blast have been classified as large, medium and small fragments. Three full-scale experiments were carried out. The research results can be used as a qualitative test for the approbation of numerical methods.

  5. Gas Explosions Mitigation by Ducted Venting

    OpenAIRE

    2007-01-01

    The mitigation of effects of gas and dust explosions within industrial equipment is effective if venting the combustion products to safe location. The presence of relief duct is however likely to increase the severity of the explosion with respect to equipment vented to open atmosphere, due to secondary explosions occurring in the initial sections of duct, frictional drag and inertia of the gas column, acoustic and Helmholtz oscillations. The weights of these phenomena on explosion e...

  6. 2000 Johnston Site 1B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  7. 2000 Johnston Site 2B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  8. 2000 Johnston Site 3B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 3B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 3, 2000. With a start point (meter 0) at...

  9. 75 FR 70291 - Commerce in Explosives; List of Explosive Materials (2010R-27T)

    Science.gov (United States)

    2010-11-17

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF JUSTICE Bureau of Alcohol, Tobacco, Firearms and Explosives Commerce in Explosives; List of Explosive Materials (2010R-27T) AGENCY: Bureau of Alcohol, Tobacco, Firearms and Explosives (ATF), Department of...

  10. 77 FR 58410 - Commerce in Explosives; List of Explosive Materials (2012R-10T)

    Science.gov (United States)

    2012-09-20

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF JUSTICE Bureau of Alcohol, Tobacco, Firearms, and Explosives Commerce in Explosives; List of Explosive Materials (2012R-10T) AGENCY: Bureau of Alcohol, Tobacco, Firearms, and Explosives (ATF), Department of...

  11. 76 FR 64974 - Commerce in Explosives; List of Explosive Materials (2011R-18T)

    Science.gov (United States)

    2011-10-19

    ... From the Federal Register Online via the Government Publishing Office ] DEPARTMENT OF JUSTICE Bureau of Alcohol, Tobacco, Firearms and Explosives Commerce in Explosives; List of Explosive Materials (2011R-18T) AGENCY: Bureau of Alcohol, Tobacco, Firearms and Explosives (ATF), Department of...

  12. Lead-free primary explosives

    Science.gov (United States)

    Huynh, My Hang V.

    2010-06-22

    Lead-free primary explosives of the formula (cat).sub.Y[M.sup.II(T).sub.X(H.sub.2O).sub.6-X].sub.Z, where T is 5-nitrotetrazolate, and syntheses thereof are described. Substantially stoichiometric equivalents of the reactants lead to high yields of pure compositions thereby avoiding dangerous purification steps.

  13. Turbulent Combustion in SDF Explosions

    Energy Technology Data Exchange (ETDEWEB)

    Kuhl, A L; Bell, J B; Beckner, V E

    2009-11-12

    A heterogeneous continuum model is proposed to describe the dispersion and combustion of an aluminum particle cloud in an explosion. It combines the gas-dynamic conservation laws for the gas phase with a continuum model for the dispersed phase, as formulated by Nigmatulin. Inter-phase mass, momentum and energy exchange are prescribed by phenomenological models. It incorporates a combustion model based on the mass conservation laws for fuel, air and products; source/sink terms are treated in the fast-chemistry limit appropriate for such gasdynamic fields, along with a model for mass transfer from the particle phase to the gas. The model takes into account both the afterburning of the detonation products of the C-4 booster with air, and the combustion of the Al particles with air. The model equations were integrated by high-order Godunov schemes for both the gas and particle phases. Numerical simulations of the explosion fields from 1.5-g Shock-Dispersed-Fuel (SDF) charge in a 6.6 liter calorimeter were used to validate the combustion model. Then the model was applied to 10-kg Al-SDF explosions in a an unconfined height-of-burst explosion. Computed pressure histories are compared with measured waveforms. Differences are caused by physical-chemical kinetic effects of particle combustion which induce ignition delays in the initial reactive blast wave and quenching of reactions at late times. Current simulations give initial insights into such modeling issues.

  14. Optical Pressure Measurements of Explosions

    Science.gov (United States)

    2013-09-01

    Explosive Shocks in Air, 2nd ed.; Springer-Verlag: Berlin , Germany, 1985. 7. Anderson, J. D. Hypersonic and High Temperature Gas Dynamics, 2nd Ed...PDF) RDRL CIO LA T LANDFRIED RDRL WML M ZOLTOSKI RDRL WML A F DE LUCIA W OBERLE RDRL WML B J GOTTFRIED J CIEZAK

  15. Explosive micro-bubble actuator

    NARCIS (Netherlands)

    Broek, van den D.M.; Elwenspoek, M.

    2008-01-01

    Explosive evaporation occurs when a liquid is exposed to extremely high heat-fluxes. Within a few microseconds a bubble in the form vapour film is generated, followed by rapid growth due to the pressure impulse and finally the bubbles collapse. This effect, which already has proven its use in curren

  16. Explosive micro-bubble actuator

    NARCIS (Netherlands)

    Broek, van den D.M.; Elwenspoek, M.C.

    2007-01-01

    Explosive evaporation occurs when a thin layer of liquid reaches a very high temperature in a very short time. At these temperatures homogeneous nucleation takes place. The nucleated bubbles almost instantly coalesce forming a vapour film followed by rapid growth due to the pressure impulse and fina

  17. The Terrestrial NPP Simulation in China since 6ka BP

    Institute of Scientific and Technical Information of China (English)

    HE Yong; DONG Wenjie; JI Jinjun; DAN Li

    2005-01-01

    A better understanding of the long-term global carbon cycle required estimate of the changes in terrestrial carbon storage after the last glacial period. The results of simulation at mid-Holocene (MH) from PMIP (Paleoclimate Modeling Intercomparison Project) and the modern data from CRU (Climate Research Unit,East Anglia University, UK) allow us to use the Atmosphere-Vegetation Interaction Model (AVIM) to simulate the Chinese terrestrial net primary productivity (NPP) at 6ka BP and present time. The change of NPP and total NPP in China from now to mid-Holocene are about 54 g m-2yr-1 and 0.63 Pg yr-1,respectively, mainly due to the build-up of temperate forest and tropical rainforest. Chinese terrestrial NPP variation from MH to now is closely related to the variation in intensity of Asian monsoon, which controlled the climate-vegetation pattern change.

  18. Scientific Support for NQR Explosive Detection Development

    Science.gov (United States)

    2006-07-01

    Final 3. DATES COVERED (From - To) 8 March 2004 - 7 March 2006 4. TITLE AND SUBTITLE Scientific Support for NQR Explosive Detection Development...Laboratory (NRL) to improve explosive detection using nuclear quadrupole resonance ( NQR ) is summarized. The work includes studies of the effects...superconducting coils for explosive detection. Additional studies involving slowly rotating NQR measurements were also pursued. 15. SUBJECT TERMS Nuclear

  19. 30 CFR 77.1301 - Explosives; magazines.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Explosives; magazines. 77.1301 Section 77.1301... and Blasting § 77.1301 Explosives; magazines. (a) Detonators and explosives other than blasting agents shall be stored in magazines. (b) Detonators shall not be stored in the same magazine with...

  20. Portable SERS Instrument for Explosives Monitoring

    Science.gov (United States)

    2008-01-01

    groundwater monitoring from a cone penetrometer (CPT) platform (5) Demonstrate improved capability for discriminating explosives versus colorimetry ...interference, and better discrimination of individual explosives compared to colorimetry • Applicability to virtually any environmental water...chemicals such as nitroaromatics or nitramines. While this makes colorimetry more generally applicable at explosive sites, it also limits the ability to

  1. 14 CFR 420.63 - Explosive siting.

    Science.gov (United States)

    2010-01-01

    ... Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... site plan shall include: (1) A scaled map that shows the location of all proposed explosive hazard... explosive hazard facility and all other explosive hazard facilities and each public area, including...

  2. Explosion Power and Pressure Desensitization Resisting Property of Emulsion Explosives Sensitized by MgH2

    Science.gov (United States)

    Cheng, Yangfan; Ma, Honghao; Liu, Rong; Shen, Zhaowu

    2014-07-01

    Due to low detonation power and pressure desensitization problems that traditional emulsion explosives encounter in utilization, a hydrogen-based emulsion explosives was devised. This type of emulsion explosives is sensitized by hydrogen-containing material MgH2, and MgH2 plays a double role as a sensitizer and an energetic material in emulsion explosives. Underwater explosion experiments and shock wave desensitization experiments show that an MgH2 emulsion explosives has excellent detonation characteristics and is resistant to pressure desensitization. The pressure desensitization-resistant mechanism of MgH2 emulsion explosives was investigated using scanning electron microscopy.

  3. Numerical computation algorithm of explosion equations and thermodynamics parameters of mine explosives

    Institute of Scientific and Technical Information of China (English)

    李守巨; 刘迎曦; 何翔; 周圆π

    2001-01-01

    A new numerical algorithm is presented to simulate the explosion reaction process of mine explosives based on the equation of state, the equation of mass conservation and thermodynamics balance equation of explosion products. With the affection of reversible reaction of explosion products to explosion reaction equations and thermodynamics parameters considered, the computer program has been developed. The computation values show that computer simulation results are identical with the testinq ones.

  4. Numerical computation algorithm of explosion equations and thermodynamics parameters of mine explosives

    Institute of Scientific and Technical Information of China (English)

    LI Shou-ju; LIU Ying-xi; HE Xiang; ZHOU Y uan-pai

    2001-01-01

    A new numerical algorithm is presented to simulate the explosion reacti on process of mine explosives based on the equation of state, the equation of ma ss conservation and thermodynamics balance equation of explosion products. With the affection of reversible reaction of explosion products to explosion reaction equations and thermodynamics parameters considered, the computer program has be en developed. The computation values show that computer simulation results are i dentical with the testing ones.

  5. Gas explosions - an elementary account; Eksplosiv fare

    Energy Technology Data Exchange (ETDEWEB)

    Seehusen, Joachim

    2002-07-01

    Although in a typical gas explosion the flame front propagates at sub-sonic speed, it still moves fast. Safety people often believe they can run away from a gas explosion. While gas explosions are well understood in the major companies, this is not true in many small ones, and people often do not realise how small the difference may be between a small puff and a dangerous explosion. Of special interest in a ''hydrogen society'' is the fact that hydrogen is dangerous and must be handled with care. The article discusses in an elementary way some of the basic concepts from the physics of gas explosions.

  6. Damage Effects of Shelled Explosive Explosion in Concrete

    Directory of Open Access Journals (Sweden)

    Liu Yan

    2010-10-01

    Full Text Available The damage of concrete subjected to explosion loading is an important issue in defense engineering. The damage degree of concrete is related to many factors, such as the type of explosive charge, the depth of burial and the parameters of concrete. In this paper, three factors are considered for experiments of shelled explosives in concrete targets, which are the filling coefficient, length-to-diameter ratio and the depth of burial. The filling coefficient is from 0.1 to 1 by changing thickness of shell, and length-to-diameter ratio is from 2.5 to 10. The unconfined compressive strength of concrete target for test is 35MPa. The experimental results showed that the sizes of craters of concretes are varied as the filling coefficient, length-to-diameter ratio and the depth of burial. The optimal values of filling coefficient, length-to-diameter ratio and the depth of burial of shelled charges were obtained to get largest damage regions of concrete targets. This work provides a base for evaluating the damage of concrete and designing the penetrating warhead.Defence Science Journal, 2010, 60(6, pp.672-677, DOI:http://dx.doi.org/10.14429/dsj.60.434

  7. The 15q11.2 BP1–BP2 Microdeletion Syndrome: A Review

    Directory of Open Access Journals (Sweden)

    Devin M. Cox

    2015-02-01

    Full Text Available Patients with the 15q11.2 BP1–BP2 microdeletion can present with developmental and language delay, neurobehavioral disturbances and psychiatric problems. Autism, seizures, schizophrenia and mild dysmorphic features are less commonly seen. The 15q11.2 BP1–BP2 microdeletion involving four genes (i.e., TUBGCP5, CYFIP1, NIPA1, NIPA2 is emerging as a recognized syndrome with a prevalence ranging from 0.57%–1.27% of patients presenting for microarray analysis which is a two to four fold increase compared with controls. Review of clinical features from about 200 individuals were grouped into five categories and included developmental (73% and speech (67% delays; dysmorphic ears (46% and palatal anomalies (46%; writing (60% and reading (57% difficulties, memory problems (60% and verbal IQ scores ≤75 (50%; general behavioral problems, unspecified (55% and abnormal brain imaging (43%. Other clinical features noted but not considered as common were seizures/epilepsy (26%, autism spectrum disorder (27%, attention deficit disorder (ADD/attention deficit hyperactivity disorder (ADHD (35%, schizophrenia/paranoid psychosis (20% and motor delay (42%. Not all individuals with the deletion are clinically affected, yet the collection of findings appear to share biological pathways and presumed genetic mechanisms. Neuropsychiatric and behavior disturbances and mild dysmorphic features are associated with genomic imbalances of the 15q11.2 BP1–BP2 region, including microdeletions, but with an apparent incomplete penetrance and variable expressivity.

  8. RANCHERO explosive pulsed power experiments

    CERN Document Server

    Goforth, J H; Armijo, E V; Atchison, W L; Bartos, Yu; Clark, D A; Day, R D; Deninger, W J; Faehl, R J; Fowler, C M; García, F P; García, O F; Herrera, D H; Herrera, T J; Keinigs, R K; King, J C; Lindemuth, I R; López, E; Martínez, E C; Martínez, D; McGuire, J A; Morgan, D; Oona, H; Oro, D M; Parker, J V; Randolph, R B; Reinovsky, R E; Rodríguez, G; Stokes, J L; Sena, F C; Tabaka, L J; Tasker, D G; Taylor, A J; Torres, D T; Anderson, H D; Broste, W B; Johnson, J B; Kirbie, H C

    1999-01-01

    The authors are developing the RANCHERO high explosive pulsed power (HEPP) system to power cylindrically imploding solid-density liners for hydrodynamics experiments. Their near-term goal is to conduct experiments in the regime pertinent to the Atlas capacitor bank. That is, they will attempt to implode liners of ~50 g mass at velocities approaching 15 km/sec. The basic building block of the HEPP system is a coaxial generator with a 304.8 mm diameter stator, and an initial armature diameter of 152 mm. The armature is expanded by a high explosive (HE) charge detonated simultaneously along its axis. The authors have reported a variety of experiments conducted with generator modules 43 cm long and have presented an initial design for hydrodynamic liner experiments. In this paper, they give a synopsis of their first system test, and a status report on the development of a generator module that is 1.4 m long. (6 refs).

  9. Determination of Nanogram Microparticles from Explosives after Real Open-Air Explosions by Confocal Raman Microscopy.

    Science.gov (United States)

    Zapata, Félix; García-Ruiz, Carmen

    2016-07-05

    Explosives are increasingly being used for terrorist attacks to cause devastating explosions. The detection of their postblast residues after an explosion is a high challenge, which has been barely investigated, particularly using spectroscopic techniques. In this research, a novel methodology using confocal Raman microscopy has been developed for the analysis of postblast residues from 10 open-air explosions caused by 10 different explosives (TNT, RDX, PETN, TATP, HMTD, dynamite, black powder, ANFO, chloratite, and ammonal) commonly used in improvised explosive devices. The methodology for the determination of postblast particles from explosives consisted of examining the samples surfaces with both the naked eye, first, and microscopically (10× and 50×), immediately afterward; and finally, analyzing the selected residues by confocal Raman spectroscopy in order to identify the postblast particles from explosives. Interestingly, confocal Raman microscopy has demonstrated to be highly suitable to rapidly, selectively, and noninvasively analyze postblast microscopic particles from explosives up to the nanogram range.

  10. Trace Explosives Detection by Photoluminescence

    OpenAIRE

    2004-01-01

    Some field tests in counter-terrorism efforts to detect explosive traces employ chemistries that yield colored products. We have examined a test kit of this kind, ETKPlus, based on widely used chemistries and employed extensively by the Israel Police. Our investigation focuses on the prospect of gaining sensitivity by replacing the normal colorimetric modality with photoluminescence detection, which, to our knowledge, has not been explored to date. We find two or more orders of magnitude sens...

  11. LX-10 Explosive Damage Studies

    Science.gov (United States)

    2015-03-03

    Suite NAWCWD TM 8757 6 where P = System pressure Vs = System volume n = Covolume we = Weight of explosive burned F = Impetus, f...simultaneously ignited and regress uniformly, and the regression rate depends only on pressure and propellant temperature. 2. Heat losses from the bomb are...and fired in a manometric closed vessel. The pressure -time history was recorded, and an analysis of the data was performed to evaluate both the

  12. EXPLOSION RISK ASSESSMENTS FOR FACILITIES

    Directory of Open Access Journals (Sweden)

    Martin KULICH

    2015-12-01

    Full Text Available In the first part of the article we discuss the possibilities and analytical tools that can deal with the classification of space into zones with danger of explosion for devices with the presence of compressed flammable gases. Then we continue with specifications of possibilities for practical utilization linked to variables such as ventilation degree, hypothetical volume etc., including the examples. At the end we also give a brief overview of software for modelling gas leak, including examples of an outcome.

  13. Shell and explosive hydrogen burning

    CERN Document Server

    Boeltzig, A; Cavanna, F; Cristallo, S; Davinson, T; Depalo, R; deBoer, R J; Di Leva, A; Ferraro, F; Imbriani, G; Marigo, P; Terrasi, F; Wiescher, M

    2016-01-01

    The nucleosynthesis of light elements, from helium up to silicon, mainly occurs in Red Giant and Asymptotic Giant Branch stars and Novae. The relative abundances of the synthesized nuclides critically depend on the rates of the nuclear processes involved, often through non-trivial reaction chains, combined with complex mixing mechanisms. In this review, we summarize the contributions made by LUNA experiments in furthering our understanding of nuclear reaction rates necessary for modeling nucleosynthesis in AGB stars and Novae explosions.

  14. Fuze for explosive magnetohydrodynamic generator

    Energy Technology Data Exchange (ETDEWEB)

    Webb, G.

    1976-12-23

    An apparatus is examined by which high explosive charges are propelled into and detonated at the center of an MHD-X generator. The high explosive charge units are engaged and propelled by a reciprocating ram device. Detonating in each instance is achieved by striking with a firing pin a detonator charge that is in register with a booster charge, the booster charge being in detonating communication with the high explosive charge. Various safety requirements are satisfied by a spring loaded slider operating in a channel transverse and adjacent to the booster charge. The slide retains the detonator charge out of register with the booster charge until a safety pin that holds the slider in place is pulled by a lanyard attached between the reciprocating ram and the safety pin. Removal of the safety pin permits the detonator charge to slide into alignment with the booster charge. Firing pin actuation is initiated by the slider at the instant the detonator charge and the booster charge come into register.

  15. Nuclear Explosions 1945-1998

    Energy Technology Data Exchange (ETDEWEB)

    Bergkvist, Nils-Olov; Ferm, Ragnhild

    2000-07-01

    The main part of this report is a list of nuclear explosions conducted by the United States, the Soviet Union, the United Kingdom, France, China, India and Pakistan in 1945-98. The list includes all known nuclear test explosions and is compiled from a variety of sources including officially published information from the USA, Russia and France. The details given for each explosion (date, origin time, location, yield, type, etc.) are often compiled from more than one source because the individual sources do not give complete information. The report includes a short background to nuclear testing and provides brief information on the Comprehensive Nuclear-Test-Ban Treaty and the verification regime now being established to verify compliance with the treaty. It also summarizes nuclear testing country by country. The list should be used with some caution because its compilation from a variety of sources means that some of the data could be incorrect. This report is the result of cooperation between the Defence Research Establishment (FOA) and the Stockholm International Peace Research Institute (SIPRI)

  16. Thermodynamic States in Explosion Fields

    Energy Technology Data Exchange (ETDEWEB)

    Kuhl, A L

    2010-03-12

    We investigate the thermodynamic states occurring in explosion fields from condensed explosive charges. These states are often modeled with a Jones-Wilkins-Lee (JWL) function. However, the JWL function is not a Fundamental Equation of Thermodynamics, and therefore cannot give a complete specification of such states. We use the Cheetah code of Fried to study the loci of states of the expanded detonation products gases from C-4 charges, and their combustion products air. In the Le Chatelier Plane of specific-internal-energy versus temperature, these loci are fit with a Quadratic Model function u(T), which has been shown to be valid for T < 3,000 K and p < 1k-bar. This model is used to derive a Fundamental Equation u(v,s) for C-4. Given u(v,s), one can use Maxwell's Relations to derive all other thermodynamic functions, such as temperature: T(v,s), pressure: p(v,s), enthalpy: h(v,s), Gibbs free energy: g(v,s) and Helmholz free energy: f(v,s); these loci are displayed in figures for C-4. Such complete equations of state are needed for numerical simulations of blast waves from explosive charges, and their reflections from surfaces.

  17. Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  18. Air Monitoring Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  19. Waste Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  20. Air Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  1. Sediment Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  2. AcEST: BP920020 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_B05 91 Adiantum capillus-veneris mRNA. clone: YMU001_000132_B05. BP920020 - Show BP920020... mRNA. clone: YMU001_000132_B05. Accession BP920020 Tissue type prothallium Developmental stage - Contig ID

  3. AcEST: BP919848 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H02 84 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H02. BP919848 - Show BP91984... mRNA. clone: YMU001_000129_H02. Accession BP919848 Tissue type prothallium Developmental stage - Contig ID

  4. AcEST: BP916868 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000093_A02 72 Adiantum capillus-veneris mRNA. clone: YMU001_000093_A02. BP916868 - Show BP916868... mRNA. clone: YMU001_000093_A02. Accession BP916868 Tissue type prothallium Developmental stage - Contig ID

  5. AcEST: BP915006 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_D07 96 Adiantum capillus-veneris mRNA. clone: YMU001_000065_D07. BP915006 - Show BP91500... mRNA. clone: YMU001_000065_D07. Accession BP915006 Tissue type prothallium Developmental stage - Contig ID

  6. AcEST: BP911835 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G02 27 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G02. BP911835 - Show BP91183... mRNA. clone: YMU001_000009_G02. Accession BP911835 Tissue type prothallium Developmental stage - Contig ID

  7. AcEST: BP911839 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G06 76 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G06. BP911839 - Show BP91183... mRNA. clone: YMU001_000009_G06. Accession BP911839 Tissue type prothallium Developmental stage - Contig ID

  8. AcEST: BP912001 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_H05 68 Adiantum capillus-veneris mRNA. clone: YMU001_000011_H05. BP912001 - Show BP9120... mRNA. clone: YMU001_000011_H05. Accession BP912001 Tissue type prothallium Developmental stage - Contig ID

  9. AcEST: BP920096 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_H11 24 Adiantum capillus-veneris mRNA. clone: YMU001_000132_H11. BP920096 - Show BP9200... mRNA. clone: YMU001_000132_H11. Accession BP920096 Tissue type prothallium Developmental stage - Contig ID

  10. AcEST: BP917073 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E10 67 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E10. BP917073 - Show BP91707... mRNA. clone: YMU001_000095_E10. Accession BP917073 Tissue type prothallium Developmental stage - Contig ID

  11. AcEST: BP919947 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A11 35 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A11. BP919947 - Show BP91994... mRNA. clone: YMU001_000131_A11. Accession BP919947 Tissue type prothallium Developmental stage - Contig ID

  12. AcEST: BP915916 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D12 73 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D12. BP915916 - Show BP91591... mRNA. clone: YMU001_000079_D12. Accession BP915916 Tissue type prothallium Developmental stage - Contig ID

  13. Biogeochemical Cycling

    Science.gov (United States)

    Bebout, Brad; Fonda, Mark (Technical Monitor)

    2002-01-01

    This lecture will introduce the concept of biogeochemical cycling. The roles of microbes in the cycling of nutrients, production and consumption of trace gases, and mineralization will be briefly introduced.

  14. Thermal explosion in oscillating ambient conditions

    Science.gov (United States)

    Novozhilov, Vasily

    2016-07-01

    Thermal explosion problem for a medium with oscillating ambient temperature at its boundaries is considered. This is a new problem in thermal explosion theory, not previously considered in a distributed system formulation, but important for combustion and fire science. It describes autoignition of wide range of fires (such as but not limited to piles of biosolids and other organic matter; storages of munitions, explosives, propellants) subjected to temperature variations, such as seasonal or day/night variation. The problem is considered in formulation adopted in classical studies of thermal explosion. Critical conditions are determined by frequency and amplitude of ambient temperature oscillations, as well as by a number of other parameters. Effects of all the parameters on critical conditions are quantified. Results are presented for the case of planar symmetry. Development of thermal explosion in time is also considered, and a new type of unsteady thermal explosion development is discovered where thermal runaway occurs after several periods of temperature oscillations within the medium.

  15. Numerical computations of explosions in gases

    Science.gov (United States)

    Chushkin, P. I.; Shurshalov, L. V.

    The development and the present-day state of the problem on numerical computations of explosions in gases are reviewed. In the first part, different one-dimensional cases are discussed: point explosion with counterpressure, blast-like expansion of volumes filled with a compressed hot gas, blast of charges of condensed explosive, explosion processes in real high-temperature air, in combustible detonating media and under action of other physical-chemical factors. In the second part devoted to two-dimensional flows, we consider explosion in the non-homogeneous atmosphere, blast of asymmetric charges, detonation in gas, explosion modelling of some cosmic phenomena (solar flares, the Tunguska meteorite). The survey includes about 110 works beginning with the first publications on the subject.

  16. Explosively Bonded Gun Tube Liner Development

    Science.gov (United States)

    2015-04-01

    FOR OFFICIAL USE ONYLFGFF ARL-CR-0771 ● APR 2015 US Army Research Laboratory Explosively Bonded Gun Tube Liner Development...return it to the originator. ARL-CR-0771 ● APR 2015 US Army Research Laboratory Explosively Bonded Gun Tube Liner Development...COVERED (From - To) 12 January 2014–1 January 2015 4. TITLE AND SUBTITLE Explosively Bonded Gun Tube Liner Development 5a. CONTRACT NUMBER ORISE 1120

  17. Land surface temperature changes in Northern Iberia since 4000 yr BP, based on δ13C of speleothems

    Science.gov (United States)

    Martín-Chivelet, Javier; Muñoz-García, M. Belén; Edwards, R. Lawrence; Turrero, María J.; Ortega, Ana I.

    2011-05-01

    The surface temperature changes for the last 4000 years in northern inland Iberia (an area particularly sensitive to climate change) are determined by a high resolution study of carbon stable isotope records of stalagmites from three caves (Kaite, Cueva del Cobre, and Cueva Mayor) separated several tens of kilometers away in N Spain. Despite the local conditions of each cave, the isotopic series show a good overall coherence, and resulted to be strongly sensitive to surface temperature changes. The record reflects alternating warmer and colder intervals, always within a temperature range of 1.6 °C. The timing and duration of the intervals were provided by 43 230Th- 234U (ICP-MS) ages. Main climatic recognized periods are: (1) 3950-3000 yr BP: warm period punctuated by cool events around ~ 3950, 3550 and 3250 yr BP; (2) 2850-2500 yr BP cold interval (Iron Age Cold Period); (3) 2500-1650 yr BP moderate warm period (Roman Warm Period), with maximum temperatures between 2150 and 1750 yr BP; (4) 1650-1350 yr BP cold interval (Dark Ages Cold Period), with a thermal minimum at ~ 1500 yr BP; (5) 1350-750 yr BP warm period (Medieval Warm Period) punctuated by two cooler events at ~ 1250 and ~ 850 yr BP; (6) 750-100 yr BP cold period (Little Ice Age) with extremes occurring at 600-500 yr BP, 350-300 yr BP, and 150-100 yr BP; and (7) the last 150 years, characterized by rapid but no linear warming (Modern Warming). Remarkably, the presented records allow direct comparison of recent warming with former warm intervals such as the Roman or the Medieval periods. That comparison reveals the 20th century as the time with highest surface temperatures of the last 4000 years for the studied area. Spectral analysis of the time series shows consistent climatic cycles of ~ 400, ~ 900 and ~ 1300 yr, comparable with those recognized in the North Atlantic marine record, the Greenland ice cores, and other terrestrial records for the middle-late Holocene, suggesting common climate forcing

  18. Deficiency in Either 4E-BP1 or 4E-BP2 Augments Innate Antiviral Immune Responses

    Science.gov (United States)

    Nehdi, Atef; Sean, Polen; Linares, Izzar; Colina, Rodney; Jaramillo, Maritza; Alain, Tommy

    2014-01-01

    Genetic deletion of both 4E-BP1 and 4E-BP2 was found to protect cells against viral infections. Here we demonstrate that the individual loss of either 4E-BP1 or 4E-BP2 in mouse embryonic fibroblasts (MEFs) is sufficient to confer viral resistance. shRNA-mediated silencing of 4E-BP1 or 4E-BP2 renders MEFs resistant to viruses, and compared to wild type cells, MEFs knockout for either 4E-BP1 or 4E-BP2 exhibit enhanced translation of Irf-7 and consequently increased innate immune response to viruses. Accordingly, the replication of vesicular stomatitis virus, encephalomyocarditis virus, influenza virus and Sindbis virus is markedly suppressed in these cells. Importantly, expression of either 4E-BP1 or 4E-BP2 in double knockout or respective single knockout cells diminishes their resistance to viral infection. Our data show that loss of 4E-BP1 or 4E-BP2 potentiates innate antiviral immunity. These results provide further evidence for translational control of innate immunity and support targeting translational effectors as an antiviral strategy. PMID:25531441

  19. Explosive Field Visualization Based on Image Fusion

    Institute of Scientific and Technical Information of China (English)

    ZHANG Wen-yao; JIANG Ling-shuang

    2009-01-01

    m the composite sequence. Experimental results show that the new images integrate the advantages of sources, effectively improve the visualization, and disclose more information about explosive field.

  20. Momentum transfer in indirect explosive drive

    Energy Technology Data Exchange (ETDEWEB)

    Kennedy, J.E.; Warnes, R.H. [Los Alamos National Lab., NM (United States); Cherry, C.R.; Cherry, C.R. Jr.; Fischer, S.H. [Sandia National Labs., Albuquerque, NM (United States)

    1996-07-01

    Material which is not in direct contact with detonating explosives may still be driven by the explosion through impact by driven material or by attachment to driven material. In such circumstances the assumption of inelastic collision permits estimation of the final velocity of an assemblage. Examples of the utility of this assumption are demonstrated through use of Gurney equations. The inelastic collision calculation may also be used for metal parts which are driven by explosives partially covering the metal. We offer a new discounting angle to account for side energy losses from laterally unconfined explosive charges in cases where the detonation wave travels parallel to the surface which is driven.

  1. High Explosives Research and Development (HERD) Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The purpose is to provide high explosive formulation, chemical analysis, safety and performance testing, processing, X-ray, quality control and loading support for...

  2. AcEST: BP919858 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_A04 328 Adiantum capillus-veneris mRNA. clone: YMU001_000130_A04. BP919858 - Show BP91985...is mRNA. clone: YMU001_000130_A04. Accession BP919858 Tissue type prothallium Developmental stage - Contig I...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91985...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919858|Adiantum capillu

  3. AcEST: BP919857 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_A03 501 Adiantum capillus-veneris mRNA. clone: YMU001_000130_A03. BP91985...7 CL3173Contig1 Show BP919857 Clone id YMU001_000130_A03 Library YMU01 Length 501 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000130_A03. Accession BP919857 Tissue type prothallium Developmental stag...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91985...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919857|Ad

  4. AcEST: BP919852 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H07 499 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H07. BP919852 - Show BP91985...is mRNA. clone: YMU001_000129_H07. Accession BP919852 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP919852|Adiantum capillus-veneris mRNA...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919852|Adiantum capillus-veneris mRNA, clo

  5. AcEST: BP911985 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_F08 421 Adiantum capillus-veneris mRNA. clone: YMU001_000011_F08. BP911985 - Show BP911985...is mRNA. clone: YMU001_000011_F08. Accession BP911985 Tissue type prothallium Developmental stage - Contig I...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91198...rams, Nucleic Acids Res. 25:3389-3402. Query= BP911985|Adiantum capillus-veneris

  6. AcEST: BP920171 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H05 509 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H05. BP920171 - Show BP92017...is mRNA. clone: YMU001_000133_H05. Accession BP920171 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92017...s. 25:3389-3402. Query= BP920171|Adiantum capillus-veneris mRNA, clone: YMU001_000133_H05. (509 letters) Dat

  7. AcEST: BP912017 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A11 578 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A11. BP912017... CL1368Contig1 Show BP912017 Clone id YMU001_000012_A11 Library YMU01 Length 578 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A11. Accession BP912017 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912017|Adiant...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912017|Adiantum capillus-veneris mRNA

  8. AcEST: BP920178 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A02 473 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A02. BP920178 - Show BP92017...is mRNA. clone: YMU001_000134_A02. Accession BP920178 Tissue type prothallium Developmental stage - Contig I...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92017... Res. 25:3389-3402. Query= BP920178|Adiantum capillus-veneris mRNA, clone: YMU001_000134_A02. (473 letters)

  9. AcEST: BP920175 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H09 490 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H09. BP920175 - Show BP92017...is mRNA. clone: YMU001_000133_H09. Accession BP920175 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92017...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920175|Adiantum

  10. AcEST: BP920174 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H08 486 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H08. BP920174 - Show BP92017...is mRNA. clone: YMU001_000133_H08. Accession BP920174 Tissue type prothallium Developmental stage - Contig I... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92017...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92017

  11. AcEST: BP913036 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_F11 458 Adiantum capillus-veneris mRNA. clone: YMU001_000025_F11. BP913036 - Show BP91303...is mRNA. clone: YMU001_000025_F11. Accession BP913036 Tissue type prothallium Developmental stage - Contig I...25:3389-3402. Query= BP913036|Adiantum capillus-veneris mRNA, clone: YMU001_00002...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91303

  12. AcEST: BP913037 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_F12 436 Adiantum capillus-veneris mRNA. clone: YMU001_000025_F12. BP913037 - Show BP91303...is mRNA. clone: YMU001_000025_F12. Accession BP913037 Tissue type prothallium Developmental stage - Contig I...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91303...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913037|Adiantum capillus-veneris mR

  13. AcEST: BP912303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000017_E02 524 Adiantum capillus-veneris mRNA. clone: YMU001_000017_E02. BP912303 - Show BP912303...is mRNA. clone: YMU001_000017_E02. Accession BP912303 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP912303|Adiantum capillus-veneris mRNA, clone: YMU001_000017_E02. (524 l...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912303|Adiantum capillus-veneris mRNA, clon

  14. AcEST: BP921303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000148_B08 459 Adiantum capillus-veneris mRNA. clone: YMU001_000148_B08. BP921303 - Show BP921303...is mRNA. clone: YMU001_000148_B08. Accession BP921303 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP921303|Adiantum capillus-veneris mRNA, clone: YMU001_000148_B...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921303

  15. AcEST: BP913031 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_F06 302 Adiantum capillus-veneris mRNA. clone: YMU001_000025_F06. BP91303...1 CL1500Contig1 Show BP913031 Clone id YMU001_000025_F06 Library YMU01 Length 302 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000025_F06. Accession BP913031 Tissue type prothallium Developmental stag...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91303...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91303

  16. AcEST: BP913303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000028_G07 539 Adiantum capillus-veneris mRNA. clone: YMU001_000028_G07. BP913303 - Show BP913303...is mRNA. clone: YMU001_000028_G07. Accession BP913303 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913303...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913303

  17. AcEST: BP914303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_D07 644 Adiantum capillus-veneris mRNA. clone: YMU001_000057_D07. BP914303... CL2270Contig1 Show BP914303 Clone id YMU001_000057_D07 Library YMU01 Length 644 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000057_D07. Accession BP914303 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914303|Adiantum capillus-veneri...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914303

  18. AcEST: BP913038 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_G01 564 Adiantum capillus-veneris mRNA. clone: YMU001_000025_G01. BP91303...8 CL793Contig1 Show BP913038 Clone id YMU001_000025_G01 Library YMU01 Length 564 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000025_G01. Accession BP913038 Tissue type prothallium Developmental stage...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913038|Adiant...Nucleic Acids Res. 25:3389-3402. Query= BP913038|Adiantum capillus-veneris mRNA, clone: YMU001_000025_G01. (

  19. AcEST: BP918303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_H04 288 Adiantum capillus-veneris mRNA. clone: YMU001_000111_H04. BP918303 - Show BP918303...is mRNA. clone: YMU001_000111_H04. Accession BP918303 Tissue type prothallium Developmental stage - Contig I... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918303|Adiantum capillus-veneris mRNA, clone: YM...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918303|

  20. AcEST: BP920303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000135_E01 493 Adiantum capillus-veneris mRNA. clone: YMU001_000135_E01. BP920303 - Show BP920303...is mRNA. clone: YMU001_000135_E01. Accession BP920303 Tissue type prothallium Developmental stage - Contig I...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920303...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920303|Adiantum capillus-

  1. AcEST: BP918043 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A02 493 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A02. BP91804...3 CL3885Contig1 Show BP918043 Clone id YMU001_000109_A02 Library YMU01 Length 493 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000109_A02. Accession BP918043 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91804...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91804

  2. AcEST: BP918040 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_H10 167 Adiantum capillus-veneris mRNA. clone: YMU001_000108_H10. BP918040 - Show BP91804...is mRNA. clone: YMU001_000108_H10. Accession BP918040 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918040|Adiantum capillus-veneris mRNA, clone: YMU001.... 25:3389-3402. Query= BP918040|Adiantum capillus-veneris mRNA, clone: YMU001_000108_H10. (167 letters) Data

  3. AcEST: BP911804 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_D03 453 Adiantum capillus-veneris mRNA. clone: YMU001_000009_D03. BP911804... CL245Contig1 Show BP911804 Clone id YMU001_000009_D03 Library YMU01 Length 453 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000009_D03. Accession BP911804 Tissue type prothallium Developmental stage...s Res. 25:3389-3402. Query= BP911804|Adiantum capillus-veneris mRNA, clone: YMU00... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911804|Adiantum capil

  4. AcEST: BP918044 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A03 150 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A03. BP918044 - Show BP91804...is mRNA. clone: YMU001_000109_A03. Accession BP918044 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91804...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918044|Adiantum cap

  5. AcEST: BP918047 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A06 349 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A06. BP91804...7 CL1525Contig1 Show BP918047 Clone id YMU001_000109_A06 Library YMU01 Length 349 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000109_A06. Accession BP918047 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918047|Adiantum capillus-veneris mRNA...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918047|Adian

  6. AcEST: BP918045 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A04 467 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A04. BP91804...5 CL1689Contig1 Show BP918045 Clone id YMU001_000109_A04 Library YMU01 Length 467 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000109_A04. Accession BP918045 Tissue type prothallium Developmental stag... programs, Nucleic Acids Res. 25:3389-3402. Query= BP918045|Adiantum capillus-ven...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918045|Adiantum capillus-veneris

  7. AcEST: BP918041 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_H11 404 Adiantum capillus-veneris mRNA. clone: YMU001_000108_H11. BP918041 - Show BP91804...is mRNA. clone: YMU001_000108_H11. Accession BP918041 Tissue type prothallium Developmental stage - Contig I... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918041|Adiantum c...eic Acids Res. 25:3389-3402. Query= BP918041|Adiantum capillus-veneris mRNA, clone: YMU001_000108_H11. (404

  8. AcEST: BP918048 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A07 409 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A07. BP918048 - Show BP91804...is mRNA. clone: YMU001_000109_A07. Accession BP918048 Tissue type prothallium Developmental stage - Contig I...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91804... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91804

  9. AcEST: BP918046 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A05 481 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A05. BP91804...6 CL10Contig1 Show BP918046 Clone id YMU001_000109_A05 Library YMU01 Length 481 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000109_A05. Accession BP918046 Tissue type prothallium Developmental stage ...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918046|Adi...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918046|Adiantum capillus-v

  10. AcEST: BP918049 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A08 458 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A08. BP91804...9 CL2636Contig1 Show BP918049 Clone id YMU001_000109_A08 Library YMU01 Length 458 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000109_A08. Accession BP918049 Tissue type prothallium Developmental stag...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918049|Adiantum capill...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918049|Adiantum ca

  11. AcEST: BP921260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_F02 609 Adiantum capillus-veneris mRNA. clone: YMU001_000147_F02. BP921260 - Show BP921260...is mRNA. clone: YMU001_000147_F02. Accession BP921260 Tissue type prothallium Developmental stage - Contig I...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921260...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP921260|Adiantum capillus-vener

  12. AcEST: BP913260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000028_C08 256 Adiantum capillus-veneris mRNA. clone: YMU001_000028_C08. BP913260 - Show BP913260...is mRNA. clone: YMU001_000028_C08. Accession BP913260 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913260|Adiantum capillus-veneris mRNA, clone: YMU00...25:3389-3402. Query= BP913260|Adiantum capillus-veneris mRNA, clone: YMU001_000028_C08. (256 letters) Databa

  13. AcEST: BP912607 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H02 459 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H02. BP912607 - Show BP91260...is mRNA. clone: YMU001_000020_H02. Accession BP912607 Tissue type prothallium Developmental stage - Contig I...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912607|Adiantum capill...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91260

  14. AcEST: BP912604 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_G11 244 Adiantum capillus-veneris mRNA. clone: YMU001_000020_G11. BP912604 - Show BP91260...is mRNA. clone: YMU001_000020_G11. Accession BP912604 Tissue type prothallium Developmental stage - Contig I...s, Nucleic Acids Res. 25:3389-3402. Query= BP912604|Adiantum capillus-veneris mRNA, clone: YMU001_000020_G11...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91260

  15. AcEST: BP919260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000123_A09 469 Adiantum capillus-veneris mRNA. clone: YMU001_000123_A09. BP919260 - Show BP919260...is mRNA. clone: YMU001_000123_A09. Accession BP919260 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919260|Adiantum capillu...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919260...ed signal transduction protein OS=Uncultured methanogenic archaeon RC-I GN=UNCMA_12260

  16. AcEST: BP918260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_D07 541 Adiantum capillus-veneris mRNA. clone: YMU001_000111_D07. BP918260 - Show BP918260...is mRNA. clone: YMU001_000111_D07. Accession BP918260 Tissue type prothallium Developmental stage - Contig I...ds Res. 25:3389-3402. Query= BP918260|Adiantum capillus-veneris mRNA, clone: YMU001_000111_D07. (521 letters.... 25:3389-3402. Query= BP918260|Adiantum capillus-veneris mRNA, clone: YMU001_000111_D07. (521 letters) Data

  17. AcEST: BP912605 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_G12 437 Adiantum capillus-veneris mRNA. clone: YMU001_000020_G12. BP91260...5 CL1961Contig1 Show BP912605 Clone id YMU001_000020_G12 Library YMU01 Length 437 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000020_G12. Accession BP912605 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91260...ams, Nucleic Acids Res. 25:3389-3402. Query= BP912605|Adiantum capillus-veneris mRNA, clone: YMU001_000020_G

  18. AcEST: BP912608 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H03 451 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H03. BP912608 - Show BP91260...is mRNA. clone: YMU001_000020_H03. Accession BP912608 Tissue type prothallium Developmental stage - Contig I...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91260...programs, Nucleic Acids Res. 25:3389-3402. Query= BP912608|Adiantum capillus-veneris mRNA, clone: YMU001_000

  19. AcEST: BP916260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000085_C09 277 Adiantum capillus-veneris mRNA. clone: YMU001_000085_C09. BP916260 - Show BP916260...is mRNA. clone: YMU001_000085_C09. Accession BP916260 Tissue type prothallium Developmental stage - Contig I...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916260|Adiantum capillus-vene...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916260

  20. AcEST: BP912600 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_G07 375 Adiantum capillus-veneris mRNA. clone: YMU001_000020_G07. BP91260...0 CL1497Contig1 Show BP912600 Clone id YMU001_000020_G07 Library YMU01 Length 375 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000020_G07. Accession BP912600 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912600|Adiantum capillus-vener...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912600|Adiantum capillus-vener

  1. AcEST: BP912601 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_G08 479 Adiantum capillus-veneris mRNA. clone: YMU001_000020_G08. BP912601 - Show BP91260...is mRNA. clone: YMU001_000020_G08. Accession BP912601 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP912601|Adiantum capillus-veneris m...ids Res. 25:3389-3402. Query= BP912601|Adiantum capillus-veneris mRNA, clone: YMU...SG-DTEDIHYQTITGLRKDLSGPSQEPSILTEQAIEDDSED 415 Query: 298 FLPVKANDQADDE 260 +++D +D E Sbjct: 416 SSSTESSDDSDT

  2. AcEST: BP919845 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G11 376 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G11. BP919845 - Show BP91984...is mRNA. clone: YMU001_000129_G11. Accession BP919845 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP919845|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G1...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919845|Adiantum capillus

  3. AcEST: BP919847 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H01 512 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H01. BP919847 - Show BP91984...is mRNA. clone: YMU001_000129_H01. Accession BP919847 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91984...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919847|Adiantum capillus-veneris mRNA, clone: YMU0

  4. AcEST: BP919849 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H04 454 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H04. BP919849 - Show BP91984...is mRNA. clone: YMU001_000129_H04. Accession BP919849 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP919849|Adiantum capillus-veneris mRNA, clone: YMU001_00...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP919849|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  5. AcEST: BP919842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G07 567 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G07. BP919842 - Show BP91984...is mRNA. clone: YMU001_000129_G07. Accession BP919842 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris m...c Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G07. (567 le

  6. AcEST: BP911984 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_F07 566 Adiantum capillus-veneris mRNA. clone: YMU001_000011_F07. BP911984... CL2332Contig1 Show BP911984 Clone id YMU001_000011_F07 Library YMU01 Length 566 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_F07. Accession BP911984 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911984|Adiantum capillus-veneris mR...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911984

  7. AcEST: BP919843 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G09 473 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G09. BP91984...3 CL2697Contig1 Show BP919843 Clone id YMU001_000129_G09 Library YMU01 Length 473 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_G09. Accession BP919843 Tissue type prothallium Developmental stag...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919843|Ad...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919843|Adiantum capillus-veneris

  8. AcEST: BP919840 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G05 476 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G05. BP919840 - Show BP91984...is mRNA. clone: YMU001_000129_G05. Accession BP919840 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP919840|Adiantum capillus-veneris mRNA, clone: YMU001_...es. 25:3389-3402. Query= BP919840|Adiantum capillus-veneris mRNA, clone: YMU001_0

  9. AcEST: BP921403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000149_D11 544 Adiantum capillus-veneris mRNA. clone: YMU001_000149_D11. BP921403... CL10Contig1 Show BP921403 Clone id YMU001_000149_D11 Library YMU01 Length 544 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000149_D11. Accession BP921403 Tissue type prothallium Developmental stage ...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP921403|Adiantum capillus-veneris mRNA, clone: YMU001_0...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921403

  10. AcEST: BP914032 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B03 607 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B03. BP914032 - Show BP91403...is mRNA. clone: YMU001_000039_B03. Accession BP914032 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914032|Adiantum...programs, Nucleic Acids Res. 25:3389-3402. Query= BP914032|Adiantum capillus-veneris mRNA, clone: YMU001_000

  11. AcEST: BP914403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_E06 616 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E06. BP914403 - Show BP914403...is mRNA. clone: YMU001_000058_E06. Accession BP914403 Tissue type prothallium Developmental stage - Contig I...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914403... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914403|Adiantum capillus-veneris mRNA, clone: YM...VEENATMHLPSLILILMKTCLD--PSISGKVTE 219 L D+ W + R +N TMHL ++ LM+ CLD P I+ V E Sbjct: 403

  12. AcEST: BP914034 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B05 392 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B05. BP91403...4 CL1150Contig1 Show BP914034 Clone id YMU001_000039_B05 Library YMU01 Length 392 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_B05. Accession BP914034 Tissue type prothallium Developmental stag...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914034|Adiantum capillus...s Res. 25:3389-3402. Query= BP914034|Adiantum capillus-veneris mRNA, clone: YMU00

  13. AcEST: BP914035 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B07 572 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B07. BP914035 - Show BP91403...is mRNA. clone: YMU001_000039_B07. Accession BP914035 Tissue type prothallium Developmental stage - Contig I...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP914035|Adiantum capillus-ve... Nucleic Acids Res. 25:3389-3402. Query= BP914035|Adiantum capillus-veneris mRNA, clone: YMU001_000039_B07.

  14. AcEST: BP914037 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B09 437 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B09. BP914037 - Show BP91403...is mRNA. clone: YMU001_000039_B09. Accession BP914037 Tissue type prothallium Developmental stage - Contig I... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914037|Adia... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914037|Adia

  15. AcEST: BP914039 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B11 577 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B11. BP91403...9 CL791Contig1 Show BP914039 Clone id YMU001_000039_B11 Library YMU01 Length 577 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_B11. Accession BP914039 Tissue type prothallium Developmental stage... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914039|Adiantum capillus-ven...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91403

  16. AcEST: BP914030 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_A12 427 Adiantum capillus-veneris mRNA. clone: YMU001_000039_A12. BP914030 - Show BP91403...is mRNA. clone: YMU001_000039_A12. Accession BP914030 Tissue type prothallium Developmental stage - Contig I...ds Res. 25:3389-3402. Query= BP914030|Adiantum capillus-veneris mRNA, clone: YMU0...WNALISGFTVHLHGDGALQCYEQMRQEGF 403 VSWN +ISG++++ A++ + +M++ Sbjct: 211 WNVMIDGYMRL...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914030|Adiantum capillus-v

  17. AcEST: BP916403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_C10 523 Adiantum capillus-veneris mRNA. clone: YMU001_000087_C10. BP916403... CL144Contig1 Show BP916403 Clone id YMU001_000087_C10 Library YMU01 Length 523 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000087_C10. Accession BP916403 Tissue type prothallium Developmental stage...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916403... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916403|Adiantum c

  18. AcEST: BP919403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G01 499 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G01. BP919403 - Show BP919403...is mRNA. clone: YMU001_000124_G01. Accession BP919403 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP919403|Adiantum capillus-veneris mRNA, clone: YMU001_000124_G01. (499 letters) Dat...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919403

  19. AcEST: BP912403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_F06 462 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F06. BP912403 - Show BP912403...is mRNA. clone: YMU001_000018_F06. Accession BP912403 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP912403|Adiantum capillus-veneris m...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912403|

  20. AcEST: BP915403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_B08 567 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B08. BP915403 - Show BP915403...is mRNA. clone: YMU001_000071_B08. Accession BP915403 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP915403|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B08. (567 letters) Dat...s, Nucleic Acids Res. 25:3389-3402. Query= BP915403|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B08

  1. AcEST: BP918403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B03 531 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B03. BP918403 - Show BP918403...is mRNA. clone: YMU001_000113_B03. Accession BP918403 Tissue type prothallium Developmental stage - Contig I...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918403...ucleic Acids Res. 25:3389-3402. Query= BP918403|Adiantum capillus-veneris mRNA, clone: YMU001_000113_B03. (5

  2. AcEST: BP914444 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_A03 493 Adiantum capillus-veneris mRNA. clone: YMU001_000059_A03. BP914444... CL1628Contig1 Show BP914444 Clone id YMU001_000059_A03 Library YMU01 Length 493 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_A03. Accession BP914444 Tissue type prothallium Developmental stag...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914444... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914444|Adiantum capillus-veneri

  3. AcEST: BP915008 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_D10 581 Adiantum capillus-veneris mRNA. clone: YMU001_000065_D10. BP915008 - Show BP91500...is mRNA. clone: YMU001_000065_D10. Accession BP915008 Tissue type prothallium Developmental stage - Contig I...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP915008|Adiantum capillus-veneris mRNA, clone: YMU001_0000...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915008|Adiant

  4. AcEST: BP917500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_F01 537 Adiantum capillus-veneris mRNA. clone: YMU001_000101_F01. BP917500 - Show BP917500...is mRNA. clone: YMU001_000101_F01. Accession BP917500 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP917500|Adiantum capillus-veneris mRNA, clone: YMU001_000101...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917500|Adiantum capillus-veneris

  5. AcEST: BP915500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_D04 497 Adiantum capillus-veneris mRNA. clone: YMU001_000072_D04. BP915500... CL2883Contig1 Show BP915500 Clone id YMU001_000072_D04 Library YMU01 Length 497 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000072_D04. Accession BP915500 Tissue type prothallium Developmental stag...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915500...programs, Nucleic Acids Res. 25:3389-3402. Query= BP915500|Adiantum capillus-veneris mRNA, clone: YMU001_000

  6. AcEST: BP915002 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_D03 491 Adiantum capillus-veneris mRNA. clone: YMU001_000065_D03. BP91500...2 CL2712Contig1 Show BP915002 Clone id YMU001_000065_D03 Library YMU01 Length 491 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000065_D03. Accession BP915002 Tissue type prothallium Developmental stag...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91500...grams, Nucleic Acids Res. 25:3389-3402. Query= BP915002|Adiantum capillus-veneris

  7. AcEST: BP915009 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_D11 575 Adiantum capillus-veneris mRNA. clone: YMU001_000065_D11. BP915009 - Show BP91500...is mRNA. clone: YMU001_000065_D11. Accession BP915009 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915009|Adiantum capillus-veneris mRNA, clone: ...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915009|

  8. AcEST: BP920500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000137_G11 581 Adiantum capillus-veneris mRNA. clone: YMU001_000137_G11. BP920500... CL3073Contig1 Show BP920500 Clone id YMU001_000137_G11 Library YMU01 Length 581 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000137_G11. Accession BP920500 Tissue type prothallium Developmental stag...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920500...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920500|Adiantum capill

  9. AcEST: BP921010 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E04 526 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E04. BP921010 - Show BP921010...is mRNA. clone: YMU001_000144_E04. Accession BP921010 Tissue type prothallium Developmental stage - Contig I...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921010|Adiantum capillus-veneris mRNA...programs, Nucleic Acids Res. 25:3389-3402. Query= BP921010|Adiantum capillus-veneris mRNA, clone: YMU001_000...002030-PA (Fragment) OS=Anopheles gambiae GN=AGAP002030 PE=4 SV=4 Length = 2210 S

  10. AcEST: BP915555 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000073_A05 516 Adiantum capillus-veneris mRNA. clone: YMU001_000073_A05. BP915555 - Show BP915555...is mRNA. clone: YMU001_000073_A05. Accession BP915555 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915555... Acids Res. 25:3389-3402. Query= BP915555|Adiantum capillus-veneris mRNA, clone: YMU001_000073_A05. (516 let

  11. AcEST: BP919975 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_E02 472 Adiantum capillus-veneris mRNA. clone: YMU001_000131_E02. BP919975 - Show BP919975...is mRNA. clone: YMU001_000131_E02. Accession BP919975 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP919975|Adiantum capillus-veneris mRNA, clone: YMU...cids Res. 25:3389-3402. Query= BP919975|Adiantum capillus-veneris mRNA, clone: YM

  12. AcEST: BP920157 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G01 550 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G01. BP92015...7 CL541Contig1 Show BP920157 Clone id YMU001_000133_G01 Library YMU01 Length 550 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_G01. Accession BP920157 Tissue type prothallium Developmental stage...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920157|Adiantum capillus-veneris mRNA,...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920157|Adiantum capillus-veneris

  13. AcEST: BP920152 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F06 457 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F06. BP920152 - Show BP92015...is mRNA. clone: YMU001_000133_F06. Accession BP920152 Tissue type prothallium Developmental stage - Contig I...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920152|Adiantu...Res. 25:3389-3402. Query= BP920152|Adiantum capillus-veneris mRNA, clone: YMU001_

  14. AcEST: BP920159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G03 420 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G03. BP920159 - Show BP92015...is mRNA. clone: YMU001_000133_G03. Accession BP920159 Tissue type prothallium Developmental stage - Contig I... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92015... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92015

  15. AcEST: BP920153 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F08 540 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F08. BP920153 - Show BP92015...is mRNA. clone: YMU001_000133_F08. Accession BP920153 Tissue type prothallium Developmental stage - Contig I...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920153|Adiantum capillus-veneris mRNA, clone: YMU...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920153|Adiantum capillus-ve

  16. AcEST: BP920156 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F12 587 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F12. BP92015...6 CL200Contig1 Show BP920156 Clone id YMU001_000133_F12 Library YMU01 Length 587 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_F12. Accession BP920156 Tissue type prothallium Developmental stage...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920156...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920156|Adiantum

  17. AcEST: BP920150 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F04 550 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F04. BP920150 - Show BP92015...is mRNA. clone: YMU001_000133_F04. Accession BP920150 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920150|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F04. (550 lette...c Acids Res. 25:3389-3402. Query= BP920150|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F04. (550 le

  18. AcEST: BP920856 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000142_E09 470 Adiantum capillus-veneris mRNA. clone: YMU001_000142_E09. BP920856... CL4215Contig1 Show BP920856 Clone id YMU001_000142_E09 Library YMU01 Length 470 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000142_E09. Accession BP920856 Tissue type prothallium Developmental stag...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920856|Adiantum capillus-... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920856|Adiantum capil

  19. AcEST: BP920000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_G10 490 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G10. BP920000 - Show BP920000...is mRNA. clone: YMU001_000131_G10. Accession BP920000 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920000...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920000|Adiantum capil

  20. AcEST: BP920127 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_D02 541 Adiantum capillus-veneris mRNA. clone: YMU001_000133_D02. BP92012...7 CL3843Contig1 Show BP920127 Clone id YMU001_000133_D02 Library YMU01 Length 541 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_D02. Accession BP920127 Tissue type prothallium Developmental stag...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920127|Adiantum capillus-ve... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920127|Adian

  1. AcEST: BP920124 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C09 380 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C09. BP920124 - Show BP92012...is mRNA. clone: YMU001_000133_C09. Accession BP920124 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920124|Adiantum capillus-veneris ...ic Acids Res. 25:3389-3402. Query= BP920124|Adiantum capillus-veneris mRNA, clone: YMU001_000133_C09. (380 l

  2. AcEST: BP920120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C05 434 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C05. BP920120 - Show BP92012...is mRNA. clone: YMU001_000133_C05. Accession BP920120 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920120|Ad...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920120|

  3. AcEST: BP920125 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C12 422 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C12. BP920125 - Show BP92012...is mRNA. clone: YMU001_000133_C12. Accession BP920125 Tissue type prothallium Developmental stage - Contig I...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92012...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92012

  4. AcEST: BP918377 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_G07 508 Adiantum capillus-veneris mRNA. clone: YMU001_000112_G07. BP9183...77 CL44Contig1 Show BP918377 Clone id YMU001_000112_G07 Library YMU01 Length 508 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000112_G07. Accession BP918377 Tissue type prothallium Developmental stage ...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918377|Adi

  5. AcEST: BP918324 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B09 441 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B09. BP918324 - Show BP9183...is mRNA. clone: YMU001_000112_B09. Accession BP918324 Tissue type prothallium Developmental stage - Contig I... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918324|Adiantum capillus-veneris

  6. AcEST: BP915183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_E04 303 Adiantum capillus-veneris mRNA. clone: YMU001_000067_E04. BP915183 - Show BP915183...is mRNA. clone: YMU001_000067_E04. Accession BP915183 Tissue type prothallium Developmental stage - Contig I...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915183...es. 25:3389-3402. Query= BP915183|Adiantum capillus-veneris mRNA, clone: YMU001_0

  7. AcEST: BP918359 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_E12 553 Adiantum capillus-veneris mRNA. clone: YMU001_000112_E12. BP9183...59 CL3958Contig1 Show BP918359 Clone id YMU001_000112_E12 Library YMU01 Length 553 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000112_E12. Accession BP918359 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918359|Adiantum capillus-veneri...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918359|Adiantum capillus-veneris mRNA, clone: Y

  8. AcEST: BP921832 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_F10 448 Adiantum capillus-veneris mRNA. clone: YMU001_000154_F10. BP921832 - Show BP92183...is mRNA. clone: YMU001_000154_F10. Accession BP921832 Tissue type prothallium Developmental stage - Contig I..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92183...s, Nucleic Acids Res. 25:3389-3402. Query= BP921832|Adiantum capillus-veneris mRNA, clone: YMU001_000154_F10

  9. AcEST: BP918353 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_E05 498 Adiantum capillus-veneris mRNA. clone: YMU001_000112_E05. BP9183...53 CL2530Contig1 Show BP918353 Clone id YMU001_000112_E05 Library YMU01 Length 498 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000112_E05. Accession BP918353 Tissue type prothallium Developmental stag...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918353|Adiantum capillus-veneris mRNA, clone: YMU00

  10. AcEST: BP918311 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A08 458 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A08. BP918311 - Show BP9183...is mRNA. clone: YMU001_000112_A08. Accession BP918311 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP918311|Adiantum capillus-veneris mRNA, clone...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918311|Adiantum capillus-veneris m

  11. AcEST: BP919183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_B10 484 Adiantum capillus-veneris mRNA. clone: YMU001_000122_B10. BP919183 - Show BP919183...is mRNA. clone: YMU001_000122_B10. Accession BP919183 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP919183|Adiantum capillus-veneris m..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919183

  12. AcEST: BP921836 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_G02 401 Adiantum capillus-veneris mRNA. clone: YMU001_000154_G02. BP921836 - Show BP92183...is mRNA. clone: YMU001_000154_G02. Accession BP921836 Tissue type prothallium Developmental stage - Contig I...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921836|Adiantum capillus-vener...s. 25:3389-3402. Query= BP921836|Adiantum capillus-veneris mRNA, clone: YMU001_000154_G02. (401 letters) Dat...GWEDVTRNSIGLIHSLEEDGDVGIAFCFRSKPFRCSVTDVEKVPPFEVG 1183 Score = 45.4 bits (106), Expect(2) = 9e-05 Identities

  13. AcEST: BP921837 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_G03 210 Adiantum capillus-veneris mRNA. clone: YMU001_000154_G03. BP921837 - Show BP92183...is mRNA. clone: YMU001_000154_G03. Accession BP921837 Tissue type prothallium Developmental stage - Contig I... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92183...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP921837|Adiantum capillus-veneris mRNA, clone: YMU0

  14. AcEST: BP918348 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_D12 438 Adiantum capillus-veneris mRNA. clone: YMU001_000112_D12. BP9183...48 CL3952Contig1 Show BP918348 Clone id YMU001_000112_D12 Library YMU01 Length 438 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000112_D12. Accession BP918348 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP918348|Adiantum capillus-veneris mRNA, clone: YMU0...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  15. AcEST: BP918328 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_C02 530 Adiantum capillus-veneris mRNA. clone: YMU001_000112_C02. BP918328 - Show BP9183...is mRNA. clone: YMU001_000112_C02. Accession BP918328 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918328|Adiantum capillus-veneris...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918328|Adian

  16. AcEST: BP918368 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_F10 559 Adiantum capillus-veneris mRNA. clone: YMU001_000112_F10. BP918368 - Show BP9183...is mRNA. clone: YMU001_000112_F10. Accession BP918368 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP918368|Adiantum capillus-veneris mRNA, clone: YMU001_000112_...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918368

  17. AcEST: BP918339 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_D02 499 Adiantum capillus-veneris mRNA. clone: YMU001_000112_D02. BP918339 - Show BP9183...is mRNA. clone: YMU001_000112_D02. Accession BP918339 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918339|Adiantum capillus-veneris mRNA, c

  18. AcEST: BP918316 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B01 479 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B01. BP9183...16 CL1887Contig1 Show BP918316 Clone id YMU001_000112_B01 Library YMU01 Length 479 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000112_B01. Accession BP918316 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918316|Adia...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  19. AcEST: BP918333 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_C07 551 Adiantum capillus-veneris mRNA. clone: YMU001_000112_C07. BP918333 - Show BP9183...is mRNA. clone: YMU001_000112_C07. Accession BP918333 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP918333|Adiantum capillus-veneris mRNA, clone: YMU001_000112_C07. (5... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  20. AcEST: BP921830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_F08 494 Adiantum capillus-veneris mRNA. clone: YMU001_000154_F08. BP92183...0 CL1991Contig1 Show BP921830 Clone id YMU001_000154_F08 Library YMU01 Length 494 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000154_F08. Accession BP921830 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92183...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92183

  1. AcEST: BP918392 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_A02 381 Adiantum capillus-veneris mRNA. clone: YMU001_000113_A02. BP918392 - Show BP9183...is mRNA. clone: YMU001_000113_A02. Accession BP918392 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918392|Adiantum capillus-veneris ...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918392|...TAKLGPNVSISANARIGPGVRLVGCIILDDVEIKEN 355 Query: 183 KCCDNALYHWMEVL-HWKMRQ---EYRESAIMLPNWE*QYLVKMFLCEDEVVVTSC

  2. AcEST: BP918372 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_G02 505 Adiantum capillus-veneris mRNA. clone: YMU001_000112_G02. BP918372 - Show BP9183...is mRNA. clone: YMU001_000112_G02. Accession BP918372 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918372... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918372|Adia

  3. AcEST: BP921833 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_F11 469 Adiantum capillus-veneris mRNA. clone: YMU001_000154_F11. BP921833 - Show BP92183...is mRNA. clone: YMU001_000154_F11. Accession BP921833 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP921833|Adiantum capillus-veneris mRNA, clone: YMU00...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92183

  4. AcEST: BP918300 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_H01 559 Adiantum capillus-veneris mRNA. clone: YMU001_000111_H01. BP918300 - Show BP9183...is mRNA. clone: YMU001_000111_H01. Accession BP918300 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP918300|Adiantum capillus-veneris mRNA, c...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  5. AcEST: BP913183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_D11 553 Adiantum capillus-veneris mRNA. clone: YMU001_000027_D11. BP913183 - Show BP913183...is mRNA. clone: YMU001_000027_D11. Accession BP913183 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913183|Adiantum capillus-veneris ...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913183

  6. AcEST: BP917183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_D01 417 Adiantum capillus-veneris mRNA. clone: YMU001_000097_D01. BP917183 - Show BP917183...is mRNA. clone: YMU001_000097_D01. Accession BP917183 Tissue type prothallium Developmental stage - Contig I... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917183...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917183|Adiantum capillus-veneris m

  7. AcEST: BP918321 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B06 529 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B06. BP9183...21 CL638Contig1 Show BP918321 Clone id YMU001_000112_B06 Library YMU01 Length 529 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000112_B06. Accession BP918321 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918321|Adiantum capillus-veneris mRNA, clo... Acids Res. 25:3389-3402. Query= BP918321|Adiantum capillus-veneris mRNA, clone:

  8. AcEST: BP918357 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_E09 576 Adiantum capillus-veneris mRNA. clone: YMU001_000112_E09. BP918357 - Show BP9183...is mRNA. clone: YMU001_000112_E09. Accession BP918357 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918357|Adiantum capillus-veneris mRNA, c...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918357|Adiantum capillus

  9. AcEST: BP918319 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B04 586 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B04. BP918319 - Show BP9183...is mRNA. clone: YMU001_000112_B04. Accession BP918319 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918319|Adiantum...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918319|Adiantu

  10. AcEST: BP918340 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_D03 538 Adiantum capillus-veneris mRNA. clone: YMU001_000112_D03. BP918340 - Show BP9183...is mRNA. clone: YMU001_000112_D03. Accession BP918340 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP918340|Adiantum capillus-veneris mRNA, clone: YMU001_000112_D03. (524 lett... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  11. AcEST: BP918308 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A05 514 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A05. BP918308 - Show BP9183...is mRNA. clone: YMU001_000112_A05. Accession BP918308 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  12. AcEST: BP918332 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_C06 222 Adiantum capillus-veneris mRNA. clone: YMU001_000112_C06. BP918332 - Show BP9183...is mRNA. clone: YMU001_000112_C06. Accession BP918332 Tissue type prothallium Developmental stage - Contig I...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918332|Adiantum capillus-veneris mRNA, clo

  13. AcEST: BP918364 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_F06 521 Adiantum capillus-veneris mRNA. clone: YMU001_000112_F06. BP918364 - Show BP9183...is mRNA. clone: YMU001_000112_F06. Accession BP918364 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...ENAPVEDNVSHFSQ--------LKDQQPATLCYAPPLSTDDTAEILFTSG 183 Query: 372 TTSDPKGVVSSHRGAYIASLTACPVWGLKEGCIYLWTLPLFH...c Acids Res. 25:3389-3402. Query= BP918364|Adiantum capillus-veneris mRNA, clone:

  14. AcEST: BP918397 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_A08 462 Adiantum capillus-veneris mRNA. clone: YMU001_000113_A08. BP918397 - Show BP9183...is mRNA. clone: YMU001_000113_A08. Accession BP918397 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918397|Adiantum capillus-veneris mRNA, clone: YM...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918397

  15. AcEST: BP918345 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_D08 477 Adiantum capillus-veneris mRNA. clone: YMU001_000112_D08. BP918345 - Show BP9183...is mRNA. clone: YMU001_000112_D08. Accession BP918345 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP918345|Adiantum capillus-veneris mRNA, c... 25:3389-3402. Query= BP918345|Adiantum capillus-veneris mRNA, clone: YMU001_000112_D08. (477 letters) Datab

  16. AcEST: BP918331 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_C05 460 Adiantum capillus-veneris mRNA. clone: YMU001_000112_C05. BP918331 - Show BP9183...is mRNA. clone: YMU001_000112_C05. Accession BP918331 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP918331|Adiantum capillus-veneris mRNA, clone...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  17. AcEST: BP918313 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A10 512 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A10. BP918313 - Show BP9183...is mRNA. clone: YMU001_000112_A10. Accession BP918313 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918313|Adiantum capillus-veneris mRNA, clone: YMU001_000112_A...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918313|Adiantum capillus-veneris mR

  18. AcEST: BP918396 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_A07 400 Adiantum capillus-veneris mRNA. clone: YMU001_000113_A07. BP918396 - Show BP9183...is mRNA. clone: YMU001_000113_A07. Accession BP918396 Tissue type prothallium Developmental stage - Contig I...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918396|Adiantum capillus-veneris mRNA, clon... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918396|Adiantum c

  19. AcEST: BP918307 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A04 589 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A04. BP9183...07 CL4210Contig1 Show BP918307 Clone id YMU001_000112_A04 Library YMU01 Length 589 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000112_A04. Accession BP918307 Tissue type prothallium Developmental stag...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918307|Adiantum capi...rams, Nucleic Acids Res. 25:3389-3402. Query= BP918307|Adiantum capillus-veneris

  20. AcEST: BP918375 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_G05 494 Adiantum capillus-veneris mRNA. clone: YMU001_000112_G05. BP918375 - Show BP9183...is mRNA. clone: YMU001_000112_G05. Accession BP918375 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918375|Adiantum capillus-...s, Nucleic Acids Res. 25:3389-3402. Query= BP918375|Adiantum capillus-veneris mRN

  1. AcEST: BP918344 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_D07 527 Adiantum capillus-veneris mRNA. clone: YMU001_000112_D07. BP918344 - Show BP9183...is mRNA. clone: YMU001_000112_D07. Accession BP918344 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918344|Adiantum capillus-v

  2. AcEST: BP918373 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_G03 522 Adiantum capillus-veneris mRNA. clone: YMU001_000112_G03. BP918373 - Show BP9183...is mRNA. clone: YMU001_000112_G03. Accession BP918373 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  3. AcEST: BP918388 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_H09 552 Adiantum capillus-veneris mRNA. clone: YMU001_000112_H09. BP918388 - Show BP9183...is mRNA. clone: YMU001_000112_H09. Accession BP918388 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP918388|Adiantum capillus-veneris mRNA, clone: YMU001_000112_H09. (552 let...eic Acids Res. 25:3389-3402. Query= BP918388|Adiantum capillus-veneris mRNA, clone: YMU001_000112_H09. (552

  4. AcEST: BP920183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A07 427 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A07. BP920183 - Show BP920183...is mRNA. clone: YMU001_000134_A07. Accession BP920183 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920183...programs, Nucleic Acids Res. 25:3389-3402. Query= BP920183|Adiantum capillus-veneris mRNA, clone: YMU001_000

  5. AcEST: BP918315 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A12 550 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A12. BP918315 - Show BP9183...is mRNA. clone: YMU001_000112_A12. Accession BP918315 Tissue type prothallium Developmental stage - Contig I...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP918315|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  6. AcEST: BP919570 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000126_F05 404 Adiantum capillus-veneris mRNA. clone: YMU001_000126_F05. BP91957...0 CL2080Contig1 Show BP919570 Clone id YMU001_000126_F05 Library YMU01 Length 404 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000126_F05. Accession BP919570 Tissue type prothallium Developmental stag...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919570|A... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919570|Adiantum c

  7. AcEST: BP919578 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000126_G03 472 Adiantum capillus-veneris mRNA. clone: YMU001_000126_G03. BP919578 - Show BP91957...is mRNA. clone: YMU001_000126_G03. Accession BP919578 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP919578|Adiantum capillus-veneris...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919578|Adiantum capillus-veneris mRNA, clone: Y

  8. AcEST: BP919577 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000126_G02 494 Adiantum capillus-veneris mRNA. clone: YMU001_000126_G02. BP91957...7 CL2728Contig1 Show BP919577 Clone id YMU001_000126_G02 Library YMU01 Length 494 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000126_G02. Accession BP919577 Tissue type prothallium Developmental stag...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919577|Adiantum capill...Acids Res. 25:3389-3402. Query= BP919577|Adiantum capillus-veneris mRNA, clone: YMU001_000126_G02. (494 lett

  9. AcEST: BP911957 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_C07 599 Adiantum capillus-veneris mRNA. clone: YMU001_000011_C07. BP911957... CL144Contig1 Show BP911957 Clone id YMU001_000011_C07 Library YMU01 Length 599 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000011_C07. Accession BP911957 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911957|Adiantum capillus-ve... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911957|Adiant

  10. AcEST: BP916000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_G02 533 Adiantum capillus-veneris mRNA. clone: YMU001_000081_G02. BP916000 - Show BP916000...is mRNA. clone: YMU001_000081_G02. Accession BP916000 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916000...s Res. 25:3389-3402. Query= BP916000|Adiantum capillus-veneris mRNA, clone: YMU001_000081_G02. (533 letters)

  11. AcEST: BP912094 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_A09 564 Adiantum capillus-veneris mRNA. clone: YMU001_000015_A09. BP9120...94 CL2967Contig1 Show BP912094 Clone id YMU001_000015_A09 Library YMU01 Length 564 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_A09. Accession BP912094 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912094|Adiantum c...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  12. AcEST: BP912057 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E09 528 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E09. BP9120...57 CL1892Contig1 Show BP912057 Clone id YMU001_000012_E09 Library YMU01 Length 528 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_E09. Accession BP912057 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP912057|Adiantum capillus-veneris mRNA, clone: YMU001_000012_E09. (528 lett... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  13. AcEST: BP921209 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A04 535 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A04. BP921209 - Show BP92120...is mRNA. clone: YMU001_000147_A04. Accession BP921209 Tissue type prothallium Developmental stage - Contig I...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92120...grams, Nucleic Acids Res. 25:3389-3402. Query= BP921209|Adiantum capillus-veneris mRNA, clone: YMU001_000147

  14. AcEST: BP912061 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_F01 532 Adiantum capillus-veneris mRNA. clone: YMU001_000012_F01. BP912061 - Show BP9120...is mRNA. clone: YMU001_000012_F01. Accession BP912061 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  15. AcEST: BP912036 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_C09 555 Adiantum capillus-veneris mRNA. clone: YMU001_000012_C09. BP912036 - Show BP9120...is mRNA. clone: YMU001_000012_C09. Accession BP912036 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP912036|Adiantum capillus-veneris mRNA, clone: YMU001_000012_C0... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912036|Adiantum capillus-ven

  16. AcEST: BP912025 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_B09 484 Adiantum capillus-veneris mRNA. clone: YMU001_000012_B09. BP9120...25 CL1441Contig1 Show BP912025 Clone id YMU001_000012_B09 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_B09. Accession BP912025 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  17. AcEST: BP912042 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_D05 541 Adiantum capillus-veneris mRNA. clone: YMU001_000012_D05. BP912042 - Show BP9120...is mRNA. clone: YMU001_000012_D05. Accession BP912042 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP912042|Adiantum capillus-veneris mRNA, clone: YMU001_000012_D05. (541 le...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912042|Adiantum capil

  18. AcEST: BP921208 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A03 436 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A03. BP921208 - Show BP92120...is mRNA. clone: YMU001_000147_A03. Accession BP921208 Tissue type prothallium Developmental stage - Contig I..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92120... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921208|Adiantum c

  19. AcEST: BP912056 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E08 538 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E08. BP912056 - Show BP9120...is mRNA. clone: YMU001_000012_E08. Accession BP912056 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912056|Adiantum capillus-veneris mRNA, clone... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  20. AcEST: BP921120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000146_A02 427 Adiantum capillus-veneris mRNA. clone: YMU001_000146_A02. BP921120 - Show BP921120...is mRNA. clone: YMU001_000146_A02. Accession BP921120 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP921120|Adiantum capillus-veneris mRNA, clone: ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921120|Adian

  1. AcEST: BP912009 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A03 561 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A03. BP912009 - Show BP9120...is mRNA. clone: YMU001_000012_A03. Accession BP912009 Tissue type prothallium Developmental stage - Contig I...s, Nucleic Acids Res. 25:3389-3402. Query= BP912009|Adiantum capillus-veneris mRNA, clone: YMU001_000012_A03... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912009|Adian

  2. AcEST: BP912030 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_C03 525 Adiantum capillus-veneris mRNA. clone: YMU001_000012_C03. BP912030 - Show BP9120...is mRNA. clone: YMU001_000012_C03. Accession BP912030 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912030|Ad...cids Res. 25:3389-3402. Query= BP912030|Adiantum capillus-veneris mRNA, clone: YMU001_000012_C03. (513 lette

  3. AcEST: BP912050 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E01 544 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E01. BP912050 - Show BP9120...is mRNA. clone: YMU001_000012_E01. Accession BP912050 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912050|Adiantum capillus-veneris mRNA, c.... 25:3389-3402. Query= BP912050|Adiantum capillus-veneris mRNA, clone: YMU001_000

  4. AcEST: BP915615 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000073_F08 475 Adiantum capillus-veneris mRNA. clone: YMU001_000073_F08. BP915615... CL3512Contig1 Show BP915615 Clone id YMU001_000073_F08 Library YMU01 Length 475 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000073_F08. Accession BP915615 Tissue type prothallium Developmental stag...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915615|Adiantum capill...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915615|Adiantum capillus-veneris mRNA, clon

  5. AcEST: BP915815 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000077_C11 552 Adiantum capillus-veneris mRNA. clone: YMU001_000077_C11. BP915815... CL3742Contig1 Show BP915815 Clone id YMU001_000077_C11 Library YMU01 Length 552 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000077_C11. Accession BP915815 Tissue type prothallium Developmental stag...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP915815|Adiantum capillus-veneris mRNA, clone: YMU001... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915815|Adiant

  6. AcEST: BP915155 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_B08 468 Adiantum capillus-veneris mRNA. clone: YMU001_000067_B08. BP91515...5 CL2592Contig1 Show BP915155 Clone id YMU001_000067_B08 Library YMU01 Length 468 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000067_B08. Accession BP915155 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915155|Adiantum capillus-ven...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915

  7. AcEST: BP917474 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_C07 287 Adiantum capillus-veneris mRNA. clone: YMU001_000101_C07. BP917474... CL2332Contig1 Show BP917474 Clone id YMU001_000101_C07 Library YMU01 Length 287 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000101_C07. Accession BP917474 Tissue type prothallium Developmental stag...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917474|Adiantum capil...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917474|Adiantum capillus-veneris mRNA, clone: YMU001_

  8. Analysis list: Irf2bp2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Irf2bp2 Blood + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Irf2bp2.1....tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Irf2bp2.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Irf...2bp2.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Irf2bp2.Blood.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Blood.gml ...

  9. AcEST: BP921521 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000150_H10 495 Adiantum capillus-veneris mRNA. clone: YMU001_000150_H10. BP921521... CL1722Contig1 Show BP921521 Clone id YMU001_000150_H10 Library YMU01 Length 495 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000150_H10. Accession BP921521 Tissue type prothallium Developmental stag... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921521...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921521|Adia

  10. AcEST: BP921219 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B05 600 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B05. BP92121...9 CL3191Contig1 Show BP921219 Clone id YMU001_000147_B05 Library YMU01 Length 600 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000147_B05. Accession BP921219 Tissue type prothallium Developmental stag...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921219|Adiantum capillus-...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92121

  11. AcEST: BP921216 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B01 347 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B01. BP921216 - Show BP92121...is mRNA. clone: YMU001_000147_B01. Accession BP921216 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP921216|Adiantum capillus-veneris mRNA, clone: YMU001_00...tities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 116 LLQTLIVTGYISFDEHLHNPHLSKHSALHITK 21 L LI...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92121

  12. AcEST: BP921211 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A08 189 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A08. BP921211 - Show BP92121...is mRNA. clone: YMU001_000147_A08. Accession BP921211 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921211|Adiantum capillus-veneris... 25:3389-3402. Query= BP921211|Adiantum capillus-veneris mRNA, clone: YMU001_000147_A08. (189 letters) Datab

  13. AcEST: BP921821 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_E10 497 Adiantum capillus-veneris mRNA. clone: YMU001_000154_E10. BP921821 - Show BP921821...is mRNA. clone: YMU001_000154_E10. Accession BP921821 Tissue type prothallium Developmental stage - Contig I...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921821|Adiantum capill...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921821|Adiantum capillus-veneris mRNA, clone: Y...ct: 159 PTSLIQPSIVTSKKEETGIDEIIRGMRDLQIKFAKLEEKGQSPRISTKQKPRLMEGVVHR 218 Query: 237 CIWCDSTDHGRRDC 196 C+WCD+ DH RR+C Sbjct: 21

  14. AcEST: BP921021 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_F03 449 Adiantum capillus-veneris mRNA. clone: YMU001_000144_F03. BP921021... CL4025Contig1 Show BP921021 Clone id YMU001_000144_F03 Library YMU01 Length 449 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_F03. Accession BP921021 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP921021|Adiantum capillus-veneris mRNA, clone: Y...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921021|Adiantum capillus-veneris mRN

  15. AcEST: BP915100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000066_E04 551 Adiantum capillus-veneris mRNA. clone: YMU001_000066_E04. BP915100... CL3103Contig1 Show BP915100 Clone id YMU001_000066_E04 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000066_E04. Accession BP915100 Tissue type prothallium Developmental stag...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915100|Adiantum capillu...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP915100|Adiantum capillus-veneris mRNA, clone: YMU001

  16. AcEST: BP919100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_C03 561 Adiantum capillus-veneris mRNA. clone: YMU001_000121_C03. BP919100 - Show BP919100...is mRNA. clone: YMU001_000121_C03. Accession BP919100 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP919100|Adiantum capillus-veneris mRNA, clone: YMU001_000121_C03. (5...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919100

  17. AcEST: BP921003 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D08 457 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D08. BP92100...3 CL1992Contig1 Show BP921003 Clone id YMU001_000144_D08 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_D08. Accession BP921003 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP921003|Adiantum capillus-veneris mRNA, clone: YMU0...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921003|Adiantum capillus-vener

  18. AcEST: BP921006 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D12 494 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D12. BP921006 - Show BP92100...is mRNA. clone: YMU001_000144_D12. Accession BP921006 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921006|Adiantum capillus-...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP921006|Adiantum capillus-veneris mRNA, clone: YMU001_

  19. AcEST: BP917100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_H06 514 Adiantum capillus-veneris mRNA. clone: YMU001_000095_H06. BP917100 - Show BP917100...is mRNA. clone: YMU001_000095_H06. Accession BP917100 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917100|... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917100

  20. AcEST: BP921007 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E01 460 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E01. BP92100...7 CL57Contig1 Show BP921007 Clone id YMU001_000144_E01 Library YMU01 Length 460 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_E01. Accession BP921007 Tissue type prothallium Developmental stage ...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921007|Adiantum capill... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921007|Adiantum capillus-veneri

  1. AcEST: BP917432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_G02 450 Adiantum capillus-veneris mRNA. clone: YMU001_000100_G02. BP917432... CL1686Contig1 Show BP917432 Clone id YMU001_000100_G02 Library YMU01 Length 450 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_G02. Accession BP917432 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP917432|Adiantum capillus-veneris mRNA, clone: Y...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917432|Adiantum capillu

  2. AcEST: BP914326 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F07 599 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F07. BP91432...6 CL274Contig1 Show BP914326 Clone id YMU001_000057_F07 Library YMU01 Length 599 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000057_F07. Accession BP914326 Tissue type prothallium Developmental stage...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914326...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  3. AcEST: BP914321 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F02. BP914321 - Show BP91432...is mRNA. clone: YMU001_000057_F02. Accession BP914321 Tissue type prothallium Developmental stage - Contig I... 25:3389-3402. Query= BP914321|Adiantum capillus-veneris mRNA, clone: YMU001_000057_F02. (534 letters) Datab...leic Acids Res. 25:3389-3402. Query= BP914321|Adiantum capillus-veneris mRNA, clone: YMU001_000057_F02. (534

  4. AcEST: BP914432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_G12 488 Adiantum capillus-veneris mRNA. clone: YMU001_000058_G12. BP914432... CL2573Contig1 Show BP914432 Clone id YMU001_000058_G12 Library YMU01 Length 488 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000058_G12. Accession BP914432 Tissue type prothallium Developmental stag...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914432|...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914432|Adiantum ca

  5. AcEST: BP914324 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F05 457 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F05. BP91432...4 CL2609Contig1 Show BP914324 Clone id YMU001_000057_F05 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000057_F05. Accession BP914324 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914324|Adiantum capillus-vener...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  6. AcEST: BP913432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000030_B10 512 Adiantum capillus-veneris mRNA. clone: YMU001_000030_B10. BP913432 - Show BP913432...is mRNA. clone: YMU001_000030_B10. Accession BP913432 Tissue type prothallium Developmental stage - Contig I...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913432|Adiantum ... TY A +T+C Sbjct: 1417 TTVSPKTYTTATVTQC 1432 >sp|Q6ZRP5|YD019_HUMAN Putative uncharacterized protein FLJ4620...ucleic Acids Res. 25:3389-3402. Query= BP913432|Adiantum capillus-veneris mRNA, clone: YMU001_000030_B10. (5

  7. AcEST: BP914328 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F09 454 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F09. BP914328 - Show BP91432...is mRNA. clone: YMU001_000057_F09. Accession BP914328 Tissue type prothallium Developmental stage - Contig I...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  8. AcEST: BP914320 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F01 393 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F01. BP914320 - Show BP91432...is mRNA. clone: YMU001_000057_F01. Accession BP914320 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914320|Adiantum capillus-veneris mRNA, clone: Y...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  9. AcEST: BP920432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000137_A06 513 Adiantum capillus-veneris mRNA. clone: YMU001_000137_A06. BP920432 - Show BP920432...is mRNA. clone: YMU001_000137_A06. Accession BP920432 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920432...eic Acids Res. 25:3389-3402. Query= BP920432|Adiantum capillus-veneris mRNA, clone: YMU001_000137_A06. (513

  10. AcEST: BP911938 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_A06 103 Adiantum capillus-veneris mRNA. clone: YMU001_000011_A06. BP911938 - Show BP911938...is mRNA. clone: YMU001_000011_A06. Accession BP911938 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911938|Adiantum ca...programs, Nucleic Acids Res. 25:3389-3402. Query= BP911938|Adiantum capillus-veneris mRNA, clone: YMU001_000

  11. AcEST: BP919384 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E05 553 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E05. BP919384 - Show BP91938...is mRNA. clone: YMU001_000124_E05. Accession BP919384 Tissue type prothallium Developmental stage - Contig I... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91938...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91938

  12. AcEST: BP919381 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E02 515 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E02. BP919381 - Show BP91938...is mRNA. clone: YMU001_000124_E02. Accession BP919381 Tissue type prothallium Developmental stage - Contig I...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91938...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919381|Adiantum capillus-veneris

  13. AcEST: BP919386 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E08 575 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E08. BP919386 - Show BP91938...is mRNA. clone: YMU001_000124_E08. Accession BP919386 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919386|Adiantum capillus-veneris mRNA, clone: YMU001...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919386|Adiantum capillus-veneris mRNA, clo

  14. AcEST: BP919385 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E07 296 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E07. BP919385 - Show BP91938...is mRNA. clone: YMU001_000124_E07. Accession BP919385 Tissue type prothallium Developmental stage - Contig I...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91938...25:3389-3402. Query= BP919385|Adiantum capillus-veneris mRNA, clone: YMU001_00012...1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res.

  15. AcEST: BP919388 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E10 530 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E10. BP919388 - Show BP91938...is mRNA. clone: YMU001_000124_E10. Accession BP919388 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP919388|Adiantum capillus-veneris mRNA, clone: YMU001_000124_E10. ...cleic Acids Res. 25:3389-3402. Query= BP919388|Adiantum capillus-veneris mRNA, cl

  16. AcEST: BP919387 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E09 378 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E09. BP919387 - Show BP91938...is mRNA. clone: YMU001_000124_E09. Accession BP919387 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP919387|Adiantum capillus-veneris mRNA, clone: YMU001_000124... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919387|Adia

  17. AcEST: BP920052 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E03 500 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E03. BP92005...2 CL183Contig1 Show BP920052 Clone id YMU001_000132_E03 Library YMU01 Length 500 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000132_E03. Accession BP920052 Tissue type prothallium Developmental stage...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92005...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920052|Adian

  18. AcEST: BP920053 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E04 141 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E04. BP92005...3 CL323Contig1 Show BP920053 Clone id YMU001_000132_E04 Library YMU01 Length 141 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000132_E04. Accession BP920053 Tissue type prothallium Developmental stage... Nucleic Acids Res. 25:3389-3402. Query= BP920053|Adiantum capillus-veneris mRNA,...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920053

  19. AcEST: BP920058 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E09 507 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E09. BP92005...8 CL621Contig1 Show BP920058 Clone id YMU001_000132_E09 Library YMU01 Length 507 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000132_E09. Accession BP920058 Tissue type prothallium Developmental stage... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92005...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920058|Adiantu

  20. AcEST: BP920059 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E10 367 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E10. BP920059 - Show BP92005...is mRNA. clone: YMU001_000132_E10. Accession BP920059 Tissue type prothallium Developmental stage - Contig I...s, Nucleic Acids Res. 25:3389-3402. Query= BP920059|Adiantum capillus-veneris mRNA, clone: YMU001_000132_E10... programs, Nucleic Acids Res. 25:3389-3402. Query= BP920059|Adiantum capillus-veneris mRNA, clone: YMU001_00

  1. AcEST: BP920056 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E07 303 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E07. BP92005...6 CL779Contig1 Show BP920056 Clone id YMU001_000132_E07 Library YMU01 Length 303 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000132_E07. Accession BP920056 Tissue type prothallium Developmental stage... 25:3389-3402. Query= BP920056|Adiantum capillus-veneris mRNA, clone: YMU001_000132_E07. (303 letters) Datab... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92005

  2. AcEST: BP920051 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E02 361 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E02. BP92005...1 CL2821Contig1 Show BP920051 Clone id YMU001_000132_E02 Library YMU01 Length 361 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000132_E02. Accession BP920051 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920051|Adiant... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92005

  3. AcEST: BP919684 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_H09 516 Adiantum capillus-veneris mRNA. clone: YMU001_000127_H09. BP919684 - Show BP91968...is mRNA. clone: YMU001_000127_H09. Accession BP919684 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919684...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91968

  4. AcEST: BP919685 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_H10 544 Adiantum capillus-veneris mRNA. clone: YMU001_000127_H10. BP919685 - Show BP91968...is mRNA. clone: YMU001_000127_H10. Accession BP919685 Tissue type prothallium Developmental stage - Contig I... Res. 25:3389-3402. Query= BP919685|Adiantum capillus-veneris mRNA, clone: YMU001_000127_H10. (544 letters) ...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91968

  5. AcEST: BP919687 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_A01 517 Adiantum capillus-veneris mRNA. clone: YMU001_000128_A01. BP919687 - Show BP91968...is mRNA. clone: YMU001_000128_A01. Accession BP919687 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91968...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91968

  6. AcEST: BP919681 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_H06 556 Adiantum capillus-veneris mRNA. clone: YMU001_000127_H06. BP919681 - Show BP91968...is mRNA. clone: YMU001_000127_H06. Accession BP919681 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919681|Adiantum capillus-veneris m...ucleic Acids Res. 25:3389-3402. Query= BP919681|Adiantum capillus-veneris mRNA, clone: YMU001_000127_H06. (5

  7. AcEST: BP919683 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_H08 545 Adiantum capillus-veneris mRNA. clone: YMU001_000127_H08. BP919683 - Show BP91968...is mRNA. clone: YMU001_000127_H08. Accession BP919683 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP919683|Adiantum capillus-veneris mRNA, clone: YMU001_000127_H08. (545 lett... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919683|Adiantum capillus-veneri

  8. AcEST: BP917220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_G09 125 Adiantum capillus-veneris mRNA. clone: YMU001_000097_G09. BP917220 - Show BP917220...is mRNA. clone: YMU001_000097_G09. Accession BP917220 Tissue type prothallium Developmental stage - Contig I...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917220...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917220|Adiantum capillus-veneris

  9. AcEST: BP913220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_G12 489 Adiantum capillus-veneris mRNA. clone: YMU001_000027_G12. BP913220 - Show BP913220...is mRNA. clone: YMU001_000027_G12. Accession BP913220 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP913220|Adiantum capillus-veneris...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913220

  10. AcEST: BP915220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_H10 510 Adiantum capillus-veneris mRNA. clone: YMU001_000067_H10. BP915220 - Show BP915220...is mRNA. clone: YMU001_000067_H10. Accession BP915220 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915220...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915220|Adiantum capillus-veneris mRNA, clone: YMU

  11. AcEST: BP921220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B06 550 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B06. BP921220 - Show BP921220...is mRNA. clone: YMU001_000147_B06. Accession BP921220 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921220|Adiantum capillus-veneris mRNA, clone...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921220|Adiantum capillus-veneris mRNA, c

  12. AcEST: BP912209 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D06 540 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D06. BP912209 - Show BP91220...is mRNA. clone: YMU001_000016_D06. Accession BP912209 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912209|Adiantum capillus-veneris... programs, Nucleic Acids Res. 25:3389-3402. Query= BP912209|Adiantum capillus-veneris mRNA, clone: YMU001_00

  13. AcEST: BP912220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_E08 357 Adiantum capillus-veneris mRNA. clone: YMU001_000016_E08. BP912220 - Show BP912220...is mRNA. clone: YMU001_000016_E08. Accession BP912220 Tissue type prothallium Developmental stage - Contig I...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912220...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912220

  14. AcEST: BP912200 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_C08 572 Adiantum capillus-veneris mRNA. clone: YMU001_000016_C08. BP91220...0 CL3270Contig1 Show BP912200 Clone id YMU001_000016_C08 Library YMU01 Length 572 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_C08. Accession BP912200 Tissue type prothallium Developmental stag...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912200|Adiantum capillus-veneris mRNA, clo...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP912200|Adiantum capillus-vener

  15. AcEST: BP912206 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D03 484 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D03. BP912206 - Show BP91220...is mRNA. clone: YMU001_000016_D03. Accession BP912206 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912206|Adiantum capi...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91220

  16. AcEST: BP919883 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C06 445 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C06. BP91988...3 CL74Contig1 Show BP919883 Clone id YMU001_000130_C06 Library YMU01 Length 445 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000130_C06. Accession BP919883 Tissue type prothallium Developmental stage ...s Res. 25:3389-3402. Query= BP919883|Adiantum capillus-veneris mRNA, clone: YMU00...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919883|Adiantum capillus-veneris mRNA, clo

  17. AcEST: BP919888 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C11 410 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C11. BP919888 - Show BP91988...is mRNA. clone: YMU001_000130_C11. Accession BP919888 Tissue type prothallium Developmental stage - Contig I...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919888|Adiantum capillu...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919888|Adiantum capillus-

  18. AcEST: BP919885 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C08 326 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C08. BP91988...5 CL2Contig2 Show BP919885 Clone id YMU001_000130_C08 Library YMU01 Length 326 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000130_C08. Accession BP919885 Tissue type prothallium Developmental stage -...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP919885|Adiantum capillus-veneris mRNA, clone: YMU001_0001... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91988

  19. AcEST: BP911988 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_F12 484 Adiantum capillus-veneris mRNA. clone: YMU001_000011_F12. BP911988 - Show BP911988...is mRNA. clone: YMU001_000011_F12. Accession BP911988 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP911988|Adiantum capillus...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP911988|Adiantum capillus-veneris mRNA, clone: YMU0

  20. AcEST: BP919881 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C04 528 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C04. BP919881 - Show BP91988...is mRNA. clone: YMU001_000130_C04. Accession BP919881 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP919881|Adiantum capillus-veneris mRNA, clone: YMU001_000130_..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91988

  1. AcEST: BP919882 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C05. BP919882 - Show BP91988...is mRNA. clone: YMU001_000130_C05. Accession BP919882 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919882|Adiantum capillus-veneris m... Nucleic Acids Res. 25:3389-3402. Query= BP919882|Adiantum capillus-veneris mRNA, clone: YMU001_000130_C05.

  2. AcEST: BP919886 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C09 570 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C09. BP919886 - Show BP91988...is mRNA. clone: YMU001_000130_C09. Accession BP919886 Tissue type prothallium Developmental stage - Contig I...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919886|Adiantum capillus-vener... Res. 25:3389-3402. Query= BP919886|Adiantum capillus-veneris mRNA, clone: YMU001_000130_C09. (570 letters)

  3. AcEST: BP917072 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E09 516 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E09. BP917072 - Show BP91707...is mRNA. clone: YMU001_000095_E09. Accession BP917072 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP917072|Adiantum capillus-veneris mRNA, clone: YMU001_000095_E09. (516 let...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91707

  4. AcEST: BP917078 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_F03 438 Adiantum capillus-veneris mRNA. clone: YMU001_000095_F03. BP91707...8 CL4266Contig1 Show BP917078 Clone id YMU001_000095_F03 Library YMU01 Length 438 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000095_F03. Accession BP917078 Tissue type prothallium Developmental stag...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91707...programs, Nucleic Acids Res. 25:3389-3402. Query= BP917078|Adiantum capillus-vene

  5. AcEST: BP917071 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E08 525 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E08. BP917071 - Show BP91707...is mRNA. clone: YMU001_000095_E08. Accession BP917071 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91707...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917071|Adiantum capillus-veneris mRNA, clone: YMU0

  6. AcEST: BP917077 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_F02 487 Adiantum capillus-veneris mRNA. clone: YMU001_000095_F02. BP91707...7 CL10Contig1 Show BP917077 Clone id YMU001_000095_F02 Library YMU01 Length 487 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000095_F02. Accession BP917077 Tissue type prothallium Developmental stage ... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91707...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917077|

  7. AcEST: BP917074 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E11 418 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E11. BP91707...4 CL413Contig1 Show BP917074 Clone id YMU001_000095_E11 Library YMU01 Length 418 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000095_E11. Accession BP917074 Tissue type prothallium Developmental stage...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917074|Adiantum ...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP917074|Adiantum capillus-veneri

  8. AcEST: BP917070 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E07 451 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E07. BP917070 - Show BP91707...is mRNA. clone: YMU001_000095_E07. Accession BP917070 Tissue type prothallium Developmental stage - Contig I...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91707...s. 25:3389-3402. Query= BP917070|Adiantum capillus-veneris mRNA, clone: YMU001_000095_E07. (451 letters) Dat

  9. AcEST: BP916167 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_A11 268 Adiantum capillus-veneris mRNA. clone: YMU001_000084_A11. BP916167 - Show BP91616...is mRNA. clone: YMU001_000084_A11. Accession BP916167 Tissue type prothallium Developmental stage - Contig I... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916167|Adiantum capillus-veneris mRNA, ...ds Res. 25:3389-3402. Query= BP916167|Adiantum capillus-veneris mRNA, clone: YMU001_000084_A11. (253 letters

  10. AcEST: BP911616 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000007_B05 303 Adiantum capillus-veneris mRNA. clone: YMU001_000007_B05. BP911616 - Show BP911616...is mRNA. clone: YMU001_000007_B05. Accession BP911616 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911616|Adiantum capillus-... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911616...132 PE=4 SV=1 Length = 278 Score = 69.7 bits (169), Expect = 7e-11 Identities = 2

  11. AcEST: BP919946 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A10 457 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A10. BP919946 - Show BP91994...is mRNA. clone: YMU001_000131_A10. Accession BP919946 Tissue type prothallium Developmental stage - Contig I...s Res. 25:3389-3402. Query= BP919946|Adiantum capillus-veneris mRNA, clone: YMU00...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919946|A

  12. AcEST: BP911994 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_G08 559 Adiantum capillus-veneris mRNA. clone: YMU001_000011_G08. BP911994... CL4209Contig1 Show BP911994 Clone id YMU001_000011_G08 Library YMU01 Length 559 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_G08. Accession BP911994 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911994|Adiantum ... programs, Nucleic Acids Res. 25:3389-3402. Query= BP911994|Adiantum capillus-veneris mRNA, clone: YMU001_00

  13. AcEST: BP919948 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A12 489 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A12. BP919948 - Show BP91994...is mRNA. clone: YMU001_000131_A12. Accession BP919948 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919948|Adia...leic Acids Res. 25:3389-3402. Query= BP919948|Adiantum capillus-veneris mRNA, clone: YMU001_000131_A12. (489

  14. AcEST: BP919943 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_H11 517 Adiantum capillus-veneris mRNA. clone: YMU001_000130_H11. BP919943 - Show BP91994...is mRNA. clone: YMU001_000130_H11. Accession BP919943 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP919943|Adiantum capillus-veneris mRNA, clone: YMU001_000130_H11. (493 le... Res. 25:3389-3402. Query= BP919943|Adiantum capillus-veneris mRNA, clone: YMU001

  15. AcEST: BP919949 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_B01 318 Adiantum capillus-veneris mRNA. clone: YMU001_000131_B01. BP91994...9 CL2311Contig1 Show BP919949 Clone id YMU001_000131_B01 Library YMU01 Length 318 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_B01. Accession BP919949 Tissue type prothallium Developmental stag...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91994...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91994

  16. AcEST: BP918814 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000117_G04 548 Adiantum capillus-veneris mRNA. clone: YMU001_000117_G04. BP918814 - Show BP918814...is mRNA. clone: YMU001_000117_G04. Accession BP918814 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP918814|Adiantum capillus-veneris mRNA, clone: YMU001_000117_G04. (548 letters) Dat... Res. 25:3389-3402. Query= BP918814|Adiantum capillus-veneris mRNA, clone: YMU001_000117_G04. (548 letters)

  17. AcEST: BP918306 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A03 562 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A03. BP918306 - Show BP91830...is mRNA. clone: YMU001_000112_A03. Accession BP918306 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP918306|Adiantum capillus-veneris mRNA, clone: YMU001_000112_...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918306|Adiantum capillus-veneris mRNA, clone: YMU001_000112

  18. AcEST: BP918302 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_H03 457 Adiantum capillus-veneris mRNA. clone: YMU001_000111_H03. BP918302 - Show BP91830...is mRNA. clone: YMU001_000111_H03. Accession BP918302 Tissue type prothallium Developmental stage - Contig I...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91830...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918302|Adiantum ca

  19. AcEST: BP915830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000077_E09 601 Adiantum capillus-veneris mRNA. clone: YMU001_000077_E09. BP915830 - Show BP915830...is mRNA. clone: YMU001_000077_E09. Accession BP915830 Tissue type prothallium Developmental stage - Contig I...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915830|Adiantu...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915830|Adiantum capillus-veneris m

  20. AcEST: BP918830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000118_A03 482 Adiantum capillus-veneris mRNA. clone: YMU001_000118_A03. BP918830... CL578Contig1 Show BP918830 Clone id YMU001_000118_A03 Library YMU01 Length 482 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000118_A03. Accession BP918830 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918830...s, Nucleic Acids Res. 25:3389-3402. Query= BP918830|Adiantum capillus-veneris mRNA, clone: YMU001_000118_A03

  1. AcEST: BP919830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_F05 476 Adiantum capillus-veneris mRNA. clone: YMU001_000129_F05. BP919830... CL2022Contig1 Show BP919830 Clone id YMU001_000129_F05 Library YMU01 Length 476 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_F05. Accession BP919830 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919830...leic Acids Res. 25:3389-3402. Query= BP919830|Adiantum capillus-veneris mRNA, clone: YMU001_000129_F05. (458

  2. AcEST: BP917830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000106_A10 487 Adiantum capillus-veneris mRNA. clone: YMU001_000106_A10. BP917830 - Show BP917830...is mRNA. clone: YMU001_000106_A10. Accession BP917830 Tissue type prothallium Developmental stage - Contig I...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917830|Adiantum ...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917830|A

  3. AcEST: BP914830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000063_D03 538 Adiantum capillus-veneris mRNA. clone: YMU001_000063_D03. BP914830 - Show BP914830...is mRNA. clone: YMU001_000063_D03. Accession BP914830 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP914830|Adiantum capillus-veneris mRNA, clone: YMU001_000063_...programs, Nucleic Acids Res. 25:3389-3402. Query= BP914830|Adiantum capillus-vene

  4. AcEST: BP918309 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A06 512 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A06. BP91830...9 CL856Contig1 Show BP918309 Clone id YMU001_000112_A06 Library YMU01 Length 512 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000112_A06. Accession BP918309 Tissue type prothallium Developmental stage...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP918309|Adiantum capillus-veneris mRNA, clone: YMU001_00011... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91830

  5. AcEST: BP914147 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_D12 534 Adiantum capillus-veneris mRNA. clone: YMU001_000042_D12. BP914147 - Show BP91414...is mRNA. clone: YMU001_000042_D12. Accession BP914147 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91414...niprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching......................................ids Res. 25:3389-3402. Query= BP914147|Adiantum capillus-veneris mRNA, clone: YMU001_000042_D12. (534 letter

  6. AcEST: BP917075 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E12 529 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E12. BP917075 - Show BP917075...is mRNA. clone: YMU001_000095_E12. Accession BP917075 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917075...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917075|Adiantum capillus-veneris mRNA

  7. AcEST: BP918650 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000116_A01 560 Adiantum capillus-veneris mRNA. clone: YMU001_000116_A01. BP918650... CL552Contig1 Show BP918650 Clone id YMU001_000116_A01 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000116_A01. Accession BP918650 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918650|Adiantum capillus-ve...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918650|Adiant

  8. AcEST: BP920168 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H02 390 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H02. BP920168 - Show BP92016...is mRNA. clone: YMU001_000133_H02. Accession BP920168 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920168|Adiantum capillus-veneris mRNA,...c Acids Res. 25:3389-3402. Query= BP920168|Adiantum capillus-veneris mRNA, clone: YMU001_000133_H02. (390 le

  9. AcEST: BP920169 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H03. BP920169 - Show BP92016...is mRNA. clone: YMU001_000133_H03. Accession BP920169 Tissue type prothallium Developmental stage - Contig I...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920169|Adiantum cap

  10. AcEST: BP920167 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H01 152 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H01. BP920167 - Show BP92016...is mRNA. clone: YMU001_000133_H01. Accession BP920167 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP920167|Adiantum capillus-veneris mRNA, clone: YMU...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920167

  11. AcEST: BP920161 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G06. BP920161 - Show BP92016...is mRNA. clone: YMU001_000133_G06. Accession BP920161 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016

  12. AcEST: BP920166 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G12 149 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G12. BP920166 - Show BP92016...is mRNA. clone: YMU001_000133_G12. Accession BP920166 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920166|Adiantum capillus-veneris

  13. AcEST: BP920164 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G09 447 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G09. BP920164 - Show BP92016...is mRNA. clone: YMU001_000133_G09. Accession BP920164 Tissue type prothallium Developmental stage - Contig I...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920164|A...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920164|Adiantum cap

  14. AcEST: BP920163 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G08 372 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G08. BP92016...3 CL2472Contig1 Show BP920163 Clone id YMU001_000133_G08 Library YMU01 Length 372 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_G08. Accession BP920163 Tissue type prothallium Developmental stag...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920163|Adiantum cap... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920163|Adiantum capillus-veneris mRNA, clone: YM

  15. AcEST: BP920165 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G11 301 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G11. BP920165 - Show BP92016...is mRNA. clone: YMU001_000133_G11. Accession BP920165 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920165...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016

  16. AcEST: BP920400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000136_F07 401 Adiantum capillus-veneris mRNA. clone: YMU001_000136_F07. BP920400 - Show BP920400...is mRNA. clone: YMU001_000136_F07. Accession BP920400 Tissue type prothallium Developmental stage - Contig I...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920400|Adi...ery: 234 EVEDYAVRLERGLNHYGRWDSLLTRLAIDNGDCSKISSEDL 356 E+ Y + G N+ D+ +TRL I D SK+ +DL Sbjct: 400 EIAPYIITAL...ids Res. 25:3389-3402. Query= BP920400|Adiantum capillus-veneris mRNA, clone: YMU001_000136_F07. (401 letter

  17. AcEST: BP914009 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G12. BP914009 - Show BP91400...is mRNA. clone: YMU001_000038_G12. Accession BP914009 Tissue type prothallium Developmental stage - Contig I...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914009|Adiantum ca...programs, Nucleic Acids Res. 25:3389-3402. Query= BP914009|Adiantum capillus-veneris mRNA, clone: YMU001_000

  18. AcEST: BP914005 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G08 416 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G08. BP914005 - Show BP91400...is mRNA. clone: YMU001_000038_G08. Accession BP914005 Tissue type prothallium Developmental stage - Contig I...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91400...s Res. 25:3389-3402. Query= BP914005|Adiantum capillus-veneris mRNA, clone: YMU001_000038_G08. (416 letters)

  19. AcEST: BP914400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_E03 571 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E03. BP914400 - Show BP914400...is mRNA. clone: YMU001_000058_E03. Accession BP914400 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914400|Adiantum capillus-veneris mRNA, clone... OS=Rattus norvegicus GN=Acsl6 PE=1 SV=1 Length = 697 Score = 158 bits (400), Expect = 2e-38 Identities = 70...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914400

  20. AcEST: BP914004 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G07 450 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G07. BP914004 - Show BP91400...is mRNA. clone: YMU001_000038_G07. Accession BP914004 Tissue type prothallium Developmental stage - Contig I...leic Acids Res. 25:3389-3402. Query= BP914004|Adiantum capillus-veneris mRNA, clo...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914004|Adiantum capillus-veneris mRN

  1. AcEST: BP915400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_B04 438 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B04. BP915400 - Show BP915400...is mRNA. clone: YMU001_000071_B04. Accession BP915400 Tissue type prothallium Developmental stage - Contig I... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915400...ucleic Acids Res. 25:3389-3402. Query= BP915400|Adiantum capillus-veneris mRNA, c

  2. AcEST: BP918400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_A11 368 Adiantum capillus-veneris mRNA. clone: YMU001_000113_A11. BP918400 - Show BP918400...is mRNA. clone: YMU001_000113_A11. Accession BP918400 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918400|Adiantum capillus-veneris mRNA, clone: YMU001_000113_A1...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918400

  3. AcEST: BP914000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G03 555 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G03. BP914000 - Show BP91400...is mRNA. clone: YMU001_000038_G03. Accession BP914000 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP914000|Adiantum capillus-veneris mRNA, clone: YMU001_000038_G03. (5...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914000|Adiantum capil

  4. AcEST: BP914002 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G05 525 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G05. BP91400...2 CL1073Contig1 Show BP914002 Clone id YMU001_000038_G05 Library YMU01 Length 525 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000038_G05. Accession BP914002 Tissue type prothallium Developmental stag... Nucleic Acids Res. 25:3389-3402. Query= BP914002|Adiantum capillus-veneris mRNA, clone: YMU001_000038_G05. ...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91400

  5. AcEST: BP912400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_F03 584 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F03. BP912400 - Show BP912400...is mRNA. clone: YMU001_000018_F03. Accession BP912400 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP912400|Adiantum capillus-veneris mRNA, clone: YMU001_000018_F03. (... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912400...ASYGVFEGEGEYYGGRE 1233 Query: 400 GPSRTQWFRASPDGTQREIKGATGDRYTCQTEDLDAFLCVSYEPVRS

  6. AcEST: BP917400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_D03 356 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D03. BP917400 - Show BP917400...is mRNA. clone: YMU001_000100_D03. Accession BP917400 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP917400|Adiantum capillus-veneris mRNA, clone: YMU001_000100_D03. (356 l...cids Res. 25:3389-3402. Query= BP917400|Adiantum capillus-veneris mRNA, clone: YMU001_000100_D03. (356 lette

  7. AcEST: BP915910 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D05 543 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D05. BP915910 - Show BP91591...is mRNA. clone: YMU001_000079_D05. Accession BP915910 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP915910|Adiantum capillus-veneris mRNA, clone: YMU001_000079_D05. (543 letters) Data...s Res. 25:3389-3402. Query= BP915910|Adiantum capillus-veneris mRNA, clone: YMU00

  8. AcEST: BP915919 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_E03 400 Adiantum capillus-veneris mRNA. clone: YMU001_000079_E03. BP91591...9 CL3486Contig1 Show BP915919 Clone id YMU001_000079_E03 Library YMU01 Length 400 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000079_E03. Accession BP915919 Tissue type prothallium Developmental stag...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91591...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915919|Adiant

  9. AcEST: BP921591 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000151_H01 458 Adiantum capillus-veneris mRNA. clone: YMU001_000151_H01. BP921591 - Show BP921591...is mRNA. clone: YMU001_000151_H01. Accession BP921591 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP921591|Adiantum capillus-veneris mRNA, clone: YMU001_000151_H0...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921591

  10. AcEST: BP915913 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D08 427 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D08. BP915913 - Show BP91591...is mRNA. clone: YMU001_000079_D08. Accession BP915913 Tissue type prothallium Developmental stage - Contig I...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91591...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91591

  11. AcEST: BP915917 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_E01 288 Adiantum capillus-veneris mRNA. clone: YMU001_000079_E01. BP915917 - Show BP91591...is mRNA. clone: YMU001_000079_E01. Accession BP915917 Tissue type prothallium Developmental stage - Contig I...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915917|Adiantum capillus-veneris mR...s Res. 25:3389-3402. Query= BP915917|Adiantum capillus-veneris mRNA, clone: YMU00

  12. AcEST: BP915911 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D06 571 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D06. BP91591...1 CL46Contig1 Show BP915911 Clone id YMU001_000079_D06 Library YMU01 Length 571 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000079_D06. Accession BP915911 Tissue type prothallium Developmental stage ...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915911|Adi... Res. 25:3389-3402. Query= BP915911|Adiantum capillus-veneris mRNA, clone: YMU001

  13. AcEST: BP915912 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D07 482 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D07. BP915912 - Show BP91591...is mRNA. clone: YMU001_000079_D07. Accession BP915912 Tissue type prothallium Developmental stage - Contig I...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915912|Adiantum capillus-veneris mR...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2...5:3389-3402. Query= BP915912|Adiantum capillus-veneris mRNA, clone: YMU001_000079_D07. (482 letters) Databas

  14. AcEST: BP911591 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000006_G06 296 Adiantum capillus-veneris mRNA. clone: YMU001_000006_G06. BP911591 - Show BP911591...is mRNA. clone: YMU001_000006_G06. Accession BP911591 Tissue type prothallium Developmental stage - Contig I...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911591|Adiantum capil...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911591|Adiantum capillus-vene

  15. AcEST: BP919218 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E11 400 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E11. BP919218 - Show BP91921...is mRNA. clone: YMU001_000122_E11. Accession BP919218 Tissue type prothallium Developmental stage - Contig I... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919218|Adiantum capillus-ven...leic Acids Res. 25:3389-3402. Query= BP919218|Adiantum capillus-veneris mRNA, clo

  16. AcEST: BP919216 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E09 388 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E09. BP919216 - Show BP91921...is mRNA. clone: YMU001_000122_E09. Accession BP919216 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919216|Adiantum cap...rams, Nucleic Acids Res. 25:3389-3402. Query= BP919216|Adiantum capillus-veneris

  17. AcEST: BP919213 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E06 293 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E06. BP919213 - Show BP91921...is mRNA. clone: YMU001_000122_E06. Accession BP919213 Tissue type prothallium Developmental stage - Contig I...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919213|Adiantu...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91921

  18. AcEST: BP919211 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E04 158 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E04. BP919211 - Show BP91921...is mRNA. clone: YMU001_000122_E04. Accession BP919211 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP919211|Adiantum capillus-veneris mRNA, clone: YMU001_000122_E04. (1...Nucleic Acids Res. 25:3389-3402. Query= BP919211|Adiantum capillus-veneris mRNA, clone: YMU001_000122_E04. (

  19. AcEST: BP919217 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E10 547 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E10. BP91921...7 CL1907Contig1 Show BP919217 Clone id YMU001_000122_E10 Library YMU01 Length 547 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000122_E10. Accession BP919217 Tissue type prothallium Developmental stag... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919217|Adiantum capillus-ven...ds Res. 25:3389-3402. Query= BP919217|Adiantum capillus-veneris mRNA, clone: YMU001_000122_E10. (547 letters

  20. AcEST: BP919411 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G09 152 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G09. BP919411 - Show BP91941...is mRNA. clone: YMU001_000124_G09. Accession BP919411 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP919411|Adiantum capillus-veneris mRNA, clone: YMU...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919411

  1. AcEST: BP919412 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G10 434 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G10. BP91941...2 CL2856Contig1 Show BP919412 Clone id YMU001_000124_G10 Library YMU01 Length 434 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000124_G10. Accession BP919412 Tissue type prothallium Developmental stag...ids Res. 25:3389-3402. Query= BP919412|Adiantum capillus-veneris mRNA, clone: YMU... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919412|Adiant

  2. AcEST: BP919415 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_H01 568 Adiantum capillus-veneris mRNA. clone: YMU001_000124_H01. BP919415 - Show BP91941...is mRNA. clone: YMU001_000124_H01. Accession BP919415 Tissue type prothallium Developmental stage - Contig I...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP919415|Adiantum capillus-veneris mRNA, clone: YMU001_00012...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91941

  3. AcEST: BP919416 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_H02 461 Adiantum capillus-veneris mRNA. clone: YMU001_000124_H02. BP91941...6 CL1302Contig1 Show BP919416 Clone id YMU001_000124_H02 Library YMU01 Length 461 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000124_H02. Accession BP919416 Tissue type prothallium Developmental stag... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919416|Adiantum capillus-ven...leic Acids Res. 25:3389-3402. Query= BP919416|Adiantum capillus-veneris mRNA, clo

  4. AcEST: BP919418 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_H05 528 Adiantum capillus-veneris mRNA. clone: YMU001_000124_H05. BP919418 - Show BP91941...is mRNA. clone: YMU001_000124_H05. Accession BP919418 Tissue type prothallium Developmental stage - Contig I...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91941...Acids Res. 25:3389-3402. Query= BP919418|Adiantum capillus-veneris mRNA, clone: Y

  5. AcEST: BP919417 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_H03 445 Adiantum capillus-veneris mRNA. clone: YMU001_000124_H03. BP919417 - Show BP91941...is mRNA. clone: YMU001_000124_H03. Accession BP919417 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP919417|Adiantum capillus-veneris mRNA, clone: YMU001_00.... 25:3389-3402. Query= BP919417|Adiantum capillus-veneris mRNA, clone: YMU001_000124_H03. (445 letters) Data

  6. AcEST: BP919413 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G11 518 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G11. BP919413 - Show BP91941...is mRNA. clone: YMU001_000124_G11. Accession BP919413 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919413|Adiantum capillu...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91941

  7. AcEST: BP917177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_C05 471 Adiantum capillus-veneris mRNA. clone: YMU001_000097_C05. BP917177 - Show BP91717...is mRNA. clone: YMU001_000097_C05. Accession BP917177 Tissue type prothallium Developmental stage - Contig I...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917177|Adiantum capillus-veneris mRNA, clone: YMU...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917

  8. AcEST: BP917117 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000096_B11 125 Adiantum capillus-veneris mRNA. clone: YMU001_000096_B11. BP917117... CL2704Contig1 Show BP917117 Clone id YMU001_000096_B11 Library YMU01 Length 125 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000096_B11. Accession BP917117 Tissue type prothallium Developmental stag...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917117...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917117

  9. AcEST: BP912100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_B06 447 Adiantum capillus-veneris mRNA. clone: YMU001_000015_B06. BP912100 - Show BP912100...is mRNA. clone: YMU001_000015_B06. Accession BP912100 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP912100|Adiantum capillus-veneris mRNA, clone: YMU001_00...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912100|Adiantum capi

  10. AcEST: BP916100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000083_B04 427 Adiantum capillus-veneris mRNA. clone: YMU001_000083_B04. BP916100... CL115Contig1 Show BP916100 Clone id YMU001_000083_B04 Library YMU01 Length 427 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000083_B04. Accession BP916100 Tissue type prothallium Developmental stage...s, Nucleic Acids Res. 25:3389-3402. Query= BP916100|Adiantum capillus-veneris mRN... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916100

  11. AcEST: BP918100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_F01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000109_F01. BP918100... CL8Contig1 Show BP918100 Clone id YMU001_000109_F01 Library YMU01 Length 496 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000109_F01. Accession BP918100 Tissue type prothallium Developmental stage -...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918100... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918100|Adia

  12. AcEST: BP914100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_H03 542 Adiantum capillus-veneris mRNA. clone: YMU001_000039_H03. BP914100 - Show BP914100...is mRNA. clone: YMU001_000039_H03. Accession BP914100 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP914100|Adiantum capillus-veneris mRNA, clone: YMU001_000039_H...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914100

  13. AcEST: BP918818 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000117_G09 538 Adiantum capillus-veneris mRNA. clone: YMU001_000117_G09. BP918818 - Show BP918818...is mRNA. clone: YMU001_000117_G09. Accession BP918818 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP918818|Adiantum capillus-veneris mRNA, clone: YMU001_000117_G09. (525 letters) Dat...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918818|Adiantum capillus-veneris mRNA, clon

  14. AcEST: BP912222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_E10 453 Adiantum capillus-veneris mRNA. clone: YMU001_000016_E10. BP912222 - Show BP912222...is mRNA. clone: YMU001_000016_E10. Accession BP912222 Tissue type prothallium Developmental stage - Contig I...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912222...cids Res. 25:3389-3402. Query= BP912222|Adiantum capillus-veneris mRNA, clone: YMU001_000016_E10. (453 lette

  15. General phenomenology of underground nuclear explosions; Phenomenologie generale des explosions nucleaires souterraines

    Energy Technology Data Exchange (ETDEWEB)

    Derlich, S.; Supiot, F. [Commissariat a l' Energie Atomique, Bruyeres-le-Chatel (France). Centre d' Etudes

    1969-07-01

    An essentially qualitatively description is given of the phenomena related to underground nuclear explosions (explosion of a single unit, of several units in line, and simultaneous explosions). In the first chapter are described the phenomena which are common to contained explosions and to explosions forming craters (formation and propagation of a shock-wave causing the vaporization, the fusion and the fracturing of the medium). The second chapter describes the phenomena related to contained explosions (formation of a cavity with a chimney). The third chapter is devoted to the phenomenology of test explosions which form a crater; it describes in particular the mechanism of formation and the different types of craters as a function of the depth of the explosion and of the nature of the ground. The aerial phenomena connected with explosions which form a crater: shock wave in the air and focussing at a large distance, and dust clouds, are also dealt with. (authors) [French] On donne une description essentiellement qualitative des phenomenes lies aux explosions nucleaires souterraines (explosion d'un seul engin, d'engins en ligne et explosions simultanees). Dans un premier chapitre sont decrits les phenomenes communs aux explosions contenues et aux explosions formant un cratere (formation et propagation d'une onde de choc provoquant la vaporisation, la fusion et la fracturation du milieu). Le deuxieme chapitre decrit les phenomenes lies aux tirs contenus (formation d'une cavite et d'une cheminee). Le troisieme chapitre est consacre a la phenomenologie des tirs formant un cratere et decrit notamment le mecanisme de formation et les differents types de crateres en fonction de la profondeur d'explosion et de la nature du terrain. Les phenomenes aeriens lies aux explosions formant un cratere: onde de pression aerienne et focalisation a grande distance, nuages de poussieres, sont egalement abordes. (auteurs)

  16. 27 CFR 70.445 - Commerce in explosives.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Commerce in explosives. 70... Cartridges, and Explosives § 70.445 Commerce in explosives. Part 55 of title 27 CFR contains the regulations..., explosives, (b) Permits for users who buy or transport explosives in interstate or foreign commerce,...

  17. 27 CFR 555.181 - Reporting of plastic explosives.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Reporting of plastic..., FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Marking of Plastic Explosives § 555.181 Reporting of plastic explosives. All persons, other than an agency of the United...

  18. 30 CFR 75.1310 - Explosives and blasting equipment.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Explosives and blasting equipment. 75.1310... SAFETY AND HEALTH MANDATORY SAFETY STANDARDS-UNDERGROUND COAL MINES Explosives and Blasting § 75.1310 Explosives and blasting equipment. (a) Only permissible explosives, approved sheathed explosive units,...

  19. The gas dynamics of explosions

    CERN Document Server

    Lee,\tJohn H S

    2016-01-01

    Explosions, and the non-steady shock propagation associated with them, continue to interest researchers working in different fields of physics and engineering (such as astrophysics and fusion). Based on the author's course in shock dynamics, this book describes the various analytical methods developed to determine non-steady shock propagation. These methods offer a simple alternative to the direct numerical integration of the Euler equations and offer a better insight into the physics of the problem. Professor Lee presents the subject systematically and in a style that is accessible to graduate students and researchers working in shock dynamics, combustion, high-speed aerodynamics, propulsion and related topics.

  20. Static Charge Development on Explosives .

    Directory of Open Access Journals (Sweden)

    K. Raha

    1991-01-01

    Full Text Available Static charge development character of some of the important explosive crystals have been predicted on the basis of their crystal class and symmetry. Among the important mechanism of charge development, the piezoelectric and pyroelectric characters have been considered. Ammonium trinitrate, ammonium nitrate, m-dinitro-benzene, trinitro-toluene, styphnic acid, beeta-lead styphnate, 4,4'dinitro-dipheny1, a-hexamethylenetetranitramine, nitroguanidine, picric acid, dimethylnitramine, a-lead azide and beeta-lead azide are pyroelectric in nature, whereas pentaerythritol tetranitrate, picryliodide, hexamethylenetranitramine, tetranitromethane and trinitroethane are piezoelectric in nature.

  1. 75 FR 1085 - Commerce in Explosives; List of Explosive Materials (2009R-18T)

    Science.gov (United States)

    2010-01-08

    ... [Federal Register Volume 75, Number 5 (Friday, January 8, 2010)] [Notices] [Pages 1085-1087] [FR Doc No: 2010-45] DEPARTMENT OF JUSTICE Bureau of Alcohol, Tobacco, Firearms and Explosives [Docket No. ATF 34N] Commerce in Explosives; List of Explosive Materials (2009R-18T) AGENCY: Bureau of...

  2. A structured approach to forensic study of explosions: The TNO Inverse Explosion Analysis tool

    NARCIS (Netherlands)

    Voort, M.M. van der; Wees, R.M.M. van; Brouwer, S.D.; Jagt-Deutekom, M.J. van der; Verreault, J.

    2015-01-01

    Forensic analysis of explosions consists of determining the point of origin, the explosive substance involved, and the charge mass. Within the EU FP7 project Hyperion, TNO developed the Inverse Explosion Analysis (TNO-IEA) tool to estimate the charge mass and point of origin based on observed damage

  3. Nature's third cycle a story of sunspots

    CERN Document Server

    Choudhuri, Arnab Rai

    2015-01-01

    The cycle of day and night and the cycle of seasons are two familiar natural cycles around which many human activities are organized. But is there a third natural cycle of importance for us humans? On 13 March 1989, six million people in Canada went without electricity for many hours: a large explosion on the sun was discovered as the cause of this blackout. Such explosions occur above sunspots, dark features on the surface of the Sun that have been observed through telescopes since the time of Galileo. The number of sunspots has been found to wax and wane over a period of 11 years. Although this cycle was discovered less than two centuries ago, it is becoming increasingly important for us as human society becomes more dependent on technology. For nearly a century after its discovery, the cause of the sunspot cycle remained completely shrouded in mystery. The 1908 discovery of strong magnetic fields in sunspots made it clear that the 11-year cycle is the magnetic cycle of the sun. It is only during the last ...

  4. Metabolic cycles are linked to the cardiovascular diurnal rhythm in rats with essential hypertension.

    Directory of Open Access Journals (Sweden)

    He Cui

    Full Text Available BACKGROUND: The loss of diurnal rhythm in blood pressure (BP is an important predictor of end-organ damage in hypertensive and diabetic patients. Recent evidence has suggested that two major physiological circadian rhythms, the metabolic and cardiovascular rhythms, are subject to regulation by overlapping molecular pathways, indicating that dysregulation of metabolic cycles could desynchronize the normal diurnal rhythm of BP with the daily light/dark cycle. However, little is known about the impact of changes in metabolic cycles on BP diurnal rhythm. METHODOLOGY/PRINCIPAL FINDINGS: To test the hypothesis that feeding-fasting cycles could affect the diurnal pattern of BP, we used spontaneously hypertensive rats (SHR which develop essential hypertension with disrupted diurnal BP rhythms and examined whether abnormal BP rhythms in SHR were caused by alteration in the daily feeding rhythm. We found that SHR exhibit attenuated feeding rhythm which accompanies disrupted rhythms in metabolic gene expression not only in metabolic tissues but also in cardiovascular tissues. More importantly, the correction of abnormal feeding rhythms in SHR restored the daily BP rhythm and was accompanied by changes in the timing of expression of key circadian and metabolic genes in cardiovascular tissues. CONCLUSIONS/SIGNIFICANCE: These results indicate that the metabolic cycle is an important determinant of the cardiovascular diurnal rhythm and that disrupted BP rhythms in hypertensive patients can be normalized by manipulating feeding cycles.

  5. Holocene explosive volcanism of the Jan Mayen (island) volcanic province, North-Atlantic

    Science.gov (United States)

    Gjerløw, Eirik; Haflidason, H.; Pedersen, R. B.

    2016-07-01

    The volcanic island Jan Mayen, located in the Norwegian-Greenland Sea, hosts the active stratovolcano of Beerenberg, the northernmost active subaerial volcano in the world. At least five eruptions are known from the island following its discovery in the 17th century, but its eruptive history prior to this is basically unknown. In this paper two sediment cores retrieved close to Jan Mayen have been studied in detail to shed light on the Holocene history of explosive volcanism from the Jan Mayen volcanic province. Horizons with elevated tephra concentrations were identified and tephra from these was analysed to determine major element chemistry of the tephra. The tephra chemistry was used to provide a link between the two cores and the land based tephra records from Jan Mayen Island. We managed to link two well-developed tephra peaks in the cores by their geochemical composition and age to Jan Mayen. One of these peaks represents the 1732 AD eruption of Eggøya while the other peak represents a previously undescribed eruption dated to around 10.3 ka BP. Two less prominent tephra peaks, one in each core, dated to approximately 2.3 and 3.0 ka BP, also have a distinct geochemical character linking them to Jan Mayen volcanism. However, the most prominent tephra layer in the cores located close to Jan Mayen and numerous other cores along the Jan Mayen ridge is the 12.1 ka BP Vedde Ash originating from the Iceland volcanic province. We find that the Holocene volcanism on Jan Mayen is much less explosive than volcanism in Iceland, and propose that either low amounts of explosive volcanic activity from the summit region of Beerenberg or small to absent glacier cover on Beerenberg is responsible for this.

  6. MOF phosphorylation by ATM regulates 53BP1-mediated DSB repair pathway choice

    Science.gov (United States)

    Gupta, Arun; Hunt, Clayton R.; Hegdec, Muralidhar L.; Chakraborty, Sharmistha; Udayakumar, Durga; Horikoshi, Nobuo; Singh1, Mayank; Ramnarain, Deepti B.; Hittelman, Walter N.; Namjoshi, Sarita; Asaithamby, Aroumougame; Hazra, Tapas K.; Ludwig, Thomas; Pandita, Raj K.; Tyler, Jessica K.; Pandita, Tej K.

    2014-01-01

    Cell cycle phase is a critical determinant of the choice between DNA damage repair by non-homologous end joining (NHEJ) or homologous recombination (HR). Here we report that DSBs induce ATM-dependent MOF (a histone H4 acetyl-transferase) phosphorylation (p-T392-MOF) and that phosphorylated MOF co-localizes with γ-H2AX, ATM, and 53BP1 foci. Mutation of the phosphorylation site (MOF-T392A) impedes DNA repair in S- and G2-phase but not G1-phase cells. Expression of MOF-T392A also reverses the reduction in DSB associated 53BP1 seen in wild type S/G2-phase cells, resulting in enhanced 53BP1 and reduced BRCA1 association. Decreased BRCA1 levels at DSB sites correlates with defective repairosome formation, reduced HR repair and decreased cell survival following irradiation. These data support a model whereby ATM mediated MOF-T392 phosphorylation modulates 53BP1 function to facilitate the subsequent recruitment of HR repair proteins, uncovering a regulatory role for MOF in DSB repair pathway choice during S/G2-phase. PMID:24953651

  7. MOF Phosphorylation by ATM Regulates 53BP1-Mediated Double-Strand Break Repair Pathway Choice

    Directory of Open Access Journals (Sweden)

    Arun Gupta

    2014-07-01

    Full Text Available Cell-cycle phase is a critical determinant of the choice between DNA damage repair by nonhomologous end-joining (NHEJ or homologous recombination (HR. Here, we report that double-strand breaks (DSBs induce ATM-dependent MOF (a histone H4 acetyl-transferase phosphorylation (p-T392-MOF and that phosphorylated MOF colocalizes with γ-H2AX, ATM, and 53BP1 foci. Mutation of the phosphorylation site (MOF-T392A impedes DNA repair in S and G2 phase but not G1 phase cells. Expression of MOF-T392A also blocks the reduction in DSB-associated 53BP1 seen in wild-type S/G2 phase cells, resulting in enhanced 53BP1 and reduced BRCA1 association. Decreased BRCA1 levels at DSB sites correlates with defective repairosome formation, reduced HR repair, and decreased cell survival following irradiation. These data support a model whereby ATM-mediated MOF-T392 phosphorylation modulates 53BP1 function to facilitate the subsequent recruitment of HR repair proteins, uncovering a regulatory role for MOF in DSB repair pathway choice during S/G2 phase.

  8. MOF phosphorylation by ATM regulates 53BP1-mediated double-strand break repair pathway choice.

    Science.gov (United States)

    Gupta, Arun; Hunt, Clayton R; Hegde, Muralidhar L; Chakraborty, Sharmistha; Chakraborty, Sharmistha; Udayakumar, Durga; Horikoshi, Nobuo; Singh, Mayank; Ramnarain, Deepti B; Hittelman, Walter N; Namjoshi, Sarita; Asaithamby, Aroumougame; Hazra, Tapas K; Ludwig, Thomas; Pandita, Raj K; Tyler, Jessica K; Pandita, Tej K

    2014-07-10

    Cell-cycle phase is a critical determinant of the choice between DNA damage repair by nonhomologous end-joining (NHEJ) or homologous recombination (HR). Here, we report that double-strand breaks (DSBs) induce ATM-dependent MOF (a histone H4 acetyl-transferase) phosphorylation (p-T392-MOF) and that phosphorylated MOF colocalizes with γ-H2AX, ATM, and 53BP1 foci. Mutation of the phosphorylation site (MOF-T392A) impedes DNA repair in S and G2 phase but not G1 phase cells. Expression of MOF-T392A also blocks the reduction in DSB-associated 53BP1 seen in wild-type S/G2 phase cells, resulting in enhanced 53BP1 and reduced BRCA1 association. Decreased BRCA1 levels at DSB sites correlates with defective repairosome formation, reduced HR repair, and decreased cell survival following irradiation. These data support a model whereby ATM-mediated MOF-T392 phosphorylation modulates 53BP1 function to facilitate the subsequent recruitment of HR repair proteins, uncovering a regulatory role for MOF in DSB repair pathway choice during S/G2 phase.

  9. Fire and explosion hazards of oil shale

    Energy Technology Data Exchange (ETDEWEB)

    1989-01-01

    The US Bureau of Mines publication presents the results of investigations into the fire and explosion hazards of oil shale rocks and dust. Three areas have been examined: the explosibility and ignitability of oil shale dust clouds, the fire hazards of oil shale dust layers on hot surfaces, and the ignitability and extinguishment of oil shale rubble piles. 10 refs., 54 figs., 29 tabs.

  10. Gas explosion prediction using CFD models

    Energy Technology Data Exchange (ETDEWEB)

    Niemann-Delius, C.; Okafor, E. [RWTH Aachen Univ. (Germany); Buhrow, C. [TU Bergakademie Freiberg Univ. (Germany)

    2006-07-15

    A number of CFD models are currently available to model gaseous explosions in complex geometries. Some of these tools allow the representation of complex environments within hydrocarbon production plants. In certain explosion scenarios, a correction is usually made for the presence of buildings and other complexities by using crude approximations to obtain realistic estimates of explosion behaviour as can be found when predicting the strength of blast waves resulting from initial explosions. With the advance of computational technology, and greater availability of computing power, computational fluid dynamics (CFD) tools are becoming increasingly available for solving such a wide range of explosion problems. A CFD-based explosion code - FLACS can, for instance, be confidently used to understand the impact of blast overpressures in a plant environment consisting of obstacles such as buildings, structures, and pipes. With its porosity concept representing geometry details smaller than the grid, FLACS can represent geometry well, even when using coarse grid resolutions. The performance of FLACS has been evaluated using a wide range of field data. In the present paper, the concept of computational fluid dynamics (CFD) and its application to gas explosion prediction is presented. Furthermore, the predictive capabilities of CFD-based gaseous explosion simulators are demonstrated using FLACS. Details about the FLACS-code, some extensions made to FLACS, model validation exercises, application, and some results from blast load prediction within an industrial facility are presented. (orig.)

  11. 77 FR 55108 - Explosive Siting Requirements

    Science.gov (United States)

    2012-09-07

    ... trinitrotoluene (TNT) equivalents of less than or equal to 450 pounds. Although decreased, the revised separation... required separation distances for division 1.1 explosives and liquid propellants with TNT equivalents that... separation from a given net explosive weight (NEW) is one percent, which is an equivalent level of safety...

  12. Explosions inside Ejecta and Most Luminous Supernovae

    CERN Document Server

    Blinnikov, S I

    2008-01-01

    The extremely luminous supernova SN2006gy is explained in the same way as other SNIIn events: light is produced by a radiative shock propagating in a dense circumstellar envelope formed by a previous weak explosion. The problems in the theory and observations of multiple-explosion SNe IIn are briefly reviewed.

  13. Some analytical methods for explosives: Part 2

    Energy Technology Data Exchange (ETDEWEB)

    Selig, W.

    1965-12-08

    This report is the second compilation of methods for analyzing explosives. All the methods were developed for routine performance by techniques, and an attempt has therefore been made to keep them as simple as possible. Methods are presented for analyzing plastic-bonded explosives based on sym-cyclomethylenetetra-nitramine (HMX), based on viton in addition to HMX, and based on pentraerythritol tetranitrate (PETN).

  14. Explosion risks and consequences for tunnels

    NARCIS (Netherlands)

    Weerheijm, J.; Berg, A.C. van den

    2014-01-01

    Tunnel accidents with transports of dangerous goods may lead to explosions. Risk assessment for these accidents is complicated because of the low probability and the unknown, but disastrous effects expected. Especially the lack of knowledge on the strength of the explosion and the consequences for t

  15. 30 CFR 7.100 - Explosion tests.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Explosion tests. 7.100 Section 7.100 Mineral... Underground Coal Mines Where Permissible Electric Equipment is Required § 7.100 Explosion tests. (a) Test... agree. (ii) Remove all parts that do not contribute to the operation or ensure the...

  16. FES cycling.

    Science.gov (United States)

    Newham, D J; Donaldson, N de N

    2007-01-01

    Spinal cord injury (SCI) leads to a partial or complete disruption of motor, sensory, and autonomic nerve pathways below the level of the lesion. In paraplegic patients, functional electrical stimulation (FES) was originally widely considered as a means to restore walking function but this was proved technically very difficult because of the numerous degrees of freedom involved in walking. FES cycling was developed for people with SCI and has the advantages that cycling can be maintained for reasonably long periods in trained muscles and the risk of falls is low. In the article, we review research findings relevant to the successful application of FES cycling including the effects on muscle size, strength and function, and the cardiovascular and bone changes. We also describe important practical considerations in FES cycling regarding the application of surface electrodes, training and setting up the stimulator limitations, implanted stimulators and FES cycling including FES cycling in groups and other FES exercises such as FES rowing.

  17. Hydrodynamics of Explosion Experiments and Models

    CERN Document Server

    Kedrinskii, Valery K

    2005-01-01

    Hydronamics of Explosion presents the research results for the problems of underwater explosions and contains a detailed analysis of the structure and the parameters of the wave fields generated by explosions of cord and spiral charges, a description of the formation mechanisms for a wide range of cumulative flows at underwater explosions near the free surface, and the relevant mathematical models. Shock-wave transformation in bubbly liquids, shock-wave amplification due to collision and focusing, and the formation of bubble detonation waves in reactive bubbly liquids are studied in detail. Particular emphasis is placed on the investigation of wave processes in cavitating liquids, which incorporates the concepts of the strength of real liquids containing natural microinhomogeneities, the relaxation of tensile stress, and the cavitation fracture of a liquid as the inversion of its two-phase state under impulsive (explosive) loading. The problems are classed among essentially nonlinear processes that occur unde...

  18. Morphomechanical Innovation Drives Explosive Seed Dispersal.

    Science.gov (United States)

    Hofhuis, Hugo; Moulton, Derek; Lessinnes, Thomas; Routier-Kierzkowska, Anne-Lise; Bomphrey, Richard J; Mosca, Gabriella; Reinhardt, Hagen; Sarchet, Penny; Gan, Xiangchao; Tsiantis, Miltos; Ventikos, Yiannis; Walker, Simon; Goriely, Alain; Smith, Richard; Hay, Angela

    2016-06-30

    How mechanical and biological processes are coordinated across cells, tissues, and organs to produce complex traits is a key question in biology. Cardamine hirsuta, a relative of Arabidopsis thaliana, uses an explosive mechanism to disperse its seeds. We show that this trait evolved through morphomechanical innovations at different spatial scales. At the organ scale, tension within the fruit wall generates the elastic energy required for explosion. This tension is produced by differential contraction of fruit wall tissues through an active mechanism involving turgor pressure, cell geometry, and wall properties of the epidermis. Explosive release of this tension is controlled at the cellular scale by asymmetric lignin deposition within endocarp b cells-a striking pattern that is strictly associated with explosive pod shatter across the Brassicaceae plant family. By bridging these different scales, we present an integrated mechanism for explosive seed dispersal that links evolutionary novelty with complex trait innovation. VIDEO ABSTRACT.

  19. [Explosion injuries - prehospital care and management].

    Science.gov (United States)

    Holsträter, Thorsten; Holsträter, Susanne; Rein, Daniela; Helm, Matthias; Hossfeld, Björn

    2013-11-01

    Explosion injuries are not restricted to war-like military conflicts or terrorist attacks. The emergency physician may also encounter such injuries in the private or industrial fields, injuries caused by fireworks or gas explosions. In such cases the injury patterns are especially complex and may consist of blunt and penetrating injuries as well as thermal damage. Emergency medical personnel must be prepared to cope with explosion trauma not only in individual cases but also in major casualty incidents (MCI). This necessitates a sound knowledge about the mechanisms and processes of an explosion as well as the particular pathophysiological relationships of explosion injuries in order to be able to initiate the best possible, guideline-conform trauma therapy.

  20. Explosion probability of unexploded ordnance: expert beliefs.

    Science.gov (United States)

    MacDonald, Jacqueline Anne; Small, Mitchell J; Morgan, M G

    2008-08-01

    This article reports on a study to quantify expert beliefs about the explosion probability of unexploded ordnance (UXO). Some 1,976 sites at closed military bases in the United States are contaminated with UXO and are slated for cleanup, at an estimated cost of $15-140 billion. Because no available technology can guarantee 100% removal of UXO, information about explosion probability is needed to assess the residual risks of civilian reuse of closed military bases and to make decisions about how much to invest in cleanup. This study elicited probability distributions for the chance of UXO explosion from 25 experts in explosive ordnance disposal, all of whom have had field experience in UXO identification and deactivation. The study considered six different scenarios: three different types of UXO handled in two different ways (one involving children and the other involving construction workers). We also asked the experts to rank by sensitivity to explosion 20 different kinds of UXO found at a case study site at Fort Ord, California. We found that the experts do not agree about the probability of UXO explosion, with significant differences among experts in their mean estimates of explosion probabilities and in the amount of uncertainty that they express in their estimates. In three of the six scenarios, the divergence was so great that the average of all the expert probability distributions was statistically indistinguishable from a uniform (0, 1) distribution-suggesting that the sum of expert opinion provides no information at all about the explosion risk. The experts' opinions on the relative sensitivity to explosion of the 20 UXO items also diverged. The average correlation between rankings of any pair of experts was 0.41, which, statistically, is barely significant (p= 0.049) at the 95% confidence level. Thus, one expert's rankings provide little predictive information about another's rankings. The lack of consensus among experts suggests that empirical studies

  1. Mass extinctions and supernova explosions

    CERN Document Server

    Korschinek, Gunther

    2016-01-01

    A nearby supernova (SN) explosion could have negatively influenced life on Earth, maybe even been responsible for mass extinctions. Mass extinction poses a significant extinction of numerous species on Earth, as recorded in the paleontologic, paleoclimatic, and geological record of our planet. Depending on the distance between the Sun and the SN, different types of threats have to be considered, such as ozone depletion on Earth, causing increased exposure to the Sun's ultraviolet radiation, or the direct exposure of lethal x-rays. Another indirect effect is cloud formation, induced by cosmic rays in the atmosphere which result in a drop in the Earth's temperature, causing major glaciations of the Earth. The discovery of highly intensive gamma ray bursts (GRBs), which could be connected to SNe, initiated further discussions on possible life-threatening events in Earth's history. The probability that GRBs hit the Earth is very low. Nevertheless, a past interaction of Earth with GRBs and/or SNe cannot be exclude...

  2. Nuclear explosives testing readiness evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Valk, T.C.

    1993-09-01

    This readiness evaluation considers hole selection and characterization, verification, containment issues, nuclear explosive safety studies, test authorities, event operations planning, canister-rack preparation, site preparation, diagnostic equipment setup, device assembly facilities and processes, device delivery and insertion, emplacement, stemming, control room activities, readiness briefing, arming and firing, test execution, emergency response and reentry, and post event analysis to include device diagnostics, nuclear chemistry, and containment. This survey concludes that the LLNL program and its supporting contractors could execute an event within six months of notification, and a second event within the following six months, given the NET group`s evaluation and the following three restraints: (1) FY94 (and subsequent year) funding is essentially constant with FY93, (2) Preliminary work for the initial event is completed to the historical sic months status, (3) Critical personnel, currently working in dual use technologies, would be recallable as needed.

  3. Congenital Arthrogryposis: An Extension of the 15q11.2 BP1-BP2 Microdeletion Syndrome?

    Directory of Open Access Journals (Sweden)

    K. M. Usrey

    2014-01-01

    Full Text Available The proximal 15q11–q13 region contains 5 breakpoints (BP1–BP5. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes. The genes in this region are known to play a role in central nervous system development and/or function. Microdeletions within the 15q11.2 BP1-BP2 region have been reported in patients with neurological dysfunction, developmental delays, behavioral problems, and dysmorphic features. We report two unrelated subjects with the 15q11.2 BP1-BP2 microdeletion and presenting with congenital arthrogryposis, a feature which has not been previously reported as part of this newly recognized microdeletion syndrome. While arthrogryposis seen in these two subjects may be coincidental, we propose that congenital arthrogryposis may result from neurological dysfunction and involvement of the microdeletion of the 15q11.2 BP1-BP2 region, further expanding the phenotype of this microdeletion syndrome. We encourage others to report patients with this chromosome microdeletion and neurological findings to further characterize the clinical phenotype.

  4. AcEST: BP912912 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000024_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000024_C05. BP912912... CL1433Contig1 Show BP912912 Clone id YMU001_000024_C05 Library YMU01 Length 413 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000024_C05. Accession BP912912 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912912|Adiantum capillus-ven...eris mRNA, clone: YMU001_000024_C05. (413 letters) Database: uniprot_sprot.fasta 412

  5. AcEST: BP912312 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000017_F01 489 Adiantum capillus-veneris mRNA. clone: YMU001_000017_F01. BP912312... CL1779Contig1 Show BP912312 Clone id YMU001_000017_F01 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000017_F01. Accession BP912312 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912312...|Adiantum capillus-veneris mRNA, clone: YMU001_000017_F01. (489 letters) Database: uniprot_sprot.fasta 412

  6. AcEST: BP912612 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H07. BP912612 - Show BP912612... Clone id YMU001_000020_H07 Library YMU01 Length 512 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000020_H07. Accession BP912612 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912612|Adiantum cap...illus-veneris mRNA, clone: YMU001_000020_H07. (512 letters) Database: uniprot_sprot.fasta 412,525 sequences;

  7. AcEST: BP912126 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa

  8. AcEST: BP912128 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D10 477 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D10. BP91212...8 CL2328Contig1 Show BP912128 Clone id YMU001_000015_D10 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D10. Accession BP912128 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...8|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D10. (461 letters) Database: uniprot_sprot.fasta 412

  9. AcEST: BP912212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D11 457 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D11. BP912212... CL1085Contig1 Show BP912212 Clone id YMU001_000016_D11 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D11. Accession BP912212 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912212...|Adiantum capillus-veneris mRNA, clone: YMU001_000016_D11. (457 letters) Database: uniprot_sprot.fasta 412

  10. AcEST: BP912712 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show BP912712...is mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, cl...one: YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI

  11. AcEST: BP912123 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D05 496 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D05. BP91212...3 CL498Contig1 Show BP912123 Clone id YMU001_000015_D05 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D05. Accession BP912123 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...3|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D05. (478 letters) Database: uniprot_sprot.fasta 412

  12. AcEST: BP912012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP912012... CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...mRNA, clone: YMU001_000012_A06. (542 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 t

  13. AcEST: BP913032 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_F07 344 Adiantum capillus-veneris mRNA. clone: YMU001_000025_F07. BP91303...2 CL600Contig1 Show BP913032 Clone id YMU001_000025_F07 Library YMU01 Length 344 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000025_F07. Accession BP913032 Tissue type prothallium Developmental stage... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913032|Adiantum capillus-veneris mRNA, clone: YM...997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2

  14. AcEST: BP920204 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_C07 410 Adiantum capillus-veneris mRNA. clone: YMU001_000134_C07. BP92020...4 CL2814Contig1 Show BP920204 Clone id YMU001_000134_C07 Library YMU01 Length 410 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000134_C07. Accession BP920204 Tissue type prothallium Developmental stag...port BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, J...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920204|Adiantum capillus

  15. AcEST: BP920620 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000139_D03 185 Adiantum capillus-veneris mRNA. clone: YMU001_000139_D03. BP920620 - Show BP920620...is mRNA. clone: YMU001_000139_D03. Accession BP920620 Tissue type prothallium Developmental stage - Contig I...hit_id - Definition - Align length - Score (bit) - E-value - Report BLASTX 2.2.19 [Nov-02-20...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920620|Adiantum...core (bit) - E-value - Report BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, St

  16. AcEST: BP920720 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000140_F08 378 Adiantum capillus-veneris mRNA. clone: YMU001_000140_F08. BP920720... CL2798Contig1 Show BP920720 Clone id YMU001_000140_F08 Library YMU01 Length 378 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000140_F08. Accession BP920720 Tissue type prothallium Developmental stag...ort BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Ji...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920720|Adiantum capillus-

  17. AcEST: BP917260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000098_D06 504 Adiantum capillus-veneris mRNA. clone: YMU001_000098_D06. BP917260... CL2353Contig1 Show BP917260 Clone id YMU001_000098_D06 Library YMU01 Length 504 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000098_D06. Accession BP917260 Tissue type prothallium Developmental stag..., Nucleic Acids Res. 25:3389-3402. Query= BP917260|Adiantum capillus-veneris mRNA, clone: YMU001_000098_D06....PQAVIDAVAETELITTAIGPNILPFIAQLIAKGIEKRR 110 Query: 260 REYNQKHIAIQQSKNL 213 NQ + I +N+ Sbjct: 111 ESQNQTPLDII

  18. AcEST: BP912609 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H04 400 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H04. BP91260...9 CL1957Contig1 Show BP912609 Clone id YMU001_000020_H04 Library YMU01 Length 400 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000020_H04. Accession BP912609 Tissue type prothallium Developmental stag...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912609|...Gaps = 2/71 (2%) Frame = -3 Query: 260 KVMSPLQSR*GQHKSAALKSTPL*QAANVHPHANQEVLY-PKTPIGYDGHDGQFVQPQ-T 87 KV++P

  19. AcEST: BP914033 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B04 449 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B04. BP914033 - Show BP91403...is mRNA. clone: YMU001_000039_B04. Accession BP914033 Tissue type prothallium Developmental stage - Contig I... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91403...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25

  20. AcEST: BP915252 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000069_C12 486 Adiantum capillus-veneris mRNA. clone: YMU001_000069_C12. BP915252... CL1221Contig1 Show BP915252 Clone id YMU001_000069_C12 Library YMU01 Length 486 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000069_C12. Accession BP915252 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915252...|Adiantum capillus-veneris mRNA, clone: YMU001_000069_C12. (486 letters) Database: uniprot_sprot.fasta 412,52