Mark Bowden and Owen Sheers present "Creation" [working title]: a new musical and poetic collaborative project for chorus, soloists and orchestra

CERN Multimedia

2013-01-01

"Creation" is a new collaboration between Mark Bowden, in his role as BBC National Orchestra of Wales’ Resident Composer, and the poet and novelist Owen Sheers.   Taking Haydn's 1798 work "The Creation" as a point of departure, they plan to create a new cantata for the digital age exploring the meaning of creation in the twenty-first century. Through engagement with developments in biology and physics they plan to create a new work incorporating poetry and music that will explore the latest ideas concerning the creation of matter and the emergence of life in the universe, whilst also delving into the human side of the brilliant minds that are currently working to uncover these secrets of the universe. More information is available here. Meet them at the CERN Library (bldg. 52 1-052) on Wednesday 2 October at 4 p.m. * Coffee will be served at 3.30 p.m.*

Use of filter papers to determine seroprevalence of Toxoplasma gondii among hunted ungulates

Science.gov (United States)

Toxoplasmosis is a zoonosis caused by the protozoan Toxoplasma gondii, and it is found worldwide. To determine whether ungulates are reservoirs of T. gondii in an isolated and remote region of the northeastern Peruvian Amazon, antibodies to T. gondii were determined in 5 species of ungulates by the...

Traffic mortality of four ungulate species in southern Finland

Directory of Open Access Journals (Sweden)

Milla Niemi

2015-07-01

Full Text Available Ungulate–vehicle collisions are intensively studied in many countries. However, limited knowledge exists on how many animals struck actually die due to collisions and whether differences in traffic mortality occur between species living in the same area. In this study, we estimated a kill rate (the proportion of individuals killed/struck and, in relation to their winter population sizes, the collision and traffic mortality rates for four ungulate species (moose Alces alces, white-tailed deer Odocoileus virginianus, roe deer Capreolus capreolus, and fallow deer Dama dama. We used an unofficial collision register collected between 2001 and 2012 (a total of 12 years by voluntary hunters from the Hyvinkää Game Management Area (323 km2 located in southern Finland. The population estimates used were based on annual snow track censuses. A total of 497 ungulates were involved in collisions during the study period. Of these, 76% were killed directly or put down afterwards. Roe deer had the highest kill rate; 95% of struck individuals died. White-tailed deer had the highest collision and traffic mortality rates (8.0% and 6.5% of the winter population, respectively, followed by moose (6.5 % and 4.5%, roe deer (3.9% and 3.7%, and fallow deer (3.2% and 2.1%. As we found the collision and traffic mortality rates to be unequal between species, we recommend separately reporting all ungulate species when compiling collision statistics. We additionally suggest that local managers should be aware of ungulate collision and traffic mortality rates in their areas and should use this knowledge when planning annual harvest.

Distribution and extinction of ungulates during the Holocene of the southern Levant.

Directory of Open Access Journals (Sweden)

Ella Tsahar

Full Text Available BACKGROUND: The southern Levant (Israel, Palestinian Authority and Jordan has been continuously and extensively populated by succeeding phases of human cultures for the past 15,000 years. The long human impact on the ancient landscape has had great ecological consequences, and has caused continuous and accelerating damage to the natural environment. The rich zooarchaeological data gathered at the area provide a unique opportunity to reconstruct spatial and temporal changes in wild species distribution, and correlate them with human demographic changes. METHODOLOGY: Zoo-archaeological data (382 animal bone assemblages from 190 archaeological sites from various time periods, habitats and landscapes were compared. The bone assemblages were sorted into 12 major cultural periods. Distribution maps showing the presence of each ungulate species were established for each period. CONCLUSIONS: The first major ungulate extinction occurred during the local Iron Age (1,200-586 BCE, a period characterized by significant human population growth. During that time the last of the largest wild ungulates, the hartebeest (Alcelaphus buselaphus, aurochs (Bos primigenius and the hippopotamus (Hippopotamus amphibius became extinct, followed by a shrinking distribution of forest-dwelling cervids. A second major wave of extinction occurred only in the 19th and 20th centuries CE. Furthermore, a negative relationship was found between the average body mass of ungulate species that became extinct during the Holocene and their extinction date. It is thus very likely that the intensified human activity through habitat destruction and uncontrolled hunting were responsible for the two major waves of ungulate extinction in the southern Levant during the late Holocene.

Distribution and extinction of ungulates during the Holocene of the southern Levant.

Science.gov (United States)

Tsahar, Ella; Izhaki, Ido; Lev-Yadun, Simcha; Bar-Oz, Guy

2009-01-01

The southern Levant (Israel, Palestinian Authority and Jordan) has been continuously and extensively populated by succeeding phases of human cultures for the past 15,000 years. The long human impact on the ancient landscape has had great ecological consequences, and has caused continuous and accelerating damage to the natural environment. The rich zooarchaeological data gathered at the area provide a unique opportunity to reconstruct spatial and temporal changes in wild species distribution, and correlate them with human demographic changes. Zoo-archaeological data (382 animal bone assemblages from 190 archaeological sites) from various time periods, habitats and landscapes were compared. The bone assemblages were sorted into 12 major cultural periods. Distribution maps showing the presence of each ungulate species were established for each period. The first major ungulate extinction occurred during the local Iron Age (1,200-586 BCE), a period characterized by significant human population growth. During that time the last of the largest wild ungulates, the hartebeest (Alcelaphus buselaphus), aurochs (Bos primigenius) and the hippopotamus (Hippopotamus amphibius) became extinct, followed by a shrinking distribution of forest-dwelling cervids. A second major wave of extinction occurred only in the 19th and 20th centuries CE. Furthermore, a negative relationship was found between the average body mass of ungulate species that became extinct during the Holocene and their extinction date. It is thus very likely that the intensified human activity through habitat destruction and uncontrolled hunting were responsible for the two major waves of ungulate extinction in the southern Levant during the late Holocene.

A framework for understanding semi-permeable barrier effects on migratory ungulates

Science.gov (United States)

Sawyer, Hall; Kauffman, Matthew J.; Middleton, Arthur D.; Morrison, Thomas A.; Nielson, Ryan M.; Wyckoff, Teal B.

2013-01-01

1. Impermeable barriers to migration can greatly constrain the set of possible routes and ranges used by migrating animals. For ungulates, however, many forms of development are semi-permeable, and making informed management decisions about their potential impacts to the persistence of migration routes is difficult because our knowledge of how semi-permeable barriers affect migratory behaviour and function is limited. 2. Here, we propose a general framework to advance the understanding of barrier effects on ungulate migration by emphasizing the need to (i) quantify potential barriers in terms that allow behavioural thresholds to be considered, (ii) identify and measure behavioural responses to semi-permeable barriers and (iii) consider the functional attributes of the migratory landscape (e.g. stopovers) and how the benefits of migration might be reduced by behavioural changes. 3. We used global position system (GPS) data collected from two subpopulations of mule deer Odocoileus hemionus to evaluate how different levels of gas development influenced migratory behaviour, including movement rates and stopover use at the individual level, and intensity of use and width of migration route at the population level. We then characterized the functional landscape of migration routes as either stopover habitat or movement corridors and examined how the observed behavioural changes affected the functionality of the migration route in terms of stopover use. 4. We found migratory behaviour to vary with development intensity. Our results suggest that mule deer can migrate through moderate levels of development without any noticeable effects on migratory behaviour. However, in areas with more intensive development, animals often detoured from established routes, increased their rate of movement and reduced stopover use, while the overall use and width of migration routes decreased. 5. Synthesis and applications. In contrast to impermeable barriers that impede animal movement

A survey of the transmission of infectious diseases/infections between wild and domestic ungulates in Europe

Science.gov (United States)

2011-01-01

The domestic animals/wildlife interface is becoming a global issue of growing interest. However, despite studies on wildlife diseases being in expansion, the epidemiological role of wild animals in the transmission of infectious diseases remains unclear most of the time. Multiple diseases affecting livestock have already been identified in wildlife, especially in wild ungulates. The first objective of this paper was to establish a list of infections already reported in European wild ungulates. For each disease/infection, three additional materials develop examples already published, specifying the epidemiological role of the species as assigned by the authors. Furthermore, risk factors associated with interactions between wild and domestic animals and regarding emerging infectious diseases are summarized. Finally, the wildlife surveillance measures implemented in different European countries are presented. New research areas are proposed in order to provide efficient tools to prevent the transmission of diseases between wild ungulates and livestock. PMID:21635726

Identification and phylogenetic analysis of novel cytochrome P450 1A genes from ungulate species.

Science.gov (United States)

Darwish, Wageh Sobhy; Kawai, Yusuke; Ikenaka, Yoshinori; Yamamoto, Hideaki; Muroya, Tarou; Ishizuka, Mayumi

2010-09-01

As part of an ongoing effort to understand the biological response of wild and domestic ungulates to different environmental pollutants such as dioxin-like compounds, cDNAs encoding for CYP1A1 and CYP1A2 were cloned and characterized. Four novel CYP1A cDNA fragments from the livers of four wild ungulates (elephant, hippopotamus, tapir and deer) were identified. Three fragments from hippopotamus, tapir and deer were classified as CYP1A2, and the other fragment from elephant was designated as CYP1A1/2. The deduced amino acid sequences of these fragment CYP1As showed identities ranging from 76 to 97% with other animal CYP1As. The phylogenetic analysis of these fragments showed that both elephant and hippopotamus CYP1As made separate branches, while tapir and deer CYP1As were located beside that of horse and cattle respectively in the phylogenetic tree. Analysis of dN/dS ratio among the identified CYP1As indicated that odd toed ungulate CYP1A2s were exposed to different selection pressure.

Recruitment dynamics mediated by ungulate herbivory can affect species coexistence for tree seedling assemblages

Directory of Open Access Journals (Sweden)

Chi-Yu Weng

2017-08-01

Full Text Available The best-known mechanism that herbivory affects species coexistence of tree seedlings is negative density-dependency driven by specialist natural enemies. However, in a forest with intense herbivory by non-specialists, what causes a diversifying seedling bank if rare species do not benefit from negative density-dependency in dominant species? We hypothesize that generalist herbivores can cause unevenly distributed species-specific mortality, which mediates recruitment dynamics and therefore affects species coexistence. To answer this question, we conducted a fence-control experiment in a montane cloud forest, Taiwan, and found that herbivorous damages were mainly caused by ungulates, which are generalists. We explored ungulate herbivory effects on recruitment dynamics by censusing tree seedling dynamics for three years. We found that herbivorous damages by ungulates significantly cause seedling death, mostly at their early stage of establishment. The percentage of death caused by herbivory varied among species. In particular, nurse plants and seedling initial height help shade-tolerant species to persist under such intense herbivory. Whereas, deaths caused by other factors occurred more often in older seedlings, with a consistent low percentage among species. We then tested species coexistence maintenance by dynamic modelling under different scenarios of ungulate herbivory. Raising percentages of death by herbivory changes relative species abundances by suppressing light-demanding species and increasing shade-tolerant species. Density-dependent mortality immediately after bursts of recruitments can suppress dominance of abundant species. With ungulate herbivory, fluctuating recruitment further prevent rare species from apparent competition induced by abundant species. Such bio-processes can interact with ungulate herbivory so that long-term coexistence can be facilitated.

Ungulate exclusion, conifer thinning and mule deer forage in northeastern New Mexico

Science.gov (United States)

Kramer, David W.; Sorensen, Grant E.; Taylor, Chase A.; Cox, Robert D.; Gipson, Philip S.; Cain, James W.

2015-01-01

The southwestern United States has experienced expansion of conifer species (Juniperus spp. and Pinus ponderosa) into areas of semi-arid grassland over the past century. The expansion of conifers can limit palatable forage and reduce grass and forb communities. Conifer species are sometimes thinned through hydraulic mulching or selective cutting. We assessed the effects of these treatments on mule deer (Odocoileus hemionus) habitat in northeastern New Mexico to determine if conifer thinning improved cover of preferred forage species for mule deer in areas with and without ungulates. We measured plant cover and occurrence of preferred forage species in the summers of 2011 and 2012. An ongoing regional drought probably reduced vegetation response, with preferred forage species and herbaceous cover responding to conifer thinning or ungulate exclusion immediately following treatment, but not the following year. In 2011, areas that received thinning treatments had a higher abundance of preferred forage when compared to sites with no treatment. Grass coverage exhibited an immediate response in 2011, with ungulate exclosures containing 8% more coverage than areas without exclosures. The results suggest that conifer thinning and ungulate exclusion may elicit a positive response, however in the presence of drought; the positive effects are only short-term.

What cues do ungulates use to assess predation risk in dense temperate forests?

NARCIS (Netherlands)

Kuijper, Dries P.J.; Verwijmeren, Mart; Churski, Marcin; Zbyryt, Adam; Schmidt, Krzysztof; Jędrzejewska, Bogumiła; Smit, Chris

2014-01-01

Anti-predator responses by ungulates can be based on habitat features or on the near-imminent threat of predators. In dense forest, cues that ungulates use to assess predation risk likely differ from half-open landscapes, as scent relative to sight is predicted to be more important. We studied, in

Wild Ungulate Distribution in the Naban River Watershed National Nature Reserve, Southwest China

Directory of Open Access Journals (Sweden)

A.C. Treydte

2014-01-01

Full Text Available Southeast Asia´s tropical forests harbour a unique diversity of wildlife but species and numbers are rapidly declining under current land use. To improve conservation strategies in these biodiversity hotspots, knowledge of animal species present and their distribution is crucial. We wanted to identify the ungulate community composition and distribution of a ‘Man and Biosphere’ reserve, the Naban River Watershed National Nature Reserve (NRWNNR, Yunnan, Southwest China. Using camera traps, transects, and spoor-plots we identified wild ungulate species and corresponding habitat properties. We compared two study sites of different protection status – the buffer and experimental zones – on an overall transect length of 32 km and analysed relationships between wildlife activity, forest vegetation structure, and human disturbance. We documented six ungulate species, all of which occurred in the buffer zone while only three species were found in the experimental zone. Wild boar sign density was about 10 times higher in the buffer than in the experimental zone. Overall wildlife sign density increased with distance away from human settlements and closer to the core zone. Hence, human disturbance strongly influenced wild ungulate abundance but the NRWNNR was found to host a diverse ungulate community, considering its small size and compared to other conservation areas in the region. The combination of various methods proved to be successful in identifying and locating forest wildlife. The NRWNNR, particularly the more strongly protected zones, could greatly contribute to future ecotourism activities in Yunnan if a strict preservation of buffer and core zones can be maintained.

Effects of Nonnative Ungulate Removal on Plant Communities and Soil Biogeochemistry in Tropical Forests

Science.gov (United States)

Cole, R. J.; Litton, C. M.; Giardina, C. P.; Sparks, J. P.

2014-12-01

Non-native ungulates have substantial impacts on native ecosystems globally, altering both plant communities and soil biogeochemistry. Across tropical and temperate ecosystems, land managers fence and remove non-native ungulates to conserve native biodiversity, a costly management action, yet long-term outcomes are not well quantified. Specifically, knowledge gaps include: (i) the magnitude and time frame of plant community recovery; (ii) the response of non-native invasive plants; and (iii) changes to soil biogeochemistry. In 2010, we established a series of paired ungulate presence vs. removal plots that span a 20 yr. chronosequence in tropical montane wet forests on the Island of Hawaii to quantify the impacts and temporal legacy of feral pig removal on plant communities and soil biogeochemistry. We also compared soil biogeochemistry in targeted areas of low and high feral pig impact. Our work shows that both native and non-native vegetation respond positively to release from top-down control following removal of feral pigs, but species of high conservation concern recover only if initially present at the time of non-native ungulate removal. Feral pig impacts on soil biogeochemistry appear to last for at least 20 years following ungulate removal. We observed that both soil physical and chemical properties changed with feral pig removal. Soil bulk density and volumetric water content decreased while extractable base cations and inorganic N increased in low vs. high feral pig impact areas. We hypothesize that altered soil biogeochemistry facilitates continued invasions by non-native plants, even decades after non-native ungulate removal. Future work will concentrate on comparisons between wet and dry forest ecosystems and test whether manipulation of soil nutrients can be used to favor native vs. non-native plant establishment.

Survival strategies in arctic ungulates

Directory of Open Access Journals (Sweden)

N. J. C. Tyler

1990-09-01

Full Text Available Arctic ungulates usually neither freeze nor starve to death despite the rigours of winter. Physiological adaptations enable them to survive and reproduce despite long periods of intense cold and potential undernutrition. Heat conservation is achieved by excellent insulation combined with nasal heat exchange. Seasonal variation in fasting metabolic rate has been reported in several temperate and sub-arctic species of ungulates and seems to occur in muskoxen. Surprisingly, there is no evidence for this in reindeer. Both reindeer and caribou normally maintain low levels of locomotor activity in winter. Light foot loads are important for reducing energy expenditure while walking over snow. The significance and control of selective cooling of the brain during hard exercise (e.g. escape from predators is discussed. Like other cervids, reindeer and caribou display a pronounced seasonal cycle of appetite and growth which seems to have an intrinsic basis. This has two consequences. First, the animals evidently survive perfectly well despite enduring negative energy balance for long periods. Second, loss of weight in winter is not necessarily evidence of undernutrition. The main role of fat reserves, especially in males, may be to enhance reproductive success. The principal role of fat reserves in winter appears to be to provide a supplement to, rather than a substitute for, poor quality winter forage. Fat also provides an insurance against death during periods of acute starvation.

Thermal cover needs of large ungulates: a review of hypothesis tests.

Science.gov (United States)

John G. Cook; Larry L. Irwin; Larry D. Bryant; Robert A. Riggs; Jack Ward. Thomas

2004-01-01

A great deal of big game research occurred in western North America during the 1960s through the 1980s, and many advances in our knowledge occurred as a result. Timber harvest increased during this period in many localities, and this trend was often perceived to threaten ungulate populations (Hieb 1976). Thus, it is not surprising that appreciable research in this era...

Effects of resource distribution patterns on ungulate foraging behaviour: a modelling approach.

NARCIS (Netherlands)

Wallis de Vries, M.F.

1996-01-01

The food resources of forest ungulates typically are patchily distributed. Research on foraging behaviour has often focused on habitat selection but has rarely taken into account the influence of the spatial distribution of different food patches in two dimensions. However, especially when

Prepartum Maternal Behavior of Domesticated Cattle: A Comparison with Managed, Feral, and Wild Ungulates

DEFF Research Database (Denmark)

Rørvang, Maria Vilain; Nielsen, Birte Lindstrøm; Herskin, Mette S.

2018-01-01

The event of giving birth is an essential part of animal production. In dairy cattle production, there are substantial economical and welfare-related challenges arising around the time of parturition, and hence increased focus on efficient management of the calving cow. Drawing on the research...... and recommendations for the management of calving cows. Maternal prepartum behavior varies among species, but the final goal of ungulate mothers is the same: ensuring a calm parturition and optimal environment for the onset of postpartum maternal behavior by locating an appropriate birth site, with low risk...... prepartum and postpartum maternal behavior. Dairy cows are thus exposed to several factors in a commercial calving environment, which may thwart their maternal motivations and influence their behavior. In addition, prepartum cattle may be more affected by olfactory cues than other ungulate species (e...

Changes of population trends and mortality patterns in response to the reintroduction of large predators: The case study of African ungulates

Science.gov (United States)

Grange, Sophie; Owen-Smith, Norman; Gaillard, Jean-Michel; Druce, Dave J.; Moleón, Marcos; Mgobozi, Mandisa

2012-07-01

Large predators have been reintroduced to an increasing number of protected areas in South Africa. However, the conditions allowing both prey and predator populations to be sustained in enclosed areas are still unclear as there is a lack of understanding of the consequences of such reintroductions for ungulate population dynamics. Variation in lion numbers, two decades after their first release, offered a special opportunity to test the effects of predation pressure on the population dynamics of seven ungulate species in the 960 km2 Hluhluwe-iMfolozi Park (HiP), South Africa. We used two different approaches to examine predator-prey relationships: the population response of ungulates to predation pressure after accounting for possible confounding factors, and the pattern of ungulate adult mortality observed from carcass records. Rainfall patterns affected observed mortalities of several ungulate species in HiP. Although lion predation accounted for most ungulate mortality, it still had no detectable influence on ungulate population trends and mortality patterns, with one possible exception. This evidence suggests that the lion population had not yet attained the maximum abundance potentially supported by their ungulate prey; but following recent increases in lion numbers it will probably occur soon. It remains uncertain whether a quasi-stable balance will be reached between prey and predator populations, or whether favoured prey species will be depressed towards levels potentially generating oscillatory dynamics in this complex large mammal assemblage. We specifically recommend a continuous monitoring of predator and prey populations in HiP since lions are likely to show more impacts on their prey species in the next years.

Ungulate browsing maintains shrub diversity in the absence of episodic disturbance in seasonally-arid conifer forest

Science.gov (United States)

Burak K. Pekin; Michael J. Wisdom; Bryan A. Endress; Bridgett J. Naylor; Catherine G. Parks

2014-01-01

Ungulates exert a strong influence on the composition and diversity of vegetation communities. However, little is known about how ungulate browsing pressure interacts with episodic disturbances such as fire and stand thinning. We assessed shrub responses to variable browsing pressure by cattle and elk in fuels treated (mechanical removal of fuels followed by prescribed...

Prepartum Maternal Behavior of Domesticated Cattle: A Comparison with Managed, Feral, and Wild Ungulates

Directory of Open Access Journals (Sweden)

Maria Vilain Rørvang

2018-03-01

Full Text Available The event of giving birth is an essential part of animal production. In dairy cattle production, there are substantial economical and welfare-related challenges arising around the time of parturition, and hence increased focus on efficient management of the calving cow. Drawing on the research literature on prepartum maternal behavior, this review compares cattle to other members of the ungulate clade with the aim of understanding the biological basis of bovine prepartum behavior with main emphasis on dairy cows. Ultimately, this knowledge may be used in future development of housing systems and recommendations for the management of calving cows. Maternal prepartum behavior varies among species, but the final goal of ungulate mothers is the same: ensuring a calm parturition and optimal environment for the onset of postpartum maternal behavior by locating an appropriate birth site, with low risk of predators, disturbances and mistaken identity of offspring. Features of chosen birth sites vary among species and depend largely on the environment, as ungulate females display a considerable ability to adapt to their surroundings. However, within commercial housing conditions in dairy production, the animals’ ability to adapt behaviorally appears to be challenged. Confinement alongside high stocking densities leave little room to express birth-site selection behavior, posing a high risk of agonistic social behavior, disturbances, and mismothering, as well as exposure to olfactory cues influencing both prepartum and postpartum maternal behavior. Dairy cows are thus exposed to several factors in a commercial calving environment, which may thwart their maternal motivations and influence their behavior. In addition, prepartum cattle may be more affected by olfactory cues than other ungulate species (e.g., sheep because they are attracted to birth fluids already before calving. Hence, providing dairy cows with an environment where they can perform the

Epidemiology of Pestivirus infection in wild ungulates of the French South Alps.

Science.gov (United States)

Martin, Claire; Letellier, Carine; Caij, Brigitte; Gauthier, Dominique; Jean, Nicolas; Shaffii, Anahita; Saegerman, Claude

2011-01-27

Inter-species transmission is often incriminated in the epidemiology of Pestivirus diseases. The purpose of this study was to investigate the prevalence of Pestivirus in some mountain wild ungulates and to determine their role in Pestivirus transmission, as mountain pastures are a place where cohabitations between wild and domestic ungulates are particularly high. Between 2003 and 2007, a longitudinal epidemiological study was carried out on hunted ungulates in the French Hautes-Alpes department. Pestivirus-specific antibodies against p80 protein (also named NS3) common to all Bovine Viral Diarrhea Virus (BVDV) and Border Disease Virus (BDV) were found in 45.9% (95% confidence interval [CI95%]: 40.5-51.3%) of the 343 tested chamois (Rupicapra rupicapra). In addition, mouflons (Ovis gmelinii musimon) were shown for the first time to be strongly infected (61.1%; CI95%: 38.6-83.6) by a Pestivirus. These serological ELISA results were confirmed by comparative virus neutralization tests, performed on seven Pestivirus strains by using 15 seropositive samples. The highest antibody titers were directed against 2 BDV strains (Av and 33s strains), rather than BDV-4, a strain responsible for Pyrenean-chamois epizooties. Virus neutralization tests confirm a BDV circulation in wild ungulates in the French South Alps. However, no Pestivirus RNA was detected by reverse-transcriptase polymerase chain reaction in serum and spleen samples from seronegative animals and no virus was isolated from those samples either. Efforts should be made to improve the protocol in order to be able to isolate and characterize the local strain. Finally, the oldness (age) and femaleness (gender) increase the risk of seroconversion in chamois. Copyright © 2010 Elsevier B.V. All rights reserved.

The shape of contention: adaptation, history, and contingency in ungulate mandibles.

Science.gov (United States)

Raia, Pasquale; Carotenuto, Francesco; Meloro, Carlo; Piras, Paolo; Pushkina, Diana

2010-05-01

Mandibles and teeth of ungulates have been extensively studied to discern the functional significance of their design. Grazing ungulates have deeper mandibles, longer coronoid processes, flatter incisor arcades, and more hypsodont molars in comparison to browsers. If the functional significance of both mandible and teeth shapes is well-established, it remains uncertain to what extent mandible shapes are really adapted to grazing, meaning that they evolved either to serve their current biological function or just as a structural requirement to accommodate higher crowned molars. Here, we address this question by studying the contribution of phylogeny, hypsodonty, and body size to mandibular shape variation. The mandible shape appeared to be significantly influenced by hypsodonty but not by body size. Interestingly, hypsodonty-related changes influenced the tooth row in artiodactyls and perissodactyls significantly but in the opposite directions, which is ultimately related to their different digestive strategies. Yet, we obtained a strong phylogenetic effect in perissodactyls, suggesting that their mandible shape should be strongly inherited. The strength of this effect was not significant within artiodactyls (where hypsodonty explained much more variance in mandible shape). Digestive strategy is deemed to interplay with hypsodonty to produce different paths of adaptation to particular diets in ungulates.

Epizoochorous dispersal by ungulates depends on fur, grooming and social interactions.

Science.gov (United States)

Liehrmann, Océane; Jégoux, Flore; Guilbert, Marie-Alice; Isselin-Nondedeu, Francis; Saïd, Sonia; Locatelli, Yann; Baltzinger, Christophe

2018-02-01

The transport phase of the animal-mediated plant dispersal process is critical to dispersal effectiveness as it determines the spatial distribution of the diaspores released and their chance for further recruitment. Assessing this specific phase of the dispersal process generally requires combining diaspore retention times with the associated distances covered. Here, we specifically tested the effect of grooming behavior, interindividual contacts and ungulate fur on diaspore retention times and associated dispersal distances for the hooked diaspores of Xanthium strumarium L. experimentally attached to tamed individuals of three ungulate species. We used a comparative approach based on differing fur quality on different body zones of these three ungulates. During 6-hr sessions, we monitored for grooming and social interactions that may induce intended or inadvertent diaspore detachment. Additionally, we proposed innovative approaches to directly assessing diaspore dispersal distances by red deer in situ. Fat-tailed functions fitted diaspore retention time, highlighting the potential for long-distance dispersal events. The longer the hair, the higher the retention capacity of diaspores in the animal's fur. As predicted, donkey retained diaspores longer than red deer and dwarf goat; and we also confirmed that diaspores attached to the short hair of the head fell off more quickly than did those on the other body zones. Dwarf goat groomed more often than both red deer and donkey, but also when it carried diaspores. Up to 14% of the diaspores detached from animal fur after specific grooming behavior. We observed, in controlled conditions, for the first time and for each ungulate species, interindividual transfers of diaspores, representing 5% of the diaspores attached to animals' fur. Our results militate for incorporating animal behavior into plant dispersal modeling approaches.

2nd International Arctic Ungulate Conference

OpenAIRE

Anonymous, A.

1996-01-01

The 2nd International Arctic Ungulate Conference was held 13-17 August 1995 on the University of Alaska Fairbanks campus. The Institute of Arctic Biology and the Alaska Cooperative Fish and Wildlife Research Unit were responsible for organizing the conference with assistance from biologists with state and federal agencies and commercial organizations. David R. Klein was chair of the conference organizing committee. Over 200 people attended the conference, coming from 10 different countries. T...

Lion, ungulate, and visitor reactions to playbacks of lion roars at Zoo Atlanta.

Science.gov (United States)

Kelling, Angela S; Allard, Stephanie M; Kelling, Nicholas J; Sandhaus, Estelle A; Maple, Terry L

2012-01-01

Felids in captivity are often inactive and elusive in zoos, leading to a frustrating visitor experience. Eight roars were recorded from an adult male lion and played back over speakers as auditory enrichment to benefit the lions while simultaneously enhancing the zoo visitor experience. In addition, ungulates in an adjacent exhibit were observed to ensure that the novel location and increased frequency of roars did not lead to a stress or fear response. The male lion in this study roared more in the playback phase than in the baseline phases while not increasing any behaviors that would indicate compromised welfare. In addition, zoo visitors remained at the lion exhibit longer during playback. The nearby ungulates never exhibited any reactions stronger than orienting to playbacks, identical to their reactions to live roars. Therefore, naturalistic playbacks of lion roars are a potential form of auditory enrichment that leads to more instances of live lion roars and enhances the visitor experience without increasing the stress levels of nearby ungulates or the lion themselves, who might interpret the roar as that of an intruder.

Generalists at the interface: Nematode transmission between wild and domestic ungulates.

Science.gov (United States)

Walker, Josephine G; Morgan, Eric R

2014-12-01

Many parasitic nematode species are generalists capable of infecting multiple host species. The complex life cycle of nematodes, involving partial development outside of the host, facilitates transmission of these parasites between host species even when there is no direct contact between hosts. Infective nematode larvae persist in the environment, and where grazing or water sources are shared ingestion of parasite larvae deposited by different host species is likely. In this paper we examine the extent to which nematode parasite species have been observed in sympatric wild and domestic ungulates. First, using existing host-parasite databases, we describe expected overlap of 412 nematode species between 76 wild and 8 domestic ungulate host species. Our results indicate that host-specific parasites make up less than half of the nematode parasites infecting any particular ungulate host species. For wild host species, between 14% (for common warthog) and 76% (for mouflon) of parasitic nematode species are shared with domestic species. For domestic host species, between 42% (for horse) and 77% (for llamas/alpacas) of parasitic nematode species are shared with wild species. We also present an index of liability to describe the risk of cross-boundary parasites to each host species. We then examine specific examples from the literature in which transmission of nematode parasites between domestic and wild ungulates is described. However, there are many limitations in the existing data due to geographical bias and certain host species being studied more frequently than others. Although we demonstrate that many species of parasitic nematode are found in both wild and domestic hosts, little work has been done to demonstrate whether transmission is occurring between species or whether similar strains circulate separately. Additional research on cross-species transmission, including the use of models and of genetic methods to define strains, will provide evidence to answer this

Generalists at the interface: Nematode transmission between wild and domestic ungulates

Directory of Open Access Journals (Sweden)

Josephine G. Walker

2014-12-01

Full Text Available Many parasitic nematode species are generalists capable of infecting multiple host species. The complex life cycle of nematodes, involving partial development outside of the host, facilitates transmission of these parasites between host species even when there is no direct contact between hosts. Infective nematode larvae persist in the environment, and where grazing or water sources are shared ingestion of parasite larvae deposited by different host species is likely. In this paper we examine the extent to which nematode parasite species have been observed in sympatric wild and domestic ungulates. First, using existing host–parasite databases, we describe expected overlap of 412 nematode species between 76 wild and 8 domestic ungulate host species. Our results indicate that host-specific parasites make up less than half of the nematode parasites infecting any particular ungulate host species. For wild host species, between 14% (for common warthog and 76% (for mouflon of parasitic nematode species are shared with domestic species. For domestic host species, between 42% (for horse and 77% (for llamas/alpacas of parasitic nematode species are shared with wild species. We also present an index of liability to describe the risk of cross-boundary parasites to each host species. We then examine specific examples from the literature in which transmission of nematode parasites between domestic and wild ungulates is described. However, there are many limitations in the existing data due to geographical bias and certain host species being studied more frequently than others. Although we demonstrate that many species of parasitic nematode are found in both wild and domestic hosts, little work has been done to demonstrate whether transmission is occurring between species or whether similar strains circulate separately. Additional research on cross-species transmission, including the use of models and of genetic methods to define strains, will provide

Possible causes of decreasing migratory ungulate populations in an East African savannah after restrictions in their seasonal movements

NARCIS (Netherlands)

Voeten, Margje M.; van de Vijver, Claudius A. D. M.; Olff, Han; van Langevelde, Frank

In many areas in Africa, seasonal movements of migratory ungulates are restricted and their population numbers decline, for example in the Tarangire region, Tanzania. Here, agriculture restricts migration of ungulates to their wet season ranges. We investigated whether low forage quality or supply

Supplemental feeding alters migration of a temperate ungulate.

Science.gov (United States)

Jones, Jennifer D; Kauffman, Matthew J; Monteith, Kevin L; Scurlock, Brandon M; Albeke, Shannon E; Cross, Paul C

Conservation of migration requires information on behavior and environmental determinants. The spatial distribution of forage resources, which migration exploits, often are altered and may have subtle, unintended consequences. Supplemental feeding is a common management practice, particularly for ungulates in North America and Europe, and carryover effects on behavior of this anthropogenic manipulation of forage are expected in theory, but have received limited empirical evaluation, particularly regarding effects on migration. We used global positioning system (GPS) data to evaluate the influence of winter feeding on migration behavior of 219 adult female elk (Cervus elaphus) from 18 fed ranges and 4 unfed ranges in western Wyoming. Principal component analysis revealed that the migratory behavior of fed and unfed elk differed in distance migrated, and the timing of arrival to, duration on, and departure from summer range. Fed elk migrated 19.2 km less, spent 11 more days on stopover sites, arrived to summer range 5 days later, resided on summer range 26 fewer days, and departed in the autumn 10 days earlier than unfed elk. Time-to-event models indicated that differences in migratory behavior between fed and unfed elk were caused by altered sensitivity to the environmental drivers of migration. In spring, unfed elk migrated following plant green-up closely, whereas fed elk departed the feedground but lingered on transitional range, thereby delaying their arrival to summer range. In autumn, fed elk were more responsive to low temperatures and precipitation events, causing earlier departure from summer range than unfed elk. Overall, supplemental feeding disconnected migration by fed elk from spring green-up and decreased time spent on summer range, thereby reducing access to quality forage. Our findings suggest that ungulate migration can be substantially altered by changes to the spatial distribution of resources, including those of anthropogenic origin, and that

Supplemental feeding alters migration of a temperate ungulate

Science.gov (United States)

Jones, Jennifer D; Kauffman, Matthew J.; Monteith, Kevin L.; Scurlock, Brandon M.; Albeke, Shannon E.; Cross, Paul C.

2014-01-01

Conservation of migration requires information on behavior and environmental determinants. The spatial distribution of forage resources, which migration exploits, often are altered and may have subtle, unintended consequences. Supplemental feeding is a common management practice, particularly for ungulates in North America and Europe, and carryover effects on behavior of this anthropogenic manipulation of forage are expected in theory, but have received limited empirical evaluation, particularly regarding effects on migration. We used global positioning system (GPS) data to evaluate the influence of winter feeding on migration behavior of 219 adult female elk (Cervus elaphus) from 18 fed ranges and 4 unfed ranges in western Wyoming. Principal component analysis revealed that the migratory behavior of fed and unfed elk differed in distance migrated, and the timing of arrival to, duration on, and departure from summer range. Fed elk migrated 19.2 km less, spent 11 more days on stopover sites, arrived to summer range 5 days later, resided on summer range 26 fewer days, and departed in the autumn 10 days earlier than unfed elk. Time-to-event models indicated that differences in migratory behavior between fed and unfed elk were caused by altered sensitivity to the environmental drivers of migration. In spring, unfed elk migrated following plant green-up closely, whereas fed elk departed the feedground but lingered on transitional range, thereby delaying their arrival to summer range. In autumn, fed elk were more responsive to low temperatures and precipitation events, causing earlier departure from summer range than unfed elk. Overall, supplemental feeding disconnected migration by fed elk from spring green-up and decreased time spent on summer range, thereby reducing access to quality forage. Our findings suggest that ungulate migration can be substantially altered by changes to the spatial distribution of resources, including those of anthropogenic origin, and that

The main but not the accessory olfactory system is involved in the processing of socially relevant chemosignals in ungulates.

Directory of Open Access Journals (Sweden)

Matthieu eKELLER

2012-09-01

Full Text Available Ungulates like sheep and goats have, like many other mammalian species, two complementary olfactory systems. The relative role played by these two systems has long been of interest regarding the sensory control of social behavior. The study of ungulate social behavior could represent a complimentary alternative to rodent studies because they live in a more natural environment and their social behaviors depend heavily on olfaction. In addition, the relative size of the main olfactory bulb (in comparison to the accessory olfactory bulb is more developped than in many other lissencephalic species like rodents. In this review, we present data showing a clear involvement of the main olfactory system in two well-characterized social situations under olfactory control in ungulates, namely maternal behavior and offspring recognition at birth and the reactivation of the gonadotropic axis of females exposed to males during the anestrous season. In conclusion, we discuss the apparent discrepancy between the absence of evidence for a role of the vomeronasal system in ungulate social behavior and the existence of a developed accessory olfactory system in these species.

Sagebrush-ungulate relationships on the Northern Yellowstone Winter Range

Science.gov (United States)

Carl L. Wambolt

2005-01-01

Sagebrush (Artemisia) taxa have historically been the landscape dominants over much of the Northern Yellowstone Winter Range (NYWR). Their importance to the unnaturally large ungulate populations on the NYWR throughout the twentieth century has been recognized since the 1920s. Sagebrush-herbivore ecology has been the focus of research on the NYWR for...

Ungulate browsing maintains shrub diversity in the absence of episodic disturbance in seasonally-arid conifer forest.

Directory of Open Access Journals (Sweden)

Burak K Pekin

Full Text Available Ungulates exert a strong influence on the composition and diversity of vegetation communities. However, little is known about how ungulate browsing pressure interacts with episodic disturbances such as fire and stand thinning. We assessed shrub responses to variable browsing pressure by cattle and elk in fuels treated (mechanical removal of fuels followed by prescribed burning and non-fuels treated forest sites in northeastern Oregon, US. Seven treatment paddocks were established at each site; three with cattle exclusion and low, moderate and high elk browsing pressure, three with elk exclusion and low, moderate and high cattle browsing pressure, and one with both cattle and elk exclusion. The height, cover and number of stems of each shrub species were recorded at multiple plots within each paddock at the time of establishment and six years later. Changes in shrub species composition over the six year period were explored using multivariate analyses. Generalized Linear Mixed Models were used to determine the effect of browsing pressure on the change in shrub diversity and evenness. Vegetation composition in un-browsed paddocks changed more strongly and in different trajectories than in browsed paddocks at sites that were not fuels treated. In fuels treated sites, changes in composition were minimal for un-browsed paddocks. Shrub diversity and evenness decreased strongly in un-browsed paddocks relative to paddocks with low, moderate and high browsing pressure at non-fuels treated sites, but not at fuels treated sites. These results suggest that in the combined absence of fire, mechanical thinning and ungulate browsing, shrub diversity is reduced due to increased dominance by certain shrub species which are otherwise suppressed by ungulates and/or fuels removal. Accordingly, ungulate browsing, even at low intensities, can be used to suppress dominant shrub species and maintain diversity in the absence of episodic disturbance events.

Adapting to climate change on Western public lands: addressing the ecological effects of domestic, wild, and feral ungulates.

Science.gov (United States)

Beschta, Robert L; Donahue, Debra L; DellaSala, Dominick A; Rhodes, Jonathan J; Karr, James R; O'Brien, Mary H; Fleischner, Thomas L; Deacon Williams, Cindy

2013-02-01

Climate change affects public land ecosystems and services throughout the American West and these effects are projected to intensify. Even if greenhouse gas emissions are reduced, adaptation strategies for public lands are needed to reduce anthropogenic stressors of terrestrial and aquatic ecosystems and to help native species and ecosystems survive in an altered environment. Historical and contemporary livestock production-the most widespread and long-running commercial use of public lands-can alter vegetation, soils, hydrology, and wildlife species composition and abundances in ways that exacerbate the effects of climate change on these resources. Excess abundance of native ungulates (e.g., deer or elk) and feral horses and burros add to these impacts. Although many of these consequences have been studied for decades, the ongoing and impending effects of ungulates in a changing climate require new management strategies for limiting their threats to the long-term supply of ecosystem services on public lands. Removing or reducing livestock across large areas of public land would alleviate a widely recognized and long-term stressor and make these lands less susceptible to the effects of climate change. Where livestock use continues, or where significant densities of wild or feral ungulates occur, management should carefully document the ecological, social, and economic consequences (both costs and benefits) to better ensure management that minimizes ungulate impacts to plant and animal communities, soils, and water resources. Reestablishing apex predators in large, contiguous areas of public land may help mitigate any adverse ecological effects of wild ungulates.

Dynamics and life histories of northern ungulates in changing environments

Science.gov (United States)

Hendrichsen, D. K.

2011-12-01

, 23: 437-443 Coulson T, Catchpole EA, Albon SD, Morgan BJT, Pemberton JM, Clutton-Brock TH, Crawley MJ and Grenfell BT. 2001. Age, sex, density, winter weather, and population crashes in Soay sheep. Science, 292: 1528-1531 Post, E and Stenseth NC. 1999. Climatic variability, plant phenology, and northern ungulates. Ecology, 80: 1322-1339 Post E, Pedersen C, Wilmers CC and Forchhammer MC. 2008. Warming, plant phenology and the spatial dimension of trophic mismatch for large herbivores. Proc. Roy Soc. B., 275: 2005-2013 Tyler NJC, Forchhammer MC and Øritsland NA. 2008. Nonlinear effects of climate and density in the dynamics of a fluctuating population of reindeer. Ecology, 89: 1675-1686

Green‐wave surfing increases fat gain in a migratory ungulate

Science.gov (United States)

Middleton, Arthur D.; Merkle, Jerod A.; McWhirter, Douglas E.; Cook, John G.; Cook, Rachel C.; White, P.J.; Kauffman, Matthew J.

2018-01-01

Each spring, migratory herbivores around the world track or ‘surf’ green waves of newly emergent vegetation to distant summer or wet‐season ranges. This foraging tactic may help explain the great abundance of migratory herbivores on many seasonal landscapes. However, the underlying fitness benefits of this life‐history strategy remain poorly understood. A fundamental prediction of the green‐wave hypothesis is that migratory herbivores obtain fitness benefits from surfing waves of newly emergent vegetation more closely than their resident counterparts. Here we evaluate whether this behavior increases body‐fat levels – a critically important correlate of reproduction and survival for most ungulates – in elk Cervus elaphus of the Greater Yellowstone Ecosystem. Using satellite imagery and GPS tracking data, we found evidence that migrants (n = 23) indeed surfed the green wave, occupying sites 12.7 days closer to peak green‐up than residents (n = 16). Importantly, individual variation in surfing may help account for up to 6 kg of variation in autumn body‐fat levels. Our findings point to a pathway for anthropogenic changes to the green wave (e.g. climate change) or migrants’ ability to surf it (e.g. development) to impact migratory populations. To explore this possibility, we evaluated potential population‐level consequences of constrained surfing with a heuristic model. If green‐wave surfing deteriorates by 5–15 days from observed, our model predicts up to a 20% decrease in pregnancy rates, a 2.5% decrease in population growth, and a 30% decrease in abundance over 50 years. By linking green‐wave surfing to fitness and illustrating potential effects on population growth, our study provides new insights into the evolution of migratory behavior and the prospects for the persistence of migratory ungulate populations in a changing world.

Thunder on the Yellowstone revisited: An assessment of management of native ungulates by natural regulation, 1968-1993

Science.gov (United States)

Singer, F.J.; Swift, D.M.; Coughenour, M.B.; Varley, J.D.

1998-01-01

Natural regulation of native ungulates was initiated in 1968 in Yellowstone National Park (YNP) based on the premise that ungulates would reach an equilibrium with their plant resources. The natural-regulation management model stated: density dependence will regulate ungulates (i.e., a dynamic equilibrium will result between ungulates and their food supply, within some bounds of vegetation and soil effects); and no retrogression of soil and vegetation will occur from elk (Cervus elaphus) grazing during this process. The historical record indicated that elk were abundant in the system and elk were primarily food limited before settlement by European man (i.e., wolves [Canis lupus] and Native Americans were only an adjunct to the density dependent population regulation of ungulates). Density dependence was demonstrated in elk, but not in bison (Bison bison). No widespread evidence of overgrazing was observed through 1993 in study sites within vegetation communities that comprised about 97% of the winter range. No evidence of increased exotics, increased sediment yield, warming or drying of the soil, changes in soil nutrients, or differences in aboveground standing-crop biomass of plants was found between grazed and ungrazed plots. Ungulate herbivory apparently stimulated aboveground production of grasses, enhanced nitrogen and macronutrients in grasses, increased nutrient cycling, and enhanced measures of fitness in 6 common plants. However, exposed soil surface (bare ground and pebbles combined) was 11-18% greater on grazed than ungrazed plots, apparently due to a 71% decline in dead and standing litter on grazed plots. Percent live-plant basal cover, however, did not differ on grazed versus ungrazed plots, and there was no difference in soil microclimate or sediment yield. Differences in the abundance of 12% of the herbaceous species were found in grazed versus ungrazed sites (16 of 128 species); 10 were declines and 6 were increases. Willow (Salix spp.) and aspen

SNP discovery in candidate adaptive genes using exon capture in a free-ranging alpine ungulate

Science.gov (United States)

Gretchen H. Roffler; Stephen J. Amish; Seth Smith; Ted Cosart; Marty Kardos; Michael K. Schwartz; Gordon Luikart

2016-01-01

Identification of genes underlying genomic signatures of natural selection is key to understanding adaptation to local conditions. We used targeted resequencing to identify SNP markers in 5321 candidate adaptive genes associated with known immunological, metabolic and growth functions in ovids and other ungulates. We selectively targeted 8161 exons in protein-coding...

Comparative response of Rangifer tarandus and other northern ungulates to climatic variability

Directory of Open Access Journals (Sweden)

Robert B. Weladji

2002-06-01

Full Text Available To understand the factors influencing life history traits and population dynamics, attention is increasingly being given to the importance of environmental stochasticity. In this paper, we review and discuss aspects of current knowledge concerning the effect of climatic variation (local and global on population parameters of northern ungu¬lates, with special emphasis on reindeer/caribou (Rangifer tarandus. We also restrict ourselves to indirect effects of climate through both forage availability and quality, and insect activity. Various authors have used different weather variables; with sometime opposite trends in resulting life history traits of ungulates, and few studies show consistent effects to the same climatic variables. There is thus little consensus about which weather variables play the most sig¬nificant role influencing ungulate population parameters. This may be because the effects of weather on ungulate pop¬ulation dynamics and life history traits are scale dependent and it is difficult to isolate climatic effects from density dependent factors. This confirms the complexity of the relationship between environment and ecosystem. We point out limits of comparability between systems and the difficulty of generalizing about the effect of climate change broadly across northern systems, across species and even within species. Furthermore, insect harassment appears to be a key climate-related factor for the ecology of reindeer/caribou that has been overlooked in the literature of climatic effects on large herbivores. In light of this, there is a need for further studies of long time series in assessing effects of climate variability on reindeer/caribou.

The scale-dependent impact of wolf predation risk on resource selection by three sympatric ungulates.

Science.gov (United States)

Kittle, Andrew M; Fryxell, John M; Desy, Glenn E; Hamr, Joe

2008-08-01

Resource selection is a fundamental ecological process impacting population dynamics and ecosystem structure. Understanding which factors drive selection is vital for effective species- and landscape-level management. We used resource selection probability functions (RSPFs) to study the influence of two forms of wolf (Canis lupus) predation risk, snow conditions and habitat variables on white-tailed deer (Odocoileus virginianus), elk (Cervus elaphus) and moose (Alces alces) resource selection in central Ontario's mixed forest French River-Burwash ecosystem. Direct predation risk was defined as the frequency of a predator's occurrence across the landscape and indirect predation risk as landscape features associated with a higher risk of predation. Models were developed for two winters, each at two spatial scales, using a combination of GIS-derived and ground-measured data. Ungulate presence was determined from snow track transects in 64 16- and 128 1-km(2) resource units, and direct predation risk from GPS radio collar locations of four adjacent wolf packs. Ungulates did not select resources based on the avoidance of areas of direct predation risk at any scale, and instead exhibited selection patterns that tradeoff predation risk minimization with forage and/or mobility requirements. Elk did not avoid indirect predation risk, while both deer and moose exhibited inconsistent responses to this risk. Direct predation risk was more important to models than indirect predation risk but overall, abiotic topographical factors were most influential. These results indicate that wolf predation risk does not limit ungulate habitat use at the scales investigated and that responses to spatial sources of predation risk are complex, incorporating a variety of anti-predator behaviours. Moose resource selection was influenced less by snow conditions than cover type, particularly selection for dense forest, whereas deer showed the opposite pattern. Temporal and spatial scale

Reliable discrimination of 10 ungulate species using high resolution melting analysis of faecal DNA.

Directory of Open Access Journals (Sweden)

Ana Ramón-Laca

Full Text Available Identifying species occupying an area is essential for many ecological and conservation studies. Faecal DNA is a potentially powerful method for identifying cryptic mammalian species. In New Zealand, 10 species of ungulate (Order: Artiodactyla have established wild populations and are managed as pests because of their impacts on native ecosystems. However, identifying the ungulate species present within a management area based on pellet morphology is unreliable. We present a method that enables reliable identification of 10 ungulate species (red deer, sika deer, rusa deer, fallow deer, sambar deer, white-tailed deer, Himalayan tahr, Alpine chamois, feral sheep, and feral goat from swabs of faecal pellets. A high resolution melting (HRM assay, targeting a fragment of the 12S rRNA gene, was developed. Species-specific primers were designed and combined in a multiplex PCR resulting in fragments of different length and therefore different melting behaviour for each species. The method was developed using tissue from each of the 10 species, and was validated in blind trials. Our protocol enabled species to be determined for 94% of faecal pellet swabs collected during routine monitoring by the New Zealand Department of Conservation. Our HRM method enables high-throughput and cost-effective species identification from low DNA template samples, and could readily be adapted to discriminate other mammalian species from faecal DNA.

The peculiarity of dynamic of helminth community of wild ungulate animals in the condition of Poles'e reserve

International Nuclear Information System (INIS)

Odintsova, T.M.

1998-01-01

It was analysed the dynamic of helminth community of wild animals in the condition of Poles'e reserve and it was shown that radiation contamination had great influence at the settled community of parasite worms resulting in disappearance or sharp diminution of species quantity that were common for wild ungulate animals and domestics cattle. It was concluded that stabilisation of helminth community of wild ungulate animals had not yet achieved

Potential Foraging Decisions by a Desert Ungulate to Balance Water and Nutrient Intake in a Water-Stressed Environment.

Science.gov (United States)

Gedir, Jay V; Cain, James W; Krausman, Paul R; Allen, Jamison D; Duff, Glenn C; Morgart, John R

2016-01-01

Arid climates have unpredictable precipitation patterns, and wildlife managers often provide supplemental water to help desert ungulates endure the hottest, driest periods. When surface water is unavailable, the only source of water for ungulates comes from the forage they consume, and they must make resourceful foraging decisions to meet their requirements. We compared two desert bighorn sheep (Ovis canadensis nelsoni) populations in Arizona, USA: a treatment population with supplemental water removed during treatment, and a control population. We examined whether sheep altered their seasonal diets without supplemental water. We calculated water and nutrient intake and metabolic water production from dry matter intake and forage moisture and nitrogen content, to determine whether sheep could meet their seasonal daily water and nutrient requirements solely from forage. Diets of sheep were higher in protein (all seasons) and moisture (autumn and winter) during treatment compared to pretreatment. During treatment, sheep diet composition was similar between the treatment and control populations, which suggests, under the climatic conditions of this study, water removal did not influence sheep diets. We estimated that under drought conditions, without any surface water available (although small ephemeral potholes would contain water after rains), female and male sheep would be unable to meet their daily water requirements in all seasons, except winter, when reproductive females had a nitrogen deficit. We determined that sheep could achieve water and nutrient balances in all seasons by shifting their total diet proportions by 8-55% from lower to higher moisture and nitrogen forage species. We elucidate how seasonal forage quality and foraging decisions by desert ungulates allow them to cope with their xeric and uncertain environment, and suggest that, with the forage conditions observed in our study area during this study period, providing supplemental water during

Potential foraging decisions by a desert ungulate to balance water and nutrient intake in a water-stressed environment

Science.gov (United States)

Gedir, Jay V.; Cain, James W.; Krausman, Paul R.; Allen, Jamison D.; Duff, Glenn C.; Morgart, John R.

2016-01-01

Arid climates have unpredictable precipitation patterns, and wildlife managers often provide supplemental water to help desert ungulates endure the hottest, driest periods. When surface water is unavailable, the only source of water for ungulates comes from the forage they consume, and they must make resourceful foraging decisions to meet their requirements. We compared two desert bighorn sheep (Ovis canadensis nelsoni) populations in Arizona, USA: a treatment population with supplemental water removed during treatment, and a control population. We examined whether sheep altered their seasonal diets without supplemental water. We calculated water and nutrient intake and metabolic water production from dry matter intake and forage moisture and nitrogen content, to determine whether sheep could meet their seasonal daily water and nutrient requirements solely from forage. Diets of sheep were higher in protein (all seasons) and moisture (autumn and winter) during treatment compared to pretreatment. During treatment, sheep diet composition was similar between the treatment and control populations, which suggests, under the climatic conditions of this study, water removal did not influence sheep diets. We estimated that under drought conditions, without any surface water available (although small ephemeral potholes would contain water after rains), female and male sheep would be unable to meet their daily water requirements in all seasons, except winter, when reproductive females had a nitrogen deficit. We determined that sheep could achieve water and nutrient balances in all seasons by shifting their total diet proportions by 8–55% from lower to higher moisture and nitrogen forage species. We elucidate how seasonal forage quality and foraging decisions by desert ungulates allow them to cope with their xeric and uncertain environment, and suggest that, with the forage conditions observed in our study area during this study period, providing supplemental water during

Potential Foraging Decisions by a Desert Ungulate to Balance Water and Nutrient Intake in a Water-Stressed Environment.

Directory of Open Access Journals (Sweden)

Jay V Gedir

Full Text Available Arid climates have unpredictable precipitation patterns, and wildlife managers often provide supplemental water to help desert ungulates endure the hottest, driest periods. When surface water is unavailable, the only source of water for ungulates comes from the forage they consume, and they must make resourceful foraging decisions to meet their requirements. We compared two desert bighorn sheep (Ovis canadensis nelsoni populations in Arizona, USA: a treatment population with supplemental water removed during treatment, and a control population. We examined whether sheep altered their seasonal diets without supplemental water. We calculated water and nutrient intake and metabolic water production from dry matter intake and forage moisture and nitrogen content, to determine whether sheep could meet their seasonal daily water and nutrient requirements solely from forage. Diets of sheep were higher in protein (all seasons and moisture (autumn and winter during treatment compared to pretreatment. During treatment, sheep diet composition was similar between the treatment and control populations, which suggests, under the climatic conditions of this study, water removal did not influence sheep diets. We estimated that under drought conditions, without any surface water available (although small ephemeral potholes would contain water after rains, female and male sheep would be unable to meet their daily water requirements in all seasons, except winter, when reproductive females had a nitrogen deficit. We determined that sheep could achieve water and nutrient balances in all seasons by shifting their total diet proportions by 8-55% from lower to higher moisture and nitrogen forage species. We elucidate how seasonal forage quality and foraging decisions by desert ungulates allow them to cope with their xeric and uncertain environment, and suggest that, with the forage conditions observed in our study area during this study period, providing supplemental

Landscape composition influences abundance patterns and habitat use of three ungulate species in fragmented secondary deciduous tropical forests, Mexico

Directory of Open Access Journals (Sweden)

G. García-Marmolejo

2015-01-01

Full Text Available Secondary forests are extensive in the tropics. Currently, these plant communities are the available habitats for wildlife and in the future they will possibly be some of the most wide-spread ecosystems world-wide. To understand the potential role of secondary forests for wildlife conservation, three ungulate species were studied: Mazama temama, Odocoileus virginianus and Pecari tajacu. We analyzed their relative abundance and habitat use at two spatial scales: (1 Local, where three different successional stages of tropical deciduous forest were compared, and (2 Landscape, where available habitats were compared in terms of landscape composition (proportion of forests, pastures and croplands within 113 ha. To determine the most important habitat-related environmental factors influencing the Sign Encounter Rate (SER of the three ungulate species, 11 physical, anthropogenic and vegetation variables were simultaneously analyzed through model selection using Akaike’s Information Criterion. We found, that P. tajacu and O. virginianus mainly used early successional stages, while M. temama used all successional stages in similar proportions. The latter species, however, used early vegetation stages only when they were located in landscapes mainly covered by forest (97%. P. tajacu and O. virginianus also selected landscapes covered essentially by forests, although they required smaller percentages of forest (86%. All ungulate species avoided landscape fragments covered by pastures. For all three species, landscape composition and human activities were the variables that best explained SER. We concluded that landscape is the fundamental scale for ungulate management, and that secondary forests are potentially important landscape elements for ungulate conservation.

Postfire Burnt-Wood Management Affects Plant Damage by Ungulate Herbivores

Directory of Open Access Journals (Sweden)

Jorge Castro

2013-01-01

Full Text Available I analyze the effect of post-fire burnt wood management on herbivore attack on a woody plant species (Ulex parviflorus. Two experimental plots of ca. 20 hectares were established at two elevations in a burnt area in a Mediterranean mountain (Sierra Nevada, Spain. Three replicates of three treatments differing in post-fire burnt wood management were established per plot: “no intervention” (NI, all trees remained standing, “partial cut plus lopping” (PCL, felling the trees, cutting the main branches, and leaving all the biomass in situ, and “salvage logging” (SL; removal of logs and elimination of woody debris. Risk of herbivory and damage intensity were monitored for two years. The pattern of attack by ungulate herbivores varied among treatments and years. In any case, there was an overall reduction in the risk of herbivory in the PCL treatment, presumably because the highest habitat complexity in this treatment hampered ungulate movement and foraging. As a result, the burnt logs and branches spread over the ground acted as a physical barrier that protected seedlings from herbivores. This protection may be used for the regeneration of shrubs and trees, and it is of interest for the regeneration of burnt sites either naturally or by reforestation.

Effect of Grazing on Forage Quality and Quantity for Ungulates of ...

African Journals Online (AJOL)

This study examined the effect of grazing as simulated by clipping on forage quality and quantity in terms of above ground biomass, live, total production and nutrients content of forages utilized by ungulates of Kainji Lake National Park. Three 2.5m by 2.5m plots were constructed in the three main vegetation communities in ...

Ungulate predation and ecological roles of wolves and coyotes in eastern North America.

Science.gov (United States)

Benson, John F; Loveless, Karen M; Rutledge, Linda Y; Patterson, Brent R

2017-04-01

Understanding the ecological roles of species that influence ecosystem processes is a central goal of ecology and conservation biology. Eastern coyotes (Canis latrans) have ascended to the role of apex predator across much of eastern North America since the extirpation of wolves (Canis spp.) and there has been considerable confusion regarding their ability to prey on ungulates and their ecological niche relative to wolves. Eastern wolves (C. lycaon) are thought to have been the historical top predator in eastern deciduous forests and have previously been characterized as deer specialists that are inefficient predators of moose because of their smaller size relative to gray wolves (C. lupus). We investigated intrinsic and extrinsic influences on per capita kill rates of white-tailed deer (Odocoileus virginianus) and moose (Alces alces) during winter by sympatric packs of eastern coyotes, eastern wolves, and admixed canids in Ontario, Canada to clarify the predatory ability and ecological roles of the different canid top predators of eastern North America. Eastern coyote ancestry within packs negatively influenced per capita total ungulate (deer and moose combined) and moose kill rates. Furthermore, canids in packs dominated by eastern coyote ancestry consumed significantly less ungulate biomass and more anthropogenic food than packs dominated by wolf ancestry. Similar to gray wolves in previous studies, eastern wolves preyed on deer where they were available. However, in areas were deer were scarce, eastern wolves killed moose at rates similar to those previously documented for gray wolves at comparable moose densities across North America. Eastern coyotes are effective deer predators, but their dietary flexibility and low kill rates on moose suggest they have not replaced the ecological role of wolves in eastern North America. © 2017 by the Ecological Society of America.

Lack of sex-biased dispersal promotes fine-scale genetic structure in alpine ungulates

Science.gov (United States)

Gretchen H. Roffler; Sandra L. Talbot; Gordon Luikart; George K. Sage; Kristy L. Pilgrim; Layne G. Adams; Michael K. Schwartz

2014-01-01

Identifying patterns of fine-scale genetic structure in natural populations can advance understanding of critical ecological processes such as dispersal and gene flow across heterogeneous landscapes. Alpine ungulates generally exhibit high levels of genetic structure due to female philopatry and patchy configuration of mountain habitats. We assessed the spatial scale...

SEROPREVALENCE OF NINE LEPTOSPIRA INTERROGANS SEROVARS IN WILD CARNIVORES, UNGULATES, AND PRIMATES FROM A ZOO POPULATION IN A METROPOLITAN REGION OF CHILE.

Science.gov (United States)

Moreno-Beas, Eduardo; Abalos, Pedro; Hidalgo-Hermoso, Ezequiel

2015-12-01

Serum samples from 130 individuals representing 42 species of carnivores, ungulates, and primates from a population of captive mammals in Metropolitan Region in Chile were tested for antibodies against nine serovars of Leptospira interrogans using the microscopic agglutination test. Ten percent of the animals were seropositive to one or more serovars. Seroprevalence was significantly higher in ungulates (20.4%) compared to carnivores (3.8%) and primates (3.4%). There were no significant differences in seroprevalence among sex and age ranges. The most frequent serovar detected was Autumnalis, present in 53.4% of antibody-positive animals. Most positive animals had titers of ≤1 : 200, except for a maned wolf ( Chrysocyon brachyurus ) with titers of 1 : 400 against serovar Hardjo. To the authors' knowledge, this is the first report of Leptospira exposure detected in native endangered pudu ( Pudu puda ) and the first confirmation of exposure to L. interrogans in captive wild mammals in Chile. Leptospirosis should be considered as a differential diagnosis in future disease presentation for hepatitis or abortions in captive mammals in Chile.

Influence of mineral nutrition on susceptibility and recovery of planted seedlings of ungulate browse

Science.gov (United States)

Owen T. Burney; Douglass F. Jacobs

2010-01-01

Efforts to minimize animal damage during reforestation in the Oregon Coast Range have had little success. Enhancing plant mineral nutrition via application of controlled-release fertilization at the time of planting may provide some relief from ungulate browse pressure due to increased height growth, but associated impacts on susceptibility of fertilized plants to...

Activation analysis of trace metals in several kinds of tissues of even-toed ungulates

International Nuclear Information System (INIS)

Fukushima, M.; Tamate, H.; Sato, S.; Terui, S.; Mitsugashira, T.

1999-01-01

The normal concentration levels of trace metals in several kinds of tissues of even-toed ungulates have been determined by instrumental neutron activation analysis, photon activation analysis, and flame atomic absorption spectrometry. In the present work the concentrations of 13 elements (Ag, Br, Ca, Co, Cu, Fe, Mg, Mn, Mo, Na, Rb, Se, and Zn) were analyzed. (author)

SNP discovery in candidate adaptive genes using exon capture in a free-ranging alpine ungulate

Science.gov (United States)

Roffler, Gretchen H.; Amish, Stephen J.; Smith, Seth; Cosart, Ted F.; Kardos, Marty; Schwartz, Michael K.; Luikart, Gordon

2016-01-01

Identification of genes underlying genomic signatures of natural selection is key to understanding adaptation to local conditions. We used targeted resequencing to identify SNP markers in 5321 candidate adaptive genes associated with known immunological, metabolic and growth functions in ovids and other ungulates. We selectively targeted 8161 exons in protein-coding and nearby 5′ and 3′ untranslated regions of chosen candidate genes. Targeted sequences were taken from bighorn sheep (Ovis canadensis) exon capture data and directly from the domestic sheep genome (Ovis aries v. 3; oviAri3). The bighorn sheep sequences used in the Dall's sheep (Ovis dalli dalli) exon capture aligned to 2350 genes on the oviAri3 genome with an average of 2 exons each. We developed a microfluidic qPCR-based SNP chip to genotype 476 Dall's sheep from locations across their range and test for patterns of selection. Using multiple corroborating approaches (lositan and bayescan), we detected 28 SNP loci potentially under selection. We additionally identified candidate loci significantly associated with latitude, longitude, precipitation and temperature, suggesting local environmental adaptation. The three methods demonstrated consistent support for natural selection on nine genes with immune and disease-regulating functions (e.g. Ovar-DRA, APC, BATF2, MAGEB18), cell regulation signalling pathways (e.g. KRIT1, PI3K, ORRC3), and respiratory health (CYSLTR1). Characterizing adaptive allele distributions from novel genetic techniques will facilitate investigation of the influence of environmental variation on local adaptation of a northern alpine ungulate throughout its range. This research demonstrated the utility of exon capture for gene-targeted SNP discovery and subsequent SNP chip genotyping using low-quality samples in a nonmodel species.

Assessment of antibiotic resistance of Escherichia coli isolates and screening of Salmonella spp. in wild ungulates from Portugal.

Science.gov (United States)

Dias, Diana; Torres, Rita T; Kronvall, Göran; Fonseca, Carlos; Mendo, Sónia; Caetano, Tânia

2015-09-01

Antibiotic resistance is an emerging global problem. Wild animals are rarely exposed to antibiotics and therefore low levels of antibiotic resistance are expected. However, the growing interactions of these animals with humans and livestock may have a huge impact on their bacterial flora. This study aimed to assess the levels of antibiotic resistance in Escherichia coli isolated from widespread wild ungulates in Portugal. The interpretation of inhibition zone diameters was performed according to clinical breakpoints and epidemiological cut-offs, determined with the normalized resistance interpretation (NRI) method. For clinical breakpoints, 16% of the isolates were resistant to at least one antibiotic, including ampicillin (10%), tetracycline (9%), streptomycin (5%) co-trimoxazole (4%), amoxicillin/clavulanic acid (1%) and cefoxitin (1%). The levels of resistance detected in E. coli strains isolated from wild boar were statistically different for ampicillin and co-trimoxasol. According to NRI cut-offs, 10% of the population showed a non-wild-type phenotype against at least one antibiotic, also including tetracycline (9%), co-trimoxazole (6%), streptomycin (4%), ampicillin (2%) and amoxicillin/clavulanic acid (1%). Considering this parameter of comparison, no statistically different levels of resistance were identified between E. coli recovered from the three wild ungulates. Screening of Salmonella spp., which can be potentially pathogenic, was also performed, revealing that its prevalence was very low (1.5%). The study demonstrated that wild ungulates from Portugal are also reservoirs of antibiotic-resistant bacteria. Copyright © 2015 Institut Pasteur. Published by Elsevier Masson SAS. All rights reserved.

Ungulate Reproductive Parameters Track Satellite Observations of Plant Phenology across Latitude and Climatological Regimes.

Directory of Open Access Journals (Sweden)

David C Stoner

Full Text Available The effect of climatically-driven plant phenology on mammalian reproduction is one key to predicting species-specific demographic responses to climate change. Large ungulates face their greatest energetic demands from the later stages of pregnancy through weaning, and so in seasonal environments parturition dates should match periods of high primary productivity. Interannual variation in weather influences the quality and timing of forage availability, which can influence neonatal survival. Here, we evaluated macro-scale patterns in reproductive performance of a widely distributed ungulate (mule deer, Odocoileus hemionus across contrasting climatological regimes using satellite-derived indices of primary productivity and plant phenology over eight degrees of latitude (890 km in the American Southwest. The dataset comprised > 180,000 animal observations taken from 54 populations over eight years (2004-2011. Regionally, both the start and peak of growing season ("Start" and "Peak", respectively are negatively and significantly correlated with latitude, an unusual pattern stemming from a change in the dominance of spring snowmelt in the north to the influence of the North American Monsoon in the south. Corresponding to the timing and variation in both the Start and Peak, mule deer reproduction was latest, lowest, and most variable at lower latitudes where plant phenology is timed to the onset of monsoonal moisture. Parturition dates closely tracked the growing season across space, lagging behind the Start and preceding the Peak by 27 and 23 days, respectively. Mean juvenile production increased, and variation decreased, with increasing latitude. Temporally, juvenile production was best predicted by primary productivity during summer, which encompassed late pregnancy, parturition, and early lactation. Our findings offer a parsimonious explanation of two key reproductive parameters in ungulate demography, timing of parturition and mean annual

Optimization of Scat Detection Methods for a Social Ungulate, the Wild Pig, and Experimental Evaluation of Factors Affecting Detection of Scat.

Directory of Open Access Journals (Sweden)

David A Keiter

Full Text Available Collection of scat samples is common in wildlife research, particularly for genetic capture-mark-recapture applications. Due to high degradation rates of genetic material in scat, large numbers of samples must be collected to generate robust estimates. Optimization of sampling approaches to account for taxa-specific patterns of scat deposition is, therefore, necessary to ensure sufficient sample collection. While scat collection methods have been widely studied in carnivores, research to maximize scat collection and noninvasive sampling efficiency for social ungulates is lacking. Further, environmental factors or scat morphology may influence detection of scat by observers. We contrasted performance of novel radial search protocols with existing adaptive cluster sampling protocols to quantify differences in observed amounts of wild pig (Sus scrofa scat. We also evaluated the effects of environmental (percentage of vegetative ground cover and occurrence of rain immediately prior to sampling and scat characteristics (fecal pellet size and number on the detectability of scat by observers. We found that 15- and 20-m radial search protocols resulted in greater numbers of scats encountered than the previously used adaptive cluster sampling approach across habitat types, and that fecal pellet size, number of fecal pellets, percent vegetative ground cover, and recent rain events were significant predictors of scat detection. Our results suggest that use of a fixed-width radial search protocol may increase the number of scats detected for wild pigs, or other social ungulates, allowing more robust estimation of population metrics using noninvasive genetic sampling methods. Further, as fecal pellet size affected scat detection, juvenile or smaller-sized animals may be less detectable than adult or large animals, which could introduce bias into abundance estimates. Knowledge of relationships between environmental variables and scat detection may allow

Landscape of fear in Europe: wolves affect spatial patterns of ungulate browsing in Bialowieza Primeval Forest, Poland

NARCIS (Netherlands)

Kuijper, D.P.J.; Kleine, de C.; Churski, M.; Hooft, van W.F.; Bubnicki, J.; Jedrzejewska, B.

2013-01-01

Large carnivores can either directly influence ungulate populations or indirectly affect their behaviour. Knowledge from European systems, in contrast to North American systems, on how this might lead to cascading effects on lower trophic levels is virtually absent. We studied whether wolves Canis

The interacting effects of ungulates and fire on forest dynamics: an analysis using the model FORSPACE

NARCIS (Netherlands)

Kramer, K.; Groen, T.A.; Wieren, van S.E.

2003-01-01

The effects of interactions between the density of ungulates and forest fires on forest dynamics were studied on an area of 1188 ha called Planken Wambuis. The vegetation consists mainly of heathland and Scots pine forest but also includes oak, beech and birch, and parts of former arable land that

Use of filter papers to determine seroprevalence of Toxoplasma gondii among hunted ungulates in remote Peruvian Amazon.

Science.gov (United States)

Aston, Emily J; Mayor, Pedro; Bowman, Dwight D; Mohammed, Hussni O; Liotta, Janice L; Kwok, Oliver; Dubey, J P

2014-04-01

Toxoplasmosis is a zoonosis caused by the protozoan Toxoplasma gondii, and it is found worldwide. To determine whether ungulates are reservoirs of T. gondii in an isolated and remote region of the northeastern Peruvian Amazon, antibodies to T. gondii were determined in 5 species of ungulates by the modified agglutination test (MAT). These animals were hunted by subsistence hunters along the Yavarí-Mirín River, in the northeastern Peruvian Amazon. Blood samples were collected by hunters on filter papers. For determination of T. gondii antibodies, blood was eluted from filter papers, and a titer of 1:25 was considered indicative of exposure to T. gondii. Antibodies to T. gondii were found in 26 (31.0%) peccaries (Pecari tajacu, Tayassu pecari), six (17.1%) brocket deer (Mazama americana, Mazama gouazoubira), and four (40.0%) lowland tapir (Tapirus terrestris). We also introduced a modification to the MAT protocol that allows the extraction of fluid samples from several types of laboratory-grade filter paper, thus enabling researchers to easily adapt their approaches to the materials presented to them.

Use of filter papers to determine seroprevalence of Toxoplasma gondii among hunted ungulates in remote Peruvian Amazon☆

Science.gov (United States)

Aston, Emily J.; Mayor, Pedro; Bowman, Dwight D.; Mohammed, Hussni O.; Liotta, Janice L.; Kwok, Oliver; Dubey, J.P.

2013-01-01

Toxoplasmosis is a zoonosis caused by the protozoan Toxoplasma gondii, and it is found worldwide. To determine whether ungulates are reservoirs of T. gondii in an isolated and remote region of the northeastern Peruvian Amazon, antibodies to T. gondii were determined in 5 species of ungulates by the modified agglutination test (MAT). These animals were hunted by subsistence hunters along the Yavarí-Mirín River, in the northeastern Peruvian Amazon. Blood samples were collected by hunters on filter papers. For determination of T. gondii antibodies, blood was eluted from filter papers, and a titer of 1:25 was considered indicative of exposure to T. gondii. Antibodies to T. gondii were found in 26 (31.0%) peccaries (Pecari tajacu, Tayassu pecari), six (17.1%) brocket deer (Mazama americana, Mazama gouazoubira), and four (40.0%) lowland tapir (Tapirus terrestris). We also introduced a modification to the MAT protocol that allows the extraction of fluid samples from several types of laboratory-grade filter paper, thus enabling researchers to easily adapt their approaches to the materials presented to them. PMID:24918073

1996: Disarmament at a critical juncture

International Nuclear Information System (INIS)

1997-01-01

The document contains edited transcript of the presentations made by Joseph Rotblat, winner of the Nobel Prize, and by Minoru Ohmuta and Hidehiko Yoko-o, speaking for the Mayors of Hiroshima and Nagasaki, at the United Nations on 25 April 1996, excerpts from the panel discussion on South Asia at a Critical Turning Point held on 24 September 1996, and extensive excerpts from the panel discussions held 22-24 October 1996 during Disarmament Week at the United Nations

Quarterly coal report, April 1996--June 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-11-01

This report provides information about U.S. coal production, distribution; exports, imports, prices, consumption, and stocks. Data on coke production is also provided. This report presents data for April 1996 thru June 1996.

Environmental and physiological influences to isotopic ratios of N and protein status in a montane ungulate in winter

Science.gov (United States)

Gustine, David D.; Barboza, Perry S.; Adams, Layne G.; Wolf, Nathan B.

2014-01-01

Winter severity can influence large herbivore populations through a reduction in maternal proteins available for reproduction. Nitrogen (N) isotopes in blood fractions can be used to track the use of body proteins in northern and montane ungulates. We studied 113 adult female caribou for 13 years throughout a series of severe winters that reduced population size and offspring mass. After these severe winters, offspring mass increased but the size of the population remained low. We devised a conceptual model for routing of isotopic N in blood in the context of the severe environmental conditions experienced by this population. We measured δ15N in three blood fractions and predicted the relative mobilization of dietary and body proteins. The δ15N of the body protein pool varied by 4‰ and 46% of the variance was associated with year. Annual variation in δ15N of body protein likely reflected the fall/early winter diet and winter locations, yet 15% of the isotopic variation in amino acid N was due to body proteins. Consistent isotopic differences among blood N pools indicated that animals tolerated fluxes in diet and body stores. Conservation of body protein in caribou is the result of active exchange among diet and body N pools. Adult females were robust to historically severe winter conditions and prioritized body condition and survival over early investment in offspring. For a vagile ungulate residing at low densities in a predator-rich environment, protein restrictions in winter may not be the primary limiting factor for reproduction.

Higher Order Loess Terracettes and Related Ungulate Activities in Western Pottawattamie County, Iowa

Science.gov (United States)

Weihs, B. J.

2009-12-01

Terracettes are small, quasi-parallel, staircase-like, stepped landforms. They are generally less than a meter in tread width and riser height and as long as 300 meters, located transversely along slopes. Many theories purport to explain the mechanisms that cause them, including animal disturbance, soil creep, solifluction (gelifluction), slumping and rotational slippage, regolith control, vegetation control, subsidence, and anthropogenic or tectonic activities. This thesis was aimed at morphologically characterizing terracettes in the western Iowa Loess Hills, with an emphasis on further classifying the forms morphogenetically. Onsite observations suggest that terracettes in this area are highly associated with anthropogenically induced grazing of domestic ungulates such as cattle, horses, and sheep, as well as deer. A new class of terracette (higher order or mega-terracette) is proposed that characterizes (and differentiates) the study area forms based on size, in that the study area contains terracettes that are an order above those discussed by other authors (sub-meter). This new addition to the current standard (tear terracettes-risers bare of vegetation, and normal terracettes-normal to the slope), as suggested by Anderson (1972), will add to the local understanding of the forms, and especially to the theory of polygenesis in which terracettes can result from a host of processes. This new class of terracette (mega) is higher magnitude, and directly related to ungulate activities such as geophagy, soil transport (from hooves), compaction, smearing, pawing, and wallowing (dust bathing) as well as the effects of variable soil moisture on erosion of the forms used by the animals. High magnitude terracettes in western Pottawattamie County, Iowa

Analysis of the Spatial Relationship between Cattle and Wild Ungulates across Different Land-Use Systems in a Tropical Savanna Landscape

Directory of Open Access Journals (Sweden)

Geoffrey W. Kinga

2018-01-01

Full Text Available In many African savanna landscapes, domestic and wild herbivores cooccur across different land-use systems, but the role of land-use in shaping their spatial relationship is poorly understood. We evaluated the spatial relationship between cattle and wild herbivores categorized by body sizes and feeding habits across different land-use types, namely, private ranches (PR, transitional lands (TRL, and pastoral grazing areas (PGA, in Laikipia County, Kenya. Cattle and wild herbivores spatial distribution data were obtained from Kenya’s Department of Resources Survey and Remote Sensing (DRSRS. Spatial relationships between cattle and different wild herbivore guilds were analyzed using Ripley’s bivariate K12 function. In PR, wild herbivore guilds showed significant attraction to cattle at short distances. In TRL, wild grazers, mixed feeders, megaherbivores, and medium-sized ungulates exhibited significant attraction to cattle. Additionally, repulsion was observed between cattle and browsers at short distances under this land-use system. In PGA, wild grazers, mixed feeders, and megaherbivores repelled strongly with cattle at short distances while browsers and medium-sized ungulates were significantly attracted to cattle. Cattle and wild herbivores were more randomly and independently distributed in PR than in TRL and PGA. These spatial relationships imply better coexistence between cattle and wild herbivores in PR than in TRL and PGA.

Lack of response of an open-habitat ungulate to the presence of predator urine La falta de la respuesta de un ungulado de habitat abierto a la presencia de orina de depredadores

Directory of Open Access Journals (Sweden)

RONALD J SARNO

2008-06-01

Full Text Available The behavioral response of ungulates to the presence of odors associated with dangerous predators has received some attention, yet little is known about how predominantly open-habitat ungulates react to the presence of predator scents. We investigated the behavioral responses of a predominantly open-habitat ungulate, the guanaco, Lama guanicoe, when exposed to the urine of various predators. Guanacos only reacted to the urine of mountain lions (native predator, Puma concolor, in one trial. The lack of a response to predator urine may indicate that guanacos generally rely on visión more than olfaction for predator detection.La respuesta conductual de ungulados a la presencia de olores asociados a depredadores ha recibido algo de atención, pero aún se sabe poco sobre cuan predominantemente los ungulados de habitat abiertos reaccionan a la presencia de olores de depredadores. Examinamos las respuestas conductuales del guanaco, Lama guanicoe, cuando estos animales estaban expuestos a orina de varios depredadores. Los guanacos solo reaccionaron a la presencia de la orina del puma en uno de los ensayos. La ausencia de respuesta registrada podría indicar que los guanacos utilizan más la visión que el olfato para detectar a sus depredadores.

Long-term understory vegetation dynamics and responses to ungulate exclusion in the dry forest of Mona Island

Science.gov (United States)

J. Rojas-Sandoval; E.J. Melendez-Ackerman; J. Fumero-Caban; M. Garcia-Bermudez; J. Sustache; S. Aragon; M. Morales-Vargas; G. Olivieri; D.S. Fernandez

2016-01-01

Mona Island protects one of the most important remnants of Caribbean dry forests and hosts a high diversity of rare and endangered plant and animal species. Feral ungulates (goats and pigs) were introduced to the island ~500 y ago, and their populations may be threatening the conservation of Mona Island’s native biodiversity. In this study, we used permanent fenced and...

Trace element analysis provides insight into the diets of early Late Miocene ungulates from the Rudabánya II locality (Hungary)

Energy Technology Data Exchange (ETDEWEB)

Eastham, L.C.; Feranecc, R.S.; Begun, D.R.

2017-11-01

The early Late Miocene vertebrate locality of Rudabánya II (R. II) in northeastern Hungary preserves an abundance of forest-adapted ungulate species. To better understand the ecological relationships within this ancient ecosystem, we used analysis of enamel strontium/calcium (Sr/Ca) ratios to infer dietary preferences. The goals of the analysis were to: i) determine whether these ungulate species specialized in specific plants or plant parts; ii) discern whether the Sr/Ca ratios support what was previously suggested about the ecology of these species; and iii) evaluate the factors that may have acted to promote coexistence within this diverse community of predominantly browsing herbivores. Results show significant differences in the diets of the sampled species. The highest Sr/Ca ratios were displayed by the suids Parachleuastochoerus kretzoii [B1] and Propotamochoerus palaeochoerus implying a preference for Sr-rich underground plant parts. Elevated Sr/Ca ratios yielded by the cervid Lucentia aff. pierensis and equid Hippotherium intrans are indicative of intermediate feeding. The bovid Miotragocerus sp. showed higher Sr/Ca ratios than the gomphothere Tetralophodon longirostris, which is incongruent with morphological and stable isotope data, and suggested browsing by both taxa. This finding is likely the result of a difference in digestive physiology (ruminant vs. monogastric) rather than a difference in dietary behaviour. The lowest Sr/Ca ratios were displayed by the traguild Dorcatherium naui and moschid Micromeryx flourensianussuggesting a preference for Sr-poor fruits. Resource specialization and partitioning within the local environment likely acted to decrease interspecific competition and promote coexistence within the diverse ungulate community at R. II.

Trace element analysis provides insight into the diets of early Late Miocene ungulates from the Rudabánya II locality (Hungary)

International Nuclear Information System (INIS)

Eastham, L.C.; Feranecc, R.S.; Begun, D.R.

2017-01-01

The early Late Miocene vertebrate locality of Rudabánya II (R. II) in northeastern Hungary preserves an abundance of forest-adapted ungulate species. To better understand the ecological relationships within this ancient ecosystem, we used analysis of enamel strontium/calcium (Sr/Ca) ratios to infer dietary preferences. The goals of the analysis were to: i) determine whether these ungulate species specialized in specific plants or plant parts; ii) discern whether the Sr/Ca ratios support what was previously suggested about the ecology of these species; and iii) evaluate the factors that may have acted to promote coexistence within this diverse community of predominantly browsing herbivores. Results show significant differences in the diets of the sampled species. The highest Sr/Ca ratios were displayed by the suids Parachleuastochoerus kretzoii [B1] and Propotamochoerus palaeochoerus implying a preference for Sr-rich underground plant parts. Elevated Sr/Ca ratios yielded by the cervid Lucentia aff. pierensis and equid Hippotherium intrans are indicative of intermediate feeding. The bovid Miotragocerus sp. showed higher Sr/Ca ratios than the gomphothere Tetralophodon longirostris, which is incongruent with morphological and stable isotope data, and suggested browsing by both taxa. This finding is likely the result of a difference in digestive physiology (ruminant vs. monogastric) rather than a difference in dietary behaviour. The lowest Sr/Ca ratios were displayed by the traguild Dorcatherium naui and moschid Micromeryx flourensianussuggesting a preference for Sr-poor fruits. Resource specialization and partitioning within the local environment likely acted to decrease interspecific competition and promote coexistence within the diverse ungulate community at R. II.

Conservation genetics of managed ungulate populations

Science.gov (United States)

Scribner, Kim T.

1993-01-01

Natural populations of many species are increasingly impacted by human activities. Perturbations are particularly pronunced for large ungulates due in part to sport and commercial harvest, to reductions and fragmentation of native habitat, and as the result of reintroductions. These perturbations affect population size, sex and age composition, and population breeding structure, and as a consequence affect the levels and partitioning of genetic variation. Three case histories highlighting long-term ecological genetic research on mule deer Odocoileus hemionus (Rafinesque, 1817), white-tailed deer O. virginianus (Zimmermann, 1780), and Alpine ibex Capra i. ibex Linnaeus, 1758 are presented. Joint examinations of population ecological and genetic data from several populations of each species reveal: (1) that populations are not in genetic equilibrium, but that allele frequencies and heterozygosity change dramatically over time and among cohorts produced in successive years, (2) populations are genetically structured over short and large geographic distances reflecting local breeding structure and patterns of gene flow, respectively; however, this structure is quite dynamic over time, due in part to population exploitation, and (3) restocking programs are often undertaken with small numbers of founding individuals resulting in dramatic declines in levels of genetic variability and increasing levels of genetic differentiation among populations due to genetic drift. Genetic characteristics have and will continue to provide valuable indirect sources of information relating enviromental and human perturbations to changes in population processes.

Forecasting the effects of fertility control on overabundant ungulates: White-tailed deer in the National Capital Region

Science.gov (United States)

Raiho, Ann M.; Hooten, Mevin B.; Bates, Scott; Hobbs, N. Thompson

2015-01-01

Overabundant populations of ungulates have caused environmental degradation and loss of biological diversity in ecosystems throughout the world. Culling or regulated harvest is often used to control overabundant species. These methods are difficult to implement in national parks, other types of conservation reserves, or in residential areas where public hunting may be forbidden by policy. As a result, fertility control has been recommended as a non-lethal alternative for regulating ungulate populations. We evaluate this alternative using white-tailed deer in national parks in the vicinity of Washington, D.C., USA as a model system. Managers seek to reduce densities of white-tailed deer from the current average (50 deer per km2) to decrease harm to native plant communities caused by deer. We present a Bayesian hierarchical model using 13 years of population estimates from 8 national parks in the National Capital Region Network. We offer a novel way to evaluate management actions relative to goals using short term forecasts. Our approach confirms past analyses that fertility control is incapable of rapidly reducing deer abundance. Fertility control can be combined with culling to maintain a population below carrying capacity with a high probability of success. This gives managers confronted with problematic overabundance a framework for implementing management actions with a realistic assessment of uncertainty.

Conservation of erupting ungulate populations on islands – a comment

Directory of Open Access Journals (Sweden)

Anne Gunn

2003-04-01

Full Text Available A generalised model for herbivores experiencing abundant forage over time is that their numbers erupt and then decline. This model has been applied to fluctuations in caribou (Rangifer tarandus populations especially those on islands. Since this generalised model for erupting herbivores was first proposed, two assumptions have slipped in (1 that an erupting population will crash; and (2 that the crash will be density-dependent. The problem with the assumptions is that, without testing, they can lead to inappropriate management such as culls. The first assumption arises from uncritical use of earlier accounts and the second assumption from not discriminating between the effects of environmental variation from the effects of the high herbivore numbers on forage availability (density-dependence. Often typical densitydependent effects such as lowered initial reproduction, reduced early survival of calves, and subsequent calf, yearling and juvenile survival are used to justify the contention that there are too many herbivores. But such reasoning is flawed unless cause/effect relationships are established and the role of environmental variation is evaluated. We argue that it is overly simplistic to believe that every population’s subsequent performance and fate will follow a singular pattern with only one paramount factor driving and ultimately dictating an inevitable outcome. The relative importance of unpredictable abiotic factors in influencing and causing variation in the response of ungulate populations should be investigated, no matter whether those factors are sporadic or periodic.

Lack of sex-biased dispersal promotes fine-scale genetic structure in alpine ungulates

Science.gov (United States)

Roffler, Gretchen H.; Talbot, Sandra L.; Luikart, Gordon; Sage, George K.; Pilgrim, Kristy L.; Adams, Layne G.; Schwartz, Michael K.

2014-01-01

Identifying patterns of fine-scale genetic structure in natural populations can advance understanding of critical ecological processes such as dispersal and gene flow across heterogeneous landscapes. Alpine ungulates generally exhibit high levels of genetic structure due to female philopatry and patchy configuration of mountain habitats. We assessed the spatial scale of genetic structure and the amount of gene flow in 301 Dall’s sheep (Ovis dalli dalli) at the landscape level using 15 nuclear microsatellites and 473 base pairs of the mitochondrial (mtDNA) control region. Dall’s sheep exhibited significant genetic structure within contiguous mountain ranges, but mtDNA structure occurred at a broader geographic scale than nuclear DNA within the study area, and mtDNA structure for other North American mountain sheep populations. No evidence of male-mediated gene flow or greater philopatry of females was observed; there was little difference between markers with different modes of inheritance (pairwise nuclear DNA F ST = 0.004–0.325; mtDNA F ST = 0.009–0.544), and males were no more likely than females to be recent immigrants. Historical patterns based on mtDNA indicate separate northern and southern lineages and a pattern of expansion following regional glacial retreat. Boundaries of genetic clusters aligned geographically with prominent mountain ranges, icefields, and major river valleys based on Bayesian and hierarchical modeling of microsatellite and mtDNA data. Our results suggest that fine-scale genetic structure in Dall’s sheep is influenced by limited dispersal, and structure may be weaker in populations occurring near ancestral levels of density and distribution in continuous habitats compared to other alpine ungulates that have experienced declines and marked habitat fragmentation.

Feral goats in the Hawaiian Islands: understanding the behavioral ecology of nonnative ungulates with GPS and remote sensing technology

Science.gov (United States)

Mark Chynoweth; Creighton M. Litton; Christopher A. Lepczyk; Susan Cordell

2010-01-01

Nonnative feral ungulates have both direct and indirect impacts on native ecosystems. Hawai`i is particularly susceptible to biological invasions, as the islands have evolved in extreme geographic isolation. In this paper we explore the ecological impacts of nonnative feral goats (Capra hircus) in the Hawaiian Islands, including both the current...

Forecasting the Effects of Fertility Control on Overabundant Ungulates: White-Tailed Deer in the National Capital Region.

Directory of Open Access Journals (Sweden)

Ann M Raiho

Full Text Available Overabundant populations of ungulates have caused environmental degradation and loss of biological diversity in ecosystems throughout the world. Culling or regulated harvest is often used to control overabundant species. These methods are difficult to implement in national parks, other types of conservation reserves, or in residential areas where public hunting may be forbidden by policy. As a result, fertility control has been recommended as a non-lethal alternative for regulating ungulate populations. We evaluate this alternative using white-tailed deer in national parks in the vicinity of Washington, D.C., USA as a model system. Managers seek to reduce densities of white-tailed deer from the current average (50 deer per km2 to decrease harm to native plant communities caused by deer. We present a Bayesian hierarchical model using 13 years of population estimates from 8 national parks in the National Capital Region Network. We offer a novel way to evaluate management actions relative to goals using short term forecasts. Our approach confirms past analyses that fertility control is incapable of rapidly reducing deer abundance. Fertility control can be combined with culling to maintain a population below carrying capacity with a high probability of success. This gives managers confronted with problematic overabundance a framework for implementing management actions with a realistic assessment of uncertainty.

Energy in 1996; L`energie en 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-31

Six charts are presented and discussed concerning energy utilization in France during the 1970-1996 period: national energy bill, energy intensity ratios, imported crude oil costs, energy-induced carbon dioxide emissions, operating ability ratios of EDF nuclear plants, France`s energy independence ratios. 1996 has seen an strong increase (+31%) in the energy bill, reaching 77 billions Francs, combining an increase in energy consumption and dollar exchange rate and a decline in energy conservation; carbon dioxide emission are taking up again after a strong decrease in the 80`s

Bacterial genomics reveal the complex epidemiology of an emerging pathogen in arctic and boreal ungulates

Science.gov (United States)

Forde, Taya L.; Orsel, Karin; Zadoks, Ruth N.; Biek, Roman; Adams, Layne G.; Checkley, Sylvia L.; Davison, Tracy; De Buck, Jeroen; Dumond, Mathieu; Elkin, Brett T.; Finnegan, Laura; Macbeth, Bryan J.; Nelson, Cait; Niptanatiak, Amanda; Sather, Shane; Schwantje, Helen M.; van der Meer, Frank; Kutz, Susan J.

2016-01-01

Northern ecosystems are currently experiencing unprecedented ecological change, largely driven by a rapidly changing climate. Pathogen range expansion, and emergence and altered patterns of infectious disease, are increasingly reported in wildlife at high latitudes. Understanding the causes and consequences of shifting pathogen diversity and host-pathogen interactions in these ecosystems is important for wildlife conservation, and for indigenous populations that depend on wildlife. Among the key questions are whether disease events are associated with endemic or recently introduced pathogens, and whether emerging strains are spreading throughout the region. In this study, we used a phylogenomic approach to address these questions of pathogen endemicity and spread for Erysipelothrix rhusiopathiae, an opportunistic multi-host bacterial pathogen associated with recent mortalities in arctic and boreal ungulate populations in North America. We isolated E. rhusiopathiae from carcasses associated with large-scale die-offs of muskoxen in the Canadian Arctic Archipelago, and from contemporaneous mortality events and/or population declines among muskoxen in northwestern Alaska and caribou and moose in western Canada. Bacterial genomic diversity differed markedly among these locations; minimal divergence was present among isolates from muskoxen in the Canadian Arctic, while in caribou and moose populations, strains from highly divergent clades were isolated from the same location, or even from within a single carcass. These results indicate that mortalities among northern ungulates are not associated with a single emerging strain of E. rhusiopathiae, and that alternate hypotheses need to be explored. Our study illustrates the value and limitations of bacterial genomic data for discriminating between ecological hypotheses of disease emergence, and highlights the importance of studying emerging pathogens within the broader context of environmental and host factors.

KURRI progress report 1996. April 1996 - March 1997

International Nuclear Information System (INIS)

1997-11-01

This report describes the activities of the Research Reactor Institute, Kyoto University (KURRI) during the fiscal year (FY) of 1996. A total of 1506 researchers visited the KURRI to perform 106 experimental applications or to attend 17 symposia and 3 workshops. At the end of a three-year period, the scientific achievements of two research projects, 'Residual Stress and Strip Investigations of Metallic Materials by Neutron Scattering' and 'Radiation Protection to the Manageable Ionizing Radiation in the KUR facilities' were reviewed during the annual Scientific Meeting of the KURRI, held on Jan 21-23, 1997. The five-year modernization Program of the KUR and its related facirities was in progress since the reorganization for a Center of Excellence on April 1, 1995. In the FY, 1996 the maintenance and close inspections of the heavy water facility and the graphite thermal column were carried out during the reactor shutdown from Feb 24, 1997 to May 9, 1997. A total of 174 reports of project and general researches in 1996 were outlined. (M.N.)

KURRI progress report 1996. April 1996 - March 1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-11-01

This report describes the activities of the Research Reactor Institute, Kyoto University (KURRI) during the fiscal year (FY) of 1996. A total of 1506 researchers visited the KURRI to perform 106 experimental applications or to attend 17 symposia and 3 workshops. At the end of a three-year period, the scientific achievements of two research projects, `Residual Stress and Strip Investigations of Metallic Materials by Neutron Scattering` and `Radiation Protection to the Manageable Ionizing Radiation in the KUR facilities` were reviewed during the annual Scientific Meeting of the KURRI, held on Jan 21-23, 1997. The five-year modernization Program of the KUR and its related facirities was in progress since the reorganization for a Center of Excellence on April 1, 1995. In the FY, 1996 the maintenance and close inspections of the heavy water facility and the graphite thermal column were carried out during the reactor shutdown from Feb 24, 1997 to May 9, 1997. A total of 174 reports of project and general researches in 1996 were outlined. (M.N.)

Re-evaluating neonatal-age models for ungulates: does model choice affect survival estimates?

Directory of Open Access Journals (Sweden)

Troy W Grovenburg

Full Text Available New-hoof growth is regarded as the most reliable metric for predicting age of newborn ungulates, but variation in estimated age among hoof-growth equations that have been developed may affect estimates of survival in staggered-entry models. We used known-age newborns to evaluate variation in age estimates among existing hoof-growth equations and to determine the consequences of that variation on survival estimates. During 2001-2009, we captured and radiocollared 174 newborn (≤24-hrs old ungulates: 76 white-tailed deer (Odocoileus virginianus in Minnesota and South Dakota, 61 mule deer (O. hemionus in California, and 37 pronghorn (Antilocapra americana in South Dakota. Estimated age of known-age newborns differed among hoof-growth models and varied by >15 days for white-tailed deer, >20 days for mule deer, and >10 days for pronghorn. Accuracy (i.e., the proportion of neonates assigned to the correct age in aging newborns using published equations ranged from 0.0% to 39.4% in white-tailed deer, 0.0% to 3.3% in mule deer, and was 0.0% for pronghorns. Results of survival modeling indicated that variability in estimates of age-at-capture affected short-term estimates of survival (i.e., 30 days for white-tailed deer and mule deer, and survival estimates over a longer time frame (i.e., 120 days for mule deer. Conversely, survival estimates for pronghorn were not affected by estimates of age. Our analyses indicate that modeling survival in daily intervals is too fine a temporal scale when age-at-capture is unknown given the potential inaccuracies among equations used to estimate age of neonates. Instead, weekly survival intervals are more appropriate because most models accurately predicted ages within 1 week of the known age. Variation among results of neonatal-age models on short- and long-term estimates of survival for known-age young emphasizes the importance of selecting an appropriate hoof-growth equation and appropriately defining intervals (i

How landscape dynamics link individual- to population-level movement patterns: A multispecies comparison of ungulate relocation data

Science.gov (United States)

Mueller, Thomas; Olson, K.A.; Dressler, G.; Leimgruber, Peter; Fuller, Todd K.; Nicholson, Craig; Novaro, A.J.; Bolgeri, M.J.; Wattles, David W.; DeStefano, Stephen; Calabrese, J.M.; Fagan, William F.

2011-01-01

Aim  To demonstrate how the interrelations of individual movements form large-scale population-level movement patterns and how these patterns are associated with the underlying landscape dynamics by comparing ungulate movements across species.Locations  Arctic tundra in Alaska and Canada, temperate forests in Massachusetts, Patagonian Steppes in Argentina, Eastern Steppes in Mongolia.Methods  We used relocation data from four ungulate species (barren-ground caribou, Mongolian gazelle, guanaco and moose) to examine individual movements and the interrelation of movements among individuals. We applied and developed a suite of spatial metrics that measure variation in movement among individuals as population dispersion, movement coordination and realized mobility. Taken together, these metrics allowed us to quantify and distinguish among different large-scale population-level movement patterns such as migration, range residency and nomadism. We then related the population-level movement patterns to the underlying landscape vegetation dynamics via long-term remote sensing measurements of the temporal variability, spatial variability and unpredictability of vegetation productivity.Results  Moose, which remained in sedentary home ranges, and guanacos, which were partially migratory, exhibited relatively short annual movements associated with landscapes having very little broad-scale variability in vegetation. Caribou and gazelle performed extreme long-distance movements that were associated with broad-scale variability in vegetation productivity during the peak of the growing season. Caribou exhibited regular seasonal migration in which individuals were clustered for most of the year and exhibited coordinated movements. In contrast, gazelle were nomadic, as individuals were independently distributed and moved in an uncoordinated manner that relates to the comparatively unpredictable (yet broad-scale) vegetation dynamics of their landscape.Main conclusions�

Seroprevalence of pestivirus in four species of alpine wild ungulates in the High Valley of Susa, Italy.

Science.gov (United States)

Olde Riekerink, R G M; Dominici, A; Barkema, H W; de Smit, A J

2005-07-01

Wildlife, once infected, can serve as a reservoir of infectious diseases that form a constant threat to domestic livestock. To make control and eradication programs successful in the long-term, presence of pestivirus in wildlife populations should be monitored. The goal of this study was to investigate seroprevalence of pestivirus in four alpine wild ungulates in the High Valley of Susa, north-west Italy. Species studied were: red deer (Cervus elaphus), roe deer (Capreolus capreolus), wild boar (Sus scrofa) and chamois (Rupicapra rupicapra). A further goal was using virus neutralisation tests (VNT) for four strains of pestivirus in chamois and wild boar. Three hundred and seventy-five serum samples collected during the hunting season of 1999 were tested for pestivirus specific antibodies. Positive sera of chamois and wild boar were subsequently tested in a VNT with four major subtypes of pestivirus, and virus isolation was performed. No antibodies were found in the 73 samples of roe deer, while 7 (12.5%), 8 (5.9%) and 28 (25.5%) of 56, 136 and 110 samples of wild boar, red deer and chamois were ELISA-positive, respectively. Different ranges of titers were found in the VNT and no pestivirus was isolated in the ELISA-positive wild boar and chamois samples. Several possibilities, which might explain the high seroprevalence in chamois are discussed. Pestivirus antibodies were found in three out of four large alpine ungulates in the High Valley of Susa. Seroprevalence was particularly high in chamois. Further investigation is needed to characterise the pestiviruses that circulate in these animals.

Tooth enamel mineralization in ungulates: implications for recovering a primary isotopic time-series

Science.gov (United States)

Passey, Benjamin H.; Cerling, Thure E.

2002-09-01

Temporal changes in the carbon and oxygen isotopic composition of an animal are an environmental and behavioral input signal that is recorded into the enamel of developing teeth. In this paper, we evaluate changes in phosphorus content and density along the axial lengths of three developing ungulate teeth to illustrate the protracted nature of mineral accumulation in a volume of developing enamel. The least mature enamel in these teeth contains by volume about 25% of the mineral mass of mature enamel, and the remaining 75% of the mineral accumulates during maturation. Using data from one of these teeth (a Hippopotamus amphibius canine), we develop a model for teeth growing at constant rate that describes how an input signal is recorded into tooth enamel. The model accounts for both the temporal and spatial patterns of amelogenesis (enamel formation) and the sampling geometry. The model shows that input signal attenuation occurs as a result of time-averaging during amelogenesis when the maturation interval is long compared to the duration of features in the input signal. Sampling does not induce significant attenuation, provided that the sampling interval is several times shorter than the maturation interval. We present a detailed δ 13C and δ 18O record for the H. amphibius canine and suggest possible input isotope signals that may have given rise to the measured isotope signal.

Uranium industry annual 1996

International Nuclear Information System (INIS)

1997-04-01

The Uranium Industry Annual 1996 (UIA 1996) provides current statistical data on the US uranium industry's activities relating to uranium raw materials and uranium marketing. The UIA 1996 is prepared for use by the Congress, Federal and State agencies, the uranium and nuclear electric utility industries, and the public. Data on uranium raw materials activities for 1987 through 1996 including exploration activities and expenditures, EIA-estimated reserves, mine production of uranium, production of uranium concentrate, and industry employment are presented in Chapter 1. Data on uranium marketing activities for 1994 through 2006, including purchases of uranium and enrichment services, enrichment feed deliveries, uranium fuel assemblies, filled and unfilled market requirements, uranium imports and exports, and uranium inventories are shown in Chapter 2. A feature article, The Role of Thorium in Nuclear Energy, is included. 24 figs., 56 tabs

Uranium industry annual 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-04-01

The Uranium Industry Annual 1996 (UIA 1996) provides current statistical data on the US uranium industry`s activities relating to uranium raw materials and uranium marketing. The UIA 1996 is prepared for use by the Congress, Federal and State agencies, the uranium and nuclear electric utility industries, and the public. Data on uranium raw materials activities for 1987 through 1996 including exploration activities and expenditures, EIA-estimated reserves, mine production of uranium, production of uranium concentrate, and industry employment are presented in Chapter 1. Data on uranium marketing activities for 1994 through 2006, including purchases of uranium and enrichment services, enrichment feed deliveries, uranium fuel assemblies, filled and unfilled market requirements, uranium imports and exports, and uranium inventories are shown in Chapter 2. A feature article, The Role of Thorium in Nuclear Energy, is included. 24 figs., 56 tabs.

Landscape simulation of foraging by elk, mule deer, and cattle on summer range.

Science.gov (United States)

Alan A. Ager; Bruce K. Johnson; Priscilla K. Coe; Michael J. Wisdom

2004-01-01

Cattle, mule deer (Odocoileus hemionus) and elk (Cervus elaphus) share more area of spring, summer and fall range than any other combination of wild and domestic ungulates in western North America (Wisdom and Thomas 1996). Not surprisingly, conflicts over perceived competition for forage have a long history, yet knowledge about...

Rift Valley Fever Risk Map Model and Seroprevalence in Selected Wild Ungulates and Camels from Kenya

Science.gov (United States)

Britch, Seth C.; Binepal, Yatinder S.; Ruder, Mark G.; Kariithi, Henry M.; Linthicum, Kenneth J.; Anyamba, Assaf; Small, Jennifer L.; Tucker, Compton J.; Ateya, Leonard O.; Oriko, Abuu A.;

Interactions between wolves and female grizzly bears with cubs in Yellowstone National Park

Science.gov (United States)

Gunther, Kerry A.; Smith, Douglas W.

2004-01-01

Gray wolves (Canis lupus) were extirpated from Yellowstone National Park (YNP) by the 1920s through predator control actions (Murie 1940,Young and Goldman 1944, Weaver 1978), then reintroduced into the park from 1995 to 1996 to restore ecological integrity and adhere to legal mandates (Bangs and Fritts 1996, Phillips and Smith 1996, Smith et al. 2000). Prior to reintroduction, the potential effects of wolves on the region’s threatened grizzly bear (Ursus arctos) population were evaluated (Servheen and Knight 1993). In areas where wolves and grizzly bears are sympatric, interspecific killing by both species occasionally occurs (Ballard 1980, 1982; Hayes and Baer 1992). Most agonistic interactions between wolves and grizzly bears involve defense of young or competition for carcasses (Murie 1944, 1981; Ballard 1982; Hornbeck and Horejsi 1986; Hayes and Mossop 1987; Kehoe 1995; McNulty et al. 2001). Servheen and Knight (1993) predicted that reintroduced wolves could reduce the frequency of winter-killed and disease-killed ungulates available for bears to scavenge, and that grizzly bears would occasionally usurp wolf-killed ungulate carcasses. Servheen and Knight (1993) hypothesized that interspecific killing and competition for carcasses would have little or no population level effect on either species.

The value of local Italian supply chain of the large wild ungulates meat: the case of the red deer meat in Alpine valleys

Directory of Open Access Journals (Sweden)

Maria Elena Marescotti

2017-05-01

Full Text Available Currently in Italy, in contrast to other EU countries, a supply chain for hunted game meat does not exist. Nevertheless there are the conditions for its development (Gaviglio et al., 2017; in fact game meat dishes’ has always been part of Alpine area’s culinary tradition and furthermore, management measures aimed at reducing the overpopulation of large wild ungulates leaded to an increase in the availability of their meat. In this context, the present research aims at analyze the dynamics of the value in the local non-existent supply chain of the large wild game meat by the application on the case study of the Valle Ossola (Piedmont, Italy. Due to its representativeness among Italian wild ungulates, the research focus on red deer meat. The data has been collected in 2016 through in-depth interviews and focus groups with the stakeholders involved in the supply chain: hunters, transformers and restaurateurs. Results show that for the hunter the red deer reach a hypothetical price of 6,00 €/kg. From a meat processing targeted at the maximum enhancement of the carcass, without any waste, the transformers can reach a hypothetical price of 9,80 €/kg. Whereas for the restaurateur, the red deer meat can reach a final price range between 22,88 and 51,47 €/kg (hypothesizing maximum sales of high value-added course. Through the maximization of the meat’s quality, hunter and transformers profits can increase significantly, with a redistribution of the added value throughout the supply chain. A limitation of this study is that the calculated values does not take into consideration the stakeholders’ production costs (that increasing along the supply chain. Considering our findings, the development of sustainable supply chain of the local game meat could be economically interesting. Thus, wild ungulates could represent an economic resource for the population rather than an environmental and social cost for the mountain areas.

[A commentary on the Ruling of the Tribuna Constitucional 212/1996 of 19 December 1996 (I)].

Science.gov (United States)

González Morán, L

1998-01-01

This article is a commentary on Spain's Constitutional Court's ruling of 19 December 1996 (STC 212/1996), on the challenge (596/89) on grounds of alleged unconstitutionality made against Law 42/1988, 28 December, which regulates the donation of human embryos and foetuses or the cells, tissues and organs therefrom. The article is structured as follows: it opens with a summary of Law 42/1988, since this is felt necessary to understand the subsequent challenge made on grounds of alleged unconstitutionality. We then provide specific details of the challenge and the resulting ruling, before concluding with some critical remarks on the aforementioned Law and ruling.

Winter wolf predation in a multiple ungulate prey system, Gates of the Arctic National Park, Alaska

Science.gov (United States)

Dale, Bruce W.; Adams, Layne G.; Bowyer, R. Terry; Carbyn, Ludwig N.; Fritts, Steven H.; Seip, Dale R.

1995-01-01

We investigated patterns of winter wolf predation, including prey selection, prey switching, kill rates, carcass utilization, and consumption rates for four wolf packs during three different study periods (March 1989, March 1990, and November 1990) in Gates of the Arctic National Park and Preserve, Alaska. Wolves killed predominantly caribou (165 caribou, seven moose, and five Dall sheep) even when moose and sheep were more abundant. Prey selection varied between study periods. More moose were killed in march 1989, a particularly deep snow year, and more sheep were killed in November 1990 than during other periods. Overall kill rates ranged from 0-8 days/ungulate killed (x̅ = 2.0, SD = 1.6) and did not vary between study periods.  Pack size and species killed explained significant variation in the length of time intervals between kills. Although caribou density varied nearly 40-fold between pack territories, it had little influence on predation characteristics except at low densities, when kill rates may have declined. Caribou distribution had marked effects on wolf predation rate.

SKB Annual Report 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-05-01

This is the annual report of the Swedish Nuclear Fuel and Waste Management Co (SKB). Part 1 of the report contains an overview of the SKB activities in different fields, and part 2 gives a description of the research and development work on nuclear waste disposal performed during 1996. Lectures and publications as well as reports issued during 1996 are listed in part 3, and summaries of the reports are listed in part 4. The task of SKB is to transport, store and dispose of the spent nuclear fuel and radioactive wastes from the nuclear power plants and to perform the research and development and other measures necessary for this work. SKB is the owner of CLAB, the Central Interim Storage Facility for spent fuel, located at Oskarshamn. CLAB was taken into operation in July 1985 and by the end of 1996 about 2500 tons of spent fuel have been received. At Forsmark the Final Repository for Radioactive Operational Waste (SFR) was taken into operation in April 1988. The repository is situated in crystalline rock under the Baltic Sea. SFR has currently a capacity of about 60000 m{sup 3} or waste. At the end of 1996 at total of 21000 m{sup 3} of waste has been deposited. Transportation from the reactor sites to CLAB and SFR is made by a specially designed ship, M/S Sigyn. The total cost for R,D and D during 1996 amounted to 124 MSEK (about 15 MUSD).

SKB Annual Report 1996

International Nuclear Information System (INIS)

1997-05-01

This is the annual report of the Swedish Nuclear Fuel and Waste Management Co (SKB). Part 1 of the report contains an overview of the SKB activities in different fields, and part 2 gives a description of the research and development work on nuclear waste disposal performed during 1996. Lectures and publications as well as reports issued during 1996 are listed in part 3, and summaries of the reports are listed in part 4. The task of SKB is to transport, store and dispose of the spent nuclear fuel and radioactive wastes from the nuclear power plants and to perform the research and development and other measures necessary for this work. SKB is the owner of CLAB, the Central Interim Storage Facility for spent fuel, located at Oskarshamn. CLAB was taken into operation in July 1985 and by the end of 1996 about 2500 tons of spent fuel have been received. At Forsmark the Final Repository for Radioactive Operational Waste (SFR) was taken into operation in April 1988. The repository is situated in crystalline rock under the Baltic Sea. SFR has currently a capacity of about 60000 m 3 or waste. At the end of 1996 at total of 21000 m 3 of waste has been deposited. Transportation from the reactor sites to CLAB and SFR is made by a specially designed ship, M/S Sigyn. The total cost for R,D and D during 1996 amounted to 124 MSEK (about 15 MUSD)

Evaluating the long-term management of introduced ungulates to protect the palila, an endangered bird, and its critical habitat in subalpine forest of Mauna Kea, Hawai‘i

Science.gov (United States)

Paul C. Banko; Steven C. Hess; Paul G. Scowcroft; Chris Farmer; James D. Jacobi; Robert M. Stephens; Richard J. Camp; David L. Leonard; Kevin W. Brinck; J. O. Juvik; S. P. Juvik

2014-01-01

Under the multiple-use paradigm, conflicts may arise when protection of an endangered species must compete with other management objectives. To resolve such a conflict in the Critical Habitat of the endangered Hawaiian honeycreeper, palila (Loxioides bailleui), federal courts ordered the eradication of introduced ungulates responsible for damaging...

Energy in 1996

International Nuclear Information System (INIS)

1996-01-01

Six charts are presented and discussed concerning energy utilization in France during the 1970-1996 period: national energy bill, energy intensity ratios, imported crude oil costs, energy-induced carbon dioxide emissions, operating ability ratios of EDF nuclear plants, France's energy independence ratios. 1996 has seen an strong increase (+31%) in the energy bill, reaching 77 billions Francs, combining an increase in energy consumption and dollar exchange rate and a decline in energy conservation; carbon dioxide emission are taking up again after a strong decrease in the 80's

Viral diseases of northern ungulates

Directory of Open Access Journals (Sweden)

K. Frölich

2000-03-01

Full Text Available This paper describes viral diseases reported in northern ungulates and those that are a potential threat to these species. The following diseases are discussed: bovine viral diarrhoea/mucosal disease (BVD/MD, alphaherpesvirus infections, malignant catarrhal fever (MCF, poxvirus infections, parainfluenza type 3 virus infection, Alvsborg disease, foot-and-mouth disease, epizootic haemorrhage disease of deer and bluetongue disease, rabies, respiratory syncytial virus infection, adenovirus infection, hog-cholera, Aujeszky's disease and equine herpesvirus infections. There are no significant differences in antibody prevalence to BVDV among deer in habitats with high, intermediate and low density of cattle. In addition, sequence analysis from the BVDV isolated from roe deer (Capreolus capreolus showed that this strain was unique within BVDV group I. Distinct BVDV strains might circulate in free-ranging roe deer populations in Germany and virus transmission may be independent of domestic livestock. Similar results have been obtained in a serological survey of alpha-herpesviruses in deer in Germany. Malignant catarrhal fever was studied in fallow deer (Cervus dama in Germany: the seroprevalence and positive PCR results detected in sheep originating from the same area as the antibody-positive deer might indicate that sheep are the main reservoir animals. Contagious ecthyma (CE is a common disease in domestic sheep and goats caused by the orf virus. CE has been diagnosed in Rocky Mountain bighorn sheep (Ovis canadensis, mountain goats (Oreamnos americanus, Dall sheep (Ovis dalli, chamois (Rupkapra rupi-capra, muskox {Ovibos moschatus and reindeer (Rangifer tarandus. Most parainfluenza type 3 virus infections are mild or clinically undetectable. Serological surveys in wildlife have been successfully conducted in many species. In 1985, a new disease was identified in Swedish moose (Alces alces, designated as Alvsborg disease. This wasting syndrome probably

Monthly energy review: September 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-09-01

Energy production during June 1996 totaled 5.6 quadrillion Btu, a 0.5% decrease from the level of production during June 1995. Energy consumption during June 1996 totaled 7.1 quadrillion Btu, 2.7% above the level of consumption during June 1995. Net imports of energy during June 1996 totaled 1.6 quadrillion Btu, 4.5% above the level of net imports 1 year earlier. Statistics are presented on the following topics: energy consumption, petroleum, natural gas, oil and gas resource development, coal, electricity, nuclear energy, energy prices, and international energy. 37 figs., 59 tabs.

Artificial deepening of seasonal waterholes in eastern Cambodia: impact on water retention and use by large ungulates and waterbirds

Directory of Open Access Journals (Sweden)

Thomas N.E. Gray

2015-05-01

Full Text Available Natural seasonal waterholes (trapeang in Khmer are an important feature of the deciduous dipterocarp forests of eastern Cambodia and are utilised by a number of globally threatened species of large ungulates and waterbirds. However at the end of the dry-season (April only a small proportion of waterholes retain water. In 2011, we artificially deepened six waterholes in the core area of Mondulkiri Protected Forest, eastern Cambodia, removing 3m3 to 24m3 of earth (mean 16.5m3 from each.  Surveys prior to deepening demonstrated that only one of these waterholes, and 10% of all waterholes surveyed in the study area (n=50, held water at the end of the dry-season.  Following modification five of the six deepened waterholes (83% held water at the end of the subsequent dry-season. From four camera traps over 448 trap-nights, 23 species including two globally threatened large ungulates, Banteng Bos javanicus and Eld’s Deer Rucervus eldii, and two Critically Endangered Ibises (Giant Thaumatibis gigantea and White-shouldered Ibis Pseudibis davisoni, were photographed foraging and drinking at the deepened waterholes between March and June 2012.  Our results suggest that artificial deepening of natural waterholes does not cause damage, and makes these waterholes suitable for use throughout the dry-season.  In the face of changing climate it is suggested that management plans should have a programme for the survey and determination of the status of waterholes every year and improve the use of water resources by artificial deepening. 

The yield and nutritional value of meat from African ungulates, camelidae, rodents, ratites and reptiles.

Science.gov (United States)

Hoffman, L C

2008-09-01

The current knowledge of the yield and nutritional (proximate and fatty acid) composition of meat derived from African ungulates, camelidae, rodents, ratites and reptiles is reviewed. Although most of the species discussed give low cholesterol levels consistent with their low meat lipid contents, the tegu lizard gives a very low level (18.2mg/100g tissue). The fatty acid profiles of the various species all have low saturated fatty acids and high polyunsaturated fatty acids resulting in favourable saturated to polyunsaturated fatty acid ratios. Although the springbok, camel, ostrich and crocodile are marketed and exported to sophisticated markets, the rodents are the species that show most promise in becoming large commercial commodities. Not only is their meat desirable and nutritional, but they are also highly adaptable to extensive and intensive production systems.

Environmental radioactivity 1996

International Nuclear Information System (INIS)

1997-01-01

Environmental Radioactivity in New Zealand and Rarotonga : annual report 1996 was published in May this year. The 1996 environmental radioactivity monitoring programme included, as usual, measurements in New Zealand and the Cook Islands of atmospheric, deposited and dairy product radioactivity. The environment in the New Zealand and Cook Island regions has now virtually returned to the situation in the 'pre-nuclear' era. The contination of monitoring, although at a reduced level of intensity, is basically to ensure that any change from the present state, due to any source of radioactivity does not go undetected or unquestioned. (author)

Prey selection of lions Panthera leo in a small, enclosed reserve

Directory of Open Access Journals (Sweden)

R.J. Power

2002-12-01

Full Text Available Annual trends in numbers of ungulate species on a 15 km² reserve from 1993 to 1998, were evaluated in the context of lion Panthera leo reintroduction during 1996, and subsequent predation by them. The ungulate prey base was enumerated annually by aerial counts and a road count that took place during 1998. The lion prey record was obtained from direct observations of a radio-located pride of eight lions and daily reserve management records. All ungulate species that underwent precipituous declines were also the most important prey to lions, comprising over 80 % of their prey, and they were preyed upon according to their availability. Lion predation was causal for the declines in wildebeest Connochaetes taurinus, Blesbok Damaliscus pygargus phillipsi and Warthog Phacochoerus africana, while the decline in Kudu Tragelaphus strepsiceros was only partly ascribed to lions, as other non-lion related mortality sources were identified. The only ungulate species to increase subsequent to lion reintroduction was the Impala Aepyceros melampus, which was furthermore under-selected by lions. The uncontrolled population growth of Impala could have elicited ecological degradation, and it was advised to either not stock Impala, or otherwise control their numbers if lions are unable to do so. Lion hunting success and kill rate, were 21 % (n = 63 and 1 kill/4.4 days, respectively. Three bushpigs Potamochoerus larvatus were killed but not utilised,and this finding is corroborated by an intensive study in Kwazulu-Natal, and this aversion is discussed. Predators can cause unprecedented declines of their prey where the prey are confined to small reserves that have no refuge from predation. On an annual basis, prey may need to be augmented to sustain predators on small reserves

Production and screening of carbon products precursors from coal. Quarterly progress report, July 1, 1996--September 30, 1996

Energy Technology Data Exchange (ETDEWEB)

Zondlo, J.; Stiller, A.

1996-10-25

This quarterly report covers activities during the period from July 1, 1996 through September 30, 1996 on the development of carbon products precursor materials from coal. The first year of the project ended in February, 1996; however, the WVU research effort continued through August 14, 1997 on a no-cost extension of the original contract. PETC chose to exercise the option for continuation of the projects and $100,000 became available on August 9, 1996. The objective for year two is to focus on development of those carbon products from coal-based solvent extract precursors which have the greatest possibility for commercial success.

Status and management of the Palila, an endangered Hawaiian honeycreeper, 1987-1996

Science.gov (United States)

Pratt, T.K.; Banko, P.C.; Fancy, S.G.; Lindsey, G.D.; Jacobi, J.D.

1998-01-01

A single, relictual population of Palila Loxioides bailleui, a Hawaiian honeycreeper, survives on the slopes of Mauna Kea volcano on the island of Hawai'i, where it feeds principally on flowers and green seeds of the mamane tree Sophora chrysophylla. The Palila was listed as an endangered species by state and federal governments because of continuing damage to its habitat by browsing Feral and Mouflon Sheep Ovis aries and O. musimon and Goats Capra hircus and because of the bird's restricted range and low numbers. Ecology of the Palila was studied from 1987 to 1996. Annual population estimates fluctuated between 1 600 and 5 700 and averaged 3 400 birds. Estimates varied with availability of mamane seeds, which are less abundant in drought years. In drought years, most birds did not attempt to breed, and survival rates were lower because of a shortage of food. Availability of mamane seeds also showed large seasonal variability. While some nests were preyed upon by Owls Asio flammeus, Cats Felis catus and Rats Rattus rattus, losses were high at the end of the season from unexplained death of eggs and chicks. Genetic studies did not implicate inbreeding depression. Neither avian malaria nor avian pox appeared at this site, where the mosquito vector was absent. However, weather and food shortage worsened towards the end of the nesting season. Availability of food and habitat remain the principal factors limiting increase in the Palila population. Recovery efforts now focus on reducing numbers of feral ungulates, fire management, removing mammalian predators, and developing techniques for captive propagation and introduction to currently unoccupied sites within the bird's former range. Reforestation adjacent to the Mauna Kea Forest Reserve would allow the Palila population to expand and grow.

ITER council proceedings: 1996

International Nuclear Information System (INIS)

1997-01-01

Records of the 10. ITER Council Meeting (IC-10), held on 26-27 July 1996, in St. Petersburg, Russia, and the 11. ITER Council Meeting (IC-11) held on 17-18 December 1996, in Tokyo, Japan, are presented, giving essential information on the evolution of the ITER Engineering Design Activities (EDA) and the cost review and safety analysis. Figs, tabs

Results of Geothermal Exploitation in Mexico During 1996; Resultados de la explotacion geotermica en Mexico en 1996

Energy Technology Data Exchange (ETDEWEB)

Gutierrez Negrin, Luis C. A. [Gerencia de Proyectos Geotermoelectricos de la Comision Federal de Electricidad, Morelia (Mexico)

1997-01-01

During 1996, 56.2 million tons of steam were produced, at an average annual rate of 6,416 tons per hour (t/h), to supply enough steam to operate of 26 geothermal-electric plants in three geothermal fields, which represent an installed capacity of 743 MW. To accomplish that production, 177 geothermal wells were operated at an average annual production of 36 t/h of steam. Electricity generation was 5,737 gigawatts-hour, which represent 3.8% of the whole electrical energy generated in Mexico in 1996. Production of steam and generation of electricity were increased in 1996, comparing with 1994 and 1995. However, unitary costs were practically the same between 1995 and 1996. The Comision Federal de Electricidad (Federal Commission for Electricity, or CFE) has programmed several geothermal- electric projects to increase the installed capacity in the fields under exploitation in new fields. Also, the CFE has some non electrical projects to reach an integral use of geothermics in Mexico. [Espanol] A fin de suministrar el vapor necesario para la generacion de 26 plantas geotermoelectricas instaladas en tres campos geotermicos, con una capacidad total de 743 megawatts (MW) durante 1996 se produjeron 56.2 millones de toneladas de vapor, a una tasa media anual de 6,416 toneladas por hora (t/h). Ello implico la operacion de 177 pozos productores, con una produccion de la energia electrica generada en Mexico en 1996. Tanto la produccion de vapor como la generacion de electricidad en 1996 se incrementaron con respecto a los anos precedentes de 1994 y 1995, pese a que los costos unitarios se mantuvieron practicamente constantes entre 1995 y 1996. La Comision Federal de Electricidad (CFE) tiene en programa varios proyectos geotermoelectricos para incrementar la capacidad instalada en los campos en explotacion y para iniciar el aprovechamiento en campos nuevos, asi como proyectos no electricos para conseguir un aprovechamiento integral de la geotermia en Mexico.

1996 annual report

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-10-01

This report presents the activities and accomplishments of the Philippine Nuclear Research Institute (PNRI) for the calendar year 1996. The highlights of the accomplishment is about the nuclear and allied services, research development, nuclear safety and regulations, and the general administration and linkages. Also, the special S and T events especially the holding of the 2nd Philippine Nuclear Congress with Dr. Hans Blix, Director General of the IAEA, as the keynote speaker; and the celebration of the 100th year of discovery of radioactivity (1896-1996) are included in this report.

1996 annual report

International Nuclear Information System (INIS)

1997-01-01

This report presents the activities and accomplishments of the Philippine Nuclear Research Institute (PNRI) for the calendar year 1996. The highlights of the accomplishment is about the nuclear and allied services, research development, nuclear safety and regulations, and the general administration and linkages. Also, the special S and T events especially the holding of the 2nd Philippine Nuclear Congress with Dr. Hans Blix, Director General of the IAEA, as the keynote speaker; and the celebration of the 100th year of discovery of radioactivity (1896-1996) are included in this report

Accelerator operation in 1995-1996

International Nuclear Information System (INIS)

Loyer, F.

1998-01-01

This report presents the operation of the GANIL accelerator between 1995 and 1996. A table is given in which the time distribution of the accelerator operation in the two years is indicated as: beam availability, time devoted to nuclear and non-nuclear physics research, radioactive ion separator operation, industrial irradiation, machine studies and maintenance. A statistics of the accelerated elements and their energy (MeV/u) shows an increase in the number of beam types and new beams from 18 and 9, respectively, in 1995 to 19 and 11 respectively in 1996. The report mentions also the safety incident of June 9, 1995, the failures in operation in 1995-1996 and events connected to SISSI, UGS-R and THI operations

Piroplasmosis in wildlife: Babesia and Theileria affecting free-ranging ungulates and carnivores in the Italian Alps.

Science.gov (United States)

Zanet, Stefania; Trisciuoglio, Anna; Bottero, Elisa; de Mera, Isabel Garcia Fernández; Gortazar, Christian; Carpignano, Maria Grazia; Ferroglio, Ezio

2014-02-17

Piroplasmosis are among the most relevant diseases of domestic animals. Babesia is emerging as cause of tick-borne zoonosis worldwide and free-living animals are reservoir hosts of several zoonotic Babesia species. We investigated the epidemiology of Babesia spp. and Theileria spp. in wild ungulates and carnivores from Northern Italy to determine which of these apicomplexan species circulate in wildlife and their prevalence of infection. PCR amplification of the V4 hyper-variable region of the 18S rDNA of Babesia sp./Theileria sp was carried out on spleen samples of 1036 wild animals: Roe deer Capreolus capreolus (n = 462), Red deer Cervus elaphus (n = 52), Alpine Chamois Rupicapra rupicapra (n = 36), Fallow deer Dama dama (n = 17), Wild boar Sus scrofa (n = 257), Red fox Vulpes vulpes (n = 205) and Wolf Canis lupus (n = 7). Selected positive samples were sequenced to determine the species of amplified Babesia/Theileria DNA. Babesia/Theileria DNA was found with a mean prevalence of 9.94% (IC95% 8.27-11.91). The only piroplasms found in carnivores was Theileria annae, which was detected in two foxes (0.98%; IC95% 0.27-3.49). Red deer showed the highest prevalence of infection (44.23%; IC95% 31.6-57.66), followed by Alpine chamois (22.22%; IC95% 11.71-38.08), Roe deer (12.55%; IC95% 9.84-15.89), and Wild boar (4.67%; IC95% 2.69-7.98). Genetic analysis identified Babesia capreoli as the most prevalent piroplasmid found in Alpine chamois, Roe deer and Red deer, followed by Babesia bigemina (found in Roe deer, Red deer and Wild boar), and the zoonotic Babesia venatorum (formerly Babesia sp. EU1) isolated from 2 Roe deer. Piroplasmids of the genus Theileria were identified in Wild boar and Red deer. The present study offers novel insights into the role of wildlife in Babesia/Theileria epidemiology, as well as relevant information on genetic variability of piroplasmids infecting wild ungulates and carnivores.

Identifying and prioritizing ungulate migration routes for landscape-level conservation

Science.gov (United States)

Sawyer, Hall; Kauffman, Matthew J.; Nielson, Ryan M.; Horne, Jon S.

2009-01-01

As habitat loss and fragmentation increase across ungulate ranges, identifying and prioritizing migration routes for conservation has taken on new urgency. Here we present a general framework using the Brownian bridge movement model (BBMM) that: (1) provides a probabilistic estimate of the migration routes of a sampled population, (2) distinguishes between route segments that function as stopover sites vs. those used primarily as movement corridors, and (3) prioritizes routes for conservation based upon the proportion of the sampled population that uses them. We applied this approach to a migratory mule deer (Odocoileus hemionus) population in a pristine area of southwest Wyoming, USA, where 2000 gas wells and 1609 km of pipelines and roads have been proposed for development. Our analysis clearly delineated where migration routes occurred relative to proposed development and provided guidance for on-the-ground conservation efforts. Mule deer migration routes were characterized by a series of stopover sites where deer spent most of their time, connected by movement corridors through which deer moved quickly. Our findings suggest management strategies that differentiate between stopover sites and movement corridors may be warranted. Because some migration routes were used by more mule deer than others, proportional level of use may provide a reasonable metric by which routes can be prioritized for conservation. The methods we outline should be applicable to a wide range of species that inhabit regions where migration routes are threatened or poorly understood.

Atlanta Centennial Olympic Games and Paralympic Games event study, 1996. Final report, July 1996--August 1996

Energy Technology Data Exchange (ETDEWEB)

Amodei, R.; Bard, E.; Brong, B.; Cahoon, F.; Jasper, K.

1998-11-01

The Atlanta metropolitan region was the location of one of the most ambitious Intelligent Transportation Systems (ITS) deployments in the United States. This deployment included several individual projects--a Central Transportation Management Center (TMC), six Traffic Control Centers (TCCs), one Transit Information Center (TIC), The Travel Information Showcase (TIS), and the extension of the Metropolitan Atlanta Rapid Transit Authority (MARTA) Rail network and the new high-occupancy vehicle (HOV) lanes on I-85 and I-75. The 1996 Atlanta Centennial Olympic Games and Paralympic Games created a focus for these projects. All of these systems were to be brought on-line in time for the Olympic Games. This report presents the findings of the 1996 Olympic and Paralympic Games Events Study--a compilation of findings of system performance, the benefits realized, and the lessons learned during their operations over the event period. The study assessed the performance of the various Travel Demand Management (TDM) plans employed for Olympic Games traffic management.

Status Report of INIS Operations April 1996 - April 1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-07-01

The total number of records announced in Atomindex volume 27 (1996) was 80,516. A total of 77 Members sent input for volume 27 (1996) (78 for volume 26 (1995)). The INIS Secretariat carried out a comprehensive effort in 1996 to encourage Liaison Officers to participate more actively in INIS. Liaison Officers of 17 countries were contacted in July to remind them that they did not send any input since the beginning of 1996. As a result of this activity 10 countries sent input for the first time in 1996.

Status Report of INIS Operations April 1996 - April 1997

International Nuclear Information System (INIS)

1997-01-01

The total number of records announced in Atomindex volume 27 (1996) was 80,516. A total of 77 Members sent input for volume 27 (1996) (78 for volume 26 (1995)). The INIS Secretariat carried out a comprehensive effort in 1996 to encourage Liaison Officers to participate more actively in INIS. Liaison Officers of 17 countries were contacted in July to remind them that they did not send any input since the beginning of 1996. As a result of this activity 10 countries sent input for the first time in 1996

Consequences of snowy winters on male mating strategies and reproduction in a mountain ungulate.

Science.gov (United States)

Apollonio, Marco; Brivio, Francesca; Rossi, Iva; Bassano, Bruno; Grignolio, Stefano

2013-09-01

Alternative mating tactics (AMTs) are intrasexual variants in mating behaviour of several species ranging from arthropods to mammals. Male AMTs coexist between and within populations. In particular, male ungulates rarely adopt just one tactic throughout their lifetime. Tactics commonly change according to internal factors (age, body size, condition) and external conditions (weather, resources, predation, animal density). However, the influence of weather has not yet been investigated in upper vertebrates. Such influence may be relevant in species whose rutting period occurs late in fall or in winter, when environmental conditions and the snow cover in particular may vary considerably. We detected two AMTs in Alpine ibex (Capra ibex) males: older and full-grown males mainly adopted the tending tactic, while younger males usually pursued an alternative one (coursing tactic). Weather was found to influence the use of AMTs by males: in snowy mating seasons, the coursing tactic was no longer used due to difficulties in moving through deep snow. In snowy rutting periods, males appeared to delay or even avoid mating activities and a decrease of births was reported in the second part of the following birth season. Snow cover may have a negative effect on population dynamics by reducing the recruitment and on population genetic variability, as a consequence of poorer mating opportunities. Studies on factors affecting mating behaviour and leading to a reduced availability of mates and a decrease in female productivity are especially relevant in species, like Alpine ibex, whose genetic variability is low. Copyright © 2013 Elsevier B.V. All rights reserved.

Annual report 1995-1996

International Nuclear Information System (INIS)

1996-01-01

The annual report including financial statements of the Canada-Nova Scotia Offshore Petroleum Board (the Board) was presented for the fiscal year ending March 31, 1996. The Board's responsibilities include ensuring safe working conditions for offshore petroleum activities, protection of the environment during offshore petroleum operations, and management of offshore petroleum resources. In February of 1996, the successful completion of the CP3A well at Cohasset added in excess of 1,000,000 barrels of recoverable oil to the field. The report also discussed efforts towards improved levels of communication with government departments, agencies and other organizations having an interest in offshore oil activities, agreements concluded with the Canadian Coast Guard and the Canadian Transportation Accident Investigation and Safety Board, the Canada-Nova Scotia Environmental Coordinating Committee, the National Energy Board, and the Canada-Newfoundland Offshore Petroleum Board. During the fiscal year production amounted to 7.5 million barrels of Scotia light crude oil. In another highlight, exploratory permit was issued for the Sable Island field, a proposed development of six gas fields, effective January 1, 1996. tabs

Shell Canada Limited 1996 annual report

International Nuclear Information System (INIS)

1996-01-01

Shell Canada Resources Limited is one of Canada's largest producers of crude oil, natural gas, natural gas liquids, sulphur and bitumen. This annual report for 1996 presented a summary review of operations and a summary of the Company's audited consolidated financial statements. Overall, the resources business delivered exceptional results in 1996. The oil products and chemicals businesses did not perform as well as expected. This less than satisfactory performance of the oil products and chemicals divisions of the the Company is reflected in the financial returns which, after excluding revenues from asset sales, left operating earnings $ 59 million below those of 1996. tabs., figs

Savannah River Site 1996 epidemiologic surveillance report

International Nuclear Information System (INIS)

2000-01-01

This report provides a summary of epidemiologic surveillance data collected from Savannah River Site from January 1, 1996 through December 31, 1996. The data were collected by a coordinator at Savannah River Site and submitted to the Epidemiologic Surveillance Data Center located at Oak Ridge Institute for Science and Education, where quality control procedures and preliminary data analyses were carried out. The analyses were interpreted and the final report prepared by the DOE Office of Epidemiologic Studies. The information in this report provides highlights of the data analyses conducted on the 1996 data collected from Savannah River Site. The main sections of the report include: work force characteristics; absences due to injury or illness lasting 5 or more consecutive workdays; workplace illnesses, injuries, and deaths that were reportable to the Occupational Safety and Health Administration (''OSHA-recordable'' events); and disabilities and deaths among current workers. The 1996 report includes a new section on time trends that provides comparative information on the health of the work force from 1994 through 1996

Eesti proosa 1996 : midagi olulist : [katkend] / Udo Uibo

Index Scriptorium Estoniae

Uibo, Udo, 1956-

2009-01-01

Katkend Udo Uibo artiklist "Eesti proosa 1996 : midagi olulist". Katkendis vaadeldakse Jüri Ehlvesti romaani "Ikka veel Bagdadis" (Tartu : EÜS Veljesto kirjastus, 1996) ja novellikogu "Krutsiaania" (Tallinn : Tuum, 1996)

Store tobacco policies: a survey of store managers, California, 1996-1997.

Science.gov (United States)

Weinbaum, Z; Quinn, V; Rogers, T; Roeseler, A

1999-01-01

To identify store tobacco policies and retailer perception and beliefs that may have contributed to changes in compliance with youth access laws in California. In the winter of 1996-7, a cross sectional, follow up telephone survey was conducted of California store managers whose stores were anonymously surveyed for illegal tobacco sales in the summer of 1996 (that is, 1996 Youth Tobacco Purchase Survey, YTPS). A simple random sample of stores from a list of California stores likely to sell tobacco, used in the 1996 YTPS. 334 managers (77%) of the 434 stores surveyed in 1996 responded to the survey. After eliminating stores that stopped selling tobacco or were under new management or ownership, 320 responses of store managers were included in the analysis. The stores were analysed by type of ownership: chain, which included corporate managed (n = 61); franchise owned (n = 56); and independent (n = 203). Responses of store managers were linked with the 1996 YTPS outcomes. Manager responses were compared by chi2 tests. Logistic regression analyses were conducted to identify store factors associated with illegal tobacco sales. A lower likelihood of illegal sales rate was associated with the chain stores when compared with the independent stores (odds ratio (OR) = 0.4, 95% confidence interval (CI) 0.2 to 0.9). A lower likelihood of illegal tobacco sales was found in stores that implemented tobacco related activities in the previous year such as changing tobacco displays (OR = 0.5, 95% CI 0.2 to 0.9) or adding new warning signs (OR = 0.7, 95% CI 0.4 to 1.2). Store managers' beliefs that youth were sent to their stores to do compliance checks also resulted in a lower likelihood of illegal sales (OR = 0.7, 95% CI 0.4 to 1.1). Store tobacco youth access policies, and managers' beliefs about the extent of youth access enforcement in the community, are important in reducing illegal tobacco sales to minors.

Scale Dependence of Female Ungulate Reproductive Success in Relation to Nutritional Condition, Resource Selection and Multi-Predator Avoidance.

Directory of Open Access Journals (Sweden)

Jared F Duquette

Full Text Available Female ungulate reproductive success is dependent on the survival of their young, and affected by maternal resource selection, predator avoidance, and nutritional condition. However, potential hierarchical effects of these factors on reproductive success are largely unknown, especially in multi-predator landscapes. We expanded on previous research of neonatal white-tailed deer (Odocoileus virginianus daily survival within home ranges to assess if resource use, integrated risk of 4 mammalian predators, maternal nutrition, winter severity, hiding cover, or interactions among these variables best explained landscape scale variation in daily or seasonal survival during the post-partum period. We hypothesized that reproductive success would be limited greater by predation risk at coarser spatiotemporal scales, but habitat use at finer scales. An additive model of daily non-ideal resource use and maternal nutrition explained the most (69% variation in survival; though 65% of this variation was related to maternal nutrition. Strong support of maternal nutrition across spatiotemporal scales did not fully support our hypothesis, but suggested reproductive success was related to dam behaviors directed at increasing nutritional condition. These behaviors were especially important following severe winters, when dams produced smaller fawns with less probability of survival. To increase nutritional condition and decrease wolf (Canis lupus predation risk, dams appeared to place fawns in isolated deciduous forest patches near roads. However, this resource selection represented non-ideal resources for fawns, which had greater predation risk that led to additive mortalities beyond those related to resources alone. Although the reproductive strategy of dams resulted in greater predation of fawns from alternative predators, it likely improved the life-long reproductive success of dams, as many were late-aged (>10 years old and could have produced multiple litters

Energy Balance of the Santa Catarina State - Series 1980 -1996; Balanco energetico do Estado de Santa Catarina - Serie 1980-1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-07-01

This energy balance of the Santa Catarina State presents the following main topics that can be outstanding: economic aspects; supply and demand of energy by source 1980-1996; energy consumption by sector 1980/1996; energy interchange; and balance of the transformation centers 1980/1996.

1996 annual report; Rapport annuel 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-12-31

This 1996 issue of the annual report of the French Commissariat a l`Energie Atomique (CEA) gives a general overview of CEA organization, activities, human resources, international relations and external communication with some budgetary informations. The main activities described concern the national defence, the fuel cycle, the nuclear reactors, the condensed matter and life sciences, the advanced technologies, the protection and transfer of knowledge and technologies, the environmental activities, the management and processing of nuclear wastes, the nuclear protection and safety, the technical and scientific information, the teaching and training, the scientific prizes, the committees, councils and commissions. (J.S.).

Decontamination systems information and research program. Quarterly report, January 1996--March 1996

International Nuclear Information System (INIS)

1996-04-01

West Virginia University (WVU) and the US Department of Energy, Morgantown Energy Technology Center (DOE/METC) entered into a Cooperative Agreement in August 1992 titled open-quotes Decontamination Systems Information and Research Programsclose quotes (DOE Instrument No.: DE-FC21-92MC29467). Requirements stipulated by the Agreement require WVU to submit quarterly Technical Progress reports. This report contains the efforts of the research projects comprising the Agreement for the 1st calendar quarter of 1996. For the period January 1 through December 31, 1996 twelve projects have been selected for funding, and the Kanawha Valley will continue under a no-cost extension. Three new projects have also been added to the program. This document describes these projects involving decontamination, decommissioning and remedial action issues and technologies

FY 1996 Congressional budget request: Budget highlights

Energy Technology Data Exchange (ETDEWEB)

1995-02-01

The FY 1996 budget presentation is organized by the Department`s major business lines. An accompanying chart displays the request for new budget authority. The report compares the budget request for FY 1996 with the appropriated FY 1995 funding levels displayed on a comparable basis. The FY 1996 budget represents the first year of a five year plan in which the Department will reduce its spending by $15.8 billion in budget authority and by $14.1 billion in outlays. FY 1996 is a transition year as the Department embarks on its multiyear effort to do more with less. The Budget Highlights are presented by business line; however, the fifth business line, Economic Productivity, which is described in the Policy Overview section, cuts across multiple organizational missions, funding levels and activities and is therefore included in the discussion of the other four business lines.

Performance profiles of major energy producers 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-01-01

This publication examines developments in the operations of the major US e energy-producing companies on a corporate level, by major line of business, by major function within each line of business, and by geographic area. In 1996, 24 companies filed Form EIA-28. The analysis and data presented in this report represents the operations of the Financial Reporting System companies in the context of their worldwide operations and in the context of the major energy markets which they serve. Both energy and nonenergy developments of these companies are analyzed. Although the focus is on developments in 1996, important trends prior to that time are also featured. Sections address energy markets in 1996; key financial developments; oil and gas exploration, development, and production; downstream petroleum in 1996; coal and alternative energy; and foreign direct investment in US energy. 30 figs., 104 tabs.

Performance profiles of major energy producers 1996

International Nuclear Information System (INIS)

1998-01-01

This publication examines developments in the operations of the major US e energy-producing companies on a corporate level, by major line of business, by major function within each line of business, and by geographic area. In 1996, 24 companies filed Form EIA-28. The analysis and data presented in this report represents the operations of the Financial Reporting System companies in the context of their worldwide operations and in the context of the major energy markets which they serve. Both energy and nonenergy developments of these companies are analyzed. Although the focus is on developments in 1996, important trends prior to that time are also featured. Sections address energy markets in 1996; key financial developments; oil and gas exploration, development, and production; downstream petroleum in 1996; coal and alternative energy; and foreign direct investment in US energy. 30 figs., 104 tabs

Seasonal and demographic factors influencing gastrointestinal parasitism in ungulates of Etosha National Park.

Science.gov (United States)

Turner, Wendy C; Getz, Wayne M

2010-10-01

Host-parasite dynamics can be strongly affected by seasonality and age-related host immune responses. We investigated how observed variation in the prevalence and intensity of parasite egg or oocyst shedding in four co-occurring ungulate species may reflect underlying seasonal variation in transmission and host immunity. This study was conducted July 2005-October 2006 in Etosha National Park, Namibia, using indices of parasitism recorded from 1,022 fecal samples collected from plains zebra (Equus quagga), springbok (Antidorcas marsupialis), blue wildebeest (Connochaetes taurinus), and gemsbok (Oryx gazella). The presence and intensity of strongyle nematodes, Strongyloides spp. and Eimeria spp. parasites, were strongly seasonal for most host-parasite combinations, with more hosts infected in the wet season than the dry season. Strongyle intensity in zebra was significantly lower in juveniles than adults, and in springbok hosts, Eimeria spp. intensity was significantly greater in juveniles than adults. These results provide evidence that acquired immunity is less protective against strongyle nematodes than Eimeria spp. infections. The seasonal patterns in parasitism further indicate that the long dry season may limit development and survival of parasite stages in the environment and, as a result, host contact and parasite transmission.

Lake Roosevelt fisheries and limnological research. Annual report 1996

International Nuclear Information System (INIS)

Cichosz, T.A.; Shields, J.P.; Underwood, K.D.; Scholz, A.; Tilson, M.B.

1997-05-01

The Lake Roosevelt Monitoring/Data Collection Program resulted from a merger between the Lake Roosevelt Monitoring Program and the Lake Roosevelt Data Collection Project. This project will model biological responses to reservoir operations, evaluate the effects of releasing hatchery origin kokanee salmon and rainbow trout on the fishery, and evaluate the success of various stocking strategies. In 1996, limnological, reservoir operation, zooplankton, and tagging data were collected. Mean reservoir elevation, storage volume and water retention time were reduced in 1996 relative to the last five years. In 1996, Lake Roosevelt reached a yearly low of 1,227 feet above mean sea level in April, a yearly high of 1,289 feet in July, and a mean yearly reservoir elevation of 1,271.4 feet. Mean monthly water retention times in Lake Roosevelt during 1996 ranged from 15.7 days in May to 49.2 days in October. Average zooplankton densities and biomass were lower in 1996 than 1995. Daphnia spp. and total zooplankton densities peaked during the summer, whereas minimum densities occurred during the spring. Approximately 300,000 kokanee salmon and 400,000 rainbow trout were released into Lake Roosevelt in 1996. The authors estimated 195,628 angler trips to Lake Roosevelt during 1996 with an economic value of $7,629,492

Lake Roosevelt Fisheries and Limnological Research : 1996 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Cichosz, Thomas A.; Underwood, Keith D.; Shields, John; Scholz, Allan; Tilson, Mary Beth

1997-05-01

The Lake Roosevelt Monitoring/Data Collection Program resulted from a merger between the Lake Roosevelt Monitoring Program and the Lake Roosevelt Data Collection Project. This project will model biological responses to reservoir operations, evaluate the effects of releasing hatchery origin kokanee salmon and rainbow trout on the fishery, and evaluate the success of various stocking strategies. In 1996, limnological, reservoir operation, zooplankton, and tagging data were collected. Mean reservoir elevation, storage volume and water retention time were reduced in 1996 relative to the last five years. In 1996, Lake Roosevelt reached a yearly low of 1,227 feet above mean sea level in April, a yearly high of 1,289 feet in July, and a mean yearly reservoir elevation of 1,271.4 feet. Mean monthly water retention times in Lake Roosevelt during 1996 ranged from 15.7 days in May to 49.2 days in October. Average zooplankton densities and biomass were lower in 1996 than 1995. Daphnia spp. and total zooplankton densities peaked during the summer, whereas minimum densities occurred during the spring. Approximately 300,000 kokanee salmon and 400,000 rainbow trout were released into Lake Roosevelt in 1996. The authors estimated 195,628 angler trips to Lake Roosevelt during 1996 with an economic value of $7,629,492.

Decontamination systems information and research program. Quarterly report, January 1996--March 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-04-01

West Virginia University (WVU) and the US Department of Energy, Morgantown Energy Technology Center (DOE/METC) entered into a Cooperative Agreement in August 1992 titled {open_quotes}Decontamination Systems Information and Research Programs{close_quotes} (DOE Instrument No.: DE-FC21-92MC29467). Requirements stipulated by the Agreement require WVU to submit quarterly Technical Progress reports. This report contains the efforts of the research projects comprising the Agreement for the 1st calendar quarter of 1996. For the period January 1 through December 31, 1996 twelve projects have been selected for funding, and the Kanawha Valley will continue under a no-cost extension. Three new projects have also been added to the program. This document describes these projects involving decontamination, decommissioning and remedial action issues and technologies.

1996 Savannah River Site annual epidemiologic surveillance report

Energy Technology Data Exchange (ETDEWEB)

None

2000-03-01

This report provides a summary of epidemiologic surveillance data collected from Savannah River Site from January 1, 1996 through December 31, 1996. The data were collected by a coordinator at Savannah River Site and submitted to the Epidemiologic Surveillance Data Center located at Oak Ridge Institute for Science and Education, where quality control procedures and preliminary data analyses were carried out. The analyses were interpreted and the final report prepared by the DOE Office of Epidemiologic Studies. The information in this report provides highlights of the data analyses conducted on the 1996 data collected from Savannah River Site. The main sections of the report include: work force characteristics; absences due to injury or illness lasting 5 or more consecutive workdays; workplace illnesses, injuries, and deaths that were reportable to the Occupational Safety and Health Administration (''OSHA-recordable'' events); and disabilities and deaths among current workers. The 1996 report includes a new section on time trends that provides comparative information on the health of the work force from 1994 through 1996.

AGS experiments - 1994, 1995, 1996

Energy Technology Data Exchange (ETDEWEB)

Depken, J.C.

1997-01-01

This report contains the following information on the Brookhaven AGS Accelerator complex: FY 1996 AGS schedule as run; FY 1997 AGS schedule (working copy); AGS beams 1997; AGS experimental area FY 1994 physics program; AGS experimental area FY 1995 physics program; AGS experimental area FY 1996 physics program; AGS experimental area FY 1997 physics program (in progress); a listing of experiments by number; two-phage summaries of each experiment begin here, also ordered by number; listing of publications of AGS experiments begins here; and listing of AGS experimenters begins here.

AGS experiments - 1994, 1995, 1996

International Nuclear Information System (INIS)

Depken, J.C.

1997-01-01

This report contains the following information on the Brookhaven AGS Accelerator complex: FY 1996 AGS schedule as run; FY 1997 AGS schedule (working copy); AGS beams 1997; AGS experimental area FY 1994 physics program; AGS experimental area FY 1995 physics program; AGS experimental area FY 1996 physics program; AGS experimental area FY 1997 physics program (in progress); a listing of experiments by number; two-phage summaries of each experiment begin here, also ordered by number; listing of publications of AGS experiments begins here; and listing of AGS experimenters begins here

A serological survey of brucellosis in wild ungulate species from five game parks in Zimbabwe

Directory of Open Access Journals (Sweden)

Tatenda R. Motsi

2013-09-01

Full Text Available A retrospective serosurvey was carried out between 2009 and 2012 to detect antibodies to Brucella spp. in free-ranging African wildlife ungulates from five selected game parks in Zimbabwe. Samples were drawn from wildlife-livestock interface and non-interface areas in Zimbabwe. A total of 270 serum samples from four different species, namely African buffalo (Syncerus caffer (n=106, impala (Aepyceros melampus (n = 72, black rhinoceros (Diceros bicornis (n= 45 and white rhinoceros (Ceratotherium simum (n = 47, were tested. The percentage of positive samples was 17.0% in buffalo (18/106; 95% CI: 9.72% – 24.1% and 1.4% in impala (1/72; 95% CI: 0% – 4.2%. No antibodies to Brucella spp. were detected in the two rhinoceros species. The difference in the percentage of seropositive cases between buffalo and impala was significant (p< 0.05. Seropositivity to Brucella spp. was higher (19.1% in adult buffalo compared with juveniles and sub-adults younger than six years (5.9%. Further, seropositivity was marginally higher (20.4% in animals from wildlife-livestock interface areas than in those from non-interface areas (13.45%; OR = 1.45 although the difference was not statistically significant. The study showed that brucellosis could be more widespread in buffalo and may circulate in this species independently in the absence of contact with cattle, whilst rhinoceros may be considered less susceptible to brucellosis. The role of the wildlife-livestock interface in the epidemiology of brucellosis in wildlife and livestock is probably overstated but needs to be explored further.

Paul Scherrer Institut annual report 1996. Annex II: PSI life sciences and Institute for Medical Radiobiology Newsletter 1996

International Nuclear Information System (INIS)

Kuehne, G.; Gschwend, B.

1997-01-01

This annex to the PSI Annual Report 1996 reports on the progress achieved by the PSI Department II during 1996 in the fields of radiation medicine, radiopharmacy, radiation hygiene, positron emission tomography and medical radiobiology. figs., tab., refs

Chronique de jurisprudence suisse (1996-2004)

DEFF Research Database (Denmark)

Cavaleri, Sylvie Cécile

2005-01-01

The article reviews case law on the Swiss Statute on Private International Law from 1996 to 2004. Sylvie Cavaleri's contribution concerns provisions on insolvency and bankruptcy.......The article reviews case law on the Swiss Statute on Private International Law from 1996 to 2004. Sylvie Cavaleri's contribution concerns provisions on insolvency and bankruptcy....

Water levels in the Yucca Mountain Area, Nevada, 1996

International Nuclear Information System (INIS)

Graves, R.P.

1998-01-01

Water levels were monitored in 24 wells in the Yucca Mountain area, Nevada, during 1996. Twenty-two wells representing 28 depth intervals were monitored periodically, generally on a monthly basis, and 2 wells representing 3 depth intervals were monitored both hourly and periodically. All wells monitor water levels in Tertiary volcanic rocks except one that monitors water levels in paleozoic carbonate rocks. Water levels were measured using either calibrated steel tapes or a pressure sensor. Mean water-level altitudes in the Tertiary volcanic rocks ranged from about 727.86 to about 1,034.58 meters above sea level during 1996. The mean water-level altitude in the well monitoring the Paleozoic carbonate rocks was about 752.57 meters above sea level during 1996. Mean water-level altitudes for 1996 were an average of about 0.06 meter lower than 1995 mean water-level altitudes and 0.03 meter lower than 1985--95 mean water-level altitudes. During 1996, water levels in the Yucca Mountain area could have been affected by long-term pumping at the C-hole complex that began on May 8, 1996. Through December 31, 1996, approximately 196 million liters were pumped from well UE-25 c number-sign 3 at the C-hole complex. Other ground-water pumpage in the Yucca Mountain area includes annual pumpage from water-supply wells UE-25 J-12 and UE-25 J-13 of approximately 163 and 105 million liters, respectively, and pumpage from well USW G-2 for hydraulic testing during February and April 1996 of approximately 6 million liters

UNIDIR and its activities. 1996

International Nuclear Information System (INIS)

1996-04-01

The United Nations Institute for Disarmament Research (UNIDIR) was established by the General Assembly for the purpose of undertaking independent research on disarmament and related problems, particularly international security issues. This paper covers the description of UNIDIR mandate, organization and finance, fellowship program, research program for 1996 and beyond, projects to be conducted in 1996, activities done in 1994/1995, list of the major conferences held, list of publications, UNIDIR voluntary contributors, and the statute of this organization

New protection initiatives announced for coral reefs

Science.gov (United States)

Showstack, Randy

Off the coasts of some of the South Pacific's most idyllic-sounding atolls, Austin Bowden-Kerby has seen first-hand the heavy damage to coral reefs from dynamite and cyanide fishing. For instance, while snorkeling near Chuuk, an island in Micronesia, he has observed craters and rubble beds of coral, which locals have told him date to World War II ordnance.A marine biologist and project scientist for the Coral Gardens Initiative of the Foundation for the Peoples of the South Pacific, Bowden-Kerby has also identified what he says are some public health effects related to destroyed coral reefs and their dying fisheries. These problems include protein and vitamin A deficiency and blindness, all of which may—in some instances—be linked to poor nutrition resulting from lower reef fish consumption by islanders, according to Bowden-Kerby.

Die dialektiek in die waardes van die 1996 Grondwet

Directory of Open Access Journals (Sweden)

J Swanepoel

1998-11-01

Full Text Available In his paper The Dialectics in the Values of the 1996 Constitution Jan Swanepoel discusses various value statements in the 1996 Constitution of the Republic of South Africa and focuses the attention on indications of a lack of coherence as far as these value statements are concerned.He does this against the background of some introductory perspectives on the 1996 Constitution. In this regard he points out that the 1996 Constitution, as successor to the 1993 Constitution with its set of thirty four constitutional principles, can be regarded as a document of political and ideological compromise. He points out that constitutions (and in particular the value statements in Bills of Rights generally tend to be formulated rather broadly in order to promote flexibility and adaptability. He also focuses the attention on the fact that such a dialectic of values point to the variety of interests that has to be harmonized in a modern state, something which is unmistakably the case in South Africa with its heterogeneous society.The 1996 Constitution contains a variety of "value terms". A closer study of these terms does, however, indicate that these terms (value, principle, foundation, and the like are not used in a very systematic or technical fashion.The problems regarding the value statements are, however, not only of a terminological nature. There are also some substantive problems, as becomes clear from a discussion of value terms in the Preamble and in Sections 1 and 7 of the 1996 Constitution. Swanepoel indicates that a tension exists between what can be called the "process" formulation in section 1(a and the "state of affairs" formulation of the values in section 7(1. . While section 1(a speaks of "the achievement of equality" and "the advancement of human rights and freedoms", section 7(1 simply makes mention of "equality" and "freedom". The dialectic between these two formulations is discussed with reference to other relevant sections of the 1996

Kuidas valiti president 1996. aastal? / Rein Toomla

Index Scriptorium Estoniae

Toomla, Rein, 1951-

2002-01-01

Autor leiab 1996. aasta presidendivalimisi analüüsides, et oluliseks tuleb pidada seda, et valimised suudeti põhiseaduses ettenähtud korras läbi viia ning ei pidanud käivituma erakorraliste valimiste mehhanism. Tabelid: 1995. a. Riigikogu valimised; Riigikogu fraktsioonid 1996. a. suvel; Toetus presidendikandidaatidele; Presidendivalimised Riigikogus; Arvatavasti Lennart Meri poolt; Arvatavasti Arnold Rüütli poolt; Presidendivalimised Valimiskogus

Environmental Report 1996

International Nuclear Information System (INIS)

Harrach, R.J.; Gallegos, G.M.; Tate, P.J.

1997-01-01

This summary provides an overview of LLNL's environmental activities in 1996, including radiological and nonradiological surveillance, effluent and compliance monitoring, remediation, assessment of radiological releases and doses, and determination of the impact of LLNL operations on the environment and public health

Diet induced differences in carbon isotope fractionation between sirenians and terrestrial ungulates

Science.gov (United States)

Clementz, M.T.; Koch, P.L.; Beck, C.A.

2007-01-01

Carbon isotope differences (??13C) between bioapatite and diet, collagen and diet, and bioapatite and collagen were calculated for four species of sirenians, Dugong dugon (Mu??ller), Trichechus manatus (Linnaeus), Trichechus inunguis (Natterer), and the extinct Hydrodamalis gigas (Zimmerman). Bone and tooth samples were taken from archived materials collected from populations during the mid eighteenth century (H. gigas), between 1978 and 1984 (T. manatus, T. inunguis), and between 1997 and 1999 (D. dugon). Mean ??13C values were compared with those for terrestrial ungulates, carnivores, and six species of carnivorous marine mammals (cetaceans = 1; pinnipeds = 4; mustelids = 1). Significant differences in mean ??13C values among species for all tissue types were detected that separated species or populations foraging on freshwater plants or attached marine macroalgae (??13C values -4???; ??13Cbioapatite-diet ???11???). Likewise, ??13Cbioapatite-collagen values for freshwater and algal-foraging species (???7???) were greater than those for seagrass-foraging species (???5???). Variation in ??13C values calculated between tissues and between tissues and diet among species may relate to the nutritional composition of a species' diet and the extent and type of microbial fermentation that occurs during digestion of different types of plants. These results highlight the complications that can arise when making dietary interpretations without having first determined species-specific ??13Ctissue-diet values. ?? 2007 Springer-Verlag.

Cogema in 1996: increasing turnover and stable net results

International Nuclear Information System (INIS)

Anon.

1997-01-01

This short article gives some financial informations about the Cogema group for 1996. The net result for 1996 reached 977 millions of French Francs (FF) with respect to 973 for the previous year. The turnover reached 34.427 billions of FF in 1996 and 30.611 in 1995, which represents a 12.5% growth. In the mining sector, the turnover has decreased to 2.853 billions of FF with respect to 3.238 in 1995. In the engineering and industry services sector the turnover of the overall companies, with the exception of Cogema, has considerably progressed (2.199 billions of FF in 1996, 1.738 in 1995). (J.S.)

Petroleum industry 1996; L`industrie petroliere 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-12-31

A survey on petroleum industry activities in France and in the world in 1996 is presented. The different parts and themes of the study are: evolution of the petroleum market (international and French markets, supply and demand, prices, mark-up and taxation in France and in Europe); activities in the petroleum industries (exploration and production, maritime transportation, inland transportation and storage, refining, quality of petroleum products and substitution fuels, oil distribution); environment and safety (refining, distribution and evolution of products, pipeline and maritime transportation, exploration and production); situation of the sector`s companies (oil groups, para-petroleum French industry, scientific and technical research)

Petroleum industry 1996; L`industrie petroliere 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-31

A survey on petroleum industry activities in France and in the world in 1996 is presented. The different parts and themes of the study are: evolution of the petroleum market (international and French markets, supply and demand, prices, mark-up and taxation in France and in Europe); activities in the petroleum industries (exploration and production, maritime transportation, inland transportation and storage, refining, quality of petroleum products and substitution fuels, oil distribution); environment and safety (refining, distribution and evolution of products, pipeline and maritime transportation, exploration and production); situation of the sector`s companies (oil groups, para-petroleum French industry, scientific and technical research)

Energy Balance of the Sao Paulo State -1997. Base year 1996; Balanco energetico do Estado de Sao Paulo - 1997. Ano base 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-07-01

This energy balance of the Santa Catarina State presents the following main topics that can be outstanding: panorama of the energy matrix; supply and demand of energy by source 1983-1996; energy consumption by sector 1983/1996; socio-economic aspects; resources and reserves energy; and balance of the transformation centers 1984/1996.

The Indigenous World, 1996-97 = El Mundo Indigena, 1996-97.

Science.gov (United States)

Erni, Christian, Ed.

This annual publication (published separately in English and Spanish) examines political, legal, social, and educational issues concerning indigenous peoples around the world during 1996-97. Part I highlights news events and ongoing situations in specific countries. In North America, these include threats of proposed oil drilling on sacred sites…

Environmental Report 1996

Energy Technology Data Exchange (ETDEWEB)

Harrach, R.J.

1996-01-01

This summary provides an overview of LLNL`s environmental activities in 1996, including radiological and nonradiological surveillance, effluent and compliance monitoring, remediation, assessment of radiological releases and doses, and determination of the impact of LLNL operations on the environment and public health.

Hydrocarbon Study 1995-1996

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — During September 1995 and May 1996, a total of 100 drop samples were taken in Upper Galveston Bay to assess potential oil spill damage to salt marsh habitats and...

Petroleum supply annual 1996: Volume 1

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-06-01

The Petroleum Supply Annual (PSA) contains information on the supply and disposition of crude oil and petroleum products. The publication reflects data that were collected from the petroleum industry during 1996 through annual and monthly surveys. The PSA is divided into two volumes. This first volume contains three sections: Summary Statistics, Detailed Statistics, and Refinery Capacity; each with final annual data. The summary statistics section show 16 years of data depicting the balance between supply, disposition and ending stocks for various commodities including crude oil, motor gasoline, distillate fuel oil, residual fuel oil, jet fuel propane/propylene, and liquefied petroleum gases. The detailed statistics section provide 1996 detailed statistics on supply and disposition, refinery operations, imports and exports, stocks, and transportation of crude oil and petroleum products. The refinery capacity contain listings of refineries and associated crude oil distillation and downstream capacities by State, as of January 1, 1997, as well as summaries of corporate refinery capacities and refinery storage capacities. In addition, refinery receipts of crude oil by method of transportation for 1996 are provided. Also included are fuels consumed at refineries, and lists of shutdowns, sales, reactivations, and mergers during 1995 and 1996. 16 figs., 59 tabs.

Petroleum supply annual 1996: Volume 1

International Nuclear Information System (INIS)

1997-06-01

The Petroleum Supply Annual (PSA) contains information on the supply and disposition of crude oil and petroleum products. The publication reflects data that were collected from the petroleum industry during 1996 through annual and monthly surveys. The PSA is divided into two volumes. This first volume contains three sections: Summary Statistics, Detailed Statistics, and Refinery Capacity; each with final annual data. The summary statistics section show 16 years of data depicting the balance between supply, disposition and ending stocks for various commodities including crude oil, motor gasoline, distillate fuel oil, residual fuel oil, jet fuel propane/propylene, and liquefied petroleum gases. The detailed statistics section provide 1996 detailed statistics on supply and disposition, refinery operations, imports and exports, stocks, and transportation of crude oil and petroleum products. The refinery capacity contain listings of refineries and associated crude oil distillation and downstream capacities by State, as of January 1, 1997, as well as summaries of corporate refinery capacities and refinery storage capacities. In addition, refinery receipts of crude oil by method of transportation for 1996 are provided. Also included are fuels consumed at refineries, and lists of shutdowns, sales, reactivations, and mergers during 1995 and 1996. 16 figs., 59 tabs

1996 Activity report; Rapport d`activite 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-31

The 1996 activity report of the Direction for Waste Management of the CEA, is presented. Its activities have been developed in the framework of the general CEA cleaning plan, and include the management of wastes generated before 1992 in R and D CEA facilities, the disposal of spent fuels generated by research reactors (Orphee and Siloe) or prototype reactors (EL4 at Brennilis), and the dismantling and cleaning of obsolete facilities such as the plutonium radiochemistry building at Fontenay-aux-Roses and the pilot workshop at Marcoule

Evidence of bovine viral diarrhea virus infection in three species of sympatric wild ungulates in Nevada: life history strategies may maintain endemic infections in wild populations

Directory of Open Access Journals (Sweden)

Peregrine Lee Wolff

2016-03-01

Full Text Available Evidence for bovine viral diarrhea virus (BVDV infection was detected in 2009-10 while investigating a pneumonia die-off in Rocky Mountain bighorn sheep (Ovis canadensis canadensis, and sympatric mountain goats (Oreamnos americanum in adjacent mountain ranges in Elko County, Nevada. Seroprevalence to BVDV-1 was 81% (N=32 in the bighorns and 100% (N=3 in the mountain goats. Serosurveillance from 2011 to 2015 of surviving bighorns and mountain goats as well as sympatric mule deer (Odocoileus hemionus, indicated a prevalence of 72% (N=45, 45% (N=51, and 51% (N=342 respectively. All species had antibody titers to BVDV1 and BVDV2. BVDV1 was isolated in cell culture from three bighorn sheep and a mountain goat kid. BVDV2 was isolated from two mule deer. Six deer (N=96 sampled in 2013 were positive for BVDV by antigen-capture ELISA on ear notch. Wild ungulates and cattle concurrently graze public and private lands in these two mountain ranges, thus providing potential for interspecies viral transmission. Like cattle, mule deer, mountain goats, and bighorn sheep can be infected with BVDV and can develop clinical disease including immunosuppression. Winter migration patterns that increase densities and species interaction during the first and second trimester of gestation may contribute to the long term maintenance of the virus in these wild ungulates. More studies are needed to determine the population level impacts of BVDV infection on these three species.

Ames Laboratory annual site environmental report, calendar year 1996

International Nuclear Information System (INIS)

1998-04-01

This report summarizes the environmental status of Ames Laboratory for calendar year 1996. It includes descriptions of the Laboratory site, its mission, the status of its compliance with applicable environmental regulations, its planning and activities to maintain compliance, and a comprehensive review of its environmental protection, surveillance and monitoring programs. Ames Laboratory is located on the campus of Iowa State University (ISU) and occupies twelve buildings owned by the Department of Energy (DOE). The Laboratory also leases space in ISU owned buildings. Laboratory activities involve less than ten percent of the total chemical use and approximately one percent of the radioisotope use on the ISU campus. In 1996, the Office of Assurance and Assessment merged with the Environment, Safety and Health Group forming the Environment, Safety, Health and Assurance (ESH and A) office. In 1996, the Laboratory accumulated and disposed of wastes under US Environmental Protection Agency (EPA) issued generator numbers. Ames Laboratory submitted a Proposed Site Treatment Plan to EPA in December 1995. This plan complied with the Federal Facilities Compliance Act (FFCA). It was approved by EPA in January 1996. The consent agreement/consent order was issued in February 1996. Pollution awareness, waste minimization and recycling programs, implemented in 1990 and updated in 1994, continued through 1996. Included in these efforts were a waste white paper and green computer paper recycling program. Ames Laboratory also continued to recycle salvageable metal and used oil, and it recovered freon for recycling. All of the chemical and nearly all of the radiological legacy wastes were properly disposed by the end of 1996. Additional radiological legacy waste will be properly disposed during 1997

Accumulation of main radionuclides that participate in exposure dose formation in liver of wild ungulate animals on the territory of the Palesse state radioecological reserve

International Nuclear Information System (INIS)

Korol', R.A.; Nikitin, A.N.

2013-01-01

The dose of internal exposure of liver of wild ungulate animals (deer, elk, boar) mainly determined by Cs 137 at present time. The dose from Cs 137 is decrease in line wild boar - deer - elk and variate from 0.3 to 104.8 mSv/y. Other 'Chernobyl' radionuclides about equally contribute in the dose. The relative role of transuranium elements are increasing and will be equal to Cs 137 after about 250 years. The role of Sr 90 will minor all time. (authors)

Study of a cutaneous leishmaniasis outbreak in General Vedia, Province of Chaco, 1996 Surto de leishmaniose cutânea em General Vedia, Provincia de Chaco, 1996

Directory of Open Access Journals (Sweden)

O. Daniel SALOMON

2001-04-01

Full Text Available Between March and July 1996, a focalized epidemic outbreak of cutaneous leishmaniasis in General Vedia, province of Chaco, associated to the gallery forest of the Oro river was verified. The incidence rate in the area, which was 0-2/000 cases in preceding years, reached 8/000 cases in 1996. The risk of symptomatic infection was similar between sexes, but was different when analizing the different age groups by sex, suggesting a greater relative importance of the peridomestic transmission for the females and of the transmission in the subtropical forest for the males. Specimens of Lutzomyia intermedia, a species already incriminated as a vector of Leishmaniasis in other provinces of northern Argentina, were captured and identified in the focus locality in May 1996. The possible causes of the outbreak related to the climatic variables and the vector abundance are analyzed and the results in the framework of possible preventive and control activities are discussed.Entre março e julho de 1996, foi verificado um surto epidêmico focalizado de leishmaniose cutânea na localidade de Geral Vedia, província de Chaco, associado com a floresta de galeria do rio de Oro. A taxa de incidência na área que era 0-2/000 casos em anos anteriores, alcançou 8/000 casos em 1996. O risco de infecção sintomática era semelhante entre sexos, mas era diferente quando foram analizados os grupos de idade diferentes segundo sexo, sugerindo maior importância relativa da transmissão na área peridoméstica nas mulheres e da transmissão na floresta subtropical nos homens. Espécimes de Lutzomyia intermedia, espécie já incriminada como vetor de Leishmaniose em outras províncias do norte da Argentina, foram capturadas e identificadas na localidade em maio de 1996. São analisadas as possíveis causas do surto relacionadas às variáveis climáticas e a abundância do vetor e os resultados são discutidas na estrutura de possíveis atividades de prevenção e

Annual report: 1996

Energy Technology Data Exchange (ETDEWEB)

Stefanini, Alberto M; Cinausero, M; Pengo, Ruggero [eds.; Istituto Nazionale di Fisica Nucleare, Legnaro, Padova (Italy). Lab. Nazionali di Legnaro

1998-12-31

This paper describes the activities of the Laboratori Nazionali di Legnaro (LNL) of INFN during 1996. The main field of research of the laboratory is experimental nuclear physics with the use of the heavy-ion beams from the XTU Tandem accelerator and from the new ALPI Linac booster.

Annual report: 1996

International Nuclear Information System (INIS)

Stefanini, Alberto M.; Cinausero, M.; Pengo, Ruggero

1997-01-01

This paper describes the activities of the Laboratori Nazionali di Legnaro (LNL) of INFN during 1996. The main field of research of the laboratory is experimental nuclear physics with the use of the heavy-ion beams from the XTU Tandem accelerator and from the new ALPI Linac booster

AGS experiments -- 1995, 1996 and 1997

Energy Technology Data Exchange (ETDEWEB)

Depken, J.C.; Presti, P.L.

1997-12-01

This report contains (1) FY 1995 AGS schedule as run; (2) FY 1996 AGS schedule as run; (3) FY 1997 AGS schedule as run; (4) FY 1998--1999 AGS schedule (proposed); (5) AGS beams 1997; (6) AGS experimental area FY 1995 physics program; (7) AGS experimental area FY 1996 physics program; (8) AGS experimental area FY 1997 physics program; (9) AGS experimental area FY 1998--1999 physics program (proposed); (10) a listing of experiments by number; (11) two-page summaries of each experiment, in order by number; and (12) listing of publications of AGS experiments.

AGS experiments - 1995, 1996 and 1997

International Nuclear Information System (INIS)

Depken, J.C.; Presti, P.L.

1997-12-01

This report contains (1) FY 1995 AGS schedule as run; (2) FY 1996 AGS schedule as run; (3) FY 1997 AGS schedule as run; (4) FY 1998--1999 AGS schedule (proposed); (5) AGS beams 1997; (6) AGS experimental area FY 1995 physics program; (7) AGS experimental area FY 1996 physics program; (8) AGS experimental area FY 1997 physics program; (9) AGS experimental area FY 1998--1999 physics program (proposed); (10) a listing of experiments by number; (11) two-page summaries of each experiment, in order by number; and (12) listing of publications of AGS experiments

Analogue Signal Processing: Collected Papers 1996-97

DEFF Research Database (Denmark)

1997-01-01

This document is a collection of the papers presented at international conferences and in international journals by the analogue signal processing group of the Department of Information Technology, Technical University of Denmark, in 1996 and 1997.......This document is a collection of the papers presented at international conferences and in international journals by the analogue signal processing group of the Department of Information Technology, Technical University of Denmark, in 1996 and 1997....

Trends in overweight and obese adults in Malaysia (1996-2009): a systematic review.

Science.gov (United States)

Khambalia, A Z; Seen, L S

2010-06-01

Like other nations experiencing rapid industrialization, urbanization and a nutrition transition, there is concern in Malaysia of a possible escalation in the prevalence of overweight and obesity. In 1996, the National Health and Morbidity Survey reported a 16.6% and 4.4% prevalence of overweight and obesity, respectively. In the following decade, there have been several national and community surveys on overweight and obesity in Malaysia. The objective of this systematic review is to describe the trend from 1996 to 2009 in the prevalence of overweight and obesity in adults in Malaysia nationally and by gender, age and race. Results indicate that there has been a small rise in overweight adults in the years 1996, 2003 and 2006 (20.7%, 26.7% and 29.1%) and a much more dramatic increase in obesity in 1996, 2003, 2004 and 2006 (5.5%, 12.2%, 12.3% and 14.0%). Evidence showed a greater risk for overweight and obesity among women compared with men. Based on the highest-quality studies, overweight and obesity levels were highest among adults 40-59 years old. Overweight levels were highest among Indians, followed by Malays, Chinese and Aboriginals, with less consistency across studies on the order of risk or obesity by ethnicity.

DETOMIDINE AND BUTORPHANOL FOR STANDING SEDATION IN A RANGE OF ZOO-KEPT UNGULATE SPECIES.

Science.gov (United States)

Bouts, Tim; Dodds, Joanne; Berry, Karla; Arif, Abdi; Taylor, Polly; Routh, Andrew; Gasthuys, Frank

2017-09-01

been demonstrated to be a reliable, safe alternative to general anesthesia for a number of large ungulate species.

Atomic energy in Lithuania: Nuclear safety in 1996; Atomine energetika Lietuvoje: Branduoline sauga 1996 m

Energy Technology Data Exchange (ETDEWEB)

Vaishnys, P; Krenevichius, R; Alejev, A; Demchenko, M [State Nuclear Power Safety Inspectorate (VATESI), Vilnius (Lithuania); and others

1998-12-31

The first annual report of VATESI - Lithuanian Nuclear Safety Authority`s activity is presented and cover description of the main results in 1996. VATESI was established in 1991 recently after regaining of independence when Ignalina NPP come into jurisdiction of Republic of Lithuania. Since the establishment in six year period of operation VATESI developed its activities considerably and now is able to perform the functions of independent regulator of nuclear safety in Lithuania. The main fields of VATESI activities in 1996 were evaluation of the safety of Ignalina NPP, supervision of Ignalina NPP`s operational safety, control of the implementation of safety improvement program SIP-1 in Ignalina NPP, development of new regulatory legislation according to IAEA standards and practices, accountancy and control of nuclear materials, regulation of radioactive waste management. Detailed description of all these activities is provided in the report. In 1996 there were no safety significant events in Ignalina NPP according to the INES scale, only five events received qualification as level 1 events. 2 tabs.,10 figs.

Seasonal egg output of gastro-intestinal parasites in wild ungulates in a mediterranean area (central Italy

Directory of Open Access Journals (Sweden)

Marta Magi

2006-03-01

Full Text Available Abstract Seasonal egg (or oocyst output of gastro-intestinal parasites of wild ungulates was studied in a Mediterranean protected area, the Monti Livornesi Park (Livorno, Tuscany region, Central Italy. Samples of faeces of wild boars (Sus scrofa and mouflons (Ovis ammon were collected monthly for one year. The observed trends of egg output were analysed taking into account seasonal variations of temperature and rainfall, life-cycle and survival strategy of parasites, and health condition of hosts. In our Mediterranean study area, the peaks of egg output appear in different months according to different biology and survival strategies of parasites. Riassunto Emissione stagionale di uova di parassiti gastrointestinali in cinghiali (Sus scrofa e in mufloni (Ovis ammon di un’area mediterranea (Italia centrale. E' stata studiata l'emissione stagionale di uova (o oocisti di parassiti nelle feci di ungulati selvatici in una zona mediterranea protetta, il Parco dei Monti Livornesi (Livorno, Toscana, Italia Centrale. Per un anno sono stati raccolti mensilmente campioni di feci di Cinghiale (Sus scrofa e di Muflone (Ovis ammon. Gli andamenti osservati di emissione di uova sono stati analizzati tenendo conto delle variazioni di temperatura e piovosità stagionali, del ciclo biologico e della strategia di sopravvivenza dei parassiti, e delle condizioni sanitarie dell'ospite. E’ risultato che in una zona mediterranea come quella considerata i picchi di emissione di uova appaiono in mesi differenti in relazione alla biologia e alle strategie di sopravvivenza dei diversi parassiti.

The response of ungulates to rainfall along the riverbeds of the Southern Kalahari

Directory of Open Access Journals (Sweden)

M. G. L Mills

1984-12-01

Full Text Available The responses of springbok Antidorcas marsupialis, gemsbok Oryx gazella, blue wildebeest Connochaetes taurinus and red hartebeest Alcelaphus buselaphus to rainfall along the riverbeds of the southern Kalahari are analysed. Springbok reacted most rapidly to rainfall along the riverbeds and, by browsing in dry times, maintained a fairly stable presence throughout the year, although the actual number present in any one year was dependent on annual rainfall. Gemsbok responded more slowly to rainfall and reached their highest numbers in years of high rainfall when the grasses were tall and mature, after which they rapidly departed from the riverbeds. Red hartebeest also reached their highest numbers during the rainy season, but departed slightly more slowly than gemsbok. In dry years, they too, failed to come into the riverbeds. Blue wildebeest in the vicinity of the riverbeds tended to be more sedentary than the other species. The presence of potable artificial water appeared to be more important for wildebeest than for the other species and, although rainfall was undoubtedly an important factor in regulating their numbers along the riverbeds, they depended to a greater extent on breeding success and mortality factors, than on emigration and immigration. The overall seasonal pattern of ungulate abundance along the riverbeds in the southern Kalahari was one of wet season concentrations and dry season dispersion.

Assessing the potential spread and maintenance of foot-and-mouth disease virus infection in wild ungulates: general principles and application to a specific scenario in Thrace

DEFF Research Database (Denmark)

Dhollander, S.; Belsham, Graham; Lange, M.

2016-01-01

Foot-and-mouth disease (FMD), due to infection with serotype O virus, occurred in wild boar and within eleven outbreaks in domestic livestock in the south-east of Bulgaria, Thrace region, in 2011. Hence, the issue of the potential for the spread and maintenance of FMD virus (FMDV) infection...... in a population of wild ungulates became important. This assessment focused on the spread and maintenance of FMDV infection within a hypothetical wild boar and deer population in an environment, which is characterized by a climate transitional between Mediterranean and continental and variable wildlife population...... densities. The assessment was based on three aspects: (i) a systematic review of the literature focusing on experimental infection studies to identify the parameters describing the duration of FMDV infection in deer and wild boar, as well as observational studies assessing the occurrence of FMDV infection...

Metropolitan Optical Networks 1996 Annual Report

DEFF Research Database (Denmark)

Kristensen, Martin; Jouanno, Jean-Marc; Malone, Kevin

1997-01-01

The report desribes the reasearch carried out in the ACTS-project METON (Metropolitan Optical Networks) in 1996. L.M. Ericsson is prime contractor and 12 partners are involved in the project including DTU, i.e. EMI and MIC.......The report desribes the reasearch carried out in the ACTS-project METON (Metropolitan Optical Networks) in 1996. L.M. Ericsson is prime contractor and 12 partners are involved in the project including DTU, i.e. EMI and MIC....

Energy Balance of the Santa Catarina State - Series 1980 -1996

International Nuclear Information System (INIS)

1997-01-01

This energy balance of the Santa Catarina State presents the following main topics that can be outstanding: economic aspects; supply and demand of energy by source 1980-1996; energy consumption by sector 1980/1996; energy interchange; and balance of the transformation centers 1980/1996

1996 site environmental report, January--December 1996

International Nuclear Information System (INIS)

Cellamare, R.; Dannatt, G.; Dubrow, M.

1997-09-01

This report provides information about environmental programs and compliance with environmental regulations in calendar year 1996 (CY96) at the Stanford Linear Accelerator Center (SLAC). SLAC is a national laboratory operated by Stanford University under contract with the US Department of Energy (DOE) and is devoted to experimental and theoretical research in elementary particle physics in basic sciences using synchrotron radiation, and in accelerator physics and technology. The most significant information in this report is summarized briefly in the following sections: (1) releases; (2) environmental restoration; (3) hazardous and radioactive wastes; (4) air quality; (5) storm water and industrial wastewater; (6) PCB's; (7) assessments; (8) environmental radiological program; (9) groundwater; and (10) additional information

Embryonal and post-embryonal sex correlation of the ungulates and predators in case of radioactive pollution of the organism and habitat

International Nuclear Information System (INIS)

Tyshkevich, V.

2002-01-01

In various publications concerning radioactive pollution there are facts about pollution level of the animal habitat, pollution of their main forage and intensification of species accumulation of radionuclides (The Elk and the Roe deer, Dunin, Voronetsky, Tyshkevitch, 1998). In a number of articles published earlier we proposed an analysis of sex and age group correlation of the ungulates depending on the habitat regime (a reserve, a sanctuary, a game husbandry). Special attention was paid to the influence of the anthropogenic factors and preying (i.e. wolf, lynx, fox) on the model populations. Moreover, there are publications concerning some change of cranio metrical indices of the mammals in the highly polluted areas, including the ungulates in the so- called Tchelyabinsky radioactive region, Russia (Danilkin et. al., 1985) and in Belarus there is an article on the morphological peculiarities of the roe deer (Tyshkevich, 1999). There are no works on the analysis of embryo correlation of the ungulates and predators females living in the areas with different pollution level of the habitat in the Belarus part of species areal. Working on the morphology of mammals (on the organometry, in particular) we paid constant attention to the significant predominance of the male embryos of the animals living in the highly polluted areas. In order to estimate the influence of this factor it has been decided to compare sex correlation of embryos in the populations living in the areas with high (Palesski State Reserve), average (the Statuary of Ostrova Duleby) and low (Nalibokskaya Puscha) habitat pollution level. The proposed model allows to state that 4 out of 5 species being analysed have evident disproportion of the sex correlation at the embryonal stage. For instance, sex correlation of the Elk and the Roe deer , on the whole, is close to 1: 1, but there is strong predominance of male embryos in the highly polluted areas. This regularity can be easily observed in the

Quarterly coal report, October--December 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-05-01

The Quarterly Coal Report (QCR) provides comprehensive information about US coal production, distribution, exports, imports, receipts, prices, consumption, and stocks to a wide audience, including Congress, Federal and State agencies, the coal industry, and the general public. Coke production, consumption, distribution, imports, and exports data are also provided. This report presents detailed quarterly data for October through December 1996 and aggregated quarterly historical data for 1990 through the third quarter of 1996. Appendix A displays, from 1988 on, detailed quarterly historical coal imports data. To provide a complete picture of coal supply and demand in the US, historical information has been integrated in this report. 8 figs., 72 tabs.

RE-SONANCEI March 1996

Indian Academy of Sciences (India)

Maynard Smith says" fifteen years later, when I decided to leave engineering and train as a biologist, I entered. RESONANCE I March 1996. S Thangavelu is with Statistics and Mathematics Unit,. Indian Statistical Institute, R V College Post, Banga- lore 560 059. University College, London, where Haldane was at that time a ...

Savannah River Site environmental report for 1996 summary

International Nuclear Information System (INIS)

Arnett, M.W.

1997-01-01

The Savannah River Site (SRS) publishes an environmental report each year to provide environmental monitoring and surveillance results to the US department of Energy (DOE), the public, Congress, state and federal regulators, universities, local governments, the news media, environmental and civic groups. The Savannah River Site Environmental Report for 1996 (WSRC-TR-97-0171) contains detailed information on site operations, environmental monitoring and surveillance programs, environmental compliance activities, and special projects for the calendar year 1996. The purpose of this document is to give a brief overview of the site and its activities, to summarize the report and the impact of 1996 SRS operations on the environment and the public, and to provide a brief explanation of radiation and dose

An outbreak of meningococcal meningitis in Gauteng, Spring 1996 ...

African Journals Online (AJOL)

Objective. To describe a Neisseri.a meningitidis outbreak in Gauteng during the period 1 July to 31 December 1996. Design. A descriptive study. Setting. Patients with meningococcal meningitis in Gauteng who had been diagnosed by laboratory means, or notified during the period 1 July to 31 December 1996.

Astronautics and Aeronautics: A Chronology, 1996-2000

Science.gov (United States)

Lewis, Marieke; Swanson, Ryan

2009-01-01

This report is a chronological compilation of narrative summaries of news reports and government documents highlighting significant events and developments in United States and foreign aeronautics and astronautics. It covers the years 1996 through 2000. These summaries provide a day-by-day recounting of major activities, such as administrative developments, awards, launches, scientific discoveries, corporate and government research results, and other events in countries with aeronautics and astronautics programs. Researchers used the archives and files housed in the NASA History Division, as well as reports and databases on the NASA Web site.

Waste Tax 1987-1996

DEFF Research Database (Denmark)

Andersen, M. S.; Dengsøe, N.; Brendstrup, S.

The report gives an ex-post evaluation of the Danish waste tax from 1987 to 1996. The evaluation shows that the waste tax has had a significant impact on the reductions in taxable waste. The tax has been decisive for the reduction in construction and demolition waste, while for the heavier...

Progress report 1996 - 1997; Rapport d'activite 1996 - 1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-07-01

This report reviews the activities of the laboratory for the years 1996 and 1997. Laboratory's activities are driven by an important international program on particle physics and astro-particles. 9 topics are presented: 1) physics at LHC: the ATLAS experiment, 2) the search for a new physics at LEP : DELPHI experiment, 3) neutrino oscillations: NOMAD and TONIC experiments, 4) the experiments H1 at HERA, 5) CP breaking: BABAR experiment, 6) DO experiment at the Tevatron, 7) gamma radiation sources: CAT experiment, 8) supernova, and 9) the project of the AUGER observatory.

Radiocesium in reindeer the slaughter-season 1996/97

International Nuclear Information System (INIS)

Aahman, B.

1997-10-01

During the slaughter season 1996/1997 (1 July 1996 to 30 June 1997), 731 reindeer in Sweden (1.2% of the total number of slaughtered reindeer) were condemned because of too high levels of radiocaesium (over 1 500 Bq 137 Cs per kg fresh meat). This was less than during the previous year, 1995/1996 (when 2% were condemned) and a large improvement compared to earlier years (before 1994). The main reason was that a large part of the slaughtered animals had been slaughtered early in the autumn - when radiocaesium levels are lower than in winter- (8952 reindeer) or that they had been fed uncontaminated feed during some period before slaughter (about 9 900 reindeer). The decreasing number of condemned reindeer is also an effect of generally declining radiocaesium levels in reindeer. The average decline in freely grazing reindeer corresponds to an effective ecological half-life at 3.4 years for the period 1986/87 to 1991/92 and a corresponding half-life 5.6 years for the following 5 years (until 1996/97). The predictions for 1996/97 and the official regulations for control of radiocaesium in reindeer meat were well in accordance with the measured levels of radiocaesium in the slaughtered reindeer. Totally about 22 000 reindeer carcasses were monitored for 137 Cs. The main part of the meat control was made by direct monitoring of gamma radiation from reindeer carcasses at the slaughter house. In this way, the number of muscle samples that were monitored for radiocaesium was kept at a low level (4 198 samples)

La agricultura colombiana en 1996 (comportamiento de sus principales variables The Agriculture in Colombia during 1996

Directory of Open Access Journals (Sweden)

Vásquez Ordoñez Rafael

1997-12-01

Full Text Available El presente artículo describe y analiza el comportamiento del sector agrícola del país durante 1996. Para ello, hemos estudiado la evolución de cada una de las variables más importantes del sector, tales como el crecimiento del Producto Bruto Agrícola, el crédíto, los precios, las importaciones y exportaciones, la estructura de tenencia de la tierra, las inversiones y el desempeño de los productos agrícolas más significativos.This article deals with the agriculture in Colombia during 1996. Founded on some indicators such as growth of the production, land reform, credits, prizes, balance of payment, etc. It gathers information and analyses the mains economics and management techniques carried out by Agriculture Ministery, to garantee an appropriate administration of the agricultural sector in Colombia. It has also been consideret the suitable actions to solve the mains problems of the agricultural sector. Finally, some results obtained to december 1996 are presented.

Semi-automated camera trap image processing for the detection of ungulate fence crossing events.

Science.gov (United States)

Janzen, Michael; Visser, Kaitlyn; Visscher, Darcy; MacLeod, Ian; Vujnovic, Dragomir; Vujnovic, Ksenija

2017-09-27

Remote cameras are an increasingly important tool for ecological research. While remote camera traps collect field data with minimal human attention, the images they collect require post-processing and characterization before it can be ecologically and statistically analyzed, requiring the input of substantial time and money from researchers. The need for post-processing is due, in part, to a high incidence of non-target images. We developed a stand-alone semi-automated computer program to aid in image processing, categorization, and data reduction by employing background subtraction and histogram rules. Unlike previous work that uses video as input, our program uses still camera trap images. The program was developed for an ungulate fence crossing project and tested against an image dataset which had been previously processed by a human operator. Our program placed images into categories representing the confidence of a particular sequence of images containing a fence crossing event. This resulted in a reduction of 54.8% of images that required further human operator characterization while retaining 72.6% of the known fence crossing events. This program can provide researchers using remote camera data the ability to reduce the time and cost required for image post-processing and characterization. Further, we discuss how this procedure might be generalized to situations not specifically related to animal use of linear features.

Recovering aspen follow changing elk dynamics in Yellowstone: evidence of a trophic cascade?

Science.gov (United States)

Painter, Luke E; Beschta, Robert L; Larsen, Eric J; Ripple, William J

2015-01-01

To investigate the extent and causes of recent quaking aspen (Populus tremuloides) recruitment in northern Yellowstone National Park, we measured browsing intensity and height of young aspen in 87 randomly selected aspen stands in 2012, and compared our results to similar data collected in 1997-1998. We also examined the relationship between aspen recovery and the distribution of Rocky Mountain elk (Cervus elaphus) and bison (Bison bison) on the Yellowstone northern ungulate winter range, using ungulate fecal pile densities and annual elk count data. In 1998, 90% of young aspen were browsed and none were taller-than 200 cm, the height at which aspen begin to escape from elk browsing. In 2012, only 37% in the east and 63% in the west portions of the winter range were browsed, and 65% of stands in the east had young aspen taller than 200 cm. Heights of young aspen were inversely related to browsing intensity, with the least browsing and greatest heights in the eastern portion of the range, corresponding with recent changes in elk density and distribution. In contrast with historical elk distribution (1930s-1990s), the greatest densities of elk recently (2006-2012) have been north of the park boundary (approximately 5 elk/km2), and in the western part of the range (2-4 elk/km2), with relatively few elk in the eastern portion of the range (wolves (Canis lupius) in 1995-1996 played a role in these changing elk population dynamics, interacting with other influences including increased predation by bears (Ursus spp.), competition with an expanding bison population, and shifting patterns of human land use and hunting outside the park. The resulting new aspen recruitment is evidence of a landscape-scale trophic cascade in which a resurgent large carnivore community, combined with other ecological changes, has benefited aspen through effects on ungulate prey.

1996 annual report; Rapport annuel 1996

Energy Technology Data Exchange (ETDEWEB)

Scheller, M [CEO, 75 - Paris (France)

1997-12-31

The 1996 annual report of the French national office of aerospace studies and researches (ONERA) presents the missions, organization, financial and operating highlights, sites and workforce, research activity, facilities, international relations and human resources of this company. ONERA`s research goals are the following: spanning the spectrum of civil and military aircraft requirements, feeding the booming civil aviation market, the development of tomorrow`s supersonic transport, the French-German cooperation on future helicopters design, design of aircraft and missile navigation instruments, applied research and simulation on turbo-machineries, development support for Ariane rocket and reentry vehicles, earth and space observation, ground and airborne radars, tactical and strategic missiles, hypersonic propulsion, development of new materials and enhanced numerical simulation. (J.S.)

1996 annual report; Rapport annuel 1996

Energy Technology Data Exchange (ETDEWEB)

Scheller, M. [CEO, 75 - Paris (France)

1996-12-31

The 1996 annual report of the French national office of aerospace studies and researches (ONERA) presents the missions, organization, financial and operating highlights, sites and workforce, research activity, facilities, international relations and human resources of this company. ONERA`s research goals are the following: spanning the spectrum of civil and military aircraft requirements, feeding the booming civil aviation market, the development of tomorrow`s supersonic transport, the French-German cooperation on future helicopters design, design of aircraft and missile navigation instruments, applied research and simulation on turbo-machineries, development support for Ariane rocket and reentry vehicles, earth and space observation, ground and airborne radars, tactical and strategic missiles, hypersonic propulsion, development of new materials and enhanced numerical simulation. (J.S.)

Holography Does Not Account for Goodness: A Critique of van der Helm and Leeuwenberg (1996)

Science.gov (United States)

Olivers, Christian N. L.; Chater, Nick; Watson, Derrick G.

2004-01-01

P. A. van der Helm and E. L. J. Leeuwenberg (1996; see record 1996-01780-002) outlined a holographic account of figural goodness of a perceptual stimulus. The theory is mathematically precise and can be applied to a broad spectrum of empirical data. The authors argue, however, that the account is inadequate on both theoretical and empirical…

Lifelong Literacies. Papers from the 1996 Conference (Manchester, England, United Kingdom, May 1996).

Science.gov (United States)

Fitzpatrick, Stella, Ed.; Mace, Jane, Ed.

This collection of 17 papers, presented at a conference in May 1996, documents some of the current thinking about adult literacy education in Great Britain. The first of the three sections of the papers, "Some Context," contains two analyses of the political and economic realities within which potential participants in adult literacy and…

Spatial distribution and risk factors of Brucellosis in Iberian wild ungulates

Directory of Open Access Journals (Sweden)

de la Fuente José

2010-03-01

Full Text Available Abstract Background The role of wildlife as a brucellosis reservoir for humans and domestic livestock remains to be properly established. The aim of this work was to determine the aetiology, apparent prevalence, spatial distribution and risk factors for brucellosis transmission in several Iberian wild ungulates. Methods A multi-species indirect immunosorbent assay (iELISA using Brucella S-LPS antigen was developed. In several regions having brucellosis in livestock, individual serum samples were taken between 1999 and 2009 from 2,579 wild bovids, 6,448 wild cervids and4,454 Eurasian wild boar (Sus scrofa, and tested to assess brucellosis apparent prevalence. Strains isolated from wild boar were characterized to identify the presence of markers shared with the strains isolated from domestic pigs. Results Mean apparent prevalence below 0.5% was identified in chamois (Rupicapra pyrenaica, Iberian wild goat (Capra pyrenaica, and red deer (Cervus elaphus. Roe deer (Capreolus capreolus, fallow deer (Dama dama, mouflon (Ovis aries and Barbary sheep (Ammotragus lervia tested were seronegative. Only one red deer and one Iberian wild goat resulted positive in culture, isolating B. abortus biovar 1 and B. melitensis biovar 1, respectively. Apparent prevalence in wild boar ranged from 25% to 46% in the different regions studied, with the highest figures detected in South-Central Spain. The probability of wild boar being positive in the iELISA was also affected by age, age-by-sex interaction, sampling month, and the density of outdoor domestic pigs. A total of 104 bacterial isolates were obtained from wild boar, being all identified as B. suis biovar 2. DNA polymorphisms were similar to those found in domestic pigs. Conclusions In conclusion, brucellosis in wild boar is widespread in the Iberian Peninsula, thus representing an important threat for domestic pigs. By contrast, wild ruminants were not identified as a significant brucellosis reservoir for

STAR: Visualization and infrastructure software. Progress report, 1996

International Nuclear Information System (INIS)

Moore, C.F.

1996-11-01

One of the two primary experiments approved for day-one operation at the Relativistic Heavy Ion Collider (RHIC) is the Solenoidal Tracker at RHIC (STAR). This report summarizes the work carried out by personnel from the University of Texas at Austin on the STAR experiment at RHIC during the calendar year 1995--1996. Topics covered are: (1) STAR visualization; (2) DFM, the Data File Manager; (3) LEV: Logging of Environment and Version Information; (4) TBR: the Table Browser; (5) STIC (Star Idl Compiler); (6) CDS (Code Style checker); (7) TOP (Table Operators); (8) Publications 1995--1996; (i) Abstracts of conference or symposium proceedings and reports 1995--1996; and (10) Personnel

STAR: Visualization and infrastructure software. Progress report, 1996

Energy Technology Data Exchange (ETDEWEB)

Moore, C.F.

1996-11-01

One of the two primary experiments approved for day-one operation at the Relativistic Heavy Ion Collider (RHIC) is the Solenoidal Tracker at RHIC (STAR). This report summarizes the work carried out by personnel from the University of Texas at Austin on the STAR experiment at RHIC during the calendar year 1995--1996. Topics covered are: (1) STAR visualization; (2) DFM, the Data File Manager; (3) LEV: Logging of Environment and Version Information; (4) TBR: the Table Browser; (5) STIC (Star Idl Compiler); (6) CDS (Code Style checker); (7) TOP (Table Operators); (8) Publications 1995--1996; (i) Abstracts of conference or symposium proceedings and reports 1995--1996; and (10) Personnel.

RCA annual report 1996. Draft

International Nuclear Information System (INIS)

1997-02-01

In accordance with Article VII.4 of the Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology 1987 and extended in 1992, a draft report of activities for the calendar year 1996 is submitted

Giving USA 1997: The Annual Report on Philanthropy for the Year 1996.

Science.gov (United States)

Kaplan, Ann E., Ed.

This report presents a comprehensive review of private philanthropy in the United States during 1996. After a preliminary section, the first section presents data on giving, using text, graphs, and charts. Sections cover: overall 1996 contributions; changes in giving by source and use; total giving (1966-1996); inflation-adjusted giving in 5-year…

1996 NRC annual report. Volume 13

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-10-01

This 22nd annual report of the US Nuclear Regulatory Commission (NRC) describes accomplishments, activities, and plans made during Fiscal Year 1996 (FH 1996)--October 1, 1995, through September 30, 1996. Significant activities that occurred early in FY 1997 are also described, particularly changes in the Commission and organization of the NRC. The mission of the NRC is to ensure that civilian uses of nuclear materials in the US are carried out with adequate protection of public health and safety, the environment, and national security. These uses include the operation of nuclear power plants and fuel cycle plants and medical, industrial, and research applications. Additionally, the NRC contributes to combating the proliferation of nuclear weapons material worldwide. The NRC licenses and regulates commercial nuclear reactor operations and research reactors and other activities involving the possession and use of nuclear materials and wastes. It also protects nuclear materials used in operation and facilities from theft or sabotage. To accomplish its statutorily mandated regulatory mission, the NRC issues rules and standards, inspects facilities and operations, and issues any required enforcement actions.

1996 NRC annual report. Volume 13

International Nuclear Information System (INIS)

1997-01-01

This 22nd annual report of the US Nuclear Regulatory Commission (NRC) describes accomplishments, activities, and plans made during Fiscal Year 1996 (FH 1996)--October 1, 1995, through September 30, 1996. Significant activities that occurred early in FY 1997 are also described, particularly changes in the Commission and organization of the NRC. The mission of the NRC is to ensure that civilian uses of nuclear materials in the US are carried out with adequate protection of public health and safety, the environment, and national security. These uses include the operation of nuclear power plants and fuel cycle plants and medical, industrial, and research applications. Additionally, the NRC contributes to combating the proliferation of nuclear weapons material worldwide. The NRC licenses and regulates commercial nuclear reactor operations and research reactors and other activities involving the possession and use of nuclear materials and wastes. It also protects nuclear materials used in operation and facilities from theft or sabotage. To accomplish its statutorily mandated regulatory mission, the NRC issues rules and standards, inspects facilities and operations, and issues any required enforcement actions

1996 Progress report on energies and raw materials; 1996 rapport d`activite energies et matieres premieres

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-31

The 1996 annual progress report, from the French Department of Energy, reviews the key points of the French policy for energy and raw materials: competitiveness, environmental protection, long term supply safety, and public service. 1996 was marked by positive results for the French energy industry, difficulties for the oil refining industry, and a new impetus for renewable energies. Five surveys are presented: nuclear safety in Eastern Europe, the european directive on electric power domestic market, evolution of the oil market, conditions of refining in France, and restructuring of the Mine bureau (BRGM). 40 prominent facts are briefly reviewed, concerning sustainable energy development, nuclear energy, electric power and gas, coal, oil products, raw materials. Diagrams on energy and raw materials are also included

1996 Progress report on energies and raw materials; 1996 rapport d`activite energies et matieres premieres

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-12-31

The 1996 annual progress report, from the French Department of Energy, reviews the key points of the French policy for energy and raw materials: competitiveness, environmental protection, long term supply safety, and public service. 1996 was marked by positive results for the French energy industry, difficulties for the oil refining industry, and a new impetus for renewable energies. Five surveys are presented: nuclear safety in Eastern Europe, the european directive on electric power domestic market, evolution of the oil market, conditions of refining in France, and restructuring of the Mine bureau (BRGM). 40 prominent facts are briefly reviewed, concerning sustainable energy development, nuclear energy, electric power and gas, coal, oil products, raw materials. Diagrams on energy and raw materials are also included

How does a carnivore guild utilise a substantial but unpredictable anthropogenic food source? Scavenging on hunter-shot ungulate carcasses by wild dogs/dingoes, red foxes and feral cats in south-eastern Australia revealed by camera traps.

Science.gov (United States)

Forsyth, David M; Woodford, Luke; Moloney, Paul D; Hampton, Jordan O; Woolnough, Andrew P; Tucker, Mark

2014-01-01

There is much interest in understanding how anthropogenic food resources subsidise carnivore populations. Carcasses of hunter-shot ungulates are a potentially substantial food source for mammalian carnivores. The sambar deer (Rusa unicolor) is a large (≥ 150 kg) exotic ungulate that can be hunted throughout the year in south-eastern Australia, and hunters are not required to remove or bury carcasses. We investigated how wild dogs/dingoes and their hybrids (Canis lupus familiaris/dingo), red foxes (Vulpes vulpes) and feral cats (Felis catus) utilised sambar deer carcasses during the peak hunting seasons (i.e. winter and spring). We placed carcasses at 1-km intervals along each of six transects that extended 4-km into forest from farm boundaries. Visits to carcasses were monitored using camera traps, and the rate of change in edible biomass estimated at ∼ 14-day intervals. Wild dogs and foxes fed on 70% and 60% of 30 carcasses, respectively, but feral cats seldom (10%) fed on carcasses. Spatial and temporal patterns of visits to carcasses were consistent with the hypothesis that foxes avoid wild dogs. Wild dog activity peaked at carcasses 2 and 3 km from farms, a likely legacy of wild dog control, whereas fox activity peaked at carcasses 0 and 4 km from farms. Wild dog activity peaked at dawn and dusk, whereas nearly all fox activity occurred after dusk and before dawn. Neither wild dogs nor foxes remained at carcasses for long periods and the amount of feeding activity by either species was a less important predictor of the loss of edible biomass than season. Reasons for the low impacts of wild dogs and foxes on sambar deer carcass biomass include the spatially and temporally unpredictable distribution of carcasses in the landscape, the rapid rate of edible biomass decomposition in warm periods, low wild dog densities and the availability of alternative food resources.

Longitudinal trends of HIV drug resistance in a large Canadian cohort, 1996-2016.

Science.gov (United States)

Rocheleau, G; Brumme, C J; Shoveller, J; Lima, V D; Harrigan, P R

2018-02-01

We aim to identify long-term trends in HIV drug resistance before and after combined antiretroviral therapy (cART) initiation. IAS-USA (2015) mutations were identified in 23 271 HIV protease-reverse transcriptase sequences from 6543 treatment naïve adults in British Columbia. Participants who started cART between 1996 and 2014 were followed until April 2016. Equality of proportions test was used to compare the percentage of participants with acquired drug resistance (ADR) or transmitted drug resistance (TDR) in 1996, to those in 2014. Kaplan-Meier was used to estimate time to ADR in four drug resistance categories. Multivariable regression odds ratios (OR) of ADR for select clinical variables were determined by 5-year eras of cART initiation. The proportion of individuals with ADR declined from 39% (51/132) to 3% (8/322) in 1996-2014 (p 16 years of therapy. After 5 years on therapy, participants initiating cART in 1996-2000 had 5.5-times more 3TC/FTC ADR, 5.3-times more other nRTI ADR, 4.7-times more NNRTI ADR, and 24-times more PI ADR than those starting in 2011-2014. The individuals with highest odds of developing ADR in 1996-2010 were adherent to regimens at levels between 60% and 80%, which shifted to 40% adherent in 2011-2014. HIV drug resistance transitioned from being primarily selected de-novo to being driven by TDR. Among those who started treatment in the past 5 years, ADR is rare and observed mostly in the lowest adherence strata. Copyright © 2017 European Society of Clinical Microbiology and Infectious Diseases. Published by Elsevier Ltd. All rights reserved.

Hazards Control Department 1996 Annual Report

Energy Technology Data Exchange (ETDEWEB)

Richards, J.

1997-06-30

This annual report on the activities of the Hazards Control Department (HCD) in 1996 is part of the department's continuing effort to foster a working environment at Lawrence Livermore National Laboratory where every person has the means, ability, and desire to work safely. The significant accomplishments and activities, the various services provided, and research into Environment, Safety, and Health (ES&H) issues by HCD would not have been possible without the many and ongoing contributions by its employees and support personnel. The HCD Leadership Team thanks each and every one in the department for their efforts and work in 1996 and for their personal commitment to keeping one of the premier research and scientific institutions in the world today a safe and healthy place.

Predicting the future impact of droughts on ungulate populations in arid and semi-arid environments.

Directory of Open Access Journals (Sweden)

Clare Duncan

Full Text Available Droughts can have a severe impact on the dynamics of animal populations, particularly in semi-arid and arid environments where herbivore populations are strongly limited by resource availability. Increased drought intensity under projected climate change scenarios can be expected to reduce the viability of such populations, yet this impact has seldom been quantified. In this study, we aim to fill this gap and assess how the predicted worsening of droughts over the 21(st century is likely to impact the population dynamics of twelve ungulate species occurring in arid and semi-arid habitats. Our results provide support to the hypotheses that more sedentary, grazing and mixed feeding species will be put at high risk from future increases in drought intensity, suggesting that management intervention under these conditions should be targeted towards species possessing these traits. Predictive population models for all sedentary, grazing or mixed feeding species in our study show that their probability of extinction dramatically increases under future emissions scenarios, and that this extinction risk is greater for smaller populations than larger ones. Our study highlights the importance of quantifying the current and future impacts of increasing extreme natural events on populations and species in order to improve our ability to mitigate predicted biodiversity loss under climate change.

Progress report 1996 - 1997; Rapport d'activite 1996 - 1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-07-01

This report reviews the activities of the laboratory for the years 1996 and 1997. Laboratory's activities are driven by an important international program on particle physics and astro-particles. 9 topics are presented: 1) physics at LHC: the ATLAS experiment, 2) the search for a new physics at LEP : DELPHI experiment, 3) neutrino oscillations: NOMAD and TONIC experiments, 4) the experiments H1 at HERA, 5) CP breaking: BABAR experiment, 6) DO experiment at the Tevatron, 7) gamma radiation sources: CAT experiment, 8) supernova, and 9) the project of the AUGER observatory.

Toward a History of Student Affairs: A Synthesis of Research, 1996-2015

Science.gov (United States)

Hevel, Michael S.

2016-01-01

This article offers a synthesis of over 40 journal articles, book chapters, and books related to the history of student affairs published since 1996. Within this literature, scholars have explored the roles and responsibilities of early student affairs administrators ("positions and practice"), demonstrated efforts to establish a…

1996 technical progress report

International Nuclear Information System (INIS)

1997-01-01

Summaries of the researches are grouped into programs as follows: research and development in food and agriculture; research and development in health, environment and industry which includes all the PNRI research projects in 1996; scientific and technological services; and the nuclear regulations, licensing and safeguards of the institute

Swiss electricity statistics 1996

International Nuclear Information System (INIS)

1997-01-01

This detailed article discusses the following subjects: Survey of electricity supply in Switzerland in 1996; The Swiss electricity balance; Electric power generation; Electric power consumption; Generation, consumption and loads on selected days; Energy trade with other countries; Expansion capacities until 2003; Financial situation and appendix. (orig./RHM) [de

1996 technical progress report

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-12-31

Summaries of the researches are grouped into programs as follows: research and development in food and agriculture; research and development in health, environment and industry which includes all the PNRI research projects in 1996; scientific and technological services; and the nuclear regulations, licensing and safeguards of the institute.

Birth Trends among Female Physicians in Taiwan: A Nationwide Survey from 1996 to 2013

Science.gov (United States)

Wang, Yi-Jen; Chiang, Shu-Chiung; Chen, Tzeng-Ji; Chou, Li-Fang; Hwang, Shinn-Jang; Liu, Jui-Yao

2017-01-01

Background: Although more and more women are becoming physicians, their decisions regarding pregnancy may be affected by the lengthy period of medical education and postgraduate training. The aim of this study was to explore the birth trends among female physicians in Taiwan; Methods: Retrospective analyses of maternal ages at delivery from 1996 to 2013, both for physicians and the general population, were conducted using a nationwide dataset called National Health Insurance Research Database; Results: During the study period, 8540 female physicians were identified. The physicians delivered a total of 4940 births in that time, with a rise from 210 in 1996 to 440 in 2013. In addition, the mean maternal age of the physicians at delivery increased from 32.19 years (standard deviations (SD) 2.80) in 1996 to 33.61 (SD 3.21) in 2013, values significantly higher than those for non-physicians of 27.81 (SD 4.74) in 1996 (p < 0.001) and 31.36 (SD 4.78) in 2013 (p < 0.001); Conclusion: Female physicians usually gave birth at an older age than non-physicians, but the discrepancy between the two groups gradually declined over the 18-year course of the study. The establishment of a maternity-friendly environment for female physicians should be considered by those who determine healthcare system policies. PMID:28698490

Impact of wild ungulates on coppices from the Bisenzio Valley (province of Prato, Italy

Directory of Open Access Journals (Sweden)

Bianchi L

2014-06-01

Full Text Available Similar to other Apennine areas, a considerable increase of wild ungulate density has been observed in the past decades in the Bisenzio valley (province of Prato, leading to a strong impact on coppice regeneration. In some felling areas, the prolonged browsing on young suckers turned the stumps into low and dense bushes, thus threatening the survival of the forest stand and triggering a loss of environmental stability. The aim of this work was to study the impact of deer on sprout regeneration after cutting in mixed coppices felled in the period 2007-2010 and characterized by the dominance of chestnut, hornbeam, Turkey oak, and beech. Some 36 plots were established in four municipal districts of the Prato province (Cantagallo, Vernio, Montemurlo, Vaiano. Damage and browsing intensity on each stump were evaluated using an index that allowed the comparison among different areas and fores stand types. Regardless of the species, over 90% of the sprouts revealed a very strong damage, whereas only 6% did not exhibit any damage. A significant difference in the sprout height was detected between browsed and non-browsed areas. Despite a high incidence of damage in all the studied areas, chestnut showed a greater resilience against browsing. In summary, overgrazing by wild game may determine severe contraints to the evolutionary dynamics of forest stands, frustrating the effects of silvicultural practices. The possible benefits of the implementation of a large-scale integrated wildlife plan, including hunting and forest-evironmental management are discussed.

Energy Balance of the Sao Paulo State -1997. Base year 1996

International Nuclear Information System (INIS)

1997-01-01

This energy balance of the Santa Catarina State presents the following main topics that can be outstanding: panorama of the energy matrix; supply and demand of energy by source 1983-1996; energy consumption by sector 1983/1996; socio-economic aspects; resources and reserves energy; and balance of the transformation centers 1984/1996

1996 Annual report; 1996 Informe anual

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-12-31

This annual report present information of the main activities on the scope of the radiation protection and nuclear safety of the Nuclear Regulatory Authority (ARN) of the Argentina during 1996. The activities are developed in 10 chapters and 2 appendices, were are described the activities and the bases of the Argentine Regulatory System. The followings chapters and appendices are: 1.-Evolution of the nuclear regulatory activities in the Argentina since the beginnings in the CNEA. 2.-Regulatory system, laws and regulations. 3.-Institutional relations with national and international organizations. 4. and 5.-Safeguards and inspections of the nuclear installations. 6.-Radiation control of the occupational and public doses. 7.-Radiological emergencies. 8.-Projects and tasks scientific-technological. 9.-Training courses and meetings. 10.-Economic and human recourses. Appendix I.-Regulatory documentation. Appendix II.- Inspections of nuclear installations.

Cytogenetic dose-response and adaptive response in cells of ungulate species exposed to ionizing radiation

International Nuclear Information System (INIS)

Ulsh, B.A.; Miller, S.M.; Mallory, F.F.; Mitchel, R.E.J.; Morrison, D.P.; Boreham, D.R.

2004-01-01

In the studies reported here, the micronucleus assay, a common cytogenetic technique, was used to examine the dose-responses in fibroblasts from three ungulate species (white-tailed deer, woodland caribou, and Indian muntjac) exposed to high doses of ionizing radiation (1-4 Gy of 60 Co gamma radiation). This assay was also used to examine the effects of exposure to low doses (1-100 mGy) typical of what these species experience in a year from natural and anthropogenic environmental sources. An adaptive response, defined as the induction of resistance to a stressor by a prior exposure to a small 'adapting' stress, was observed after exposure to low doses. This work indicates that very small doses are protective for the endpoint examined. The same level of protection was seen at all adapting doses, including 1 radiation track per cell, the lowest possible cellular dose. These results are consistent with other studies in a wide variety of organisms that demonstrate a protective effect of low doses at both cellular and whole-organism levels. This implies that environmental regulations predicated on the idea that even the smallest dose of radiation carries a quantifiable risk of direct adverse consequences to the exposed organism require further examination. Cytogenetic assays provide affordable and feasible biological effects-based alternatives that are more biologically relevant than traditional contaminant concentration-based radioecological risk assessment

Human genome program report. Part 2, 1996 research abstracts

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-11-01

This report contains Part 2 of a two-part report to reflect research and progress in the US Department of Energy Human Genome Program from 1994 through 1996, with specified updates made just before publication. Part 2 consists of 1996 research abstracts. Attention is focused on the following: sequencing; mapping; informatics; ethical, legal, and social issues; infrastructure; and small business innovation research.

Enforcement actions: Significant actions resolved individual actions. Semiannual progress report, January 1996--June 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-08-01

This document summarizes significant enforcement actions that have been resolved during the period of January-June 1996. The report includes copies of Orders and Notices of Violations sent by the Nuclear Regulatory Commission to individuals with respect to the enforcement actions.

Enforcement actions: Significant actions resolved individual actions. Semiannual progress report, January 1996--June 1996

International Nuclear Information System (INIS)

1996-08-01

This document summarizes significant enforcement actions that have been resolved during the period of January-June 1996. The report includes copies of Orders and Notices of Violations sent by the Nuclear Regulatory Commission to individuals with respect to the enforcement actions

Houston prefreshman enrichment program (Houston PREP). Final report, June 10, 1996--August 1, 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-10-01

The 1996 Houston Pre-freshman Enrichment Program (PREP) was conducted on the campus of the University of Houston-Downtown from June 10 to August 1, 1996. Program Participants were recruited from the Greater Houston area. All participants were identified as high achieving students with an interest in learning about the engineering and science professions. The goal of the program was to better prepare our pre-college youth prior to entering college as mathematics, science and engineering majors. The program participants were middle school and high school students from the Aldine, Alief, Channel View, Crockett, Cypress-Fairbanks, Fort Bend, Galena Park, Houston, Humble, Katy, Klein, North Forest, Pasadena, Private, and Spring Branch Independent School Districts. Of the 197 students starting the program, 170 completed, 142 students were from economically and socially disadvantage groups underrepresented in the engineering and science professions, and 121 of the 197 were female. Our First Year group for 1996 composed of 96% minority and women students. Our Second and Third Year students were 100% and 93.75% minority or women respectively. This gave an overall minority and female population of 93.75%. This year, special efforts were again made to recruit students from minority groups, which caused a significant increase in qualified applicants. However, due to space limitations, 140 applicants were rejected. Investigative and discovery learning were key elements of PREP. The academic components of the program included Algebraic Structures, Engineering, Introduction to Computer Science, Introduction to Physics, Logic and Its Application to Mathematics, Probability and Statistics, Problem Solving Seminar using computers and PLATO software, SAT Preparatory Seminars, and Technical Writing.

DOE occupational radiation exposure 1996 report

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-12-31

The goal of the US Department of Energy (DOE) is to conduct its radiological operations to ensure the health and safety of all DOE employees including contractors and subcontractors. The DOE strives to maintain radiation exposures to its workers below administrative control levels and DOE limits and to further reduce these exposures and releases to levels that are ``As Low As Reasonably Achievable`` (ALARA). The DOE Occupational Radiation Exposure Report, 1996 provides summary and analysis of the occupational radiation exposure received by individuals associated with DOE activities. The DOE mission includes stewardship of the nuclear weapons stockpile and the associated facilities, environmental restoration of DOE and precursor agency sites, and energy research. Collective exposure at DOE has declined by 80% over the past decade due to a cessation in opportunities for exposure during the transition in DOE mission from weapons production to cleanup, deactivation and decommissioning, and changes in reporting requirements and dose calculation methodology. In 1996, the collective dose decreased by 10% from the 1995 value due to decreased doses at five of the seven highest-dose DOE sites. For 1996, these sites attributed the reduction in collective dose to the completion of several decontamination and decommissioning projects, reduced spent fuel storage activities, and effective ALARA practices. This report is intended to be a valuable tool for managers in their management of radiological safety programs and commitment of resources.

DOE occupational radiation exposure 1996 report

International Nuclear Information System (INIS)

1996-01-01

The goal of the US Department of Energy (DOE) is to conduct its radiological operations to ensure the health and safety of all DOE employees including contractors and subcontractors. The DOE strives to maintain radiation exposures to its workers below administrative control levels and DOE limits and to further reduce these exposures and releases to levels that are ''As Low As Reasonably Achievable'' (ALARA). The DOE Occupational Radiation Exposure Report, 1996 provides summary and analysis of the occupational radiation exposure received by individuals associated with DOE activities. The DOE mission includes stewardship of the nuclear weapons stockpile and the associated facilities, environmental restoration of DOE and precursor agency sites, and energy research. Collective exposure at DOE has declined by 80% over the past decade due to a cessation in opportunities for exposure during the transition in DOE mission from weapons production to cleanup, deactivation and decommissioning, and changes in reporting requirements and dose calculation methodology. In 1996, the collective dose decreased by 10% from the 1995 value due to decreased doses at five of the seven highest-dose DOE sites. For 1996, these sites attributed the reduction in collective dose to the completion of several decontamination and decommissioning projects, reduced spent fuel storage activities, and effective ALARA practices. This report is intended to be a valuable tool for managers in their management of radiological safety programs and commitment of resources

75 FR 80037 - Poultry Programs; Notice of Request for an Extension and Revision of a Currently Approved...

Science.gov (United States)

2010-12-21

... DEPARTMENT OF AGRICULTURE Agricultural Marketing Service [Doc. No. AMS-PY-10-0098] Poultry... David Bowden, Jr., Chief, Standards, Promotion, & Technology Branch; Poultry Programs, AMS, U.S.... FOR FURTHER INFORMATION CONTACT: Sara Lutton, Standards, Promotion, & Technology Branch; Poultry...

Go For the Gold...Read! Louisiana Summer Reading Program, 1996.

Science.gov (United States)

White, Dorothy J., Ed.

A manual for the 1996 Louisiana Summer Reading Program is presented in five sections with an Olympic and sports-related theme and illustrations. An evaluation form, a 1996 monthly calendar, and clip art images are provided. The first section covers promotion and publicity, and contains facts about the Olympics, promotion ideas, and sample news…

Quarterly coal report July--September 1996, February 1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-02-01

The Quarterly Coal Report (QCR) provides comprehensive information about US coal production, distribution, exports, imports, receipts, prices, consumption, and stocks to a wide audience, including Congress, Federal and State agencies, the coal industry, and the general public. Coke production, consumption, distribution, imports, and exports data are also provided. This report presents detailed quarterly data for July through September 1996 and aggregated quarterly historical data for 1990 through the second quarter of 1996. Appendix A displays, from 1988 on, detailed quarterly historical coal imports data. 8 figs., 72 tabs.

TIARA annual report 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-11-01

This annual report describes research activities which have been performed with the JAERI TIARA (Takasaki Ion Accelerators for Advanced Radiation Application) facilities from April 1, 1996 to March 31, 1997. Summary reports of 88 papers and 4 brief descriptions on the status of TIARA in the period are contained. A list of publications, the type of research collaborations and organization of TIARA are also given as appendices. (J.P.N.)

Environmentally assisted cracking in light water reactors. Semiannual report July 1996 - December 1996

International Nuclear Information System (INIS)

Chopra, O.K.; Chung, H.M.; Gavenda, D.J.

1997-10-01

This report summarizes work performed by Argonne National Laboratory on fatigue and environmentally assisted cracking (EAC) in light water reactors from July 1996 to December 1996. Topics that have been investigated include (a) fatigue of carbon, low-alloy, and austenitic stainless steels (SSs) used in reactor piping and pressure vessels, (b) irradiation-assisted stress corrosion cracking of Type 304 SS, (c) EAC of Alloy 600, and (d) characterization of residual stresses in welds of boiling water reactor (BWR) core shrouds by numerical models. Fatigue tests were conducted on ferritic and austenitic SSs in water that contained various concentrations of dissolved oxygen to determine whether a slow strain rate applied during various portions of a tensile-loading cycle are equally effective in decreasing fatigue life. Slow-strain-rate-tensile tests were conducted in simulated BWR water at 288 C on SS specimens irradiated to a low fluence in the Halden reactor and the results were compared with similar data from a control-blade sheath and neutron-absorber tubes irradiated in BWRs to the same fluence level. Crack-growth-rate tests were conducted on compact-tension specimens from a low-carbon content heat of Alloy 600 in high-purity oxygenated water at 289 C. Residual stresses and stress intensity factors were calculated for BWR core shroud welds

CEA 1996 survey of accounting policies and practices

International Nuclear Information System (INIS)

Constant, M.

1997-01-01

A survey of accounting policies and practices of some of Canada's largest electrical utilities was presented. The first survey was done in 1981 and then updated in 1986, 1991 and 1996. The dominating issues affecting accounting practices in the 1996 survey were regulation versus deregulation, corporate governance, risk management, research and development costs, new ventures, and environmental liabilities. The Survey examined eight areas of accounting concern, among them financial statement concepts, statement of operations, assets, liabilities, equity, special topics, and financial ratios and other statistics

Abstracts and papers of the 1996 International RERTR Meeting

International Nuclear Information System (INIS)

1996-10-01

The 1996 International Meeting on Reduced Enrichment for Research and Test Reactors (RERTR) was sponsored by the Korea Atomic Energy Research Institute and the International Atomic Energy Agency and was held in Seoul, Korea, on 6-10 October 1996. The abstracts and available papers that were presented at this meeting are provided. The most important subject dealt with was progress of the Reduced Enrichment Research and Test Reactor (RERTR) Program. The major events, findings, and activities of 1996 are reviewed with the results which the RERTR Program has achieved by the end of 1995 in collaboration of the ANL and its many international partners

Abstracts and papers of the 1996 International RERTR Meeting

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-10-01

The 1996 International Meeting on Reduced Enrichment for Research and Test Reactors (RERTR) was sponsored by the Korea Atomic Energy Research Institute and the International Atomic Energy Agency and was held in Seoul, Korea, on 6-10 October 1996. The abstracts and available papers that were presented at this meeting are provided. The most important subject dealt with was progress of the Reduced Enrichment Research and Test Reactor (RERTR) Program. The major events, findings, and activities of 1996 are reviewed with the results which the RERTR Program has achieved by the end of 1995 in collaboration of the ANL and its many international partners.

Planning integration FY 1996 program plan. Revision 1

International Nuclear Information System (INIS)

1995-09-01

This Multi-Year Program Plan (MAP) Planning Integration Program, Work Breakdown Structure (WBS) Element 1.8.2, is the primary management tool to document the technical, schedule, and cost baseline for work directed by the US Department of Energy (DOE), Richland Operations Office (RL). As an approved document, it establishes an agreement between RL and the performing contractors for the work to be performed. It was prepared by Westinghouse Hanford Company (WHC) and Pacific Northwest Laboratory (PNL). The MYPPs for the Hanford Site programs are to provide a picture from fiscal year (FY) 1996 through FY 2002. At RL Planning and Integration Division (PID) direction, only the FY 1996 Planning Integration Program work scope has been planned and presented in this MAP. Only those known significant activities which occur after FY 1996 are portrayed in this MAP. This is due to the uncertainty of who will be accomplishing what work scope when, following the award of the Management and Integration (M ampersand I) contract

INEEL BNCT research program. Annual report, January 1, 1996--December 31, 1996

International Nuclear Information System (INIS)

Venhuizen, J.R.

1997-04-01

This report is a summary of the progress and research produced for the Idaho National Engineering and Environmental Laboratory (INEEL) Boron Neutron Capture Therapy (BNCT) Research Program for calendar year 1996. Contributions from the individual investigators about their projects are included, specifically, physics: treatment planning software, real-time neutron beam measurement dosimetry, measurement of the Finnish research reactor epithermal neutron spectrum, BNCT accelerator technology; and chemistry: analysis of biological samples and preparation of 10 B enriched decaborane

Environmental policy. Ambient radioactivity levels and radiation doses in 1996; Umweltpolitik. Umweltradioaktivitaet und Strahlenbelastung im Jahr 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-10-01

The report is intended as information for the German Bundestag and Bundesrat as well as for the general population interested in issues of radiological protection. The information presented in the report shows that in 1996, the radiation dose to the population was low and amounted to an average of 4 millisievert (mSv), with 60% contributed by natural radiation sources, and 40% by artificial sources. The major natural source was the radioactive gas radon in buildings. Anthropogenic radiation exposure almost exclusively resulted from application of radioactive substances and ionizing radiation in the medical field, for diagnostic purposes. There still is a potential for reducing radiation doses due to these applications. In the reporting year, there were 340 000 persons occupationally exposed to ionizing radiation. Only 15% of these received a dose different from zero, the average dose was 1.8 mSv. The data show that the anthropogenic radiation exposure emanating from the uses of atomic energy or applications of ionizing radiation in technology is very low. (orig./CB) [Deutsch] Der vorliegende Bericht ueber die `Umweltradioaktivitaet und Strahlenbelastung im Jahr 1996` richtet sich an Bundestag und Bundesrat und darueber hinaus an alle an Fragen des Strahlenschutzes interessierte Buerger. Der Bericht belegt, dass die Strahlenbelastung der Bevoelkerung im Jahr 1996 gering war und insgesamt durchschnittlich 4 Millisievert (mSv) betrug. Dieser Wert war zu 60% auf natuerliche und zu 40% auf kuenstliche Strahlenquellen zurueckzufuehren. Den wesentlichen Beitrag zur natuerlichen Strahlenbelastung lieferte das radioaktive Gas Radon in Wohnungen. Die zivilisatorische Strahlenexposition der Bevoelkerung wurde fast ausschliesslich durch die Anwendung radioaktiver Stoffe und ionisierender Strahlen in der Medizin im Rahmen der Diagnostik hervorgerufen. Hier bestehen nach wie vor Moeglichkeiten zur Reduktion der Strahlenbelastung. Im Jahre 1996 waren 340 000 Personen beruflich

A survey of heavy metals in mussels (Monaco, 1989-1996)

International Nuclear Information System (INIS)

Veglia, A.

1999-01-01

The pollution by heavy metals of the marine environment in Monaco was estimated by analysing mussels which naturally grow on the open-sea side of the main dam of the new harbour of Fontvieille. Sampling took place ten times between November 1989 and May 1996

Environmentally assisted cracking in light water reactors. Semiannual progress report, January 1996--June 1996

International Nuclear Information System (INIS)

Chopra, O.K.; Chung, H.M.; Gruber, E.E.

1997-05-01

This report summarizes work performed by Argonne National Laboratory on fatigue and environmentally assisted cracking (EAC) in light water reactors from January 1996 to June 1996. Topics that have been investigated include (a) fatigue of carbon, low-alloy, and austenitic stainless steels (SSs) used in reactor piping and pressure vessels, (b) irradiation-assisted stress corrosion cracking of Type 304 SS, and (c) EAC of Alloys 600 and 690. Fatigue tests were conducted on ferritic and austenitic SSs in water that contained various concentrations of dissolved oxygen (DO) to determine whether a slow strain rate applied during various portions of a tensile-loading cycle are equally effective in decreasing fatigue life. Slow-strain-rate-tensile tests were conducted in simulated boiling water reactor (BWR) water at 288 degrees C on SS specimens irradiated to a low fluence in the Halden reactor and the results were compared with similar data from a control-blade sheath and neutron-absorber tubes irradiated in BWRs to the same fluence level. Crack-growth-rate tests were conducted on compact-tension specimens from several heats of Alloys 600 and 690 in air and high-purity, low-DO water. 83 refs., 60 figs., 14 tabs

Environmentally assisted cracking in light water reactors. Semiannual progress report, January 1996--June 1996

Energy Technology Data Exchange (ETDEWEB)

Chopra, O.K.; Chung, H.M.; Gruber, E.E. [and others

1997-05-01

This report summarizes work performed by Argonne National Laboratory on fatigue and environmentally assisted cracking (EAC) in light water reactors from January 1996 to June 1996. Topics that have been investigated include (a) fatigue of carbon, low-alloy, and austenitic stainless steels (SSs) used in reactor piping and pressure vessels, (b) irradiation-assisted stress corrosion cracking of Type 304 SS, and (c) EAC of Alloys 600 and 690. Fatigue tests were conducted on ferritic and austenitic SSs in water that contained various concentrations of dissolved oxygen (DO) to determine whether a slow strain rate applied during various portions of a tensile-loading cycle are equally effective in decreasing fatigue life. Slow-strain-rate-tensile tests were conducted in simulated boiling water reactor (BWR) water at 288{degrees}C on SS specimens irradiated to a low fluence in the Halden reactor and the results were compared with similar data from a control-blade sheath and neutron-absorber tubes irradiated in BWRs to the same fluence level. Crack-growth-rate tests were conducted on compact-tension specimens from several heats of Alloys 600 and 690 in air and high-purity, low-DO water. 83 refs., 60 figs., 14 tabs.

1996 Talisman Energy Inc. annual report

International Nuclear Information System (INIS)

Anon.

1997-01-01

A review of operations, revenues and expenditures during 1996 by Talisman Energy Inc., was made available for the benefit of shareholders. Talisman Energy is an independent, Canadian-based international upstream oil and gas company. The company's main business activities include exploration, development, production and marketing of crude oil, natural gas and natural gas liquids. Production comes from Canada, the North Sea and Indonesia. This report presented an operations review, consolidated financial statements, common share information, discussed outlook on prices, expectations of future production, business plans for drilling and exploration and expectations of capital expenditures, debt levels and royalty rates. Financially, 1996 was a good year for Talisman Energy, with share values increasing by 65 per cent over year-end 1995. On February 12, 1997, Talisman announced plans to offer to purchase all of the outstanding common shares of Wascana Energy Inc. tabs., figs

Tank Vapor Characterization Project: Annual status report for FY 1996

International Nuclear Information System (INIS)

Silvers, K.L.; Fruchter, J.S.; Huckaby, J.L.; Almeida, T.L.; Evans, J.C. Jr.; Pool, K.H.; Simonen, C.A.; Thornton, B.M.

1997-01-01

In Fiscal Year 1996, staff at the Vapor Analytical Laboratory at Pacific Northwest National Laboratory performed work in support of characterizing the vapor composition of the headspaces of radioactive waste tanks at the Hanford Site. Work performed included support for technical issues and sampling methodologies, upgrades for analytical equipment, analytical method development, preparation of unexposed samples, analyses of tank headspaces samples, preparation of data reports, and operation of the tank vapor database. Progress made in FY 1996 included completion and issuance of 50 analytical data reports. A sampling system comparison study was initiated and completed during the fiscal year. The comparison study involved the vapor sampling system (VSS), a truck-based system, and the in situ vapor sampling system (ISVS), a cart-based system. Samples collected during the study were characterized for inorganic, permanent gases, total non-methane organic compounds and organic speciation by SUMMA trademark and TST methods. The study showed comparable sampling results between the systems resulting in the program switching from the VSS to the less expensive ISVS methodology in late May 1996. A temporal study was initiated in January 1996 in order to understand the influences seasonal temperatures changes have on the vapors in the headspace of Hanford waste tanks. A holding time study was initiated in the fourth quarter of FY 1996. Samples were collected from tank S-102 and rushed to the laboratory for time zero analysis. Additional samples will be analyzed at 1, 2, 4, 8, 16, and 32 weeks

Folic acid knowledge and use among expectant mothers in 1997: a comparison with 1996.

LENUS (Irish Health Repository)

McDonnell, R

1999-04-01

This study examined changes in folic acid knowledge and use among antenatal women in Dublin maternity hospitals between 1996 and 1997, following a campaign to improve the very low uptake of peri-conceptional folic acid. The results showed significant improvements between the two years. Almost 76% of respondents had heard of folic acid in 1997 compared with 54% in 1996 (p < 0.01), with a shift in the proportion of people hearing of folic acid from hospital doctors to general practitioners (GP). Almost 43% of respondents in 1997 knew that folic acid can prevent spina bifida compared with 21% in 1996 (p < 0.01). A higher proportion was taking folic acid prior to conception in 1997 (16% vs 6%, p < 0.01). We conclude that the improvements may have been in part due to the promotional campaign among health professionals, women\\'s groups and the media. However, less than a fifth of women were taking folic acid peri-conceptionally in 1997 and there is still scope for much improvement.

KURRI progress report 1995. April 1995 - March 1996

International Nuclear Information System (INIS)

1996-11-01

1995 is the first year into the 'second life' of KURRI. Following the suggestion of the Science Council, the research divisions were reorganized from old 16 divisions into 6 large divisions on April 1, 1995, and the five year modernization program of the Kyoto University reactor (KUR) and its related facilities was begun. The KUR added 1,165 h of operation during the past fiscal year. 2,002 researchers in total visited the KURRI to perform 148 experimental applications or to attend 16 symposia and 6 workshops. At the end of three year period, the scientific achievements of five research projects were reviewed during the annual scientific meeting of the KURRI held on January 25 and 26, 1996. On March 18, 1996, the KURRI celebrated the reorganization of the Center of Excellence, and the international symposium on the advance in neutron optics and the related research facilities was held for the following three days. The replacement of the heavy water facility was carried out during the reactor shutdown from December, 1995 to May, 1996. The user operation of the KUR was resumed on July 15, 1996. In this book, research activities, organization, research divisions and laboratories, the operation and development of facilities, radiation protection and monitoring, publications, meetings and seminars are reported. (K.I.)

KURRI progress report 1995. April 1995 - March 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-11-01

1995 is the first year into the `second life` of KURRI. Following the suggestion of the Science Council, the research divisions were reorganized from old 16 divisions into 6 large divisions on April 1, 1995, and the five year modernization program of the Kyoto University reactor (KUR) and its related facilities was begun. The KUR added 1,165 h of operation during the past fiscal year. 2,002 researchers in total visited the KURRI to perform 148 experimental applications or to attend 16 symposia and 6 workshops. At the end of three year period, the scientific achievements of five research projects were reviewed during the annual scientific meeting of the KURRI held on January 25 and 26, 1996. On March 18, 1996, the KURRI celebrated the reorganization of the Center of Excellence, and the international symposium on the advance in neutron optics and the related research facilities was held for the following three days. The replacement of the heavy water facility was carried out during the reactor shutdown from December, 1995 to May, 1996. The user operation of the KUR was resumed on July 15, 1996. In this book, research activities, organization, research divisions and laboratories, the operation and development of facilities, radiation protection and monitoring, publications, meetings and seminars are reported. (K.I.)

1996 annual report

International Nuclear Information System (INIS)

1996-01-01

This 1996 issue of the annual report of the French Commissariat a l'Energie Atomique (CEA) gives a general overview of CEA organization, activities, human resources, international relations and external communication with some budgetary informations. The main activities described concern the national defence, the fuel cycle, the nuclear reactors, the condensed matter and life sciences, the advanced technologies, the protection and transfer of knowledge and technologies, the environmental activities, the management and processing of nuclear wastes, the nuclear protection and safety, the technical and scientific information, the teaching and training, the scientific prizes, the committees, councils and commissions. (J.S.)

The 1996 CFM results. Record natural gas sales figure in 1996

International Nuclear Information System (INIS)

Anon.

1997-01-01

The French Methane Company (CFM) provides about 20% of the French natural gas market with its pipes network. Its sales wined a new record in 1996 with 86 billions of kWh which corresponds to a 20% increase in two years. This growth reached 12% in the domestic sector with respect to 1995 and is explained by colder climatic conditions and to the efficient promotional policy of Gaz de France. In the industrial sector, a 10% growth is recorded due to the start up a new cogeneration installations in which CFM is considerably involved (short note). (J.S.)

Landelijk Meetnet Bodemkwaliteit; Resultaten 1996

NARCIS (Netherlands)

Groot MSM; Bronswijk JJB; Leeuwen TC van; LEI-DLO; LBG

2001-01-01

This report contains the results of the National Soil Monitoring Network of the Netherlands in 1996, the fourth year of sampling. The network represents the cooperative effort of the National Institute of Public Health and the Environment (RIVM), the Agriculture Economics Research Institute

Landelijk Meetnet Regenwatersamenstelling. Meetresultaten 1996

NARCIS (Netherlands)

Boschloo DJ; Stolk AP; LLO

1999-01-01

This report presents the results of the chemical composition measurements of precipitation in the Netherlands in 1996. Measurements were performed on 4-weekly samples obtained from the National Precipitation Chemistry Monitoring Network. Samples from 15 stations were analysed for main components and

Water supply at Los Alamos during 1996. Progress report

International Nuclear Information System (INIS)

McLin, S.G.; Purtymun, W.D.; Maes, M.N.; Longmire, P.A.

1997-12-01

Production of potable municipal water supplies during 1996 totaled about 1,368.1 million gallons from wells in the Guaje, Pajarito, and Otowi well fields. There was no water used from either the spring gallery in Water Canyon or from Guaje Reservoir during 1996. About 2.6 million gallons of water from Los Alamos Reservoir was used for lawn irrigation. The total water usage in 1996 was about 1,370.7 million gallons, or about 131 gallons per day per person living in Los Alamos County. Groundwater pumpage was up about 12.0 million gallons in 1996 compared with the pumpage in 1995. This report fulfills requirements specified in US Department of Energy (DOE) Order 5400.1 (Groundwater Protection Management Program), which requires the Los Alamos National Laboratory (LANL) to monitor and document groundwater conditions below Pajarito Plateau and to protect the regional aquifer from contamination associated with Laboratory operations. Furthermore, this report also fulfills special conditions by providing information on hydrologic characteristics of the regional aquifer, including operating conditions of the municipal water supply system

Performing a stellar autopsy using the radio-bright remnant of SN 1996cr

Science.gov (United States)

Meunier, C.; Bauer, F. E.; Dwarkadas, V. V.; Koribalski, B.; Emonts, B.; Hunstead, R. W.; Campbell-Wilson, D.; Stockdale, C.; Tingay, S. J.

2013-05-01

We present newly reduced archival radio observations of SN 1996cr in the Circinus Galaxy from the Australia Telescope Compact Array and the Molonglo Observatory Synthesis Telescope, and attempt to model its radio light curves using recent hydrodynamical simulations of the interaction between the supernova (SN) ejecta and the circumstellar material (CSM) at X-ray wavelengths. The radio data within the first 1000 d show clear signs of free-free absorption (FFA), which decreases gradually and is minimal above 1.4 GHz after day ˜3000. Constraints on the FFA optical depth provide estimates of the CSM free electron density, which allows insight into the ionization of SN 1996cr's CSM and offers a test on the density distribution adopted by the hydrodynamical simulation. The intrinsic spectral index of the radiation shows evidence for spectral flattening, which is characterized by α = 0.852 ± 0.002 at day 3000 and a decay rate of Δα = -0.014 ± 0.001 yr-1. The striking similarity in the spectral flattening of SN 1987A, SN 1993J and SN 1996cr suggests this may be a relatively common feature of SNe/CSM shocks. We adopt this spectral index variation to model the synchrotron radio emission of the shock, and consider several scalings that relate the parameters of the hydrodynamical simulation to the magnetic field and electron distribution. The simulated light curves match the large-scale features of the observed light curves, but fail to match certain tightly constraining sections. This suggests that simple energy density scalings may not be able to account for the complexities of the true physical processes at work, or alternatively, that the parameters of the simulation require modification in order to accurately represent the surroundings of SN 1996cr.

Electric trade in the United States, 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-12-01

Wholesale trade in electricity plays an important role for the US electric utility industry. Wholesale, or bulk power, transactions allow electric utilities to reduce power costs, increase power supply options, and improve reliability. In 1996, the wholesale trade market totaled 2.3 trillion kilowatthours, over 73% of total sales to ultimate consumers. This publication, Electric Trade in the United States 1996 (ELECTRA), is the sixth in a series of reports on wholesale power transactions prepared by the Office of Coal, Nuclear, Electric and Alternate Fuels, Energy Information Administration (EIA). The electric trade data are published biennially. The first report presented 1986 data, and this report provides information on the electric power industry during 1996. The electric trade data collected and presented in this report furnish important information on the wholesale structure found within the US electric power industry. The patterns of interutility trade in the report support analyses of wholesale power transactions and provide input for a broader understanding of bulk power market issues that define the emerging national electric energy policies. The report includes information on the quantity of power purchased, sold, exchanged, and wheeled; the geographical locations of transactions and ownership classes involved; and the revenues and costs. 1 fig., 43 tabs.

EIA publications directory 1996

International Nuclear Information System (INIS)

1997-05-01

This edition of the EIA Publications Directory contains titles and abstracts of periodicals and one-time reports produced by the Energy Information Administration (EIA) from January through December 1996. The body of the Directory contains citations and abstracts arranged by broad subject categories; metadata, coal, oil and gas, nuclear, electricity, renewable and energy/alternative fuels, multifuel, end-use consumption, models, and forecasts

1996 year-end market review

International Nuclear Information System (INIS)

Anon.

1996-01-01

A summary of financial data for uranium markets in 1996 is provided. Spot market activity and buyers and sellers of spot uranium are outlined for the restricted and unrestricted market. Data on the concentrates, uranium hexafluoride, enriched uranium product, and term uranium markets are also presented. Market data is also provided for conversion and enrichment services

[Economic burden of cancer in China during 1996-2014: a systematic review].

Science.gov (United States)

Shi, J F; Shi, C L; Yue, X P; Huang, H Y; Wang, L; Li, J; Lou, P A; Mao, A Y; Dai, M

2016-12-23

Objective: To explore the current status of research on economic burden of cancer in China from 1996 to 2014. Methods: The key words including cancer, economic burden, expenditure, cost were used to retrieve the literatures published in CNKI and Wanfang (the two most commonly used databases for literature in Chinese) and PubMed during 1996-2014. A total of 91 studies were included after several exclusionary procedures. Information on subjects and data source, methodology, main results were structurally abstracted. All the expenditure data were discounted to year of 2013 value using China's health care consumer price indices. Results: More than half of the included studies were published over the past 5 years, 32 of the studies were about lung cancer. Among the 83 individual-based surveys, 77 were hospital-based and obtained data via individually medical record abstraction, and most of which only considered the direct medical expenditure. Expenditure per cancer patient and expenditure per diem were the most commonly used outcome indicators. Majority of the findings on expenditure per cancer patient ranged from 10 thousands to 30 thousands Chinese Yuan (CNY), with larger disparity in lung and breast cancer (ranged from 10 thousands to 90 thousands CNY), narrower difference in esophageal and stomach cancer (ranged from 10 thousands to 50 thousands CNY), and most stable trend in cervical cancer (almost all the values less than 20 thousands CNY). Without exception, the expenditures per diem for all the common cancers were increasing over the period from 1996 to 2014 (3-7 fold increase). Only 8 population-level economic burden studies were included and the reported expenditure of cancer at national level ranged from 32.6 billions to 100.7 billions CNY. Conclusions: Evidence on economic burden of cancer in China from 1996 to 2014 are limited and weakly comparable, particularly at a population level, and the reported expenditure per patient may be underestimated.

Safety against releases in severe accidents. Annual report 1996. Project plan 1997; Saekerhet mot utslaepp vid reaktorhaverier. Aarsrapport 1996. Plans 1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-01-01

The work scope of the RAK-2 project is divided into three sub-projects: RAK-2.1 Severe Accident Phenomenology; RAK-2.2 Computerised Accident Management; RAK-2.3 Reactors In Nordic Surroundings. The work in subproject 1 progresses roughly according to budget and time schedule. Some adjustments in the technical work scope were made during 1996. Main tasks of RAK-2.1 in 1996: Complete recriticality studies for Nordic BWRs; Investigate phenomena related to late phase melt progression; Issue and NKS Final Technical Report on KTH experiments. Main tasks of RAK-2.2 in 1996: CAMS would be further developed with signal validation, tracking simulation, state identification and PSA and risk monitoring applications; Carry out a feasibility study for development of a PWR version of CAMS in collaboration with EdF, France; Use CAMS in the Halden Man-Machine laboratory to perform human factor studies. Main tasks of RAK-2.3 in 1996: Collect and report data from the British reactor types AGR, MAGNOX and PWR; Make a report on accidents in nuclear ships; Put the collected data together in a common data base covering neighbour reactors treated in SIK-3 and RAK-2.3; Update the data in the former SIK-3 report if needed. The work in project 2 progresses according to plans. The data collection of British reactors with in sub-project 3 has been delayed significantly due to difficulty of obtaining information from some of the British utilities, but the problems are expected to be solved by the end of 1997. (EG).

The annual report for 1996

International Nuclear Information System (INIS)

1997-07-01

Article VI.J of the Agency's Statute requires the Board of Governors to submit 'an annual report to the General Conference concerning the affairs of the Agency and any projects approved by the Agency'. This report covers the period 1 January to 31 December 1996

1996, a turning point in the evolution of the EDF with good financial results; 1996, une annee charniere dans l'evolution d'EDF avec de bons resultants financiers

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-03-01

This conference held on March 1997 presents the financial results obtained in 1996 by French Electricity Company EDF (Electricite de France). This year represented a turning point because essential landmarks were established in 1996. An european directive has been adopted in 1996 defining the framework in which european electricity market will function as well as the rules for its opening to competition. Discussions with the trade unions were conducted at the beginning of 1997and a social agreement aiming at the amelioration of services and hiring of 11,000 to 15,000 young people in the next three years. Finally, a new contract of enterprise with the state has been discussed and approved in March 5, 1997, which redefined the place and the role of EDF in the French economy, in the new stage of electricity market started by the opening to competition. The document contains the following 8 chapters: 1. Financial results and enterprise management; 2. Institutional frame and the relation with the state; 3. Development in France; 4. International development; 5. Alliances, partnerships and cooperation; 6. Management, social and human resources; 7. Environment; 8. Technical results.

Petroleum industry 1996

International Nuclear Information System (INIS)

1997-01-01

A survey on petroleum industry activities in France and in the world in 1996 is presented. The different parts and themes of the study are: evolution of the petroleum market (international and French markets, supply and demand, prices, mark-up and taxation in France and in Europe); activities in the petroleum industries (exploration and production, maritime transportation, inland transportation and storage, refining, quality of petroleum products and substitution fuels, oil distribution); environment and safety (refining, distribution and evolution of products, pipeline and maritime transportation, exploration and production); situation of the sector's companies (oil groups, para-petroleum French industry, scientific and technical research)

Alberta oil and gas industry : annual statistics for 1996

International Nuclear Information System (INIS)

1997-01-01

Alberta's 1996 annual and historical statistics for the supply and disposition of the following oil and gas products was presented: (1) crude oil and equivalent, (2) natural gas, (3) ethane, (4) propane, (5) butanes, (6) natural gas liquids, and (7) sulphur. Statistics regarding the deliveries and average price of the products and statistical data on drilling activity during 1996 were also included. Tables

1996 Activity report

International Nuclear Information System (INIS)

1996-01-01

The 1996 activity report of the Direction for Waste Management of the CEA, is presented. Its activities have been developed in the framework of the general CEA cleaning plan, and include the management of wastes generated before 1992 in R and D CEA facilities, the disposal of spent fuels generated by research reactors (Orphee and Siloe) or prototype reactors (EL4 at Brennilis), and the dismantling and cleaning of obsolete facilities such as the plutonium radiochemistry building at Fontenay-aux-Roses and the pilot workshop at Marcoule

The Illegal Immigration Reform and Immigrant Responsibility Act of 1996: an overview.

Science.gov (United States)

Fragomen, A T

1997-01-01

"On September 30, 1996, President Clinton signed the Illegal Immigration Reform and Immigrant Responsibility Act of 1996 (1996 Act), Pub. L. No. 104-208, 110 Stat. 3009. After an intense lobbying effort by the business community, most provisions relating to legal immigration were omitted from the final bill. Instead, the 1996 Act focuses on illegal immigration reform and includes some of the toughest measures ever taken against illegal immigration." Aspects considered include border enforcement, penalities against alien smuggling and document fraud, deportation and exclusion proceedings, employer sanctions, welfare provisions, and changes to existing refugee and asylum procedures. excerpt

Lying in wait: Limiting factors on a low-density ungulate population and the latent traits that can facilitate escape from them

Science.gov (United States)

Joly, Kyle; Craig, Tim; Cameron, Matthew D.; Gall, Adrian E.; Sorum, Mathew S.

2017-11-01

Predation, habitat, hunting, and environmental conditions have all been implicated as regulatory mechanisms in ungulate populations. The low-density equilibrium hypothesis predicts that in low-density populations, predators regulate their prey and that the population will not escape unless predation pressure is eased. We evaluated survival of adult and juvenile moose (Alces alces) in north-central Alaska to determine whether or not the population supported the hypothesis. We instrumented adult male and female moose with radiocollars and used aerial observations to track parturition and subsequent survival of juvenile moose. Generalized linear mixed-effects models were used to assess survival. Adult annual survival rates were high (∼89%), but may be negatively influenced by winter conditions. Migratory status did not affect moose survivorship or productivity. Approximately 60% of the calf crop died before 5 months of age. Productivity was significantly lower in the northern section of the study area where there is less high-quality habitat, suggesting that, even in this low-density population, nutrition could be a limiting factor. It appears that predation on young calves, winter weather, and nutritional constraints may be interacting to limit this population. Latent traits, such as overproduction of calves and migratory behavior, which do not currently enhance fitness, may persist within this population so that individuals with these traits can reap benefits when environmental conditions change.

Annual statistical information 1996; Informe estatistico anual 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-31

This annual statistical report aims to propagate the information about the generation, transmission and distribution systems evolution and about the electric power market from the Parana State, Brazil, in 1996. The electric power consumption in the distribution area of the Parana Power Company (COPEL) presented a growth about 6,7%. The electric power production in the the COPEL plants increased 42,2% higher than 1995, due to the outflows verified in the Iguacu river and to the long period of the affluence reduction that the Southern region tanks coursed during this year. This report presents statistical data about the following topics: a) electric power energy balance from the Parana State; b) electric power energy balance from the COPEL - own generation, certain interchange, electric power requirement, direct distribution and the electric system 6 graphs, 3 maps, 61 tabs.; e-mail: splcnmr at mail.copel.br

Annual report of SPring-8, 1996

International Nuclear Information System (INIS)

1997-01-01

This report summarizes the activities of the SPring-8 Project in 1996. The purpose of the SPring-8 Project is to construct the world's most brilliant synchrotron radiation source in the soft and hard x-ray regions. The construction of the facility started in 1990, and the Project approaches its final stage of construction with the most outstanding progress in 1996 being the successful commissioning of the injector linac and the booster synchrotron. Installation of the linac was completed by the end of 1995 and the power test of the entire system started in January 1996. After the RF aging of the waveguide and accelerator columns for three months, the commissioning of the linac started on August 1 and it succeeded to accelerate electrons up to 1 GeV one week later. As for the booster synchrotron, its installation and precise alignment were completed in September. After the full power test of two months, the synchrotron commissioning started on December 6. Electrons were accelerated up to 8 GeV on December 16. The installation of all magnets in the storage ring was completed and the precise alignment of focusing magnets is under way. The installation of vacuum chambers and RF cavities has already been completed and the evacuation test is going on. The commissioning of the storage ring is scheduled in March, 1997. (M.N.)

Gene : CBRC-SARA-01-1996 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL

A guide to experimental particle physics literature, 1991-1996

International Nuclear Information System (INIS)

Ezhela, V.V.; Filimonov, B.B.; Lugovsky, S.B.

1996-10-01

We present an indexed guide to experimental particle physics literature for the years 1991 - 1996. Approximately 4200 papers are indexed by (1) Beam/Target/Momentum (2) Reaction/Momentum/Data-Descriptor (including the final state) (3) Particle/Decay (4) Accelerator/Experiment/Detector. All indices are cross-referenced to the paper''s title and references in the ID/Reference/Title index. The information presented in this guide is also publicly available on a regularly-updated DATAGUIDE database from the World Wide Web

A guide to experimental particle physics literature, 1991-1996

Energy Technology Data Exchange (ETDEWEB)

Ezhela, V.V.; Filimonov, B.B.; Lugovsky, S.B. [Inst. for High Energy Physics, Moscow (Russian Federation)] [and others

1996-10-01

We present an indexed guide to experimental particle physics literature for the years 1991 - 1996. Approximately 4200 papers are indexed by (1) Beam/Target/Momentum (2) Reaction/Momentum/Data-Descriptor (including the final state) (3) Particle/Decay (4) Accelerator/Experiment/Detector. All indices are cross-referenced to the paper`s title and references in the ID/Reference/Title index. The information presented in this guide is also publicly available on a regularly-updated DATAGUIDE database from the World Wide Web.

US Shipbuilding International Market Study, 1996-2005

National Research Council Canada - National Science Library

1995-01-01

The following report presents the results of a study undertaken by A & P Appledore International on behalf of NSRP SP-4, to forecast international commercial shipbuilding demand over the 10 year period 1996 to 2005...

Suncor Energy 1996 annual report

International Nuclear Information System (INIS)

1996-01-01

A review of revenues, expenditures and earnings, and 1996 operational highlights of Suncor Energy were presented. Suncor Energy is a leader in oil sands extraction and upgrading technology. In 1996 the company increased its earnings to $187 million, an increase of 24% over the previous year. It achieved record production of 77,600 barrels per day, up from 76,000 barrels per day in 1995. It commissioned a $190 million sulphur dioxide reduction plant which, in concert with other improvements, will cut sulphur dioxide emissions to 25 per cent of 1990 levels. It achieved regulatory approvals on plant expansion and the Steepbank Mine project. It began construction of the bridge across the Athabasca River that will connect Suncor's oil sands plant with the new Steepbank Mine. It added 30 million barrels of oil equivalent of proven new reserves and initiated the first phase of the Burnt Lake heavy oil project. It repositioned and restructured its wholesale and retail marketing businesses in Ontario and Quebec and positioned its Sunoco branded retail business in the top 10 per cent of its markets. Goals for 1997, for each of the company's three business divisions, were also given prominent attention. tabs., figs

How does a carnivore guild utilise a substantial but unpredictable anthropogenic food source? Scavenging on hunter-shot ungulate carcasses by wild dogs/dingoes, red foxes and feral cats in south-eastern Australia revealed by camera traps.

Directory of Open Access Journals (Sweden)

David M Forsyth

Full Text Available There is much interest in understanding how anthropogenic food resources subsidise carnivore populations. Carcasses of hunter-shot ungulates are a potentially substantial food source for mammalian carnivores. The sambar deer (Rusa unicolor is a large (≥ 150 kg exotic ungulate that can be hunted throughout the year in south-eastern Australia, and hunters are not required to remove or bury carcasses. We investigated how wild dogs/dingoes and their hybrids (Canis lupus familiaris/dingo, red foxes (Vulpes vulpes and feral cats (Felis catus utilised sambar deer carcasses during the peak hunting seasons (i.e. winter and spring. We placed carcasses at 1-km intervals along each of six transects that extended 4-km into forest from farm boundaries. Visits to carcasses were monitored using camera traps, and the rate of change in edible biomass estimated at ∼ 14-day intervals. Wild dogs and foxes fed on 70% and 60% of 30 carcasses, respectively, but feral cats seldom (10% fed on carcasses. Spatial and temporal patterns of visits to carcasses were consistent with the hypothesis that foxes avoid wild dogs. Wild dog activity peaked at carcasses 2 and 3 km from farms, a likely legacy of wild dog control, whereas fox activity peaked at carcasses 0 and 4 km from farms. Wild dog activity peaked at dawn and dusk, whereas nearly all fox activity occurred after dusk and before dawn. Neither wild dogs nor foxes remained at carcasses for long periods and the amount of feeding activity by either species was a less important predictor of the loss of edible biomass than season. Reasons for the low impacts of wild dogs and foxes on sambar deer carcass biomass include the spatially and temporally unpredictable distribution of carcasses in the landscape, the rapid rate of edible biomass decomposition in warm periods, low wild dog densities and the availability of alternative food resources.

How Does a Carnivore Guild Utilise a Substantial but Unpredictable Anthropogenic Food Source? Scavenging on Hunter-Shot Ungulate Carcasses by Wild Dogs/Dingoes, Red Foxes and Feral Cats in South-Eastern Australia Revealed by Camera Traps

Science.gov (United States)

Forsyth, David M.; Woodford, Luke; Moloney, Paul D.; Hampton, Jordan O.; Woolnough, Andrew P.; Tucker, Mark

2014-01-01

There is much interest in understanding how anthropogenic food resources subsidise carnivore populations. Carcasses of hunter-shot ungulates are a potentially substantial food source for mammalian carnivores. The sambar deer (Rusa unicolor) is a large (≥150 kg) exotic ungulate that can be hunted throughout the year in south-eastern Australia, and hunters are not required to remove or bury carcasses. We investigated how wild dogs/dingoes and their hybrids (Canis lupus familiaris/dingo), red foxes (Vulpes vulpes) and feral cats (Felis catus) utilised sambar deer carcasses during the peak hunting seasons (i.e. winter and spring). We placed carcasses at 1-km intervals along each of six transects that extended 4-km into forest from farm boundaries. Visits to carcasses were monitored using camera traps, and the rate of change in edible biomass estimated at ∼14-day intervals. Wild dogs and foxes fed on 70% and 60% of 30 carcasses, respectively, but feral cats seldom (10%) fed on carcasses. Spatial and temporal patterns of visits to carcasses were consistent with the hypothesis that foxes avoid wild dogs. Wild dog activity peaked at carcasses 2 and 3 km from farms, a likely legacy of wild dog control, whereas fox activity peaked at carcasses 0 and 4 km from farms. Wild dog activity peaked at dawn and dusk, whereas nearly all fox activity occurred after dusk and before dawn. Neither wild dogs nor foxes remained at carcasses for long periods and the amount of feeding activity by either species was a less important predictor of the loss of edible biomass than season. Reasons for the low impacts of wild dogs and foxes on sambar deer carcass biomass include the spatially and temporally unpredictable distribution of carcasses in the landscape, the rapid rate of edible biomass decomposition in warm periods, low wild dog densities and the availability of alternative food resources. PMID:24918425

JAERI TANDEM and V.D.G. annual report 1996. April 1, 1996 - March 31, 1997

International Nuclear Information System (INIS)

Takeuchi, Suehiro; Ikezoe, Hiroshi; Iwamoto, Akira; Sataka, Masao; Nagame, Yuichiro; Shoji, Tokio; Okabe, Takashi; Maekawa, Hiroshi

1997-09-01

This annual report describes research activities which have been performed with the JAERI tandem accelerator and the Van de Graaf accelerator from April 1, 1996 to March 31, 1997. Summary reports of 48 papers, and list of publications, personnel and cooperative researches with universities are contained. (author)

1996, a turning point in the evolution of the EDF with good financial results

International Nuclear Information System (INIS)

1997-03-01

This conference held on March 1997 presents the financial results obtained in 1996 by French Electricity Company EDF (Electricite de France). This year represented a turning point because essential landmarks were established in 1996. An european directive has been adopted in 1996 defining the framework in which european electricity market will function as well as the rules for its opening to competition. Discussions with the trade unions were conducted at the beginning of 1997 and a social agreement aiming at the amelioration of services and hiring of 11,000 to 15,000 young people in the next three years. Finally, a new contract of enterprise with the state has been discussed and approved in March 5, 1997, which redefined the place and the role of EDF in the French economy, in the new stage of electricity market started by the opening to competition. The document contains the following 8 chapters: 1. Financial results and enterprise management; 2. Institutional frame and the relation with the state; 3. Development in France; 4. International development; 5. Alliances, partnerships and cooperation; 6. Management, social and human resources; 7. Environment; 8. Technical results

Radioactivity in food and the environment, 1996

International Nuclear Information System (INIS)

1997-09-01

This report continues the series which combines the results of the radioactivity monitoring programmes previously published by MAFF in two documents: the 'Terrestrial Radioactivity Monitoring Programme (TRAMP) Report: Radioactivity in food and agricultural products in England and Wales' and the 'Aquatic Environment Monitoring Report: Radioactivity in surface and coastal waters of the British Isles' (AEMR). For the first time the report includes the results of all environmental monitoring for radioactivity carried out on behalf of the regulatory authority in Scotland. These results were previously presented in the 'Statistical Bulletin: Environmental Monitoring for Radioactivity in Scotland' (e.g. The Scottish Office, (1996). Measurements in 1996 included the analysis of samples of food and other materials from the environment and detection of beta and gamma dose rates in the environment. The results show that radionuclide concentrations and radiation dose rates were generally similar to those in 1995. However, near Sellafield, despite the general downward trend in disposals from the site during 1996, there were some increases in concentrations of technetium-99 and carbon-14 in marine foodstuffs reflecting disposals from and operations on the site in previous years. These operations included processing of stored wastes and the operation of the Enhanced Actinide Removal Plant (EARP). The Thermal Oxide Reprocessing Plant (THORP) continued its commissioning phase in 1996 and its disposals had little effect on food and the marine environment. The results of the monitoring have been interpreted in terms of public radiation exposures using data on activity levels in food and local surveys to establish potential 'critical groups' of people likely to be most exposed. (author)

Atomic energy in Lithuania: Nuclear safety in 1996

International Nuclear Information System (INIS)

Vaishnys, P.; Krenevichius, R.; Alejev, A.; Demchenko, M.

1997-01-01

The first annual report of VATESI - Lithuanian Nuclear Safety Authority's activity is presented and cover description of the main results in 1996. VATESI was established in 1991 recently after regaining of independence when Ignalina NPP come into jurisdiction of Republic of Lithuania. Since the establishment in six year period of operation VATESI developed its activities considerably and now is able to perform the functions of independent regulator of nuclear safety in Lithuania. The main fields of VATESI activities in 1996 were evaluation of the safety of Ignalina NPP, supervision of Ignalina NPP's operational safety, control of the implementation of safety improvement program SIP-1 in Ignalina NPP, development of new regulatory legislation according to IAEA standards and practices, accountancy and control of nuclear materials, regulation of radioactive waste management. Detailed description of all these activities is provided in the report. In 1996 there were no safety significant events in Ignalina NPP according to the INES scale, only five events received qualification as level 1 events

Parto vertical em hospital universitário: série histórica, 1996 a 2005 Vertical-position births at a University Hospital: a time-series study, 1996 to 2005

Directory of Open Access Journals (Sweden)

Odaléa Maria Brüggemann

2009-06-01

Full Text Available OBJETIVOS: descrever a evolução do número de partos horizontais e verticais na maternidade do Hospital da Universidade Federal de Santa Catarina, Brasil, e avaliar a associação dos mesmos com a taxa de cesárea, de internações dos recém-nascidos em unidade de tratamento intensivo e semi-intensivo e as transfusões sanguíneas maternas. MÉTODOS: estudo descritivo -série histórica. Foram incluídos todos os partos, as internações dos recémnascidos na Unidade de Terapia Intensiva e as transfusões sanguíneas maternas ocorridas de 1996 até 2005. Para testar as tendências, utilizou-se o método de Prais-Winsten para regressão linear generalizada. RESULTADOS: em 1996 a porcentagem de partos verticais era 5,4% e em 2005 foi 52,3%. A variação média anual dos partos verticais foi de +20,8% (p=0,007 e dos partos horizontais de -15,2% (pOBJECTIVES: to describe the evolution of the number of horizontal and vertical births in the maternity ward of the University Hospital of the Federal University of Santa Catarina, Brazil and to evaluate their correlation with the rates for caesarian, for transfer of newborns to intensive and semi-intensive care units, and maternal blood transfusions. METHODS: a time-series study. All births resulting in newborns being transferred to the Intensive Care Unit, and the maternal blood transfusions obstetrics ward between 1996 and 2005 were included in this study. In order to test the tendencies, the Prais-Winsten generalized linear regression method was used. RESULTS: in 1996 the percentage for vertical births was 5.4% and in 2005 52.3%. The average annual variance for vertical births was +20.8% (p=0.007, and for horizontal births -15.2% (p<0.001. Caesarian births showed a tendency to stabilize (p=0.243. There was a decrease of in the number of newborns transferred to the neonatal intensive care unit, 6.1% per year (p=0.001 and in the need of maternal blood transfusions (5.2% -p<0.01. CONCLUSIONS: the

Canadian Petroleum Products Institute 1996 annual review

International Nuclear Information System (INIS)

1996-01-01

The Canadian Petroleum Products Institute (CPPI) is an association of Canadian companies involved in the downstream sector of the petroleum industry which includes refining, distributing and marketing of petroleum products. CPPI's mandate includes: (1) establishing environmental policies, (2) establishing working relationships with governments to develop public policy, (3) developing guidelines for the safe handling of petroleum products, and (4) providing information about the petroleum industry to the public. Canada's 19 refineries processed an average of 1.5 million barrels of crude oil per day in 1996. Domestic sources of crude made up 61 per cent of crude oil processed in 1996. Total exports during the year amounted to 105 million barrels. Some of the issues that the CPPI focused on during 1996 included the controversy over the future of the octane enhancing fuel additive MMT, fuel quality standards for transportation fuels and reformulated fuels, gasoline pricing, air quality and workplace safety. CPPI members' participation in the Voluntary Challenge and Registry (VCR) program towards reducing greenhouse gas emissions was also discussed. The industry was also actively involved in seeking to improve its refinery wastewater discharges

Task 11: Technology development integration. Semi-annual report, April 1, 1996--September 30, 1996

Energy Technology Data Exchange (ETDEWEB)

Musich, M.A.

1997-05-01

A review was conducted of three systems analysis (SA) studies performed by Lockheed Idaho Technologies Company (LITCO) on integrated thermal treatment systems (ITTSs) and integrated nonthermal treatment systems (INTSs) for the remediation of mixed low-level waste (MLLW) stored throughout the U.S. Department of Energy (DOE) weapons complex. The review was performed by an independent team led by the Energy & Environmental Research Center (EERC), including Science Applications International Corporation, the Waste Policy Institute (WPI), and Virginia Tech. The three studies reviewed were as follows: (1) Integrated Thermal Treatment System Study, Phase 1 - issued July 1994, (2) Integrated Thermal Treatment System Study, Phase 2 - issued February 1996, and (3) Integrated Nonthermal Treatment System Study - drafted March 1996. The three studies were commissioned by DOE to be SA studies of environmental management (EM) systems. The purpose of LITCO`s engineering evaluation of the MLLW treatment system alternatives was to help DOE in the prioritization of research, development, and demonstration activities for remediation technologies. The review of these three studies was structured to further aid DOE in its current and future decision-making processes. The methodology in the studies was compared to a sound systems engineering (SE) approach to help DOE determine which tasks still need to be accomplished to complete a thorough design/review.

Task 11: Technology development integration. Semi-annual report, April 1, 1996--September 30, 1996

International Nuclear Information System (INIS)

Musich, M.A.

1997-01-01

A review was conducted of three systems analysis (SA) studies performed by Lockheed Idaho Technologies Company (LITCO) on integrated thermal treatment systems (ITTSs) and integrated nonthermal treatment systems (INTSs) for the remediation of mixed low-level waste (MLLW) stored throughout the U.S. Department of Energy (DOE) weapons complex. The review was performed by an independent team led by the Energy ampersand Environmental Research Center (EERC), including Science Applications International Corporation, the Waste Policy Institute (WPI), and Virginia Tech. The three studies reviewed were as follows: (1) Integrated Thermal Treatment System Study, Phase 1 - issued July 1994, (2) Integrated Thermal Treatment System Study, Phase 2 - issued February 1996, and (3) Integrated Nonthermal Treatment System Study - drafted March 1996. The three studies were commissioned by DOE to be SA studies of environmental management (EM) systems. The purpose of LITCO's engineering evaluation of the MLLW treatment system alternatives was to help DOE in the prioritization of research, development, and demonstration activities for remediation technologies. The review of these three studies was structured to further aid DOE in its current and future decision-making processes. The methodology in the studies was compared to a sound systems engineering (SE) approach to help DOE determine which tasks still need to be accomplished to complete a thorough design/review

Annual report of JMTR, FY 1996. April 1, 1996 - March 31, 1997

Energy Technology Data Exchange (ETDEWEB)

Ooka, Norikazu; Fujiki, Kazuo; Nishiwaki, Kei-ichiro [eds.; Japan Atomic Energy Research Inst., Oarai, Ibaraki (Japan). Oarai Research Establishment; and others

1998-02-01

During FY 1996, the JMTR was operated for 2 complete cycles (118th and 119th cycles) and was utilized for the research and development programs on the reactor technology for LWRs, HTTR and fusion reactor, as well as for basic research of fuels and materials, and for radio-isotope productions. With regard to technology development in the JMTR, improvement of evaluation technique for local neutron spectrum, development of new oxygen sensor for oxide fuel pellet are proceeded. A research on the blanket material for thermonuclear fusion reactor was also progressed. (author)

SULA 2 - Energy-efficient steel and metal production. Yearbook 1996; SULA 2 - Perusmetallien energiataloudellinen valmistus. Vuosikirja 1996

Energy Technology Data Exchange (ETDEWEB)

Hakulin, H. [ed.

1996-12-31

The main objective of SULA 2 programme are (1) reduction of specific energy consumption, (2) reduction of harmful emissions and impact on the environment, (3) promoting technology export. Participants in the programme are the steel and base metal producers; Fundia wire, Imatra Steel Oy Ab, Outokumpu Oy and Rautaruukki Oy, as well as universities with laboratories for research on metal producing processes and their control such as Helsinki University of Technology, University of Oulu, Aabo Akademi and Tampere University of Technology. The programme consists of 32 research projects, of which 14 are applied technology. The total funding for 1995-1996 is 52,5 mill. FIM. Information on the research results is exchanged at the SULA-seminars arranged in 1994, 1996 and at the beginning of 1999. In connection with the seminars a yearbook will be published. The yearbook contains the reports of all the programme projects

SULA 2 - Energy-efficient steel and metal production. Yearbook 1996; SULA 2 - Perusmetallien energiataloudellinen valmistus. Vuosikirja 1996

Energy Technology Data Exchange (ETDEWEB)

Hakulin, H [ed.

1997-12-31

The main objective of SULA 2 programme are (1) reduction of specific energy consumption, (2) reduction of harmful emissions and impact on the environment, (3) promoting technology export. Participants in the programme are the steel and base metal producers; Fundia wire, Imatra Steel Oy Ab, Outokumpu Oy and Rautaruukki Oy, as well as universities with laboratories for research on metal producing processes and their control such as Helsinki University of Technology, University of Oulu, Aabo Akademi and Tampere University of Technology. The programme consists of 32 research projects, of which 14 are applied technology. The total funding for 1995-1996 is 52,5 mill. FIM. Information on the research results is exchanged at the SULA-seminars arranged in 1994, 1996 and at the beginning of 1999. In connection with the seminars a yearbook will be published. The yearbook contains the reports of all the programme projects

AGFW. Main report of the district heat supply 1996; AGFW. Hauptbericht der Fernwaermeversorgung 1996. Technische Daten zur Fernwaermeversorgung in Deutschland 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-11-01

A total of 232 district heating companies participated in the main report of district heating 1996. See the table for the distribution of corporate data per federal state (orig.) [Deutsch] Die in Tafeln 1 bis 15 ausgewiesenen Zahlen beziehen sich auf Angaben, die von der AGFW direkt bei den Unternehmen erhoben wurden. Seit 1995 werden die Angaben, die im Ostteil von Berlin erhoben wurden, dem Bundesland Berlin mit der Kennziffer 11 zugeordnet. Die AGFW bedankt sich bei den Unternehmen fuer die gute Zusammenarbeit (orig.)

AECL annual report 1996-1997

International Nuclear Information System (INIS)

1997-01-01

The 1996/1997 Annual Report of Atomic Energy of Canada Ltd. (AECL) is published and submitted to the Honourable member of parliament, Minister of Natural Resources. Included in this report are messages from marketing, commercial operations, product development, CANDU research, waste management, environmental management, financial review and copies of financial statements

AECL annual report 1996-1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-07-01

The 1996/1997 Annual Report of Atomic Energy of Canada Ltd. (AECL) is published and submitted to the Honourable member of parliament, Minister of Natural Resources. Included in this report are messages from marketing, commercial operations, product development, CANDU research, waste management, environmental management, financial review and copies of financial statements.

1996 scientific report; Rapport scientifique 1996

Energy Technology Data Exchange (ETDEWEB)

Berhouet, F.; Delavault, E.; Dupuy, P.; Legre, J.; Comte, M.; Panek, H.; Martin-Daguet, V.; Fleche, J.L.; Meis, C.; Kupecek, Ph.; Mennerat, G.; Mauchien, P.; Chaleard, C.; Kocon, S.; Lacour, J.L.; Gueneau, C.; Dauvois, V.; Gonella, C.; Berhier, C.; Lameille, J.M. [CEA Saclay, 91 - Gif-sur-Yvette (France). Dept. des Procedes d`enrichissement] [and others

1997-12-31

This report presents the work realized in 1996 by CEA-DCC (Direction du Cycle du Combustible). The main study fields are: laser beam stabilization, copper vapor laser (LVC) modelling, vapor density measurements, light transport in thick vapor, uranium evaporation, GdR-PRACTIS activities, uranyl organo phosphates, actinide extraction, ultra son in chemistry, oxidation mechanisms, salt free processes, tributyl phosphate (TBP) stability, cation exchanging membranes, filtering mineral membranes, liquid-liquid extraction processes, centrifugal contactor, supercritical phase, iodine reduction, weapon plutonium reprocessing, long term waste packaging, clay behaviour modelling; gas formation in deep storages, water-clay chemical interaction, nuclear glass behaviour, actinide storage dies, radionuclide release in storage, waste storage dies, iodine conditioning, cesium extraction by calix[4]arene molecules, decontamination foam, oxidation by supercritical water, decontamination by electrolysis, microorganism actions on metals, long life radionuclide determination in wastes, active and passive tomography, sulfated wastes, zircon-titanates ceramics, direct storage of irradiated fuel, caramel type fuel dismantling, radioprotection calculation codes, diffraction of backscattered electrons, infrared light coherent source, optical spectrometry, physical and chemical aspect of corium, iron-nickel-chromium alloy corrosion, natural uranium perspective, Atalante installation, interlaboratory comparisons. (A.C.)

1996 scientific report; Rapport scientifique 1996

Energy Technology Data Exchange (ETDEWEB)

Berhouet, F; Delavault, E; Dupuy, P; Legre, J; Comte, M; Panek, H; Martin-Daguet, V; Fleche, J L; Meis, C; Kupecek, Ph; Mennerat, G; Mauchien, P; Chaleard, C; Kocon, S; Lacour, J L; Gueneau, C; Dauvois, V; Gonella, C; Berhier, C; Lameille, J M [CEA Saclay, 91 - Gif-sur-Yvette (France). Dept. des Procedes d` enrichissement; and others

1998-12-31

This report presents the work realized in 1996 by CEA-DCC (Direction du Cycle du Combustible). The main study fields are: laser beam stabilization, copper vapor laser (LVC) modelling, vapor density measurements, light transport in thick vapor, uranium evaporation, GdR-PRACTIS activities, uranyl organo phosphates, actinide extraction, ultra son in chemistry, oxidation mechanisms, salt free processes, tributyl phosphate (TBP) stability, cation exchanging membranes, filtering mineral membranes, liquid-liquid extraction processes, centrifugal contactor, supercritical phase, iodine reduction, weapon plutonium reprocessing, long term waste packaging, clay behaviour modelling; gas formation in deep storages, water-clay chemical interaction, nuclear glass behaviour, actinide storage dies, radionuclide release in storage, waste storage dies, iodine conditioning, cesium extraction by calix[4]arene molecules, decontamination foam, oxidation by supercritical water, decontamination by electrolysis, microorganism actions on metals, long life radionuclide determination in wastes, active and passive tomography, sulfated wastes, zircon-titanates ceramics, direct storage of irradiated fuel, caramel type fuel dismantling, radioprotection calculation codes, diffraction of backscattered electrons, infrared light coherent source, optical spectrometry, physical and chemical aspect of corium, iron-nickel-chromium alloy corrosion, natural uranium perspective, Atalante installation, interlaboratory comparisons. (A.C.)

Lower Grande Ronde smolt trap monitoring. Annual report 1996

International Nuclear Information System (INIS)

Setter, A.; Carmichael, R.W.

1998-01-01

The authors sampled downstream migrating salmonids at Boggan's Oasis in the Grande Ronde River with a screw trap during 1995 and a scoop trap during 1996. Sampling began in March and terminated early in June. Wild spring chinook and wild/hatchery steelhead were collected and marked to assess migration patterns and timing. Fish were marked with tags in order to obtain downstream migration data with minimal fish handling. Observations were recorded when a fish swam through an interrogation monitor at hydroelectric facilities downstream. The second year for monitoring smolts leaving the Grande Ronde River was completed in 1995. The authors continued to pursue moving to a permanent location downstream for 1997 because of the limitations for trapping smolts at Boggan's Oasis. This involved reconnaissance surveys of several potential sites near the mouth of the river from 1994--1996. During February of 1996, a water velocity and bottom topography assessment was completed. Results of the assessment were used for siting the anchoring tower structure upstream approximately 1.2 miles from the mouth of the Grande Ronde River

High Energy Physics Division semiannual report of research activities, January 1, 1996--June 30, 1996

International Nuclear Information System (INIS)

Norem, J.; Rezmer, R.; Wagner, R.

1997-07-01

This report describes the research conducted in the High Energy Physics Division of Argonne National Laboratory during the period of January 1 - June 30, 1996. Topics covered here include experimental and theoretical particle physics, advanced accelerator physics, detector development, and experimental facilities research. List of Division publications and colloquia are included

Coal industry annual 1996

International Nuclear Information System (INIS)

1997-11-01

This report presents data on coal consumption, coal distribution, coal stocks, coal prices, and coal quality, and emissions for Congress, Federal and State agencies, the coal industry, and the general public. Appendix A contains a compilation of coal statistics for the major coal-producing States.This report does not include coal consumption data for nonutility power producers that are not in the manufacturing, agriculture, mining, construction, or commercial sectors. Consumption for nonutility power producers not included in this report is estimated to be 24 million short tons for 1996. 14 figs., 145 tabs

Coal industry annual 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-11-01

This report presents data on coal consumption, coal distribution, coal stocks, coal prices, and coal quality, and emissions for Congress, Federal and State agencies, the coal industry, and the general public. Appendix A contains a compilation of coal statistics for the major coal-producing States.This report does not include coal consumption data for nonutility power producers that are not in the manufacturing, agriculture, mining, construction, or commercial sectors. Consumption for nonutility power producers not included in this report is estimated to be 24 million short tons for 1996. 14 figs., 145 tabs.

America’s Shadow Warriors on a Mission to Kill Pablo: Focus on Special Operations Forces in Light of Afghanistan

Science.gov (United States)

2002-04-19

in 1999-2000. However, Bowden gets lots of Colombia-specific details right to those familiar with the country, even the Hotel Tequendama. He...teams sent there in the 1960’s. Clancy/Stiner state that with SF help, “La violencia ” in Colombia ended. Although Colombia experienced a

Petroleum supply annual 1996: Volume 2

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-06-01

The Petroleum Supply Annual (PSA) contains information on the supply and disposition of crude oil and petroleum products. The publication reflects data that were collected from the petroleum industry during 1996 through monthly surveys. The PSA is divided into two volumes. The first volume contains three sections: Summary Statistics, Detailed Statistics, and Refinery Capacity; each with final annual data. The second volume contains final statistics for each month of 1996, and replaces data previously published in the Petroleum Supply Monthly (PSM). The tables in Volumes 1 and 2 are similarly numbered to facilitate comparison between them. Explanatory Notes, located at the end of this publication, present information describing data collection, sources, estimation methodology, data quality control procedures, modifications to reporting requirements and interpretation of tables. Industry terminology and product definitions are listed alphabetically in the Glossary. 35 tabs.

Petroleum supply annual 1996: Volume 2

International Nuclear Information System (INIS)

1997-06-01

The Petroleum Supply Annual (PSA) contains information on the supply and disposition of crude oil and petroleum products. The publication reflects data that were collected from the petroleum industry during 1996 through monthly surveys. The PSA is divided into two volumes. The first volume contains three sections: Summary Statistics, Detailed Statistics, and Refinery Capacity; each with final annual data. The second volume contains final statistics for each month of 1996, and replaces data previously published in the Petroleum Supply Monthly (PSM). The tables in Volumes 1 and 2 are similarly numbered to facilitate comparison between them. Explanatory Notes, located at the end of this publication, present information describing data collection, sources, estimation methodology, data quality control procedures, modifications to reporting requirements and interpretation of tables. Industry terminology and product definitions are listed alphabetically in the Glossary. 35 tabs

Presidential Green Chemistry Challenge: 1996 Small Business Award

Science.gov (United States)

Presidential Green Chemistry Challenge 1996 award winner, Donlar, developed thermal polyaspartate, a nontoxic, biodegradable, biobased polymer made in a highly efficient process for use in agriculture, water treatment, etc.

Airline Quality Rating 1996

OpenAIRE

Bowen, Brent D.; Headley, Dean E.

1996-01-01

The Airline Quality Rating (AQR) was developed and first announced in early 1991 as an objective method of comparing airline performance on combined multiple factors important to consumers. Development history and calculation details for the AQR rating system are detailed in The Airline Quality Rating issued in April, 1991, by the National Institute for Aviation Research at Wichita State University. This current report, Airline Quality Rating 1996, contains monthly Airline Quality Rating scor...

Registratie van Seksueel Overdraagbare Aandoeningen bij GGD-en: jaarverslag 1996

NARCIS (Netherlands)

Laar MJW van de; Termorshuizen F; CIE

1998-01-01

In 1996 the total number of consultations on STD and HIV-testing at STD clinics and municipal health services was 13,226 and increased with 12.5% compared with 1995 (women 18%; men 7%). The total number of diagnosed STD was 4,976 and increased with 10.1% in 1996 compared with 1995 (women 16.9%; men

Paul Scherrer Institut annual report 1996. Annex I. PSI-F1-Newsletter 1996 nuclear and particle physics. Muons in solid-state physics and chemistry

Energy Technology Data Exchange (ETDEWEB)

Herlach, D.; Kettle, P.R.; Buechli, C. [eds.] [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

1997-02-01

This newsletter contains reports from the F1-Department and its Divisions. The contributions are categorized as follows: - activities of the F1-Department of PSI, - nuclear and particle physics supported by the Department, -applications of muons in solid-state physics and chemistry. Groups were asked to present new, preliminary or final results obtained in 1996, as well as a publication list, related to F1-supported work which had appeared in scientific journals during 1996. (author) figs., tabs., refs.

Paul Scherrer Institut annual report 1996. Annex I. PSI-F1-Newsletter 1996 nuclear and particle physics. Muons in solid-state physics and chemistry

International Nuclear Information System (INIS)

Herlach, D.; Kettle, P.R.; Buechli, C.

1997-02-01

This newsletter contains reports from the F1-Department and its Divisions. The contributions are categorized as follows: - activities of the F1-Department of PSI, - nuclear and particle physics supported by the Department, -applications of muons in solid-state physics and chemistry. Groups were asked to present new, preliminary or final results obtained in 1996, as well as a publication list, related to F1-supported work which had appeared in scientific journals during 1996. (author) figs., tabs., refs

Mesoherbivores affect grasshopper communities in a megaherbivore-dominated South African savannah.

Science.gov (United States)

van der Plas, Fons; Olff, Han

2014-06-01

African savannahs are among the few places on earth where diverse communities of mega- and meso-sized ungulate grazers dominate ecosystem functioning. Less conspicuous, but even more diverse, are the communities of herbivorous insects such as grasshoppers, which share the same food. Various studies investigated the community assembly of these groups separately, but it is poorly known how ungulate communities shape grasshopper communities. Here, we investigated how ungulate species of different body size alter grasshopper communities in a South African savannah. White rhino is the most abundant vertebrate herbivore in our study site. Other common mesoherbivores include buffalo, zebra and impala. We hypothesized that white rhinos would have greater impact than mesoherbivores on grasshopper communities. Using 10-year-old exclosures, at eight sites we compared the effects of ungulates on grasshopper communities in three nested treatments: (i) unfenced plots ('control plots') with all vertebrate herbivores present, (ii) plots with a low cable fence, excluding white rhino ('megaherbivore exclosures'), and (iii) plots with tall fences, excluding all herbivores larger than rodents ('complete ungulate exclosures'). In each plot, we collected data of vegetation structure, grass and grasshopper community composition. Complete ungulate exclosures contained 30% taller vegetation than megaherbivore exclosures and they were dominated by different grass and grasshopper species. Grasshoppers in complete ungulate exclosures were on average 3.5 mm longer than grasshoppers in megaherbivore exclosures, possibly due to changes in plant communities or vegetation structure. We conclude that surprisingly, in this megaherbivore hotspot, mesoherbivores, instead of megaherbivores, most strongly affect grasshopper communities.

Trypanosoma brucei gambiense trypanosomiasis in Terego county, northern Uganda, 1996: a lot quality assurance sampling survey.

Science.gov (United States)

Hutin, Yvan J F; Legros, Dominique; Owini, Vincent; Brown, Vincent; Lee, Evan; Mbulamberi, Dawson; Paquet, Christophe

2004-04-01

We estimated the pre-intervention prevalence of Trypanosoma brucei gambiense (Tbg) trypanosomiasis using the lot quality assurance sampling (LQAS) methods in 14 parishes of Terego County in northern Uganda. A total of 826 participants were included in the survey sample in 1996. The prevalence of laboratory confirmed Tbg trypanosomiasis adjusted for parish population sizes was 2.2% (95% confidence interval =1.1-3.2). This estimate was consistent with the 1.1% period prevalence calculated on the basis of cases identified through passive and active screening in 1996-1999. Ranking of parishes in four categories according to LQAS analysis of the 1996 survey predicted the prevalences observed during the first round of active screening in the population in 1997-1998 (P LQAS were validated by the results of the population screening, suggesting that these survey methods may be useful in the pre-intervention phase of sleeping sickness control programs.

Final report for the 1996 Engineer Starters Program (Pre-Freshmen Enrichment Program)

Energy Technology Data Exchange (ETDEWEB)

Sharpe, L. Jr.

1996-08-15

This report has been developed for the North Carolina Agricultural and Technical State University College of Engineering, Department of Energy and other foundations/corporations sponsoring the 1996 Engineer Starters Program and for general information. The College of Engineering conducted its Annual outreach program for Middle and High School students from July 8 to August 2, 1996. The continuing primary goal of this program is to expose youth to the various challenging opportunities in the Mathematics and Science based careers, Engineering and Technology. The curriculum for the summer of 1996 included: Mathematics; Science; Computers; Graphics; Problem Solving; Career Explorations; Communications; Field Trips to Manufacturing Plants/Industries; and Engineering Projects/Designs. The 1996 program included rising seventh through tenth graders. Parental involvement was instituted as a vital component of the summer experiences. The primary objective is to increase the number of minorities entering engineering and science professions.

1996, a turning point in the evolution of the EDF with good financial results; 1996, une annee charniere dans l'evolution d'EDF avec de bons resultants financiers

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-03-01

This conference held on March 1997 presents the financial results obtained in 1996 by French Electricity Company EDF (Electricite de France). This year represented a turning point because essential landmarks were established in 1996. An european directive has been adopted in 1996 defining the framework in which european electricity market will function as well as the rules for its opening to competition. Discussions with the trade unions were conducted at the beginning of 1997and a social agreement aiming at the amelioration of services and hiring of 11,000 to 15,000 young people in the next three years. Finally, a new contract of enterprise with the state has been discussed and approved in March 5, 1997, which redefined the place and the role of EDF in the French economy, in the new stage of electricity market started by the opening to competition. The document contains the following 8 chapters: 1. Financial results and enterprise management; 2. Institutional frame and the relation with the state; 3. Development in France; 4. International development; 5. Alliances, partnerships and cooperation; 6. Management, social and human resources; 7. Environment; 8. Technical results.

Progress report 1996 - 1997

International Nuclear Information System (INIS)

1998-01-01

This report reviews the activities of the laboratory for the years 1996 and 1997. Laboratory's activities are driven by an important international program on particle physics and astro-particles. 9 topics are presented: 1) physics at LHC: the ATLAS experiment, 2) the search for a new physics at LEP : DELPHI experiment, 3) neutrino oscillations: NOMAD and TONIC experiments, 4) the experiments H1 at HERA, 5) CP breaking: BABAR experiment, 6) DO experiment at the Tevatron, 7) gamma radiation sources: CAT experiment, 8) supernova, and 9) the project of the AUGER observatory

ECP divisional training: plan 1996

OpenAIRE

Storr, Kenneth Mick

1996-01-01

The divisional training plan is produced each year at the request of the Joint Training Board (JTB) following a recommendation in the 1991 CERN Training Plan which states that divisions should produce a plan setting out training priorities. This plan presents a review of training activities. a report on ECP progress in implementing the recommendations of the 1995 CERN training plan, a discussion of divisional training objectives, and a summary of training requests generated by the 1996 period...

Calculation of statistic estimates of kinetic parameters from substrate uncompetitive inhibition equation using the median method

Directory of Open Access Journals (Sweden)

Pedro L. Valencia

2017-04-01

Full Text Available We provide initial rate data from enzymatic reaction experiments and tis processing to estimate the kinetic parameters from the substrate uncompetitive inhibition equation using the median method published by Eisenthal and Cornish-Bowden (Cornish-Bowden and Eisenthal, 1974; Eisenthal and Cornish-Bowden, 1974. The method was denominated the direct linear plot and consists in the calculation of the median from a dataset of kinetic parameters Vmax and Km from the Michaelis–Menten equation. In this opportunity we present the procedure to applicate the direct linear plot to the substrate uncompetitive inhibition equation; a three-parameter equation. The median method is characterized for its robustness and its insensibility to outlier. The calculations are presented in an Excel datasheet and a computational algorithm was developed in the free software Python. The kinetic parameters of the substrate uncompetitive inhibition equation Vmax, Km and Ks were calculated using three experimental points from the dataset formed by 13 experimental points. All the 286 combinations were calculated. The dataset of kinetic parameters resulting from this combinatorial was used to calculate the median which corresponds to the statistic estimator of the real kinetic parameters. A comparative statistical analyses between the median method and the least squares was published in Valencia et al. [3].

Communication of 7 February 1996 received from the Permanent Mission of Australia to the International Atomic Energy Agency

International Nuclear Information System (INIS)

1996-01-01

On 7 February 1996, the Director General received a communication of 6 February 1996 from the Resident Representative of Australia transmitting Statements made by the Prime Minister of Australia on 28 January 1996 about the sixth nuclear test by France at Fangataufa and on 30 January 1996 about the subsequent announcement of France's commitment to sign the South Pacific Nuclear Free Zone Treaty and a Comprehensive Test Ban Treaty in 1996

CBTs Budget for 1997 og Arbejdsplaner for 1996 - 1999

DEFF Research Database (Denmark)

Jeppesen, Palle

1996-01-01

For Center for Bredbånds Telekommunikation beskrives budget for 1997 samt forskningsplaner for 1996-1999 for områderne optiske netværk, gigabit elektronik, optiske bølgeledere og bredbåndsswitching samt for højhastighedssystemer.......For Center for Bredbånds Telekommunikation beskrives budget for 1997 samt forskningsplaner for 1996-1999 for områderne optiske netværk, gigabit elektronik, optiske bølgeledere og bredbåndsswitching samt for højhastighedssystemer....

Presidential Green Chemistry Challenge: 1996 Academic Award

Science.gov (United States)

Presidential Green Chemistry Challenge 1996 award winner, Professor Mark Holtzapple, developed methods to convert waste biomass (e.g., sewage sludge, agricultural wastes), into animal feed, industrial chemicals, or fuels.

Work at Forsmark since ASSET 1996

Energy Technology Data Exchange (ETDEWEB)

Loewenhielm, G; Andersson, O [Forsmark Kraftgrupp AB, Oesthammar (Sweden)

1997-10-01

The following directions of work at Forsmark since ASSET 1996 are briefly described: peer review follow-up; work related to peer review, Forsmark 2 mini-ASSET; MTO(man-technology-organization)-analysis method, concept development, combination of MTO and ASSET methods; Forsmark INES manual.

Consistent individual differences and population plasticity in network-derived sociality: An experimental manipulation of density in a gregarious ungulate

Science.gov (United States)

O’Brien, Paul P.; Vander Wal, Eric

2018-01-01

In many taxa, individual social traits appear to be consistent across time and context, thus meeting the criteria for animal personality. How these differences are maintained in response to changes in population density is unknown, particularly in large mammals, such as ungulates. Using a behavioral reaction norm (BRN) framework, we examined how among- and within-individual variation in social connectedness, measured using social network analyses, change as a function of population density. We studied a captive herd of elk (Cervus canadensis) separated into a group of male elk and a group of female elk. Males and females were exposed to three different density treatments and we recorded social associations between individuals with proximity-detecting radio-collars fitted to elk. We constructed social networks using dyadic association data and calculated three social network metrics reflective of social connectedness: eigenvector centrality, graph strength, and degree. Elk exhibited consistent individual differences in social connectedness across densities; however, they showed little individual variation in their response to changes in density, i.e., individuals oftentimes responded plastically, but in the same manner to changes in density. Female elk had highest connectedness at an intermediate density. In contrast, male elk increased connectedness with increasing density. Whereas this may suggest that the benefits of social connectedness outweigh the costs of increased competition at higher density for males, females appear to exhibit a threshold in social benefits (e.g. predator detection and forage information). Our study illustrates the importance of viewing social connectedness as a density-dependent trait, particularly in the context of plasticity. Moreover, we highlight the need to revisit our understanding of density dependence as a population-level phenomenon by accounting for consistent individual differences not only in social connectedness, but likely

Annual report 1996 NV Gemeenschappelijk Kolenbureau Elektriciteitsproduktiebedrijven (GKE)

International Nuclear Information System (INIS)

1997-01-01

GKE Vliegasunie is responsible for supplying the coal for the Dutch electricity generating companies and for the sale of the construction raw materials produced as by-products of coal-based electricity generation. In 1996 emphasis was placed on achieving the lowest coal prices possible and therefore working towards achieving the lowest electricity price in Europe. The annual report also gives details of GKE Vliegasunie's business and activities during the year including information on coal markets, logistics, coal markets, throughput and coal stocks and coal fly ash production. Financial data for the year ending 31 December 1996 is included

1995-1996 Landsat TM False Color Composite

Data.gov (United States)

Minnesota Department of Natural Resources — Land imagery derived from 30 meter resolution Thematic Mapper satellite data. Source imagery dates ranging from June 1995 to June 1996. DNR performed additional...

[Economic burden of stomach cancer in China during 1996-2015: a systematic review].

Science.gov (United States)

Yao, F; Shi, C L; Liu, C C; Wang, L; Song, S M; Ren, J S; Guo, C G; Lou, P A; Dai, M; Zhu, L; Shi, J F

2017-08-06

Objective: To clarify the research status of economic burden of stomach cancer in China from 1996 to 2015. Methods: Based on three electronic literature databases (China Knowledge Resource Integrated Database, Wanfang Database and PubMed), a total of 2 873, 1 244 and 84 articles published during 1996 to 2015 were found, respectively, using keywords of"cancer","neoplasms","malignant tumor","tumor","economic burden","health expenditure","cost","cost of illness", and"China". According to the inclusion and exclusion criteria, 30 literatures were included in the final analysis. Then the basic information and study subjects, indicators and main results of economic burden were abstracted and analyzed. All the expenditure data were discounted to the values in 2013 by using China's percapita consumer price index. Results: Totally, 30 articles were included, covering 14 provinces and of which 16 were published during 2011-2015. One article was based on population-level and the remaining studies were all based on individual-level. The number of individual-level articles that reported direct medical, non-medical and indirectly economic burden was 29, 1 and 2, respectively. The main indicators of direct medical expenditure were expenditure per patient (22), per clinical visit (9) and per diem (11), respectively. The median expenditure per patient was 7 387-28 743 RMB (CNY), with average annual growth rate (AAGR) of 1.7% (1996-2013). The median expenditure per clinical visit was 18 504-41 871 RMB (2003-2013), with AAGR of 5.5%. The median expenditure per diem was 313-1 445 RMB (1996-2012), with AAGR of 3.7%. Difference was found among provinces. Conclusions: The evidence for economic burden of stomach cancer was still limited over the past two decades and mainly focused on individual and regional levels. An increase and differences in provinces were observed in direct medical expenditure. Evaluation on direct non-medical and indirect medical expenditure needs to be addressed.

CTD data from CTD casts in the Northeast Pacific Ocean from NOAA Ship DISCOVERER and other platforms from 1996-03-09 to 1996-06-24 (NODC Accession 9600096)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — CTD data were collected from CTD casts from NOAA Ship DISCOVERER and other platforms in the Northeast Pacific Ocean from 09 March 1996 to 24 June 1996. Data were...

Working Papers in Educational Linguistics, 1996-1997.

Science.gov (United States)

Furumoto, Mitchell A., Ed.; And Others

1997-01-01

Reports of language research in the 1996 issue include: "Corpus Planning for the Southern Peruvian Quechua Language" (Serafin M. Coronel-Molina); "Foreign Language Planning in U.S. Higher Education: The Case of a Graduate Business Program" (Mitchell A. Furumoto); "Charting New Directions: Of Communication in a Social…

Environmental Report 1996, Volume 2

Energy Technology Data Exchange (ETDEWEB)

Harrach, R.J.

1996-01-01

This is Volume 2 of the Lawrence Livermore National Laboratory`s (LLNL`s) annual Environmental Report 1996, prepared for the US Department of Energy. Volume 2 supports Volume 1 summary data and is essentially a detailed data report that provides individual data points, where applicable. Volume 2 includes information on monitoring of air, air effluents, sewerable water, surface water, ground water, soil and sediment, vegetation and foodstuff, environmental radiation, and quality assurance.

Licensee contractor and vendor inspection status report. Quarterly report, October--December 1996

International Nuclear Information System (INIS)

1997-03-01

This periodical covers the results of inspections performed by the NRC's Special Inspection Branch, Vendor Inspection Section, that have been distributed to the inspected organizations during the period from October 1996 through December 1996

Alternatives to traditional transportation fuels 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-01

Interest in alternative transportation fuels (ATF`s) has increased in recent years due to the drives for cleaner air and less dependence upon foreign oil. This report, Alternatives to Traditional Transportation Fuels 1996, provides information on ATFs, as well as the vehicles that consume them.

Hawaii Small Boat Cost-Earnings Data: 1995-1996

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — These data represent a cost-earnings study of the Hawaii small boat fishery in 1995-1996. Data collected include fisher classification, vessel characteristics,...

Papillary thyroid carcinoma in Denmark 1996-2008

DEFF Research Database (Denmark)

Londero, Stefano Christian; Krogdahl, Annelise; Bastholt, Lars

2013-01-01

question this assumption. Methods: National, unselected, prospective cohort study of 1350 papillary thyroid cancer patients in Denmark from 1996 to 2008. Objective: To analyze changes in incidence by time and to identify factors which might influence detection rate. Results: A rise in incidence is seen...

Summary of the Hanford Site environmental report for calendar year 1996

International Nuclear Information System (INIS)

Hanf, R.W.; O'Connor, G.P.; Dirkes, R.L.

1997-08-01

This report summarizes the 420-page Hanford Site Environmental Report for Calendar Year 1996. The Hanford Site environmental report is prepared annually to summarize environmental data and information, describe environmental management performance, demonstrate the status of compliance with environmental regulations, and highlight major environmental programs and efforts. The summary is designed to briefly: describe the Hanford Site and its mission; summarize the status in 1996 of compliance with environmental regulations; describe environmental programs at the Hanford Site; discuss estimated radionuclide exposure to the public from 1996 Hanford Site activities; present information on effluent monitoring and environmental surveillance, including groundwater protection and monitoring; and discuss activities to ensure quality

Summary of the Hanford Site environmental report for calendar year 1996

Energy Technology Data Exchange (ETDEWEB)

Hanf, R.W.; O`Connor, G.P.; Dirkes, R.L. [eds.] [comps.

1997-08-01

This report summarizes the 420-page Hanford Site Environmental Report for Calendar Year 1996. The Hanford Site environmental report is prepared annually to summarize environmental data and information, describe environmental management performance, demonstrate the status of compliance with environmental regulations, and highlight major environmental programs and efforts. The summary is designed to briefly: describe the Hanford Site and its mission; summarize the status in 1996 of compliance with environmental regulations; describe environmental programs at the Hanford Site; discuss estimated radionuclide exposure to the public from 1996 Hanford Site activities; present information on effluent monitoring and environmental surveillance, including groundwater protection and monitoring; and discuss activities to ensure quality.

The Copenhagen Forum 1996-2016

DEFF Research Database (Denmark)

Ry Nielsen, Jens Carl; Raine, John

2016-01-01

Purpose: This chapter tells the story of the initiation, development (over two decades) and collective contribution of the Copenhagen Forum since its foundation in 1996. This Forum comprises a grouping of teachers and directors of masters-level public administrative programmes (notably the MPA) f...... the inspiration for this volume, and the individual contributions, derive. It is a context that has been all about a shared fascination with, and collective commitment to, the advancement of learning and development among practicing public managers....

1996 Activities report on energies and raw materials

International Nuclear Information System (INIS)

1996-01-01

The 1996 activity survey of the French General Directory for Energy and Raw Materials, which main objectives are to preserve the competitiveness of French economy, enhance environmental protection, secure the long term supply safety and maintain the public service basis for energy supply, is presented. The main themes of the survey are: the nuclear safety in Eastern Europe, the electric power inland market, the evolution of the oil market in 1996, the situation of refining in France, restructuring the BRGM (Mining and Geological Research Bureau), followed by brief facts concerning the sustainable energy development, nuclear energy, electric power, electricity and gas common issues, gas, coal, petroleum products, raw materials and underground materials. A series of global diagrams concludes the survey

Annual report and accounts 1996

International Nuclear Information System (INIS)

1997-12-01

This report outlines the work of the Radiological Protection Institute of Ireland (RPII) during 1996. Some developments during the year were the concerns about the effects in the Irish Sea of increased discharges of technetium-99 from Sellafield, an international emergency exercise which incorporated an exercise of Ireland's National Emergency Plan dor Nuclear Accidents, the organisation of a conference marking the tenth anniversary of the Chernobyl accident and further work on the Institute's national survey of radon in dwellings

Federal Energy Regulatory Commission`s fiscal year 1996 financial statement audit

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-02-14

This report presents the results of the independent certified public accountants` audit of the Federal Energy Regulatory Commission`s (FERC) financial statements as of September 30, 1996. The auditors have expressed an unqualified opinion on the 1996 statement of financial position and the related statements of operations and changes in net position.

Savannah River site environmental report for 1996

Energy Technology Data Exchange (ETDEWEB)

Arnett, M.; Mamatey, A. [eds.

1998-12-31

The mission at the Savannah River Site (SRS) has changed from the production of nuclear weapons materials for national defense to the management of site-generated waste, restoration of the surrounding environment, and the development of industry in and around the site. However, SRS-through its prime operating contractor, Westinghouse Savannah River Company (WSRC)-continues to maintain a comprehensive environmental monitoring program. In 1996, effluent monitoring and environmental surveillance were conducted within a 31,000-square-mile area in and around SRS that includes neighboring cities, towns, and counties in Georgia and South Carolina and extends up to 100 miles from the site. Though the environmental monitoring program was streamlined in 1996-to improve its cost-effectiveness without compromising data quality or reducing its overall ability to produce critical information-thousands of samples of air, surface water, groundwater, food products, drinking water, wildlife, rainwater, soil, sediment, and vegetation were collected and analyzed for radioactive and nonradioactive contaminants.

Savannah River site environmental report for 1996

International Nuclear Information System (INIS)

Arnett, M.; Mamatey, A.

1998-01-01

The mission at the Savannah River Site (SRS) has changed from the production of nuclear weapons materials for national defense to the management of site-generated waste, restoration of the surrounding environment, and the development of industry in and around the site. However, SRS-through its prime operating contractor, Westinghouse Savannah River Company (WSRC)-continues to maintain a comprehensive environmental monitoring program. In 1996, effluent monitoring and environmental surveillance were conducted within a 31,000-square-mile area in and around SRS that includes neighboring cities, towns, and counties in Georgia and South Carolina and extends up to 100 miles from the site. Though the environmental monitoring program was streamlined in 1996-to improve its cost-effectiveness without compromising data quality or reducing its overall ability to produce critical information-thousands of samples of air, surface water, groundwater, food products, drinking water, wildlife, rainwater, soil, sediment, and vegetation were collected and analyzed for radioactive and nonradioactive contaminants

Summaries of FY 1996 engineering research

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-06-01

This report documents the Basic Energy Sciences (BES) Engineering Research Program for fiscal year 1996; it provides a summary for each of the program projects in addition to a brief program overview. The report is intended to provide staff of Congressional committees, other executive departments, and other DOE offices with substantive program information so as to facilitate governmental overview and coordination of Federal research programs. Of equal importance, its availability facilitates communication of program information to interested research engineers and scientists. Each BES Division administers basic, mission oriented research programs in the area indicated by its title. The BES Engineering Research Program is one such program; it is administered by the Engineering and Geosciences Division of BES. In preparing this report the principal investigators were asked to submit summaries for their projects that were specifically applicable to fiscal year 1996. The summaries received have been edited if necessary, but the press for timely publication made it impractical to have the investigators review and approve the revised summaries prior to publication. For more information about a given project, it is suggested that the investigators be contacted directly.

Results on safety research for five years (from fiscal year 1996 to 2000). A field of power reactors

International Nuclear Information System (INIS)

2001-10-01

This safety research carried out by the Japan Nuclear Cycle Development Institute (JNC) for five years ranged from 1996 to 2000 fiscal year, was performed according to the safety research basic plan (from 1996 to 2000 fiscal year) established on March, 1996 (revised again on May, 2000). This report was arranged on a field on power reactors (all subjects on fields of advanced conversion reactor and a subject on power reactor in a field of seismic resistant and probability theoretical safety evaluation) by combining its research results for five years ranged from 1996 to 2000 fiscal year with general outlines on the safety research basic plan. Here were shown outlines on the safety research basic plan, aims and subjects on safety research at a field of power reactors, a list of survey sheets on safety research result, and survey sheets on safety research results. The survey sheets containing research field, title, organization, researcher name, researching period, names of cooperative organization, using facilities, research outline, research results, established contents, application, and research trends, are ranged to 5 items on advanced conversion reactor, 29 items on high breeder reactor, 1 item on seismic resistance, and 5 items on probability theoretical safety evaluation. (G.K.)

Seismicity Catalog Collection, 2150 BC to 1996 AD

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Seismicity Catalog Collection is a compilation data on over four million earthquakes dating from 2150 BC to 1996 AD from NOAA's National Geophysical Data Center...

Electric sales and revenue 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-01

Information is provided on electricity sales, associated revenue, average revenue per kilowatthour sold, and number of consumers throughout the US. The data provided in the Electric Sales and Revenue are presented at the national, Census division, State, and electric utility levels. The information is based on annual data reported by electric utilities for the calendar year ending December 31, 1996. 16 figs., 20 tabs.

Law no. 111/1996 on the safe deployment of nuclear activities - A law central to the Romanian nuclear law system

International Nuclear Information System (INIS)

Chiripus, Vlad-Ionut

2004-01-01

Law no. 111/1996 on the safe deployment of nuclear activities was published in its original form in the Official Gazette of Romania, Part no. 267 of 29th October 1996. The complexity of this law prevents from performing a comprehensive analysis of the legal provisions thereof for which reason the author shall review only those aspects he consider to be relevant to the issues dealt with by this law. Furthermore, as the author intends his undertaking to be a comparative analysis of Law no. 111/1996 in its successive stages - from its issue till the present - he uses mostly the present tense even though the law has been amended and in some respects the changes are quite significant. The presentation contains the following three sections: 1. Passing of Law no. 111/1996 on the safe deployment of nuclear activities - a turning point in the development of the Romanian nuclear law; 2. The successive modifications of Law no. 111/1996 on safe deployment of nuclear activities; 3. Law no. 193/2003 for the modification and completion of Law no. 111/1996 on the safe deployment of nuclear activities - a key moment in the modernization of Romanian nuclear law and harmonization with the relevant international requirement. In conclusion, the issue of Law no. 111/1996 on safe deployment of nuclear activities represents a turning point in the development of Romanian nuclear law. From this moment on one may regard it as a modern area of the Romanian law, European in spirit. The pre-existent legal framework - namely the Law no. 61/1974 on the deployment of activities in the Romanian nuclear field - was no longer up to the existing standards and its replacement by a new, modern law, fully harmonized with the European and NATO accession requirements was a must. Such a new, European law was to fully guarantee the safe deployment of nuclear activities for exclusively peaceful purposes, so that the requirements regarding the nuclear safety, protection of professionally exposed personnel

Building beef cow nutritional programs with the 1996 NRC beef cattle requirements model.

Science.gov (United States)

Lardy, G P; Adams, D C; Klopfenstein, T J; Patterson, H H

2004-01-01

Designing a sound cow-calf nutritional program requires knowledge of nutrient requirements, diet quality, and intake. Effectively using the NRC (1996) beef cattle requirements model (1996NRC) also requires knowledge of dietary degradable intake protein (DIP) and microbial efficiency. Objectives of this paper are to 1) describe a framework in which 1996NRC-applicable data can be generated, 2) describe seasonal changes in nutrients on native range, 3) use the 1996NRC to predict nutrient balance for cattle grazing these forages, and 4) make recommendations for using the 1996NRC for forage-fed cattle. Extrusa samples were collected over 2 yr on native upland range and subirrigated meadow in the Nebraska Sandhills. Samples were analyzed for CP, in vitro OM digestibility (IVOMD), and DIP. Regression equations to predict nutrients were developed from these data. The 1996NRC was used to predict nutrient balances based on the dietary nutrient analyses. Recommendations for model users were also developed. On subirrigated meadow, CP and IVOMD increased rapidly during March and April. On native range, CP and IVOMD increased from April through June but decreased rapidly from August through September. Degradable intake protein (DM basis) followed trends similar to CP for both native range and subirrigated meadow. Predicted nutrient balances for spring- and summer-calving cows agreed with reported values in the literature, provided that IVOMD values were converted to DE before use in the model (1.07 x IVOMD - 8.13). When the IVOMD-to-DE conversion was not used, the model gave unrealistically high NE(m) balances. To effectively use the 1996NRC to estimate protein requirements, users should focus on three key estimates: DIP, microbial efficiency, and TDN intake. Consequently, efforts should be focused on adequately describing seasonal changes in forage nutrient content. In order to increase use of the 1996NRC, research is needed in the following areas: 1) cost-effective and

ISOLDE 1996-1999: Preparing for new science opportunities

CERN Multimedia

CERN. Geneva

2014-01-01

1996-1999 was a time in which ISOLDE saw important changes. In order to make space for REX-ISOLDE the experimental hall saw its first extension and first equipment for REX-ISOLDE was installed and commissioned.

Theseus First Flight - May 24, 1996

Science.gov (United States)

1996-01-01

The Theseus prototype research aircraft shows off its high aspect-ratio wing as it lifts off from Rogers Dry Lake during its first test flight from NASA's Dryden Flight Research Center, Edwards, California, on May 24, 1996. The Theseus aircraft, built and operated by Aurora Flight Sciences Corporation, Manassas, Virginia, was a unique aircraft flown at NASA's Dryden Flight Research Center, Edwards, California, under a cooperative agreement between NASA and Aurora. Dryden hosted the Theseus program, providing hangar space and range safety for flight testing. Aurora Flight Sciences was responsible for the actual flight testing, vehicle flight safety, and operation of the aircraft. The Theseus remotely piloted aircraft flew its maiden flight on May 24, 1996, at Dryden. During its sixth flight on November 12, 1996, Theseus experienced an in-flight structural failure that resulted in the loss of the aircraft. As of the beginning of the year 2000, Aurora had not rebuilt the aircraft. Theseus was built for NASA under an innovative, $4.9 million fixed-price contract by Aurora Flight Sciences Corporation and its partners, West Virginia University, Morgantown, West Virginia, and Fairmont State College, Fairmont, West Virginia. The twin-engine, unpiloted vehicle had a 140-foot wingspan, and was constructed largely of composite materials. Powered by two 80-horsepower, turbocharged piston engines that drove twin 9-foot-diameter propellers, Theseus was designed to fly autonomously at high altitudes, with takeoff and landing under the active control of a ground-based pilot in a ground control station 'cockpit.' With the potential ability to carry 700 pounds of science instruments to altitudes above 60,000 feet for durations of greater than 24 hours, Theseus was intended to support research in areas such as stratospheric ozone depletion and the atmospheric effects of future high-speed civil transport aircraft engines. Instruments carried aboard Theseus also would be able to

Outline of the safety research results, in the power reactor field, fiscal year 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-11-01

The Power Reactor and Nuclear Fuel Development Corporation (PNC) has promoted the safety research in fiscal year of 1996 according to the Fundamental Research on Safety Research (fiscal year 1996 to 2000) prepared on March, 1996. Here is described on the research results in fiscal year 1996, the first year of the 5 years programme, and whole outline of the fundamental research on safety research, on the power reactor field (whole problems on the new nuclear converter and the fast breeder reactor field and problems relating to the power reactor in the safety for earthquake and probability theoretical safety evaluation field). (G.K.)

Interim sanitary landfill groundwater monitoring report. 1996 Annual report

International Nuclear Information System (INIS)

Bagwell, L.A.

1997-01-01

Eight wells of the LFW series monitor groundwater quality in the Steed Pond Aquifer (Water Table) beneath the Interim Sanitary Landfill at the Savannah River Site. These wells are sampled semiannually to comply with the South Carolina Department of Health and Environmental Control Modified Municipal Solid Waste Permit 025500-1120 and as part of the SRS Groundwater Monitoring Program. Trichlorofluoromethane and 1,1,1-trichloroethane were elevated in one sidegradient well and one downgradient well during 1996. Zinc was elevated in three downgradient wells and also was detected in the associated laboratory blanks for two of those wells. Specific conductance was elevated in one background well and one sidegradient well. Barium and copper exceeded standards in one sidegradient well, and dichloromethane (a common laboratory contaminant) was elevated in another sidegradient well. Barium, copper, and dichloromethane were detected in the associated blanks for these wells, also. The groundwater flow direction in the Steed Pond Acquifer (Water Table) beneath the Interim Sanitary Landfill was to the southeast (universal transverse Mercator coordinates). The flow rate in this unit was approximately 210 ft/year during first quarter 1996 and 180 ft/yr during third quarter 1996

Work report 1995-1996; Informe de Labores 1995-1996

Energy Technology Data Exchange (ETDEWEB)

National Institute of Nuclear Research

1997-12-31

The Instituto Nacional de Investigaciones Nucleares presents the results obtained from the activities carried out during the period 1995-1996. This report is divided into 3 main sections, plus a statistical appendix. The first section points out the importance that the Institute has obtained within the national context, as well as within the state industry of Mexico, emphasizing the support given to the Central Nucleoelectrica of Laguna Verde (sponsored by the Comision Federal de Electricidad), and to the technical cooperation programs, at international level, in the fields of nuclear science and technology. The second section gathers the results of operation and investment, dedicated to cover the expenses of services and employment, commercialization, administrative development, productivity and operative efficiency; external economic relations and some relevant aspects of the budget and financial situation. The third one corresponds to the researches that are actually being developed; their results will be presented in the forthcoming reports. (Author).

Radiation practices 1996

International Nuclear Information System (INIS)

Havukainen, R.

1997-05-01

At the end of 1996, there were 1,762 valid safety licences in Finland for the use of radiation. In addition, there were 2,052 responsible parties for dental x-ray diagnostics. The registry of the Finnish Centre for Radiation and Nuclear Safety listed 13,360 radiation sources and 313 radionuclide laboratories. The import of radioactive substances amounted to 1.14 x 10 +16 Bq and export to 7.78 x 10 +13 Bq. A total of 4.02 x 10 +13 Bq of short-lived radionuclides were produced in Finland. There were 11,842 workers monitored for radiation exposure at 1,352 work sites. Of these employees, 27% received an annual dose exceeding the recording level. The total dose recorded in the dose registry (sum of individual dosimeter readings) was 7.96 manSv in 1996, with nuclear power plant workers accounting for 69% of this total. The annual dosimeter reading of ten medical doctors (radiologists, interventional radiologists and cardiologists) and eight nuclear power plant employees was equal to or in excess of 20 mSv. Effective doses, however, did not exceed the dose limit of 50 mSv established for one-year monitoring periods. The sum of dosimeter readings (depth dose) on the lead-rubber apron of one interventional radiologist was 242 mSv. It was verified that the annual dose limit for the lens of the eye, 150 mSv, had been exceeded in this case. This high dose was caused by the fact that the radiologist had carried out multiple examinations where unusually high exposure to radiation was an unavoidable part of the task. Report was made of 12 incidents of anomalies in the use of radiation. None of these proved to have caused significant radiation exposure to the radiation source operators. Five of these cases occurred in radiotherapy, three in use of a radiation source in industry, three in transport of radiation sources and one in use of solarium appliances. Radiation-contaminated material was found in 17 shipments of scrap. (orig.)

Radiation practices 1996

Energy Technology Data Exchange (ETDEWEB)

Havukainen, R. [ed.

1997-05-01

At the end of 1996, there were 1,762 valid safety licences in Finland for the use of radiation. In addition, there were 2,052 responsible parties for dental x-ray diagnostics. The registry of the Finnish Centre for Radiation and Nuclear Safety listed 13,360 radiation sources and 313 radionuclide laboratories. The import of radioactive substances amounted to 1.14 x 10{sup +16} Bq and export to 7.78 x 10{sup +13} Bq. A total of 4.02 x 10{sup +13} Bq of short-lived radionuclides were produced in Finland. There were 11,842 workers monitored for radiation exposure at 1,352 work sites. Of these employees, 27% received an annual dose exceeding the recording level. The total dose recorded in the dose registry (sum of individual dosimeter readings) was 7.96 manSv in 1996, with nuclear power plant workers accounting for 69% of this total. The annual dosimeter reading of ten medical doctors (radiologists, interventional radiologists and cardiologists) and eight nuclear power plant employees was equal to or in excess of 20 mSv. Effective doses, however, did not exceed the dose limit of 50 mSv established for one-year monitoring periods. The sum of dosimeter readings (depth dose) on the lead-rubber apron of one interventional radiologist was 242 mSv. It was verified that the annual dose limit for the lens of the eye, 150 mSv, had been exceeded in this case. This high dose was caused by the fact that the radiologist had carried out multiple examinations where unusually high exposure to radiation was an unavoidable part of the task. Report was made of 12 incidents of anomalies in the use of radiation. None of these proved to have caused significant radiation exposure to the radiation source operators. Five of these cases occurred in radiotherapy, three in use of a radiation source in industry, three in transport of radiation sources and one in use of solarium appliances. Radiation-contaminated material was found in 17 shipments of scrap. (orig.)

AECB staff annual assessment of the Bruce A Nuclear Generating Station for the year 1996

International Nuclear Information System (INIS)

1997-06-01

The Atomic Energy Control Board is the independent federal agency that controls all nuclear activities in Canada. A major use of nuclear energy in Canada is electricity production. The AECB assesses every station's performance against legal requirements, including the conditions in the operating licence. Each station is inspected and all aspects of the station's operation and management is reviewed. This report is the AECB staff assessment of reactor safety at the Bruce Nuclear Generating Station A for 1996. Ontario Hydro operated Bruce A safely in 1996, maintaining the risk to workers and the public at an acceptably low level. Special safety system performance at Bruce A was adequate. Availability targets were all met. Improvement is needed to reduce the number of operating licence non-compliances

Possibilities of paired comparison of receptor binding parameters obtained in a single experiment

International Nuclear Information System (INIS)

Mashilova, K.V.; Kiriakov, G.V.; Malin, K.M.; Rozhanets, V.V.

1987-01-01

The authors explore the use of comparing control and experimental groups on the basis of extrapolation parameters obtained from a single pair of experiments. One of the experiments study the parameters of specific binding of 3 H-D-ala-2-enkephelin-5-D-leucine in the striatum of different groups of rats. The analysis was done by the Cornish-Bowden method

1996 petroleum exploration and production in France; 1996 recherche et production petrolieres en France

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-31

A detailed analysis and data compilations on petroleum exploration and production activities in France in 1996, are presented. Acreage evolution is decreasing despite a growth of new exploration licenses; a significant rise in the activity of seismic surveying has occurred, while exploration drilling activity (onshore only), equivalent to the previous year, led to two oil discoveries, and the investments in exploration showed a decrease of 28 percent compared to 1995. Production is declining for oil as well as natural gas (15 and 12 percent decrease resp.), while production investments dropped very sharply showing a reduction of 48 percent

1996 petroleum exploration and production in France; 1996 recherche et production petrolieres en France

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-12-31

A detailed analysis and data compilations on petroleum exploration and production activities in France in 1996, are presented. Acreage evolution is decreasing despite a growth of new exploration licenses; a significant rise in the activity of seismic surveying has occurred, while exploration drilling activity (onshore only), equivalent to the previous year, led to two oil discoveries, and the investments in exploration showed a decrease of 28 percent compared to 1995. Production is declining for oil as well as natural gas (15 and 12 percent decrease resp.), while production investments dropped very sharply showing a reduction of 48 percent

48 CFR 1552.235-76 - Treatment of Confidential Business Information (APR 1996).

Science.gov (United States)

2010-10-01

... Business Information (APR 1996). 1552.235-76 Section 1552.235-76 Federal Acquisition Regulations System... Provisions and Clauses 1552.235-76 Treatment of Confidential Business Information (APR 1996). As prescribed in 1535.007-70(c), insert the following clause: Treatment of Confidential Business Information (TSCA...

NAEP 1996 Trends in Writing: Fluency and Writing Conventions. Holistic and Mechanics Scores in 1984 and 1996.

Science.gov (United States)

Ballator, Nada; Farnum, Marisa; Kaplan, Bruce

Supplementary to "NAEP 1996 Trends in Academic Progress," this report describes two aspects of writing for which change has been measured since 1984: writing fluency as determined by holistic scoring; and mastery of the conventions of written English as determined by mechanics scoring. The introduction discusses the layout and means of…

De verkeersonveiligheid in Nederland in de periode 1985-1996 : analyse van de ontwikkelingen.

NARCIS (Netherlands)

Davidse, R.J. (red.)

1997-01-01

This report presents an analysis of the general developments in road safety in The Netherlands, with a special focus on the year 1996. The number of road deaths in 1996 dropped considerably in comparison to the figures for 1995, thus indicating the first decrease in the number of deaths since 1991.

Industry's 1996 U.S. budgets rise for second year in a row

International Nuclear Information System (INIS)

Beck, R.J.

1996-01-01

This is a compilation of information on the estimated expenditures for the US oil and gas industry for 1996. It is broken down into budget categories such as exploration and development, marketing, pipeline construction, refining, petrochemicals. It also categorizes the expenditures into domestic and foreign operations. In addition, this paper does provide some historical trends in the various expenditure items

A Bayesian approach to study the risk variables for tuberculosis occurrence in domestic and wild ungulates in South Central Spain

Directory of Open Access Journals (Sweden)

Rodríguez-Prieto Víctor

2012-08-01

Full Text Available Abstract Background Bovine tuberculosis (bTB is a chronic infectious disease mainly caused by Mycobacterium bovis. Although eradication is a priority for the European authorities, bTB remains active or even increasing in many countries, causing significant economic losses. The integral consideration of epidemiological factors is crucial to more cost-effectively allocate control measures. The aim of this study was to identify the nature and extent of the association between TB distribution and a list of potential risk factors regarding cattle, wild ungulates and environmental aspects in Ciudad Real, a Spanish province with one of the highest TB herd prevalences. Results We used a Bayesian mixed effects multivariable logistic regression model to predict TB occurrence in either domestic or wild mammals per municipality in 2007 by using information from the previous year. The municipal TB distribution and endemicity was clustered in the western part of the region and clearly overlapped with the explanatory variables identified in the final model: (1 incident cattle farms, (2 number of years of veterinary inspection of big game hunting events, (3 prevalence in wild boar, (4 number of sampled cattle, (5 persistent bTB-infected cattle farms, (6 prevalence in red deer, (7 proportion of beef farms, and (8 farms devoted to bullfighting cattle. Conclusions The combination of these eight variables in the final model highlights the importance of the persistence of the infection in the hosts, surveillance efforts and some cattle management choices in the circulation of M. bovis in the region. The spatial distribution of these variables, together with particular Mediterranean features that favour the wildlife-livestock interface may explain the M. bovis persistence in this region. Sanitary authorities should allocate efforts towards specific areas and epidemiological situations where the wildlife-livestock interface seems to critically hamper the definitive b

A Bayesian approach to study the risk variables for tuberculosis occurrence in domestic and wild ungulates in South Central Spain.

Science.gov (United States)

Rodríguez-Prieto, Víctor; Martínez-López, Beatriz; Barasona, José Angel; Acevedo, Pelayo; Romero, Beatriz; Rodriguez-Campos, Sabrina; Gortázar, Christian; Sánchez-Vizcaíno, José Manuel; Vicente, Joaquín

2012-08-30

Bovine tuberculosis (bTB) is a chronic infectious disease mainly caused by Mycobacterium bovis. Although eradication is a priority for the European authorities, bTB remains active or even increasing in many countries, causing significant economic losses. The integral consideration of epidemiological factors is crucial to more cost-effectively allocate control measures. The aim of this study was to identify the nature and extent of the association between TB distribution and a list of potential risk factors regarding cattle, wild ungulates and environmental aspects in Ciudad Real, a Spanish province with one of the highest TB herd prevalences. We used a Bayesian mixed effects multivariable logistic regression model to predict TB occurrence in either domestic or wild mammals per municipality in 2007 by using information from the previous year. The municipal TB distribution and endemicity was clustered in the western part of the region and clearly overlapped with the explanatory variables identified in the final model: (1) incident cattle farms, (2) number of years of veterinary inspection of big game hunting events, (3) prevalence in wild boar, (4) number of sampled cattle, (5) persistent bTB-infected cattle farms, (6) prevalence in red deer, (7) proportion of beef farms, and (8) farms devoted to bullfighting cattle. The combination of these eight variables in the final model highlights the importance of the persistence of the infection in the hosts, surveillance efforts and some cattle management choices in the circulation of M. bovis in the region. The spatial distribution of these variables, together with particular Mediterranean features that favour the wildlife-livestock interface may explain the M. bovis persistence in this region. Sanitary authorities should allocate efforts towards specific areas and epidemiological situations where the wildlife-livestock interface seems to critically hamper the definitive bTB eradication success.

Kootenai River fisheries investigation: Stock status of burbot. Annual report 1996

International Nuclear Information System (INIS)

Paragamian, V.L.; Whitman, V.

1996-11-01

The main theme of the 1996 burbot Lota lota study was to test the hypothesis that winter discharge for power production/flood control inhibits burbot migration to spawning tributaries. There were to be two to three minimum discharge (113 m 3 /s) periods from Libby Dam of approximately five days duration during December 1995 and January 1996. However, exceptionally heavy precipitation and an excessive amount of water stored in Lake Koocanusa created near flood conditions in the Kootenai River. These high flows prevented a controlled test. But the authors captured 27 burbot in the Kootenai River, Idaho and the Goat River, British Columbia, Canada. Burbot catch from November 1995 through March 1996 averaged 0.055 fish/net-day. Captured burbot ranged from 396 to 830 mm total length and weighed from 400 to 2,800 g (mean = 1,376 g). One burbot was captured at rkm 170 (the Idaho-Canada border) in mid-March after the spawning season. Nine burbot were implanted with sonic transmitters and released at the Goat River capture location. Two additional burbot had active transmitters from the previous season. Telemetry of burbot during the pre-spawn, spawning, and post-spawning periods was conducted. Burbot were located a total of 161 times from September 1, 1995 through August 31, 1996. Ripe burbot were captured at the mouth of the Goat River during February

The Fermilab Farms in 1996

International Nuclear Information System (INIS)

1997-05-01

The farms in 1996 began a period of transition. The old farms continue to be used but do not provide sufficient CPU power, memory, or network bandwidth for all of the tasks which are required. Therefore we have purchased and installed a substantial increment of new farms and are working on adding another increment during 1997. The purpose of all this activity is to provide computing for the fixed target run and for the other large computing users who cannot be accommodated on the other systems that are available at Fermilab

Presidential Green Chemistry Challenge: 1996 Greener Synthetic Pathways Award

Science.gov (United States)

Presidential Green Chemistry Challenge 1996 award winner, Monsanto Company, developed a safer synthesis for DSIDA, a key building block for the herbicide RoundUp. The synthesis uses no ammonia, cyanide, or formaldehyde.

Investigations of introduced species in Pearl Harbor; Oahu, Hawaii, from 1996-01-11 to 1996-09-18 (NODC Accession 0000330)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The marine and estuarine invertebrate and fish communities in Pearl Harbor, Oahu, Hawaii were surveyed between January and October, 1996. Samples were taken and...

The extra mile: Ungulate migration distance alters the use of seasonal range and exposure to anthropogenic risk

Science.gov (United States)

Sawyer, Hall; Middleton, Arthur D.; Hayes, Matthew M.; Kauffman, Matthew J.; Monteith, Kevin L.

2016-01-01

Partial migration occurs across a variety of taxa and has important ecological and evolutionary consequences. Among ungulates, studies of partially migratory populations have allowed researchers to compare and contrast performance metrics of migrants versus residents and examine how environmental factors influence the relative abundance of each. Such studies tend to characterize animals discretely as either migratory or resident, but we suggest that variable migration distances within migratory herds are an important and overlooked form of population structure, with potential consequences for animal fitness. We examined whether the variation in individual migration distances (20–264 km) within a single wintering population of mule deer (Odocoileus hemionus) was associated with several critical behavioral attributes of migration, including timing of migration, time allocation to seasonal ranges, and exposure to anthropogenic mortality risks. Both the timing of migration and the amount of time animals allocated to seasonal ranges varied with migration distance. Animals migrating long distances (150–250 km) initiated spring migration more than three weeks before than those migrating moderate (50–150 km) or short distances (forage and effectively increase carrying capacity. Clear differences in winter residency, migration duration, and risk of anthropogenic mortality among short-, moderate-, and long-distance migrants suggest fitness trade-offs may exist among migratory segments of the population. Future studies of partial migration may benefit from expanding comparisons of residents and migrants, to consider how variable migration distances of migrants may influence the costs and benefits of migration.

Energie-Versorgung Schwaben AG. Report on the 58th business year 1996; Energie-Versorgung Schwaben AG. Bericht ueber das 58. Geschaeftsjahr 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-09-01

The present report describes the tasks and activities of one of the German power economy`s large integrated companies which operate large-scale power plants. The 1996 business report disclases extensive financial data (balance, profit and loss account etc.). The purpose of the business is to produce, transmit or transport, respectively, and distribute electricity, long-distance thermal energy, and gas. (RHM) [Deutsch] Es wird eine Beschreibung der Aufgaben und Aktivitaeten dieses grossen Verbundunternehmens und Grosskraftwerksbetreibers der deutschen Elektrizitaetswirtschaft gegeben, wobei der Geschaeftsbericht 1996 zahlreiche finanzielle Daten (Bilanz, Gewinn- und Verlustrechnung etc.) offenlegt. Der Zweck des Unternehmens ist die Erzeugung, Fortleitung und Verteilung von elektrischem Strom, von Fernwaerme und Gas. (RHM)

EL SISTEMA FINANCIERO EN 1996 Y PERSPECTIVAS PARA 1997

Directory of Open Access Journals (Sweden)

Julio César Espinosa Rodríguez

2011-09-01

Full Text Available La evolución del sistema financiero en 1996 estuvo circunscripta dentro de la tendencia de los últimos cuatro años de una continua disminución de la tasa de crecimiento del PIB, comportamiento enmarcado dentro de una serie de desequilibrios financieros. Dado lo anterior, se implementaron políticas encaminadas a la restricción de los gastos en la economía, aspecto evidenciado en el incremento de los impuestos y en las elevadas tasas de interés, lo cual definió a 1996 como un año recesivo. Empero, a pesar de los problemas citados, se produjo un avance en la innovación de nuevos instrumentos financieros, aunado a una mayor participación de los inversionistas institucionales.

Presidential Green Chemistry Challenge: 1996 Designing Greener Chemicals Award

Science.gov (United States)

Presidential Green Chemistry Challenge 1996 award winner, Rohm and Haas, developed Sea-Nine, a marine antifoulant to control plants and animals on ship hulls. Sea-Nine replaces persistent, toxic organotin antifoulants.

Bioenergy research programme. Yearbook 1996. Peat and field biomass; Bioenergian tutkimusohjelma. Vuosikirja 1996. Turpeen ja peltobiomassojen tuotantotekniikka

Energy Technology Data Exchange (ETDEWEB)

Nikku, P [ed.

1997-12-01

The aim of the programme is to increase the use of economically profitable and environmentally sound bioenergy by improving the competitiveness of present peat and wood fuels. Research and development projects will also develop new economically competitive biofuels, new equipment and methods for production, handling and utilisation of biofuels. The total funding for 1996 was 27.3 million FIM and the number of projects 63. The number of projects concerning peat production was 7 and that of field biomass projects 4. Results of the projects carried out in 1996 are presented in this publication. The development target in the research area of peat production is to improve the competitiveness of peat by reducing the production costs by 20 % (by 5-6 FIM/MWh) from the level of 1992, and to reduce the environmental impacts. The target of the research area of peat production is possible to achieve if the sub-targets are achieved. The production costs are reduced by 5 % if the width of the production field is increased from 20 m to 60 m, by 8 % if the degree of utilisation of solar energy is increased from 30 % to 40 %, by 6.5 % if the value of peat remaining on the cutover field is reduced from 3 000 MWh to 1 500 MWh, by 3 % if light and fireproof machines are developed, and by 3 % if combined peat and wood harvesting is applied. The production costs will be reduced by 24 % if the different sub-targets are achieved. In this programme no common target for the field biomass projects was set. Field biomass projects are mainly funded by the Finnish Ministry of Agriculture and Forestry. Most of the research projects were completed in 1996. (orig.)

ALTERNER programme for 1995 and planning for 1996; Programma ALTENER consuntivo 1995 e pianificazione 1996

Energy Technology Data Exchange (ETDEWEB)

Crea, C [Ministero dell` Industria, Commercio e Artigianato, Rome (Italy); Ricci, A; Tarquini, P; Gerardi, V; La Motta, S [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dip. Energia

1995-12-01

This report concerns the main results, some considerations and analysis on the outcome of Altener Programme for 1995 and information on the necessary formalities for participating to the Programme 1996. Particularly it will be reported the distribution of accepted proposals and relative awarded contributions for each Member States, a critical analysis on the contents of the accepted and financed proposals in relation to indications given by guidelines 1995 and to different energy sources. Further a synthetic description of Italian accepted proposals is reported and at last new Guidelines for the Altener 96 participation are reported.

Enforcement actions: Significant actions resolved reactor licensees. Semiannual progress report, July 1996--December 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-04-01

This compilation summarizes significant enforcement actions that have been resolved during the period (July-December 1996) and includes copies of letters, Notices, and Orders sent by the Nuclear Regulatory Commission to reactor licensees with respect to these enforcement actions. It is anticipated that the information in this publication will be widely disseminated to managers and employees engaged in activities licensed by the NRC, so that actions can be taken to improve safety by avoiding future violations similar to those described in this publication.

Enforcement actions: Significant actions resolved reactor licensees. Semiannual progress report, July 1996--December 1996

International Nuclear Information System (INIS)

1997-04-01

This compilation summarizes significant enforcement actions that have been resolved during the period (July-December 1996) and includes copies of letters, Notices, and Orders sent by the Nuclear Regulatory Commission to reactor licensees with respect to these enforcement actions. It is anticipated that the information in this publication will be widely disseminated to managers and employees engaged in activities licensed by the NRC, so that actions can be taken to improve safety by avoiding future violations similar to those described in this publication

Results on safety research for five years (from fiscal year 1996 to 2000). A field of nuclear fuel cycle

International Nuclear Information System (INIS)

2001-10-01

This safety research carried out by the Japan Nuclear Cycle Development Institute (JNC) for five years ranged from fiscal year 1996 to 2000, was performed according to the safety research basic plan (from fiscal year 1996 to 2000) established on March, 1996 (revised again on May, 2000). This report was arranged on a field on nuclear fuel cycle (all subjects on fields of nuclear fuel facility, environmental radioactivity and radioactive wastes and a subject on nuclear fuel cycle in a field of seismic resistant and probabilistic safety assessment) by combining its research results for five years ranged from 1996 to 2000 fiscal year with general outlines on the safety research basic plan. Here were shown outlines on the safety research basic plan, aims and subjects on safety research at a field of nuclear fuel cycle, a list of survey sheets on safety research result, and survey sheets on safety research results. The survey sheets containing research field, title, organization, researcher name, researching period, names of cooperative organization, using facilities, research outline, research results, established contents, application, and research trends, are ranged to 21 items on nuclear fuel facility, 1 item on seismic resistance, 2 items on probabilistic safety assessment, 8 items on environmental radioactivity, and 20 items on radioactive wastes. (G.K.)

1996 outstanding facts; Faits marquants 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-31

This progress report of the Direction of Studies and Research (DER) of Electricite de France (EdF) reports on some outstanding studies carried out during the year 1996 and concerning: new applications of electric power (thermal comfort, heating floors, building diagnosis, energy management, customers communicating interfaces, services, air conditioning, off-peak tariffs, power demand mastery in the industry, infrared dryers for paper industry); production means (automatic systems for nuclear power plants operation, management of reactors shutdown schedules for refuelling operations, optimization of fuel loading patterns for PWRs, neutronic and thermohydraulic computer codes for steam pipes rupture accidents, thermo-hydraulic modeling of the confinement building during post-accidental situation, 3D numerical simulation of overpressures inside reactor valves and of vortex and two-phase flow inside auxiliary pipes, control of vibrating fatigue of pipe nozzles, qualification of the adjustable speed drives of the Gravelines` cooling pumps, 3D analysis of new steam turbine designs, identification of bi-metal welding surface defects, a simple method for the evaluation of in-service fatigue of components, the probabilistic dimensioning of safety coefficients, the modeling of thermo-hydro-mechanical coupling of geo-materials for radioactive wastes storage, the supply of isolated sites using renewable energies); environment protection (batteries for electric-powered vehicles, modeling of atmospheric reactive flows, chlorination of the Dampierre`s cooling circuits for pathogen amoebas elimination, in-situ treatment of PCBs isolated transformers); and development and exploitation of materials for power networks. (J.S.).

1996 outstanding facts; Faits marquants 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-12-31

This progress report of the Direction of Studies and Research (DER) of Electricite de France (EdF) reports on some outstanding studies carried out during the year 1996 and concerning: new applications of electric power (thermal comfort, heating floors, building diagnosis, energy management, customers communicating interfaces, services, air conditioning, off-peak tariffs, power demand mastery in the industry, infrared dryers for paper industry); production means (automatic systems for nuclear power plants operation, management of reactors shutdown schedules for refuelling operations, optimization of fuel loading patterns for PWRs, neutronic and thermohydraulic computer codes for steam pipes rupture accidents, thermo-hydraulic modeling of the confinement building during post-accidental situation, 3D numerical simulation of overpressures inside reactor valves and of vortex and two-phase flow inside auxiliary pipes, control of vibrating fatigue of pipe nozzles, qualification of the adjustable speed drives of the Gravelines` cooling pumps, 3D analysis of new steam turbine designs, identification of bi-metal welding surface defects, a simple method for the evaluation of in-service fatigue of components, the probabilistic dimensioning of safety coefficients, the modeling of thermo-hydro-mechanical coupling of geo-materials for radioactive wastes storage, the supply of isolated sites using renewable energies); environment protection (batteries for electric-powered vehicles, modeling of atmospheric reactive flows, chlorination of the Dampierre`s cooling circuits for pathogen amoebas elimination, in-situ treatment of PCBs isolated transformers); and development and exploitation of materials for power networks. (J.S.).

Communication of 14 February 1996 received from the Permanent Mission of New Zealand to the International Atomic Energy Agency

International Nuclear Information System (INIS)

1996-01-01

On 14 February 1996, the Director General received a communication of 9 February 1996 from the Resident Representative of New Zealand transmitting Statements made by the Prime Minister of New Zealand on 28 January 1996 about the sixth nuclear test by France and on 30 January 1996 after France announced the conclusion of nuclear testing in the South Pacific

Estimación de la prevalencia de hipotiroidismo en España a partir del consumo de hormonas tiroideas (1996-1999

Directory of Open Access Journals (Sweden)

Morant Ginestar Consuelo

2001-01-01

Full Text Available Fundamento: Ante la escasez de datos acerca de la prevalencia de hipotiroidismo en España, se decide estimarla a través del consumo de su tratamiento específico, las hormonas tiroideas, utilizando la metodología de los estudios de utilización de medicamentos. Métodos: Cálculo de la Dosis Habitante Día (DHD de hormonas tiroideas (grupo terapéutico H03 de la Anatomical Therapeutic Chemical a través de la Dosis Diaria Definida (DDD, durante 1996 y 1999, en las distintas provincias de las Comunidades Autónomas de todo el territorio nacional. Se han calculado los intervalos de confianza al 95 % para las prevalencias estimadas en las comunidades autónomas y en el territorio nacional, así como los incrementos porcentuales de 1999 respecto a 1996. Los datos de las prescripciones han sido facilitados por el Ministerio de Sanidad y Consumo. Resultados: Se estima una prevalencia nacional de hipotiroidismo para 1996, de 3,19 casos por 1.000 habitantes y para 1999, de 4,33 casos por 1000 habitantes; el incremento porcentual es de 26,38 %. Los resultados de la DHD muestran diferencias en la prevalencia entre provincias: Guadalajara presenta las cifras más altas en los dos años estudiados(5,02 y 7,01 casos por 1.000 habitantes/día en 1996 y 1999 respectivamente y Melilla, las más bajas (1,07 y 1,60 casos por 1.000 habitantes/día. En todas las provincias y comunidades autónomas se ha producido un incremento de la DHD en el año 1999 respecto al 1996. El incremento menor fue para Asturias (9,62 % y el más alto para La Rioja (35,26 %. Conclusiones: Los 3,19 y 4,33 DDD por 1.000 habitantes/día en 1996 y 1999 respectivamente, pueden ser interpretados como la prevalencia de hipotiroidismo diagnosticado y tratado. Estas cifras se hallan en el intervalo determinado por otros estudios, aunque las comparaciones entre estudios de diferente metodología deben hacerse con extremada precaución. El incremento observado en el consumo podría explicarse m

Estimación de la prevalencia de hipotiroidismo en españa a partir del consumo de hormonas tiroideas (1996-1999

Directory of Open Access Journals (Sweden)

Consuelo Morant Ginestar

2001-01-01

Full Text Available Fundamento: Ante la escasez de datos acerca de la prevalencia de hipotiroidismo en España, se decide estimarla a través del consumo de su tratamiento específico, las hormonas tiroideas, utilizando la metodología de los estudios de utilización de medicamentos. Métodos: Cálculo de la Dosis Habitante Día (DHD de hormonas tiroideas (grupo terapéutico H03 de la Anatomical Therapeutic Chemical a través de la Dosis Diaria Definida (DDD, durante 1996 y 1999, en las distintas provincias de las Comunidades Autónomas de todo el territorio nacional. Se han calculado los intervalos de confianza al 95 % para las prevalencias estimadas en las comunidades autónomas y en el territorio nacional, así como los incrementos porcentuales de 1999 respecto a 1996. Los datos de las prescripciones han sido facilitados por el Ministerio de Sanidad y Consumo. Resultados: Se estima una prevalencia nacional de hipotiroidismo para 1996, de 3,19 casos por 1.000 habitantes y para 1999, de 4,33 casos por 1000 habitantes; el incremento porcentual es de 26,38 %. Los resultados de la DHD muestran diferencias en la prevalencia entre provincias: Guadalajara presenta las cifras más altas en los dos años estudiados(5,02 y 7,01 casos por 1.000 habitantes/ día en 1996 y 1999 respectivamente y Melilla, las más bajas (1,07 y 1,60 casos por 1.000 habitantes/día. En todas las provincias y comunidades autónomas se ha producido un incremento de la DHD en el año 1999 respecto al 1996. El incremento menor fue para Asturias (9,62 % y el más alto para La Rioja (35,26 %. Conclusiones: Los 3,19 y 4,33 DDD por 1.000 habitantes/ día en 1996 y 1999 respectivamente, pueden ser interpretados como la prevalencia de hipotiroidismo diagnosticado y tratado. Estas cifras se hallan en el intervalo determinado por otros estudios, aunque las comparaciones entre estudios de diferente metodología deben hacerse con extremada precaución. El incremento observado en el consumo podría explicarse

Performance of spanish wind turbines. Year 1996; Estadisticas de produccion de parques eolicos en Espana. Ano 1996

Energy Technology Data Exchange (ETDEWEB)

Lago, C.

1998-04-01

In this document we can find a statistical evaluation for the wind energy generation from each spanish wind farm referred to 1996 going on with the work that has been carried since 1992, by initiative of the Wind Energy Division from Renewable Energy Institute. The purpose of this work is to contribute with interesting information for the wind environment and offer a global view from monthly performance of different wind farms. (Author) 4 refs.

Paul Scherrer Institut annual report 1996. Annex V: PSI general energy technology newsletter 1996

Energy Technology Data Exchange (ETDEWEB)

Daum, C; Leuenberger, J [eds.

1997-06-01

Surveying the results of General Energy Research in 1996, three major trends can be identified. First, in areas where research results have reached an advanced stage, decisive steps have been taken to promote a transfer towards industrial realization; examples include biomass gasification, advanced battery concepts, and combustion research. Second, in projects with longer term orientation, several options are being evaluated by exploratory studies, e.g. in solar chemistry and reaction analysis. Third, in line with the strategic planning of our institute, the development and characterization of materials for energy research has received increased attention. (author) figs., tabs., refs.

Presidential Green Chemistry Challenge: 1996 Greener Reaction Conditions Award

Science.gov (United States)

Presidential Green Chemistry Challenge 1996 award winner, Dow Chemical Company, developed a process to manufacture polystyrene foam sheet packaging that uses carbon dioxide (CO2) as a blowing agent, eliminating CFC-12 and HCFC-22.

Annual report 1996-97

International Nuclear Information System (INIS)

1997-01-01

The second annual report of the Council for the Central Laboratory of the Research Councils (CCLRC) for the year 1996-1997 is presented together with the organisation's accounts for the year. CCLRC exists to promote high quality scientific and engineering research by providing facilities and technical expertise in support of basic, strategic and applied research programmes funded by United Kingdom and overseas sources. The corporate objectives are listed together with evidence of adherence to each and financial data presented on how CCLRC funds are distributed. Research programme highlights, commercial and operation activities are also described. (UK)

48 CFR 1552.235-75 - Access to Toxic Substances Control Act Confidential Business Information (APR 1996).

Science.gov (United States)

2010-10-01

... Control Act Confidential Business Information (APR 1996). 1552.235-75 Section 1552.235-75 Federal... Confidential Business Information (APR 1996). As prescribed in 1535.007(b), insert the following provision: Access to Toxic Substances Control Act Confidential Business Information (APR 1996) In order to perform...

International Ocean Symposium (IOS) 1996; Kokusai kaiyo symposium 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-02-18

This is a proceedings of the International Ocean Symposium 1996. On the first day of the symposium, the following were given with a theme `The Ocean, Can She Save Us`: Underwater research and future of mankind as a commemorative speech; The ocean, can she save us -- trying to discover the true figure of the ocean as a keynote speech. Panel discussion was held on The global environment and the infinite potential of the ocean. On the second day, an approach was made mostly from a cultural aspect with a theme `The Ocean and the Japanese.` The following were given: Human links between east and west as a commemorative speech; The ocean and Japanese culture as a keynote speech; Civilization spanning across oceans as a panel discussion. The Japanese have been developing their individual technologies in shipbuilding, shipping, and ocean development, have been raised by Mother Ocean, and have lived together. Ocean has been supplying humans food, water, oxygen, marine routes, and even dream and hope. The environmental pollution is the result of the human greediness. It is fear and friendship between humans and ocean that can save humans and ocean.

Origins of the semiannual variation of geomagnetic activity in 1954 and 1996

Directory of Open Access Journals (Sweden)

L. Svalgaard

Full Text Available We investigate the cause of the unusually strong semiannual variation of geomagnetic activity observed in the solar minimum years of 1954 and 1996. For 1996 we separate the contributions of the three classical modulation mechanisms (axial, equinoctial, and Russell-McPherron to the six-month wave in the aam index and find that all three contribute about equally. This is in contrast to the longer run of geomagnetic activity (1868-1998 over which the equinoctial effect accounts for ∼70% of the semiannual variation. For both 1954 and 1996, we show that the Russell-McPherron effect was enhanced by the Rosenberg-Coleman effect (an axial polarity effect which increased the amount of the negative (toward Sun [positive (away from Sun] polarity field observed during the first [second] half of the year; such fields yield a southward component in GSM coordinates. Because this favourable condition occurs only for alternate solar cycles, the marked semiannual variation in 1954 and 1996 is a manifestation of the 22-year cycle of geomagnetic activity. The 11-year evolution of the heliospheric current sheet (HCS also contributes to the strong six-month wave during these years. At solar minimum, the streamer belt at the base of the HCS is located near the solar equator, permitting easier access to high speed streams from polar coronal holes when the Earth is at its highest heliographic latitudes in March and September. Such an axial variation in solar wind speed was observed for 1996 and is inferred for 1954. Key words. Magnetosphere (solar wind – magnetosphere interactions; storms and substorms

Origins of the semiannual variation of geomagnetic activity in 1954 and 1996

Directory of Open Access Journals (Sweden)

E. W. Cliver

2004-01-01

Full Text Available We investigate the cause of the unusually strong semiannual variation of geomagnetic activity observed in the solar minimum years of 1954 and 1996. For 1996 we separate the contributions of the three classical modulation mechanisms (axial, equinoctial, and Russell-McPherron to the six-month wave in the aam index and find that all three contribute about equally. This is in contrast to the longer run of geomagnetic activity (1868-1998 over which the equinoctial effect accounts for ∼70% of the semiannual variation. For both 1954 and 1996, we show that the Russell-McPherron effect was enhanced by the Rosenberg-Coleman effect (an axial polarity effect which increased the amount of the negative (toward Sun [positive (away from Sun] polarity field observed during the first [second] half of the year; such fields yield a southward component in GSM coordinates. Because this favourable condition occurs only for alternate solar cycles, the marked semiannual variation in 1954 and 1996 is a manifestation of the 22-year cycle of geomagnetic activity. The 11-year evolution of the heliospheric current sheet (HCS also contributes to the strong six-month wave during these years. At solar minimum, the streamer belt at the base of the HCS is located near the solar equator, permitting easier access to high speed streams from polar coronal holes when the Earth is at its highest heliographic latitudes in March and September. Such an axial variation in solar wind speed was observed for 1996 and is inferred for 1954. Key words. Magnetosphere (solar wind – magnetosphere interactions; storms and substorms

Compilation of the opinions expressed by the CCTN in 1996; Raccolta dei pareri espressi dalla CCTN nel 1996

Energy Technology Data Exchange (ETDEWEB)

Camoni, I [Istituto Superiore di Sanita` , Rome (Italy). Lab. di Tossicologia Applicata; Mucci, N [ISPESL, Monteporzio Catone, Rome (Italy). Dipt. di Medicina del Lavoro

1997-06-01

The opinion expressed by the Italian National Advisory Toxicological Committee (CCTN) in 1996 are presented. Among the most important opinions the following may be mentioned: (1) toxic properties of substances deriving from Cannabis sativa; (2) reproductive-toxicity of friazolic pesticides; (3) re-evaluations of the carcinogenic evidences of several chemical substances.

Site environmental report for calendar year 1996

International Nuclear Information System (INIS)

1997-06-01

This Annual Site Environmental Report presents information pertaining to environmental activities conducted during calendar year 1996 at the U.S. Department of Energy (DOE) Grand Junction Office (GJO) facility in Grand Junction, Colorado. WASTREN-Grand Junction, the Facility Operations and Support contractor for the GJO, prepared this report in accordance with the requirements of DOE Order 5400.1, General Environmental Protection Program, and supplemental guidance from DOE Headquarters. This report applies specifically to the GJO facility; the Monticello Mill Tailings Site Environmental Summary for Calendar Year 1996 was prepared as a separate document. Primary GJO activities involve laboratory analysis of environmental samples from GJO and other DOE sites and site remediation of contamination caused by previous uranium mill operations. Activities at the GJO are conducted in compliance with applicable Federal, State, and local regulations and requirements and as directed by applicable DOE orders. Environmental monitoring is performed on air emissions, sewer effluent, surface water and groundwater, and wetlands restoration. Wastes are generated from the Analytical Laboratory, site remediation, and facility operation

NREL Photovoltaic Program FY 1996 Annual Report

Energy Technology Data Exchange (ETDEWEB)

1997-08-01

This report summarizes the in-house and subcontract research and development (R&D) activities under the National Renewable Energy Laboratory (NREL) Photovoltaics (PV) Program from October 1, 1995 through September 30, 1996 (fiscal year [FY] 1996). The NREL PV Program is part of the U.S. Department of Energy's (DOE) National Photovoltaics Program, as described in the DOE Photovoltaics Program Plan, FY 1991 - FY 1995. The mission of the DOE National Photovoltaics Program is to: "Work in partnership with U.S. industry to develop and deploy photovoltaic technology for generating economically competitive electric power, making photovoltaics an important contributor to the nation's and the world's energy use and environmental improvement. The two primary goals of the national program are to (1) maintain the U.S. PV industry's world leadership in research and technology development and (2) help the U.S. industry remain a major, profitable force in the world market. The NREL PV Program provides leadership and support to the national program toward achieving its mission and goals.

Contaminants in food chains of arctic ungulates: what have we learned from the Chernobyl accident?

International Nuclear Information System (INIS)

Åhman, B.

1998-01-01

The Chernobyl accident of 1986 caused radioactive contamination of widespread areas of reindeer pasture in Scandinavia. Reindeer (Rangifer tarandus) are especially exposed to radioactive fallout due to their winter diet, of which lichens are an important part. Much knowledge about the transfer of radiocaesium to reindeer, and via reindeer meat to man, was accumulated by intense scientific investigations, undertaken during the 1960s and 1970s, following nuclear weapons testing. Various ways to reduce the transfer of radiocaesium to animals and humans were also developed during this time. Much of the older knowledge proved to be of great value in the attempts to determine potential consequences of the Chernobyl accident and to suggest possible ways to ameliorate the effects of contamination. After Chernobyl, not only did reindeer prove to be a problem; many other food products originating from natural and semi-natural ecosystems were found to accumulate significant amounts of radiocaesium. Intense scientific work has produced new knowledge about the role of ungulates in the transfer of nutrients and contaminants within these systems. Different measures, like providing uncontaminated feed, use of caesium binders, altering the time of slaughter have been used with good results to minimize the transfer of radiocaesium to animals grazing natural pastures. The high cost of countermeasures has enforced consideration of cost against risk, which may also be of general interest with respect to other forms of pollution. Information, introduction of countermeasures and so forth would be more efficient in case a similar accident were to happen again. The Chernobyl accident is an obvious example of how human failures when dealing with a modern technical system can have global consequences and also be a potential threat to what we like to think of as the unspoiled wilderness of the Arctic

Tendência das taxas de mortalidade infantil e de seus componentes em Guarulhos-SP, no período de 1996 a 2011

Directory of Open Access Journals (Sweden)

Daniel Hideki Bando

Full Text Available OBJETIVO: analisar as tendências das taxas de mortalidade infantil (TMI e seus componentes em Guarulhos-SP, no período 1996-2011. MÉTODOS: regressão linear segmentada, para estimar as variações percentuais anuais (VPA. RESULTADOS: em 1996, a TMI e de seus componentes neonatal precoce, neonatal tardio e pós-neonatal foram, respectivamente, de 31,6, 16,7, 3,4 e 11,6 por 1000 nascidos vivos; em 2011, essas taxas foram de 12,6, 5,9, 1,6 e 5,1 respectivamente; houve diminuição significativa das TMI em todo o período; de 1996 a 2002, a VPA foi de -9,9, e de 2002 a 2011, foi de -3,7; o componente neonatal apresentou igual padrão; o componente neonatal precoce apresentou diminuição de 1996 a 2002 (VPA: -12,8, permanecendo estável até 2011; verificou-se diminuição do componente neonatal tardio de 1996 a 2009 (VPA: -2,8; o componente pós-neonatal apresentou redução em todo o período (VPA: -5,7. CONCLUSÃO: observou-se tendência de diminuição das TMI e de seus componentes.

International excursion hydrogeology, Slovakia, [September 8 - 15, 1996

NARCIS (Netherlands)

Dijksma, R.

1996-01-01

This is a report of the hydrogeological excursion to Slovakia, held in the period from September 8 up to September 15, 1996. This report is a compilation of the work of the participating students, parts of the excursion guide and also information, provided by the Slovak excursion guides.

Wild boar movement ecology across scales: Insights from a population expanding into agroecosystems of Southern Belgium

OpenAIRE

Morelle, Kevin

2015-01-01

Over the time, ungulates have seen their populations continuously changing under the e ect of direct, i.e. hunting pressure, and indirect, i.e. land-use changes, human activities. Under control until recently, ungulates have progressively adapted to these modi cations and are now able to cope with human-shaped environments, consequently their number and range have greatly and worryingly increased. More particularly, among ungulates species, the wild boar Sus scrofa raises...

Tallinna sadama ümbruse maa-ala renoveerimise ideekonkurss 1996 = The area around the port of Tallinn : contest for renovation ideas 1996 / Veljo Kaasik

Index Scriptorium Estoniae

Kaasik, Veljo

1999-01-01

Tallinna sadamapiirkonnast. Linnaehituslik ideekava Tallinna kesklinna sadama ümbruse maa-ala renoveerimiseks (ideekonkursi võistlustöö arhitektuurne osa, 1996). Autorid: A. Alver, V. Kaasik, T. Trummal. Kaasautorid: T. Laht, S. Koppel, U. Mets

Fish monitoring project -- Oregon: Smolt monitoring activities at Little Goose Dam in 1996. Annual Report 1996

International Nuclear Information System (INIS)

Setter, A.

1998-01-01

The juvenile fish facility at Little Goose Dam is operated seasonally to collect and bypass downstream migrating smolts and keep them from passing through the turbine blades. Fish are diverted from turbines by traveling screens as they sound in the forebay to pass the dam. A small percentage of the passing fish are sampled on a daily basis to provide information on fish condition, species composition, migration timing, and size distribution. Oregon Department of Fish and Wildlife personnel perform daily fish sampling and data collection. Physical operation of the facility is the responsibility of the US Army Corps of Engineers. Data is reported to the Fish Passage Center daily by means of electronic data transfer. Funding for this project was provided through the Smolt Monitoring Program administered by the Fish Passage Center. Overall, the number of fish collected and sampled in 1996 was a reduction from the previous years of operation. The 1996 migration season was characterized by higher than average flows and greater spill frequency at the dam. It was the first year that coho salmon were obtained in the sample. The predominant species collected was steelhead with hatchery fish outnumbering wild fish by a ratio of 8:1. An increased emphasis was placed on gas bubble trauma examination and a routine, consistent effort was implemented using a protocol established by the Fish Passage Center. The objective of the gas bubble trauma (GBT) examinations was to document the relative incidence of symptoms throughout the migration season

State heating oil and propane program. Final report, 1995--1996

International Nuclear Information System (INIS)

Rizzolo, D.R.

1997-01-01

This reports documents the 1995-1996 United States Department of Energy (USDOE) program to monitor No. 2 heating oil and propane prices. Data reported encompass states that are heavily dependent on these products. Twelve surveys were conducted semimonthly to obtain the necessary price information from retail fuel merchants and propane dealers. Surveys began on October 2, 1995 and ended on March 18, 1996. Responses were analyzed to avoid questionable prices. Tables and graphs included in the report reflect the general activity of the prices furnished during the surveys. 3 figs., 2 tabs

Research at GANIL. A compilation 1996-1997

Energy Technology Data Exchange (ETDEWEB)

Balanzat, E.; Bex, M.; Galin, J.; Geswend, S. [eds.

1998-12-01

The present compilation gives an overview of experimental results obtained with the GANIL facility during the period 1996-1997. It includes nuclear physics activities as well as interdisciplinary research. The scientific domain presented here extends well beyond the traditional nuclear physics and includes atomic physics, condensed matter physics, nuclear astrophysics, radiation chemistry, radiobiology as well as applied physics. In the nuclear physics field, many new results have been obtained concerning nuclear structure as well as the dynamics of nuclear collisions and nuclear disassembly of complex systems. Results presented deal in particular with the problem of energy equilibration, timescales and the origin of multifragmentation. Nuclear structure studies using both stable and radioactive beams deal with halo systems, study of shell closures far from stability, the existence of nuclear molecules as well as measurements of fundamental data s half lives, nuclear masses, nuclear radii, quadrupole and magnetic moments. In addition to traditional fields of atomic and solid state physics, new themes such as radiation chemistry and radiobiology are progressively being tackled. (K.A.)

Summary report of the overseas researcher invitation program in FY1996; 1996 nendo kaigai kenkyusha shohei jigyo hokokusho

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-03-01

To exchange research information, Mr. Koernaen Inif was invited from the Ministry of Industry and Commerce, Indonesia in the period between 4th November in 1996 and 4th February in 1997 as a part of the overseas researcher invitation program in FY 1996. The research theme is `Investigation of low cost removal method of COD and BOD from industrial waste water: Biodegradation of lignin in the waste water from pulp industry using anaerobic bacteria.` The institute of the invited researcher has promoted investigations for improving water quality of the Surabaya River. The largest reason of the water quality pollution of the Surabaya River is caused by the waste water from paper and pulp industry, and pollutants are COD and BOD. In major factories with economic margins, waste water treatments have been conducted, which do not satisfy the waste water standard of factories. In this investigation, the treatment technology information of industrial waste water were collected. The information were summarized for contributing to the future research and development in Surabaya. The objective was to obtain the biodegradation techniques of lignin using anaerobic bacteria. 51 refs., 7 figs., 5 tabs.

Materials Research Department annual report 1996

International Nuclear Information System (INIS)

Soerensen, B.F.; Hansen, N.

1997-04-01

Selected activities of the Materials Research Department at Risoe National Laboratory during 1996 are described. The scientific work is presented in four chapters: Materials Science, Materials Chemistry, Materials Engineering and Materials Technology. A survey is given of the Department's participation in international collaboration and of its activities within education and training. Furthermore, the main figures outlining the funding and expenditure of the Department are given. Lists of staff members, visiting scientists, publications and other Department activities are included. (au)

Spawning salmon disrupt trophic coupling between wolves and ungulate prey in coastal British Columbia

Directory of Open Access Journals (Sweden)

Darimont Chris T

2008-09-01

Full Text Available Abstract Background As a cross-boundary resource subsidy, spawning salmon can strongly affect consumer and ecosystem ecology. Here we examine whether this marine resource can influence a terrestrial wolf-deer (Canis lupus-Odocoileus hemionus predator-prey system in coastal British Columbia, Canada. Data on resource availability and resource use among eight wolf groups for three seasons over four years allow us to evaluate competing hypotheses that describe salmon as either an alternate resource, consumed in areas where deer are scarce, or as a targeted resource, consumed as a positive function of its availability. Faecal (n = 2203 wolf scats and isotopic analyses (n = 60 wolf hair samples provide independent data sets, also allowing us to examine how consistent these common techniques are in estimating foraging behaviour. Results At the population level during spring and summer, deer remains occurred in roughly 90 and 95% of faeces respectively. When salmon become available in autumn, however, the population showed a pronounced dietary shift in which deer consumption among groups was negatively correlated (r = -0.77, P 13C isotopic signatures (r = 0.78; P = 0.008, which were calculated by intra-hair comparisons between segments grown during summer and fall. The magnitude of this seasonal isotopic shift, our proxy for salmon use, was related primarily to estimates of salmon availability, not deer availability, among wolf groups. Conclusion Concordance of faecal and isotopic data suggests our intra-hair isotopic methodology provides an accurate proxy for salmon consumption, and might reliably track seasonal dietary shifts in other consumer-resource systems. Use of salmon by wolves as a function of its abundance and the adaptive explanations we provide suggest a long-term and widespread association between wolves and salmon. Seasonally, this system departs from the common wolf-ungulate model. Broad ecological implications include the potential

Revisiting Education for All 1996-2006 (India) | IDRC - International ...

International Development Research Centre (IDRC) Digital Library (Canada)

The Public Report on Basic Education (1996), a study that is widely known as ... has made a significant contribution to public policy on primary education in India. ... prevent gender-based violence, and make digital platforms work for inclusive ...

Annual report 1996

Energy Technology Data Exchange (ETDEWEB)

Chmielewska, D.; Infeld, E.; Zupranski, P. [eds.

1997-12-31

In the presented report the research activities of the Soltan Institute for Nuclear Studies (SINS) in year 1996 are described. The report is divided into parts in which the research in SINS departments and laboratories are described and namely in: Department of Nuclear Reactions, Department of Nuclear Spectroscopy and Technique, Department of Nuclear Electronics, Department of Radiation Shielding and Dosimetry, Department of Plasma Physics and Technology, Department of High Energy Physics, Department of Cosmic Radiation Physics, Department of Atomic Nucleus Theory, Department of Radiation Detectors, Department of Accelerator Physics and Technology, Sections for Standards and Patents and Establishment for Nuclear Equipment. All sections include an introduction in which whole of mentioned department activity is briefly presented. Additionally the information about: list of personnel, seminars held at the department and published papers is given.

Annual report 1996

International Nuclear Information System (INIS)

Chmielewska, D.; Infeld, E.; Zupranski, P.

1997-01-01

In the presented report the research activities of the Soltan Institute for Nuclear Studies (SINS) in year 1996 are described. The report is divided into parts in which the research in SINS departments and laboratories are described and namely in: Department of Nuclear Reactions, Department of Nuclear Spectroscopy and Technique, Department of Nuclear Electronics, Department of Radiation Shielding and Dosimetry, Department of Plasma Physics and Technology, Department of High Energy Physics, Department of Cosmic Radiation Physics, Department of Atomic Nucleus Theory, Department of Radiation Detectors, Department of Accelerator Physics and Technology, Sections for Standards and Patents and Establishment for Nuclear Equipment. All sections include an introduction in which whole of mentioned department activity is briefly presented. Additionally the information about: list of personnel, seminars held at the department and published papers is given

Science and Technology Review, August 1996

Energy Technology Data Exchange (ETDEWEB)

Failor, B.; Stull, S.; Wheatcraft, D. [eds.

1996-08-01

This review is published ten times a year to communicate, to a broad audience, Lawrence Livermore National Laboratory`s scientific and technological accomplishments, particularly in the Laboratory`s core mission areas - global security, energy and the environment, and bioscience and biotechnology. Topics discussed in this August 1996 issue are: Keeping the nuclear stockpile safe, secure, and reliable; Molten salt takes the bang out of high explosives; Security clearances meet the electronic age; and Exploring oil fields with crosshole electromagnetic induction.

Results from the organ and tissue transplant program in Nuevo Leon, Mexico, 1996 to 2001.

Science.gov (United States)

Carbajal, H; Cabriales, H

2003-12-01

Before 1996, solid organs from cadaveric donors (CD) did not account for more than 2% of all transplants. The need for more transplants led the state to undergo several legislative, societal, organizational, and infrastructure changes. A descriptive analysis of the evolution of the transplant program in the State of Nuevo León, Mexico, from 1996 to 2001. Trimester reports have been routinely performed since 1996 from the 14 institutions that are licensed to perform organ and tissue transplants in the State of Nuevo León, Mexico. All reports were concentrated and a descriptive analysis is presented herein. From 1996 until 2001, a total of 1457 organ and tissue (OT) transplants have been performed. At the end of this period, there was a 214% increase in the total number of transplants. By 2001, 73% of the program's total of 1457 OT transplants came from cadaveric donors. The state transplant program of Nuevo León has experienced a dramatic growth since 1996. The percent of organs transplanted from cadaveric donors is one of the highest in Mexico. There is still much work to be done at the state and national levels; better epidemiological studies and dialysis registries are needed as well as investment in transplant research.

Steam generator cleaning campaigns at Bruce A: 1993-1996

International Nuclear Information System (INIS)

Puzzuoli, F.V.; Leinonen, P.J.; Lowe, G.A.

1997-01-01

Boiler chemical cleaning (BOCC) and high-pressure water lancing operations were performed during the Bruce A 1993 Unit 3, 1994 Unit 3, 1995 Unit 1 and 1996 Unit 3 outages to remove secondary side deposits. High-pressure water lancing focused on three boiler areas: tube support plates, to remove broached hole deposits, hot leg U-bend supports to dislodge deposits contributing to boiler tube stress corrosion cracking and tube sheets with the aim of removing accumulated sludge piles and post BOCC insoluble residues. The chemical cleaning processes applied were modified versions of the one developed by the Electric Power Research Institute/Steam Generator Owners Group. During these BOCC operations, corrosion for several key boiler materials was monitored and was well below the specified allowances

MORPHOLOGICAL INTEGRATION OF NATIVE SOUTH AMERICAN UNGULATE MANDIBLES. A TRIBUTE TO D’ARCY THOMPSON IN THE CENTENNIAL OF “ON GROWTH AND FORM”

Directory of Open Access Journals (Sweden)

Cassini, Guillermo H.

2017-12-01

Full Text Available South American native ungulates include several extinct lineages that evolved within the context of South American Cenozoic geographic isolation. By the late early Miocene Santacrucian Age, the orders Notoungulata, Litopterna, and Astrapotheria were differentiated. Recent ecomorphological studies highlighted complex functional patterns between their habitat/diet and hypsodonty. In order to understand these relationships in an evolutionary context we used geometric morphometrics methods (27 3-D landmarks to evaluate the morphological integration of two of the primary functional units of the mandible: the alveolar region and the ascending ramus. Principal component analyses (PCA and two blocks Partial Least Squares analyses (PLS were used to explore the patterns of variation and covariation between these two modules. The main variation in shape is related to the robusticity and curvature of the mandibular corpus, and the relative size of the angular and coronoid process. The PLS analyses show a very strong morphological integration within the Litopterna, but a pattern of modularity in the Notoungulata. There is a common pattern of covariation in Astrapotheria and Litopterna, which might be due to similar constraints. The different covariation patterns in notoungulates with respect to litopterns are in concordance with both the taxonomic and morphological diversity of the clades, particularly in the typotheres. The modularity present in notoungulates could have allowed specializations in each module of the mandible, related to crown height or muscle attachments, without a high morphological constrain. This could have resulted in their high morphological diversity, in contrast with the more conservative morphology present in litopterns.

Measurement of radioactivity in Austria 1996 and 1997: Data and assesment; Radioaktivitaetsmessungen in Oesterreich 1996 und 1997: Daten und Bewertung

Energy Technology Data Exchange (ETDEWEB)

Hsg Republik Oesterreich, IV, Bundeskanzleramt Sektion

1998-12-01

In the years 1996 and 1997 the average annual radiation exposure of the Austrian population amounted to about 4.6 mSv effective dose. The contributions dominating by far originate from natural and medical sources of radiation. Contributions of all other sources of radiation are extremely small in comparison with these. The average annual effective dose caused by natural radiation amounts to approximately 3.2 mSv. The inhalation of the radioactive noble gas radon and its short lived progeny in the mean contributes more than half to this exposure, but considerable variations do occur. There are regions with particular geological conditions where the exposure due to radon by far exceeds all other exposures. Artificial radiation exposure is predominantly caused by the use of radioactive substances and of ionizing radiation in medical applications, in particular by x-ray diagnostics, leading on the average to approximately 1.3 mSv annually in the reporting period. By comparison, the dose to the Austrian population due to the effects of the reactor accident at Chernobyl amounting in the years 1996 and 1997 to less than 0.02 mSv annually is small. The exposure as a result of the operation of the nuclear installations at the Austrian Research Centre Seibersdorf and at the Atomic Institute of the Austrian Universities also in 1996 and 1997 was negligible. Investigative measurements by the authorities of gaseous and liquid emissions and the internal surveillance by the operators show that maximum permissible levels were never exceeded. Also environmental monitoring in the surroundings could not detect any inadmissibly high gamma dose rates or immissions. (author)

Activity report june 1996 - may 1998; Rapport d'activite juin 1996 - mai 1998

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-07-01

The aim of this report is to outline the scientific activity of the ''Service de Physique Theorique'' (SPhT), during the period june 1996-may 1998: activity in terms of structure, scientific research programs and results, publications, training and contracts. SPhT is one of the service of the ''Direction des Sciences de la Matiere'' (DSM), itself depending of the CEA Institution. The scientific domains covered by this report are: the statistical physics (phase transition, biophysics, soft matter, quantum systems); mathematical physics and fields theory (strings theory, random matrix, quantum theory); astrophysics, nuclear physics and particles physics. (A.L.B.)

AECB staff annual assessment of the Darlington Nuclear Generating Station for the year 1996

International Nuclear Information System (INIS)

1997-06-01

The Atomic Energy Control Board is the independent federal agency that controls all nuclear activities in Canada. A major use of nuclear energy in Canada is electricity production. The AECB assesses every station's performance against legal requirements, including the conditions in the operating licence. Each station is inspected and all aspects of the station's operation and management is reviewed. This report is the AECB staff assessment of safety at the Darlington Nuclear Generating Station for 1996. Ontario Hydro operated the station in a safe manner in 1996. All four special safety systems were fully available 100 percent of the time. There were more problems that affected the safety support systems in 1996 than in the previous year

Annual report of Institute of Nuclear Chemistry and Technology 1996

International Nuclear Information System (INIS)

1997-06-01

The report is a collection of short communications being a review of the scientific activities of the Institute of Nuclear Chemistry and Technology, Warsaw in 1996. The papers are gathered in several branches as follows: radiation chemistry and physics (17); Radiochemistry, stable isotopes, nuclear analytical methods,chemistry in general (20); radiobiology (9); nuclear technologies and methods (28).The last and biggest chapter has been divided in four smaller groups; process engineering; material engineering,structural studies,diagnostics; radiation technologies; nucleonic control systems. The annual report of INCT-1996 contains also a general information of Institute, the full list of scientific publications and patents, conferences organized by INCT, Ph.D. and D.Sc. thesis, a list of projects granted by Polish Committee of Scientific Research and other organizations

Annual report of Institute of Nuclear Chemistry and Technology 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-06-01

The report is a collection of short communications being a review of the scientific activities of the Institute of Nuclear Chemistry and Technology, Warsaw in 1996. The papers are gathered in several branches as follows: radiation chemistry and physics (17); Radiochemistry, stable isotopes, nuclear analytical methods,chemistry in general (20); radiobiology (9); nuclear technologies and methods (28).The last and biggest chapter has been divided in four smaller groups; process engineering; material engineering,structural studies,diagnostics; radiation technologies; nucleonic control systems. The annual report of INCT-1996 contains also a general information of Institute, the full list of scientific publications and patents, conferences organized by INCT, Ph.D. and D.Sc. thesis, a list of projects granted by Polish Committee of Scientific Research and other organizations.

International energy annual 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-02-01

The International Energy Annual presents an overview of key international energy trends for production, consumption, imports, and exports of primary energy commodities in over 220 countries, dependencies, and areas of special sovereignty. Also included are population and gross domestic product data, as well as prices for crude oil and petroleum products in selected countries. Renewable energy reported in the International Energy Annual includes hydroelectric power, geothermal, solar, and wind electric power, biofuels energy for the US, and biofuels electric power for Brazil. New in the 1996 edition are estimates of carbon dioxide emissions from the consumption of petroleum and coal, and the consumption and flaring of natural gas. 72 tabs.

Precursors to potential severe core damage accidents: 1996. A status report. Volume 25

International Nuclear Information System (INIS)

Belles, R.J.; Cletcher, J.W.; Copinger, D.A.; Muhlheim, M.D.; Dolan, B.W.; Minarick, J.W.

1997-12-01

This report describes the 14 operational events in 1996 that affected 13 commercial light-water reactors and that are considered to be precursors to potential severe core damage accidents. All these events had conditional probabilities of subsequent severe core damage greater than or equal to 1.0 x 10 -6 . These events were identified by first computer-screening the 1996 licensee event reports from commercial light-water reactors to identify those events that could potentially be precursors. Candidate precursors were selected and evaluated in a process similar to that used in previous assessments. Selected events underwent engineering evaluation that identified, analyzed, and documented the precursors. Other events designated by the Nuclear Regulatory Commission (NRC) also underwent a similar evaluation. Finally, documented precursors were submitted for review by licensees and NRC headquarters and regional offices to ensure the plant design and its response to the precursor were correctly characterized. This study is a continuation of earlier work, which evaluated 1969--1995 events. The report discusses the general rationale for this study, the selection and documentation of events as precursors, and the estimation of conditional probabilities of subsequent severe core damage for the events

Distance Learning Skills and Responsibilities: A Content Analysis of Job Announcements 1996-2010

Science.gov (United States)

Rebmann, Kristen Radsliff; Molitor, Simone; Rainey, Bonnie

2012-01-01

Archived job advertisements from the "International Federation of Library Associations and Institutions (IFLA) LIBJOBS" mailing list (1996-2010) were examined using content analysis. Findings suggest that distance learning (DL) skillsets as job qualifications emerged in the late 1990's and continue to be relevant today. Jobs with DL…

Human Cases of Tularemia in Armenia, 1996-2012.

Science.gov (United States)

Melikjanyan, Syuzanna; Palayan, Karo; Vanyan, Artavazd; Avetisyan, Lilit; Bakunts, Nune; Kotanyan, Marine; Guerra, Marta

2017-09-01

A retrospective analysis was conducted of human cases and outbreaks of tularemia in the Republic of Armenia from 1996 to 2012 utilizing geographic information system software. A total of 266 human cases of tularemia were recorded in Armenia from 1996 to 2012, with yearly incidence ranging from 0 to 5.5 cases per 100,000 people. Cases predominantly affected the male population (62.8%), 11-20 year age group (37.2%), agricultural workers (49.6%), and persons residing in rural areas (93.6%). In 2003, a waterborne outbreak involving 158 cases occurred in Kotayk Marz, and in 2007, a foodborne outbreak with 17 cases occurred in Gegharkunik Marz, attributed to exposure of food products to contaminated hay. Geospatial analysis of all cases showed that the majority were associated with the steppe vegetation zone, elevations between 1,400 and 2,300 m, and the climate zone associated with dry, warm summers, and cold winters. Characterization of these environmental factors were used to develop a predictive risk model to improve surveillance and outbreak response for tularemia in Armenia.

Report of Activity, 1996 - 1997; Rapport d`activite 1996 - 1997

Energy Technology Data Exchange (ETDEWEB)

Augustin, Jean-Eudes [Inst. de Physique Nucleaire, Lyon-1 Univ., 69 - Villeurbanne (France)

1999-12-31

This report covers the activity developed in the Lyon Institute of Nuclear Physics in the years 1996-1997. The INP-Lyon is a mixed research unit, dependent on Lyon 1 Claude Bernard University, on one side, and on CNRS Institute of Nuclear and Particle Physics, on the other side. Its personnel of some 200 fellows is formed up of a half of researchers and undergraduate researchers, the other half being engineers, technicians and administration personnel. The principal activities in INP Lyon are the experimental research in sub-atomic physics as well as the training by research of the master and enrolled towards Ph D students. The main research problems concern the particle physics nuclear matter and the particle astrophysics as well as the works in theoretical physics, radioactive product management and the interactions ions/clusters - matter. The report contains the following chapters: Physics at LEP, Experiment preparation for LHC, Hadronic and Nuclear Matter, Astro-particles, Theoretical Physics, Ions/clusters - matter and physico-chemistry of the ion-matter interaction, Technical activities, Scientific life at INP -Lyon

Report of Activity, 1996 - 1997; Rapport d`activite 1996 - 1997

Energy Technology Data Exchange (ETDEWEB)

Augustin, Jean-Eudes [Inst. de Physique Nucleaire, Lyon-1 Univ., 69 - Villeurbanne (France)

1998-12-31

This report covers the activity developed in the Lyon Institute of Nuclear Physics in the years 1996-1997. The INP-Lyon is a mixed research unit, dependent on Lyon 1 Claude Bernard University, on one side, and on CNRS Institute of Nuclear and Particle Physics, on the other side. Its personnel of some 200 fellows is formed up of a half of researchers and undergraduate researchers, the other half being engineers, technicians and administration personnel. The principal activities in INP Lyon are the experimental research in sub-atomic physics as well as the training by research of the master and enrolled towards Ph D students. The main research problems concern the particle physics nuclear matter and the particle astrophysics as well as the works in theoretical physics, radioactive product management and the interactions ions/clusters - matter. The report contains the following chapters: Physics at LEP, Experiment preparation for LHC, Hadronic and Nuclear Matter, Astro-particles, Theoretical Physics, Ions/clusters - matter and physico-chemistry of the ion-matter interaction, Technical activities, Scientific life at INP -Lyon

1995-1996 annual report of the Petroleum Recovery Institute

International Nuclear Information System (INIS)

1996-01-01

Financial performance and technical achievements were highlighted in the Petroleum Recovery Institute's 1995-96 annual review, with a special review of PRI's involvement with microgravity science. A list of PRI research and technology contracts and research reports from 1995-1996 was also included

Use of Special Operations Forces in United Nations Missions: a Method to Resolve Complexity

Science.gov (United States)

2015-05-21

physical stamina and psychological stability, followed by a rigorous training program are the imperatives to create SOF soldiers.42 Mark Bowden in...recommendation is that the United Nations should establish a Special Operations planning cell within the UN Department of Peacekeeping Operations. As of...now, the cell is nonexistent. This cell should be able to facilitate the integration of SOF into the overall peace operations concept. Finally, the

Par Pond vegetation status 1996

International Nuclear Information System (INIS)

Mackey, H.E. Jr.; Riley, R.S.

1996-12-01

The water level of Par Pond was lowered approximately 20 feet in mid-1991 in order to protect downstream residents from possible dam failure suggested by subsidence on the downstream slope of the dam and to repair the dam. This lowering exposed both emergent and nonemergent macrophyte beds to drying conditions resulting in extensive losses. A survey of the newly emergent, shoreline aquatic plant communities of Par Pond began in June 1995, three months after the refilling of Par Pond to approximately 200 feet above mean sea level. These surveys continued in July, September, and late October, 1995, and into the early spring and late summer of 1996. Communities similar to the pre-drawdown, Par Pond aquatic plant communities continue to become re-established. Emergent beds of maidencane, lotus, waterlily, watershield, and Pontederia are extensive and well developed. Measures of percent cover, width of beds, and estimates of area of coverage with satellite data indicate regrowth within two years of from 40 to 60% of levels prior to the draw down. Cattail occurrence continued to increase during the summer of 1996, especially in the former warm arm of Par Pond, but large beds common to Par Pond prior to the draw down still have not formed. Lotus has invaded and occupies many of the areas formerly dominated by cattail beds. To track the continued development of macrophytes in Par Pond, future surveys through the summer and early fall of 1997, along with the evaluation of satellite data to map the extent of the macrophyte beds of Par Pond, are planned

Design and Control of a Powered Hip Exoskeleton for Walking Assistance

OpenAIRE

Wu, Qingcong; Wang, Xingsong; Du, Fengpo; Zhang, Xiaobo

2015-01-01

The wearable powered exoskeleton is a human-robot cooperation system that integrates the strength of a robot with human intelligence. This paper presents the research results into a powered hip exoskeleton (PH-EXOS) designed to provide locomotive assistance to individuals with walking impediments. The Bowden cable actuated exoskeleton has an anthropomorphic structure with six degrees of freedom (DOF) in order to match the human hip anatomy and enable natural interaction with the user. The mec...

International study on gas prices (September 1996 - September 1997)

International Nuclear Information System (INIS)

1998-01-01

This economic study summarizes the evolution of gas prices from September 1996 to September 1997 in a selected panel of European and Non-European countries (Italy, The Netherlands, Sweden, Spain, Germany, Belgium, Finland, UK, Canada, USA, South Africa, Australia). (J.S.)

Issues in midterm analysis and forecasting, 1996

International Nuclear Information System (INIS)

1996-08-01

This document consists of papers which cover topics in analysis and modeling that underlie the Annual Energy Outlook 1996. Topics include: The Potential Impact of Technological Progress on U.S. Energy Markets; The Outlook for U.S. Import Dependence; Fuel Economy, Vehicle Choice, and Changing Demographics, and Annual Energy Outlook Forecast Evaluation

CLIMEX project: Report on the third year of treatment. May 1996 - December 1996

Energy Technology Data Exchange (ETDEWEB)

Jenkins, A. [ed.

1997-10-10

CLIMEX (Climate change experiment) is an international, cooperative whole-ecosystem research project studying the response of entire forested catchments to increased CO{sub 2} and temperature. The project is located at Risdalsheia in the southernmost Norway and involves five catchments and employs multiple treatments and controls. These whole-catchment manipulation experiments are designed to allow quantification of the links between terrestrial and aquatic ecosystems and provide direct experimental evidence of the effect of climatic change on natural forests, terrestrial ecosystems and water resources. This report describes results from the third year of treatment, which was 1996. Significant responses in vegetation, soils and waters were measured. 41 refs., 35 figs., 11 tabs.

Monitoring of long-range transported air pollutants, Annual report for 1996; Overvaaking av langtransportert forurenset luft og nedboer. Atmosfaerisk tilfoersel, 1996

Energy Technology Data Exchange (ETDEWEB)

Toerseth, K.; Manoe, S.

1997-12-31

This report describes the results from the rural air- and precipitation chemistry network in Norway. In 1996, main components in precipitation were measured at 32 sites and trace elements were determined at 13 sites. The concentrations of sulphur and nitrogen compounds in air were determined at 12 sites, and concentrations of ozone at 15 sites. The highest mean concentrations of sulphate, nitrate, ammonium and strong acid in precipitation occurred along the southern coast. Low values were found from Moere og Romsdal to Troms counties. The largest wet deposition of sulphate, nitrogen components and strong acid occurred along the coast of the southernmost tip of the country. All over the country the mean concentrations of sulphate, nitrate, ammonium and strong acid in precipitation had in general increased from 1995 to 1996. Because of small annual precipitation amounts the wet depositions were the lowest measured so far at most places in Norway. The highest content of particulate sulphate and of nitrogen components in air and in precipitation were measured in Southern Norway. The mean concentrations of sulphur dioxide were highest in Finnmark due to the nickel smelters in Russia. The largest annual mean concentrations of lead, cadmium and zinc in precipitation were measured in Southern Norway. Mercury in air decreased from 1992 to 1996 while the concentrations of lead, cadmium and zinc increased. This is opposite to the trend observed in precipitation chemistry and is probably due to emissions in Eastern Europe. 47 refs., 34 figs., 37 tabs.

1996 Annual report

International Nuclear Information System (INIS)

1997-01-01

This annual report present information of the main activities on the scope of the radiation protection and nuclear safety of the Nuclear Regulatory Authority (ARN) of the Argentina during 1996. The activities are developed in 10 chapters and 2 appendices, were are described the activities and the bases of the Argentine Regulatory System. The followings chapters and appendices are: 1.-Evolution of the nuclear regulatory activities in the Argentina since the beginnings in the CNEA. 2.-Regulatory system, laws and regulations. 3.-Institutional relations with national and international organizations. 4. and 5.-Safeguards and inspections of the nuclear installations. 6.-Radiation control of the occupational and public doses. 7.-Radiological emergencies. 8.-Projects and tasks scientific-technological. 9.-Training courses and meetings. 10.-Economic and human recourses. Appendix I.-Regulatory documentation. Appendix II.- Inspections of nuclear installations

Spring outmigration of wild and hatchery chinook salmon and steelhead trout smolts from the Imnaha River, Oregon, February 23--June 24, 1996. Annual report 1996

International Nuclear Information System (INIS)

Blendon, M.L.; Rocklage, S.J.; Kucera, P.A.

1997-04-01

For the third consecutive year, the Nez Perce Tribe, in conjunction with the Fish Passage Center, participated in the smolt monitoring program in the Imnaha River. A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from February 23 to June 24, 1996. A total of 1,797 wild chinook salmon, 11,896 hatchery chinook salmon, 3,786 wild steelhead trout, and 31,094 hatchery steelhead trout smolts were captured during outmigration studies on the Imnaha River in 1996. Mortality associated with trapping, handling and tagging was low, being 1.4% for wild chinook, 0.18% for hatchery chinook, 0.21% for wild steelhead and 0.28% for hatchery steelhead trout smolts

Conversion of native terrestrial ecosystems in Hawai‘i to novel grazing systems: a review

Science.gov (United States)

Leopold, Christina R.; Hess, Steven C.

2017-01-01

The remote oceanic islands of Hawai‘i exemplify the transformative effects that non-native herbivorous mammals can bring to isolated terrestrial ecosystems. We reviewed published literature containing systematically collected, analyzed, and peer-reviewed original data specifically addressing direct effects of non-native hoofed mammals (ungulates) on terrestrial ecosystems, and indirect effects and interactions on ecosystem processes in Hawai‘i. The effects of ungulates on native vegetation and ecosystems were addressed in 58 original studies and mostly showed strong short-term regeneration of dominant native trees and understory ferns after ungulate removal, but unassisted recovery was dependent on the extent of previous degradation. Ungulates were associated with herbivory, bark-stripping, disturbance by hoof action, soil erosion, enhanced nutrient cycling from the interaction of herbivory and grasses, and increased pyrogenicity and competition between native plants and pasture grasses. No studies demonstrated that ungulates benefitted native ecosystems except in short-term fire-risk reduction. However, non-native plants became problematic and continued to proliferate after release from herbivory, including at least 11 species of non-native pasture grasses that had become established prior to ungulate removal. Competition from non-native grasses inhibited native species regeneration where degradation was extensive. These processes have created novel grazing systems which, in some cases, have irreversibly altered Hawaii’s terrestrial ecology. Non-native plant control and outplanting of rarer native species will be necessary for recovery where degradation has been extensive. Lack of unassisted recovery in some locations should not be construed as a reason to not attempt restoration of other ecosystems.

Problem Gambling in New Mexico: 1996 and 1998

Science.gov (United States)

Starling, Randall; Blankenship, Jason; May, Philip; Woodall, Gill

2009-01-01

Included in both the 1996 and 1998 Survey of Gambling Behavior in New Mexico was a scale of individual problem gambling. To assess problems related to gambling behavior, questions were developed using the DSM-IV criteria for pathological gambling. The purpose of this paper is to describe problem gamblers in New Mexico. Descriptive data indicate…

Meteorology and Wind Energy Department annual report 1996

Energy Technology Data Exchange (ETDEWEB)

Hauge Madsen, P.; Dannemand Andersen, P.; Skrumsager, B. [eds.

1997-07-01

In 1996 the Meteorology and Wind Energy Department has performed research within the programme areas: (1) wind energy and (2) atmospheric processes. The objectives are through research in boundary layer meteorology, fluid dynamics, aerodynamics and structural mechanics to contribute with new knowledge within (1) wind energy in relation to development, manufacturing, operation and export as well as testing and certification of wind turbines, and (2) aspects of boundary-layer meteorology related to environmental and energy problems of society. The work is supported by the research programs of the Ministry of Environment and Energy, the Nordic Council of Ministers, EU as well as by industry. Through our research and development work we develop and provide methodologies including computer models for use by industry, institutions, and governmental authorities. In the long view we are developing facilities and programs enabling us to serve as a national and European centre for wind-energy and boundary-layer meteorological research. A summary of our activities in 1996 is presented. (au) 4 tabs., 5 ills.

Increasing hospital admission rates and economic burden for colorectal cancer in Brazil, 1996-2008 Aumento de las tasas de ingresos hospitalarios por cáncer colorrectal y su carga económica en Brasil, 1996-2008

Directory of Open Access Journals (Sweden)

Ulysses dos Santos Torres

2010-10-01

Full Text Available OBJECTIVE: To determine the trends in hospital admission rates for colorectal cancer (CRC in the Brazilian Public Health System from 1996 to 2008 and to assess the economic costs. METHODS: Data from the Hospital Information Systems database of the Brazilian Unified Health System were used for analysis of all admissions with a primary diagnosis of CRC between 1996 and 2008. RESULTS: There were 297 108 CRC admissions over the study period, with an annual increase from 12 821 in 1996 to 35 040 in 2008. Age-standardized admission rates increased from 8.7 to 23.56 per 100 000 for a percentage increase of 171%. The average length of stay decreased from 11.6 days in 1996 to 7.5 days in 2008. The average hospital mortality declined from 10.4% to 8.5%. Overall costs in United States dollars (US$ of CRC hospitalizations rose from US$ 16.5 million in 1996 to US$ 33.5 million in 2008; the average cost of each admission, however, decreased from US$ 1 283 to US$ 954. CONCLUSIONS: Hospitalization rates for CRC in Brazil significantly increased during a 13-year period, incurring a considerable rise in the inflation-adjusted economic burden; national in-hospital mortality rates have remained relatively high.OBJETIVO: Determinar las tendencias de las tasas de ingresos hospitalarios por cáncer colorrectal (CCR en el sistema de salud pública brasileño de 1996 al 2008 y evaluar sus costos económicos. MÉTODOS: Se utilizó la información de la base de datos de los sistemas de información de los hospitales del Sistema Único de Salud brasileño con objeto de analizar todos los ingresos con diagnóstico primario de CCR entre 1996 y el 2008. RESULTADOS: Durante el período de estudio, se produjeron 297 108 ingresos por CCR, con un aumento anual de 12 821 en 1996 a 35 040 en el 2008. Las tasas de ingresos estandarizadas según la edad aumentaron de 8,7 a 23,56 por 100 000, con un aumento porcentual de 171%. La estancia hospitalaria media disminuyó de 11,6 días en

Evolução temporal do tabagismo em estudantes de medicina, 1986, 1991, 1996 Trends in smoking habits among medical students in 1986, 1991, 1996

Directory of Open Access Journals (Sweden)

Ana Menezes

2001-04-01

Full Text Available OBJETIVO: Avaliar a tendência temporal do tabagismo em estudantes de medicina nos últimos dez anos. MÉTODOS: Realizou-se estudo transversal com estudantes do primeiro ao quinto ano do curso de medicina, em 1996. A amostra foi de 449 alunos que responderam a questionário auto-aplicável. Fumante era aquele que fumava um ou mais cigarros por dia há pelo menos um mês; ex-fumantes foram aqueles que, no período da entrevista, não eram fumantes regulares, mas o haviam sido anteriormente. Pesquisa similar foi realizada em 1986 e 1991. RESULTADOS/CONCLUSÕES: A prevalência de tabagismo foi de 11%, comparada com 14% em 1991 e 21% em 1986. Apesar da redução do tabagismo nas três séries estudadas, a queda percentual entre 1996 e 1991 foi menor do que aquela observada entre 1991 e 1986. Em 1996, a prevalência do vício de fumar aumentou conforme o ano cursado. Não houve diferenças significativas quanto ao sexo. A maioria dos alunos mostrou-se favorável à proibição do fumo em locais de ensino e assistência e afirmaram que o tema era pouco valorizado no currículo da faculdade.OBJECTIVE: To evaluate trends in smoking habits among medical students in the last ten years. METHODS: In 1996, a cross-sectional survey of smoking habits was carried out among students in the first to the fifth year of medical school. Four hundred and nine students answered the questionnaire. A regular smoker was defined as someone who smokes one or more cigarettes a day at least for one month; former smokers were the ones who used to smoke in the past but not at the moment. Similar researchs were conducted in 1986 and 1991. RESULTS/CONCLUSIONS: Smoking prevalence was 11% compared with 14% in 1991 and 21% in 1986. Although there was a significant reduction of smoking in the last three years, the actual decrease from 1991 to 1996 was less than that observed from 1986 to 1991. In 1961, the prevalence of smoking increased in the last years of medical school. There

Performance of spanish wind turbines. Year 1996

International Nuclear Information System (INIS)

Lago, C.

1998-01-01

In this document we can find a statistical evaluation for the wind energy generation from each spanish wind farm referred to 1996 going on with the work that has been carried out since 1992, by initiative of the Wind Energy Division from Renewable Energy Institute. The purpose of this work is to contribute with interesting information for the wind environment and offer a global view from monthly performances of different wind farms. (Author) 4 refs

Publications issued in 1996. Priced and unpriced

International Nuclear Information System (INIS)

1997-01-01

The publications issued by the IAEA's Division of Publications in 1996 are grouped in four categories: Priced and miscellaneous publications classified by divisions and by series; unpriced and miscellaneous publications classified by divisions and series. The information provided about each publication includes the symbol, language, title, centre and project code, data of time and number of pages

Systems Analysis Department. Annual progress report 1996

Energy Technology Data Exchange (ETDEWEB)

Larsen, H; Olsson, C; Petersen, K E [eds.

1997-03-01

The report describes the work of the Systems Analysis Department at Risoe National Laboratory during 1996. The department is undertaking research within Simulation and Optimisation of Energy Systems, Energy and Environment in Developing Countries - UNEP Centre, Integrated Environmental and Risk Management and Man/Machine Interaction. The report includes lists of publications, lectures, committees and staff members. (au) 131 refs.

Hanford Site groundwater monitoring for fiscal year 1996

Energy Technology Data Exchange (ETDEWEB)

Hartman, M.J.; Dresel, P.E.; Borghese, J.V. [eds.] [and others

1997-02-01

This report presents the results of groundwater and vadose-zone monitoring for fiscal year (FY) 1996 on the Hanford Site, Washington. Hanford Site operations from 1943 onward produced large quantities of radiological and chemical waste that affected groundwater quality on the site. Characterization and monitoring of the vadose zone during FY 1996 comprised primarily spectral gamma logging, soil-gas monitoring, and electrical resistivity tomography. Water-level monitoring was performed to evaluate groundwater-flow directions, to track changes in water levels, and to relate such changes to evolving disposal practices. Water levels over most of the Hanford Site continued to decline between June 1995 and June 1996. Groundwater chemistry was monitored to track the extent of contamination, to note trends, and to identify emerging groundwater-quality problems. The most widespread radiological contaminant plumes were tritium and iodine-129. Smaller plumes of strontium-90, technetium-99, and plutonium also were present at levels above the U.S. Environmental Protection Agency or State of Washington interim drinking water standards. Uranium concentrations greater than the proposed drinking water standard were also observed. Nitrate, fluoride, chromium, carbon tetrachloride, chloroform, trichloroethylene, and cis-1,2-dichlomethylene were present in groundwater samples at levels above their U.S. Environmental Protection Agency or State of Washington maximum contaminant levels. The nitrate plume is the most extensive. Three-dimensional, numerical, groundwater models were applied to the Hanford Site to predict contaminant-flow paths and the impact of operational changes on site groundwater conditions. Other models were applied to assess the performance of three separate pump-and-treat systems.

Hanford Site groundwater monitoring for fiscal year 1996

International Nuclear Information System (INIS)

Hartman, M.J.; Dresel, P.E.; Borghese, J.V.

1997-02-01

This report presents the results of groundwater and vadose-zone monitoring for fiscal year (FY) 1996 on the Hanford Site, Washington. Hanford Site operations from 1943 onward produced large quantities of radiological and chemical waste that affected groundwater quality on the site. Characterization and monitoring of the vadose zone during FY 1996 comprised primarily spectral gamma logging, soil-gas monitoring, and electrical resistivity tomography. Water-level monitoring was performed to evaluate groundwater-flow directions, to track changes in water levels, and to relate such changes to evolving disposal practices. Water levels over most of the Hanford Site continued to decline between June 1995 and June 1996. Groundwater chemistry was monitored to track the extent of contamination, to note trends, and to identify emerging groundwater-quality problems. The most widespread radiological contaminant plumes were tritium and iodine-129. Smaller plumes of strontium-90, technetium-99, and plutonium also were present at levels above the U.S. Environmental Protection Agency or State of Washington interim drinking water standards. Uranium concentrations greater than the proposed drinking water standard were also observed. Nitrate, fluoride, chromium, carbon tetrachloride, chloroform, trichloroethylene, and cis-1,2-dichlomethylene were present in groundwater samples at levels above their U.S. Environmental Protection Agency or State of Washington maximum contaminant levels. The nitrate plume is the most extensive. Three-dimensional, numerical, groundwater models were applied to the Hanford Site to predict contaminant-flow paths and the impact of operational changes on site groundwater conditions. Other models were applied to assess the performance of three separate pump-and-treat systems

National energy balance - 1977-1996 - Chile

International Nuclear Information System (INIS)

1997-01-01

The present document summarizes the historic document related to energy production, transformation and consumption in the country between 1977 and 1996. The manner the figures are presented allows their usage for diverse analyses. Certain modifications have been added to this introduction according to the suggestions received due to the publication of the 1975-1994 statement. This work will be periodically updated, including possible new energy sources as well as new consumption sectors. (author)

Environmental releases for calendar year 1996

International Nuclear Information System (INIS)

Greager, E.M.

1997-01-01

This report presents data on radioactive and nonradioactive materials released into the environment during calendar year 1996 from facilities and activities managed by the Fluor Daniel Hanford, Incorporated (formerly the Westinghouse Hanford Company) and Bechtel Hanford, Incorporated. Fluor Daniel Hanford, Incorporated provides effluent monitoring services for Bechtel Hanford, Incorporated, which includes release reporting. Both summary and detailed presentations of the environmental releases are provided. When appropriate, comparisons to data from previous years are made

Environmental releases for calendar year 1996

Energy Technology Data Exchange (ETDEWEB)

Greager, E.M.

1997-07-31

This report presents data on radioactive and nonradioactive materials released into the environment during calendar year 1996 from facilities and activities managed by the Fluor Daniel Hanford, Incorporated (formerly the Westinghouse Hanford Company) and Bechtel Hanford, Incorporated. Fluor Daniel Hanford, Incorporated provides effluent monitoring services for Bechtel Hanford, Incorporated, which includes release reporting. Both summary and detailed presentations of the environmental releases are provided. When appropriate, comparisons to data from previous years are made.

National energy balance - 1977-1996 - Chile

International Nuclear Information System (INIS)

1997-01-01

The present document summarizes the historic document related to energy production, transformation and consumption in the country between 1977 and 1996. The manner the figures are presented allows their usage for diverse analyses. Certain modifications have been added to this introduction according to the suggestions received due to the publication of the 1975-1994 statement. This work will be periodically updated, including possible new energy sources as well as new consumption sectors

Turbidity, SOLAR RADIATION - ATMOSPHERIC and other data from NATHANIEL B. PALMER from 1996-10-08 to 1996-11-05 (NODC Accession 9900066)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Temperature, salinity, and nutrients data were collected from CTD and bottle casts in the Pacific Ocean from the Nathaniel B. Palmer from 08 October 1996 to 05...

Communication of 13 June 1996 received from the Permanent Mission of Australia to the International Atomic Energy Agency

International Nuclear Information System (INIS)

1996-01-01

The document reproduces the Statement of the Prime Minister of Australia made on 8 June 1996 and a Press Release issued by the Minister for Foreign Affairs of Australia at the same date in respect of the test of a nuclear weapon conducted by China on 8 June 1996. These documents were received by the Director General of the IAEA on 17 June 1996 from the Resident Representative of Australia

An analysis of US propane markets, winter 1996-1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-06-01

In late summer 1996, in response to relatively low inventory levels and tight world oil markets, prices for crude oil, natural gas, and products derived from both began to increase rapidly ahead of the winter heating season. Various government and private sector forecasts indicated the potential for supply shortfalls and sharp price increases, especially in the event of unusually severe winter weather. Following a rapid runup in gasoline prices in the spring of 1996, public concerns were mounting about a possibly similar situation in heating fuels, with potentially more serious consequences. In response to these concerns, the Energy Information Administration (EIA) participated in numerous briefings and meetings with Executive Branch officials, Congressional committee members and staff, State Energy Offices, and consumers. EIA instituted a coordinated series of actions to closely monitor the situation and inform the public. This study constitutes one of those actions: an examination of propane supply, demand, and price developments and trends.

[Economic burden of esophageal cancer in China from 1996 to 2015: a systematic review].

Science.gov (United States)

Guo, L W; Shi, C L; Huang, H Y; Wang, L; Yue, X P; Liu, S Z; Li, J; Su, K; Dai, M; Sun, X B; Shi, J F

2017-01-10

Objective: To explore existing evidence of economic burden of esophageal cancer in China over the past 20 years. Methods: Based on PubMed, CNKI and Wanfang, literatures published from 1996 to 2015 were retrieved with the key words such as " economic burden" , "cost of illness" and so on. Then the information excerpted from those literatures were analyzed after several exclusionary procedures for non-esophageal cancer related literatures. The information about subjects and data source, methodology, main results were structurally abstracted and then analyzed. Quality assessments were conducted independently by two investigators using an 11-item instrument recommended by the Agency for Healthcare Research and Quality (AHRQ) for cross-sectional studies. All the expenditure data were calculated according to year-specific personal health care consumer price index (CPI) of China, the annual growth rate was calculated according to the average speed of growth. Results: A total of 23 studies (21 individual surveys and 2 population-based surveys) were included in the analysis, in which 12 were published over the past 5 years. Among the 21 individual surveys, 17 were hospital-based and the data were obtained through medical record review, and most of which only considered the direct medical economic burden (including the average overall expenditure per patient, per time and per diem). The median expenditure per patient during 1996-2011 ranged from 7 463 to 37 647 yuan (RMB) and the average growth rate was 7.68 % . The median medical expenditure per clinical visit during 1996-2013 ranged from 6 851 to 57 554 yuan (RMB) and the average growth rate was 11.89 % . The median medical expenditure per diem during 1996-2010 ranged from 225 to 1 319 yuan (RMB) and the average growth rate was 12.53 % . The direct medical expenditure per clinical visit varied greatly with area, which were much higher in Beijing, Shanxi and Hubei. In both individual survey and population-based survey, less

Safety against releases in severe accidents. Annual report 1996. Project plan 1997

International Nuclear Information System (INIS)

1997-01-01

The work scope of the RAK-2 project is divided into three sub-projects: RAK-2.1 Severe Accident Phenomenology; RAK-2.2 Computerised Accident Management; RAK-2.3 Reactors In Nordic Surroundings. The work in subproject 1 progresses roughly according to budget and time schedule. Some adjustments in the technical work scope were made during 1996. Main tasks of RAK-2.1 in 1996: Complete recriticality studies for Nordic BWRs; Investigate phenomena related to late phase melt progression; Issue and NKS Final Technical Report on KTH experiments. Main tasks of RAK-2.2 in 1996: CAMS would be further developed with signal validation, tracking simulation, state identification and PSA and risk monitoring applications; Carry out a feasibility study for development of a PWR version of CAMS in collaboration with EdF, France; Use CAMS in the Halden Man-Machine laboratory to perform human factor studies. Main tasks of RAK-2.3 in 1996: Collect and report data from the British reactor types AGR, MAGNOX and PWR; Make a report on accidents in nuclear ships; Put the collected data together in a common data base covering neighbour reactors treated in SIK-3 and RAK-2.3; Update the data in the former SIK-3 report if needed. The work in project 2 progresses according to plans. The data collection of British reactors with in sub-project 3 has been delayed significantly due to difficulty of obtaining information from some of the British utilities, but the problems are expected to be solved by the end of 1997. (EG)

Birth interval and stunting in children under five years of age in Peru (1996-2014).

Science.gov (United States)

Sobrino, M; Gutiérrez, C; Alarcón, J; Dávila, M; Cunha, A J

2017-01-01

Examine the evolution of stunting in birth interval (BI), and associated factors from 1996 to 2014. Data were extracted from the National Demographic and Health Survey of Peru (DHS) for the years 1996, 2000, 2005, 2010 and 2014 on children birth (≤24 months vs. >24 months) and others sociodemographic variables. Crude and adjusted odds ratios with 95% confidence intervals were estimated in logistic regression for the effect of BI and other variables on stunting by each survey year. Between 1996 and 2014, stunting declined in both BI groups: ≤24 months: 35.8% to 21.8%; >24 months: 29.5% to 14.3%. BI was associated with stunting after adjustment for other variables in each survey except 2005. Of the other factors, sex, birth order (fourth child or more), maternal education and poverty were independently associated with stunting in all survey years. Residence in rural areas and in Amazon forest and highland regions was associated with stunting 1996 and 2000. Maternal age was not independently associated with stunting. While stunting showed a decreasing trend from 1996 to 2014, birth interval exceeding 24 months exerted a protective effect on stunting across the years surveyed. Poverty, low maternal education and high birth order were associated with stunting in all survey years. © 2016 John Wiley & Sons Ltd.

AGS experiments -- 1996, 1997, 1998, 1999. Fifteenth edition

Energy Technology Data Exchange (ETDEWEB)

Lo Presti, P.

1999-03-01

This report is a compilation of two-page summaries for AGS experiments for FY 1996, FY 1997, FY 1998, FY 1999. The bulk of the experiments are for high energy physics and nuclear physics programs. Also included are the run schedules for the AGS for each of those years and a listing of publications of AGS experiments for 1982--1999.

AGS experiments - 1996, 1997, 1998, 1999. Fifteenth edition

International Nuclear Information System (INIS)

Lo Presti, P.

1999-03-01

This report is a compilation of two-page summaries for AGS experiments for FY 1996, FY 1997, FY 1998, FY 1999. The bulk of the experiments are for high energy physics and nuclear physics programs. Also included are the run schedules for the AGS for each of those years and a listing of publications of AGS experiments for 1982--1999

Environmental surveillance and compliance at Los Alamos during 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-09-01

This report presents environmental data that characterize environmental performance and addresses compliance with environmental standards and requirements at Los Alamos National Laboratory (LANL or the Laboratory) during 1996. The Laboratory routinely monitors for radiation and for radioactive nonradioactive materials at Laboratory sites as well as in the surrounding region. LANL uses the monitoring results to determine compliance with appropriate standards and to identify potentially undesirable trends. Data were collected in 1996 to assess external penetrating radiation; quantities of airborne emissions; and concentrations of chemicals and radionuclides in ambient air, surface waters and groundwaters, the municipal water supply, soils and sediments, and foodstuffs. Using comparisons with standards and regulations, this report concludes that environmental effects from Laboratory operations are small and do not pose a demonstrable threat to the public, Laboratory employees, or the environment. Laboratory operations were in compliance with all major environmental regulations.

Environmental surveillance and compliance at Los Alamos during 1996

International Nuclear Information System (INIS)

1997-09-01

This report presents environmental data that characterize environmental performance and addresses compliance with environmental standards and requirements at Los Alamos National Laboratory (LANL or the Laboratory) during 1996. The Laboratory routinely monitors for radiation and for radioactive nonradioactive materials at Laboratory sites as well as in the surrounding region. LANL uses the monitoring results to determine compliance with appropriate standards and to identify potentially undesirable trends. Data were collected in 1996 to assess external penetrating radiation; quantities of airborne emissions; and concentrations of chemicals and radionuclides in ambient air, surface waters and groundwaters, the municipal water supply, soils and sediments, and foodstuffs. Using comparisons with standards and regulations, this report concludes that environmental effects from Laboratory operations are small and do not pose a demonstrable threat to the public, Laboratory employees, or the environment. Laboratory operations were in compliance with all major environmental regulations

TEX-2 - experimental reports 1996

International Nuclear Information System (INIS)

Brokmeier, H.-G.; Witassek, B.

1997-01-01

In 1996 the FRG-1 has been operated during 262 days. Hence, numerous investigations on about 26 different projects were carried out at TEX-2. This report gives a short description of these projects. Beam time was given at about 50% for geological projects and about 50% for materials science projects. The different samples measured at TEX-2 represent a broad spectrum: Magnetite, hematite, gypsum, calcite, halite, galena, YBaCuO-superconductures, niobium, copper, titanium aluminides, intermetallic NiAl, composites (Fe-Cu, Al-Mg, Al-Nb, Cu-Mg, Ag-Ni) and zircaloy. Instrumental improvements were carried out at the loading device, at special sample holders and at the slit system. (orig.) [de

AFRA annual report 1996-97

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-09-01

This report is submitted to the Meeting of the AFRA Representatives pursuant to Article VII.3 (e) of the African Regional Co-operative Agreement (AFRA). It covers the activities undertaken under AFRA during the period September 1996 to June 1997 with particular reference to the implementation of the co-operative projects. The report thus sets forth a schedule of work and modalities for the implementation of projects, shows the resources made available, the distribution of resources to the various components of the projects and the utilization of the resources. This document contains relevant information on AFRA programme and can be considered as a major reference source for AFRA Member States, observers as well as donors.

AFRA annual report 1996-97

International Nuclear Information System (INIS)

1997-09-01

This report is submitted to the Meeting of the AFRA Representatives pursuant to Article VII.3 (e) of the African Regional Co-operative Agreement (AFRA). It covers the activities undertaken under AFRA during the period September 1996 to June 1997 with particular reference to the implementation of the co-operative projects. The report thus sets forth a schedule of work and modalities for the implementation of projects, shows the resources made available, the distribution of resources to the various components of the projects and the utilization of the resources. This document contains relevant information on AFRA programme and can be considered as a major reference source for AFRA Member States, observers as well as donors

Communication of 28 June 1996 received from the Permanent Mission of New Zealand to the International Atomic Energy Agency

International Nuclear Information System (INIS)

1996-01-01

The document reproduces the Statement made on 9 June 1996 by the Prime Minister of New Zealand in respect of the test of a nuclear weapon conducted by China on 8 June 1996. The document was received by the Director General of the IAEA on 3 July 1996 from the Resident Representative of New Zealand

Temperature, salinity and other variables collected from discrete sample and profile observations using CTD, bottle and other instruments from FRANKLIN in the Indian Ocean from 1996-05-07 to 1996-05-31 (NCEI Accession 0143942)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0143942 includes discrete sample and profile data collected from FRANKLIN in the Indian Ocean from 1996-05-07 to 1996-05-31. These data include...

Control of bracken (Pteridium aquilinum and feeding preferences in pastures grazed by wild ungulates in an area of the Northern Apennines (Italy

Directory of Open Access Journals (Sweden)

Giovanni Argenti

2012-10-01

Full Text Available The diminution of pastoral activities in marginal areas, and consequently of livestock grazing, implies a strong encroachment of invasive vegetation. The conservation of the open areas is however particularly important for wildlife management. With this aim, this paper describes the results obtained in a protected area on the Apennine mountains (Italy, encroached by Pteridium aquilinum (L. Kuhn. Two restoration practices were carried out by the Administration of the Regional Park of the Laghi di Suviana e Brasimone (Bologna, Italy, in order to reverse the infestation of bracken and restore pastures within the park. The pasture, only grazed by wild animals, was improved through different treatments (ploughing followed by cuttings vs harrowing, each followed by seeding of a forage mixture. Our results showed better performance of the ploughing both as pastoral value of recovered pasture and as botanical composition. Some differences in the effects of the two restoration techniques were also found on the biodiversity index and on floristic richness. Data about grazing selection of the single botanical species have also been collected. The tesults also showed different behaviour in feeding preferences for wild ungulates in comparison to domestic stocks, giving a better evaluation of the real forage availability for wild herbivores.

Spring outmigration of wild and hatchery chinook salmon and steelhead trout smolts from the Imnaha River, Oregon, February 23--June 24, 1996. Annual report 1996; ANNUAL

International Nuclear Information System (INIS)

Blendon, M.L.; Rocklage, S.J.; Kucera, P.A.

1997-01-01

For the third consecutive year, the Nez Perce Tribe, in conjunction with the Fish Passage Center, participated in the smolt monitoring program in the Imnaha River. A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from February 23 to June 24, 1996. A total of 1,797 wild chinook salmon, 11,896 hatchery chinook salmon, 3,786 wild steelhead trout, and 31,094 hatchery steelhead trout smolts were captured during outmigration studies on the Imnaha River in 1996. Mortality associated with trapping, handling and tagging was low, being 1.4% for wild chinook, 0.18% for hatchery chinook, 0.21% for wild steelhead and 0.28% for hatchery steelhead trout smolts

Wild sheep and deer in Hawai'i: a threat to fragile ecosystems

Science.gov (United States)

Hess, Steven C.

2008-01-01

The unique native flora of the Hawaiian Islands, which evolved in the absence of ungulates (grazing animals), is highly vulnerable to damage by trampling and browsing. Wild ungulates introduced into Hawai'i in the past 150 years, including mouflon, axis deer, and mule deer, have severely harmed the native flora. Control measures used against feral animals do not work as well against these wild animals. Trophy hunting tends to alter sex ratios and increase population growth. U.S. Geological Survey scientists are studying these wild ungulates in order to develop more effective control measures that help protect Hawai'i's endemic flora.

The crude petroleum and natural gas industry : 1996

International Nuclear Information System (INIS)

1997-01-01

Statistics regarding Canada's crude oil and natural gas industry for 1996 were presented. Data presentation was in tabular form, the topics being exploration and development, synthetic crude oil reserves, crude oil production and movements by source, natural gas production, drilling completions, net cash expenditures of the petroleum industry, and total sales of natural gas by province. Some of the noteworthy highlights for 1996 were: (1) 14,600 new wells were drilled, the highest number ever recorded, (2) capital investment was over $13 billion, (3) 148 companies were involved in mergers and acquisitions, (4) value of marketable production of oil, natural gas and natural gas by-products topped $30 billion, (5) Empress pipelines began operations of the first new major oil pipeline from Western Canada in 45 years, (6) the Hibernia offshore crude oil facility was completed, (7) Sable Island offshore energy projects applications were filed, and (8) the development of the Terra Nova, Whitehorse and Hebron fields was announced. 8 tabs

Bioenergy research programme. Yearbook 1996. Production of wood fuels; Bioenergian tutkimusohjelma. Vuosikirja 1996. Puupolttoaineiden tuotantotekniikka

Energy Technology Data Exchange (ETDEWEB)

Nikku, P [ed.

1997-12-01

The aim of the programme is to increase the use of economically profitable and environmentally sound bioenergy by improving the competitiveness of present peat and wood fuels. Research and development projects will also develop new economically competitive biofuels, new equipment and methods for production, handling and utilisation of biofuels. The total funding for 1996 was 27.3 million FIM and the number of projects 63. The number of projects concerning wood fuels production was 36. The main goals of the research are to develop new production methods for wood fuels in order to decrease the production costs to the level of imported fuels (100 km distance). The second goal is to decrease the small scale production costs by 20 % as compared with the 1992 technology level. Also, new harvesting technology and new work methods will be developed for forest owners and small-entrepreneurs in the course of the programme. Results of the projects carried out in 1996 in this programme are presented in this publication. The integrated harvesting methods, which supply both raw material to wood products industry and wood fuel for energy production, have been chosen the main research areas because they seem to be most promising. Most of the projects are focused in the wood fuel production from first thinnings and from final fellings. The projects broadly covered the research area focusing from material flows, productivity studies, basic wood properties to several case studies. The follow up project of Evaluation-drum chipper was completed with good fuel quality and productivity results. Also the large Forest Energy Project of Central Finland was completed. The project was a significant technology transfer and information dissemination project. (orig.)

US Department of Energy report 1996 LANL radionuclide air emissions

Energy Technology Data Exchange (ETDEWEB)

Jacobson, K.W.

1997-08-01

Presented is the Laboratory-wide certified report regarding radioactive effluents released into the air by the Los Alamos National Laboratory (LANL) in 1996. This information is required under the Clean Air Act and is being reported to the U.S. Environmental Protection Agency (EPA). The effective dose equivalent (EDE) to a hypothetical maximum exposed individual (MEI) of the public was calculated, using procedures specified by the EPA and described in this report. That dose was 1.93 mrem for 1996. Emissions of {sup 11}C, {sup 13}N, and {sup 15}O from a 1-mA, 800 MeV proton accelerator contributed over 92% of the EDE to LANL`s MEI. Using CAP88, the EPA`s dose assessment model, more than 86% of the total dose received by the MEI was via the air immersion pathway.

BOREAS/AES Campbell Scientific 15-minute Surface Meteorological Data: 1996

Data.gov (United States)

National Aeronautics and Space Administration — Contains data from 1996 from the Atmospheric Environment Service Campbell Scientific autostations collecting continuous fifteen minute data for BOREAS.

Communication of 7 June 1996 received from the Permanent Mission of Ukraine to the International Atomic Energy Agency

International Nuclear Information System (INIS)

1996-01-01

The document reproduces the Statement of the President of Ukraine made on 1 June 1996, received by the Director General of the IAEA on 11 June 1996 from the Resident Representative of Ukraine. The Statement refers to the completion on 1 June 1996 of removal of strategic nuclear weapons from the territory of Ukraine to the Russian Federation, with a view to subsequent destruction in the presence of observers from Ukraine

LNG imports make strong recovery in 1996; exports increase also

International Nuclear Information System (INIS)

Swain, E.J.

1998-01-01

LNG imports to the US jumped in 1996 as Algerian base-load plants resumed operations following major revamps. Exports from Alaska to Japan grew by nearly 4% over 1995. Total LNG imports to the US in 1996 were 40.27 bcf compared to 17.92 bcf in 1995, an increase of 124.8%. Algeria supplied 35.32 bcf; Abu Dhabi, 4.95 bcf. About 82.3% of the imported LNG was received at Distrigas Corp.'s terminal north of Boston. The remaining LNG was received at the Pan National terminal in Lake Charles, LA. LNG imports during 1995 fell to such a low level not because of depressed US demand but because of limited supply. The paper discusses LNG-receiving terminals, base-load producers, LNG pricing, and exports

Maternal mortality in Henan Province, China: changes between 1996 and 2009.

Directory of Open Access Journals (Sweden)

Fengzhi You

Full Text Available BACKGROUND: Maternal deaths occur mostly in developing countries and the majority of them are preventable. This study analyzes changes in maternal mortality and related causes in Henan Province, China, between 1996 and 2009, in an attempt to provide a reliable basis for introducing effective interventions to reduce the maternal mortality ratio (MMR, part of the fifth Millennium Development Goal. METHODS AND FINDINGS: This population-based maternal mortality survey in Henan Province was carried out from 1996 to 2009. Basic information was obtained from the health care network for women and children and the vital statistics system, from specially trained monitoring personnel in 25 selected monitoring sites and by household survey in each case of maternal death. This data was subsequently reported to the Henan Provincial Maternal and Child Healthcare Hospital. The total MMR in Henan Province declined by 78.4%, from 80.1 per 100 000 live births in 1996 to 17.3 per 100 000 live births in 2009. The decline was more pronounced in rural than in urban areas. The most common causes of maternal death during this period were obstetric hemorrhage (43.8%, pregnancy-induced hypertension (15.8%, amniotic fluid embolism (13.9% and heart disease (8.0%. The MMR was higher in rural areas with lower income, less education and poorer health care. CONCLUSION: There was a remarkable decrease in the MMR in Henan Province between 1996 and 2009 mainly in the rural areas and MMR due to direct obstetric causes such as obstetric hemorrhage. This study indicates that improving the health care network for women, training of obstetric staff at basic-level units, promoting maternal education, and increasing household income are important interventional strategies to reduce the MMR further.

DANSYNC. Annual report 1996

Energy Technology Data Exchange (ETDEWEB)

Als-Nielsen, J

1997-02-01

DANSYNC is an organisation of Danish users of hard X-ray synchrotron facilities, funded by The Danish Natural Science Research Council. It was founded in the beginning of 1996, and this is the first Annual Report from DANSYNC. Users span from basic physics at Risoe National Laboratory, Oersted Laboratory and Denmarks Technical University over materials science from Risoe National Laboratory to chemistry and biology at Aarhus University, Copenhagen University and Denmarks Technical University, as well as industrial research represented by Haldor Topsoee A/S and space research at Danish Space Research Institute. We do not have an X-ray synchrotron facility in Denmark, so all of this work is carried out at facilities abroad. Clearly the facility at DESY in Hamburg (HASYLAB and EMBL) is of the greatest significance for Danish synchrotron research. Home page: http://www.dansync.dk/dansync/. (LN).

DANSYNC. Annual report 1996

International Nuclear Information System (INIS)

Als-Nielsen, J.

1997-02-01

DANSYNC is an organisation of Danish users of hard X-ray synchrotron facilities, funded by The Danish Natural Science Research Council. It was founded in the beginning of 1996, and this is the first Annual Report from DANSYNC. Users span from basic physics at Risoe National Laboratory, Oersted Laboratory and Denmarks Technical University over materials science from Risoe National Laboratory to chemistry and biology at Aarhus University, Copenhagen University and Denmarks Technical University, as well as industrial research represented by Haldor Topsoee A/S and space research at Danish Space Research Institute. We do not have an X-ray synchrotron facility in Denmark, so all of this work is carried out at facilities abroad. Clearly the facility at DESY in Hamburg (HASYLAB and EMBL) is of the greatest significance for Danish synchrotron research. Home page: http://www.dansync.dk/dansync/. (LN)

Peso ao nascer e mortalidade hospitalar entre nascidos vivos, 1975-1996 Birth weight and hospital mortality among the newborns in maternity, 1975-1996

Directory of Open Access Journals (Sweden)

Gladys GB Mariotoni

2000-02-01

Full Text Available OBJETIVO: Conhecer a evolução do peso ao nascer e a mortalidade hospitalar de nascidos vivos em maternidade de Campinas, SP. MÉTODOS: Foram estudados 215.435 nascimentos ocorridos em maternidade do Município de Campinas, SP, de 1975 a 1996. As informações foram coletadas de livros de registro e relatórios de assistência médica. Foram analisados os óbitos ocorridos antes da alta hospitalar, independentemente da idade. Para a análise dos dados, utilizou-se o programa Epi Info 6.01. RESULTADOS: O baixo peso se manteve próximo a 9% desde os anos 70, concentrando82% dos óbitos hospitalares em 1996. O peso insuficiente foi observado em 24% dos nascidos vivos. Em 1975, 13,3% dos nascidos com peso entre 1.000 g e 1.499 g sobreviveram e 73,8% dos nascidos com peso entre 1.500 g e 1.999 g. Em 1996, a sobrevida foi 69,1% e 87,7%, respectivamente. Houve grande diminuição do número de óbitos especialmente na faixa de 1.000 g a 1.499 g (de 867 para 309 por mil nascidos vivos, redução de 64,5% e de 1.500 g a 1.999 g (de 264 para 123 por mil nascidos vivos, redução de 53,4%. A mortalidade hospitalar entre aqueles de peso abaixo de 1.000 g permaneceu entre 78,9% e 100,0%, mesmo nos anos 90. Observou-se queda da mortalidade hospitalar de 17 para 11 por mil nascidos vivos. CONCLUSÕES: Não houve modificação na distribuição do peso ao nascer, a despeito deavanços apresentados por Campinas. Contudo, observou-se queda da mortalidade hospitalar. Outros estudos são necessários para compreender esse perfil.OBJECTIVE: To assess the trend of birth weight and hospital mortality rate of newborns, in a maternity hospital of Campinas, SP. METHODS: A total of 215,435 births of a maternity hospital in Campinas, S. Paulo State, Brazil, was studied between 1976 and 1996. Information was collected from registration files and annual reports of medical care. All the newborns from that period were included. The causes of death that occurred before the

Scottish Power Annual Report and Accounts - 1996-97

International Nuclear Information System (INIS)

1997-01-01

The annual report and accounts of Scottish Power for 1996-97 outlines the operational and financial highlights of the year, and presents the reports of the Chairman and other Directors. Details are given of the financial year, the accounting policy, profits and losses, and company and shareholder information. (UK)

Compilation of the FY 1996 Financial Statements for Other Defense Organizations

National Research Council Canada - National Science Library

1998-01-01

... statements to the Office of Management and Budget. The DoD consolidated financial statements for FY 1996 included financial statements for a new reporting entity entitled "Other Defense Organizations...

Drivers of cycling mode-share: analysis of danes travel behavior 1996-2013

DEFF Research Database (Denmark)

Nielsen, Thomas Alexander Sick; Mulalic, Ismir; Christiansen, Hjalmar

2016-01-01

-level travel survey data series from 1996 through 2013 to analyze the trend in cycling as main or access mode, as well as the significance of background variables representing key spatial and societal trends. The analysis confirms that the general trend in cycling from 1996 to 2013 was negative irrespective...... of statistical control for socio-economics, ageing, location, urban density, and weather. Results points to an increasing significance of population density over time as well as changes to the effect of location vis-a-vis the largest urban centers. The difference in cycling between central areas and more...

The integrated monitoring area Lheebroekerzand the Netherlands. Data of 1996

Energy Technology Data Exchange (ETDEWEB)

Mathijssen-Spiekman, E.A.M.; Wolters-Balk, M.A.H.

1998-12-31

The objectives of this paper are to compile and present the 1996 monitoring data which are forwarded to the international database in Helsinki, Finland, in November 1997, and to inform participating organizations and volunteers on the scope and progress of the monitoring programme on a national and international level. Additional non-obligatory data are also reported. In 1996, the biological part of the integrated monitoring programme consisted of a regular inventory of birds, leafminers and butterflies in the monitoring area, as well as inventories of the aquatic macrofauna present in the moorland pool Kliplo and observations on the performance of pine trees. The chemical-physical part included meteorological variables like temperature, humidity, the amount of precipitation and irradiation, together with chemical analysis of air, precipitation, leaves, needles, mosses and pool water. Where possible, the series of data are described, interpreted and compared

Fiscal 1996 achievement report. Development of liquid fuel conversion technology (Feasibility study project on liquid fuel conversion); 1996 nendo ekitai nenryo tenkan gijutsu kaihatsu seika hokokusho. Ekitai nenryo tenkan kanosei chosa nado jigyo

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-03-01

This article comprises Part 1 on 'surveys of gas fields fit for a new methanol manufacturing process' and Part 2 'reports on overseas surveys of gas fields fit for a new methanol manufacturing process.' In Part 1, surveys are conducted on the existence, exploitation, and the actual utilization of natural gas resources, and on the status of natural gas industry related infrastructures in the Middle East. Proved natural gas reserves in Iran were 742tcf (trillion cubic feet) as of 1996-end, which was the largest in the world next to Russia. As for Kuwaiti natural gas resources, they all accompany oil production, with the proved reserves marking 52.4tcf as of 1996-end or the smallest in the Middle East. In Egypt, there were proved reserves of 20.4tcf as of 1996-end, and further existence of 30-40tcf is predicted. Proved reserves in Yemen are approximately 15tcf. Proved reserves in Oman were 30tcf as of 1996-end. It is expected that there will be a 1.4% increase in the demand for methanol for automobiles. The annual demand for methanol for power generation is 720,000 tons. In Part 2, on-site surveys of infrastructures and the like indispensable for methanol plant installation are reported. (NEDO)

Fitting program for linear regressions according to Mahon (1996)

Energy Technology Data Exchange (ETDEWEB)