WorldWideScience

Sample records for botanical insecticide neem

  1. A renaissance for botanical insecticides?

    Science.gov (United States)

    Isman, Murray B

    2015-12-01

    Botanical insecticides continue to be a subject of keen interest among the international research community, reflected in the steady growth in scientific publications devoted to the subject. Until very recently though, the translation of that theory to practice, i.e. the commercialisation and adoption of new botanical insecticides in the marketplace, has seriously lagged behind. Strict regulatory regimes, long the bane of small pesticide producers, are beginning to relax some of the data requirements for 'low-risk' pesticide products, facilitating movement of more botanicals into the commercial arena. In this paper I discuss some of the jurisdictions where botanicals are increasingly finding favour, some of the newer botanical insecticides in the plant and animal health arsenal and some of the specific sectors where botanicals are most likely to compete effectively with other types of insecticidal product. © 2015 Society of Chemical Industry.

  2. Potential applications of Neem based products as biopesticides

    OpenAIRE

    Bajwa AA; Ahmad A

    2012-01-01

    Biopesticides are a good alternative to the synthetic pesticide. Both leaves and fruit of neem plant are known to have bitter taste having fungicidal, insecticidal and nematicidal properties. Azadirachtin, chemically a tetranorterpenoid component of neem acts on the mitotic cells and blocks the microtubule polymerization. Certain activities of genes and proteins are also altered by azadirachtin. As a botanical insecticide azadirachtin is effective against many biological processes. It may cau...

  3. Larvicidal activities of chinaberry, neem and Bacillus thuringiensis israelensis (Bti to an insecticide resistant population of Anopheles arabiensis from Tolay, Southwest Ethiopia

    Directory of Open Access Journals (Sweden)

    Assalif Demissew

    2016-07-01

    Conclusions: Neem, chinaberry and Bti showed potent larvicidal and pupicidal activities. However, in the area, high level of mosquito resistance to pyrethroids and dichloro-diphenyl-tricgloroethane was seen which will pose serious challenge to vector control in the future. Therefore, using integrated approach including these botanical larvicides is warranted to manage insecticide resistance.

  4. Eupatorium Capillifolium Essential Oil: Chemical Composition, Antifungal Activity, and Insecticidal Activity

    Science.gov (United States)

    2010-01-01

    deionized water. One percent oil concentration was used based on commercial botanical insecticides such as Neem (Azadiractin), Ecotrol (Rosmarinus...analyses for E. capillifolium oil and two commercial insecticides (Malathion, Neem ) topically applied to adult azalea lace bugs, S. pyrioides...0.93 (0.06) . . . 262.58 < 0.0001 exposure time . 695 0.44 (0.04) . . . 135.87 < 0.0001 a Malathion and Neem used as positive baseline controls for

  5. Botanical Insecticides in Plant Protection

    OpenAIRE

    Grdiša, Martina; Gršić, Kristina

    2013-01-01

    Botanical insecticides are natural compounds with insecticidal properties and their use in crop protection is as old as agricultural practice. Although they have been in use for over one hundred years, the advent of synthetic insecticides has unfortunately displaced their use today. Due to fast action, low cost, easy application and efficiency against a wide range of harmful species, synthetic insecticides have become an important part of pest management in modern agricultural systems....

  6. Botanical insecticides inspired by plant-herbivore chemical interactions.

    Science.gov (United States)

    Miresmailli, Saber; Isman, Murray B

    2014-01-01

    Plants have evolved a plethora of secondary chemicals to protect themselves against herbivores and pathogens, some of which have been used historically for pest management. The extraction methods used by industry render many phytochemicals ineffective as insecticides despite their bioactivity in the natural context. In this review, we examine how plants use their secondary chemicals in nature and compare this with how they are used as insecticides to understand why the efficacy of botanical insecticides can be so variable. If the commercial production of botanical insecticides is to become a viable pest management option, factors such as production cost, resource availability, and extraction and formulation techniques need be considered alongside innovative application technologies to ensure consistent efficacy of botanical insecticides. Copyright © 2013 Elsevier Ltd. All rights reserved.

  7. Exploration of Novel Botanical Insecticide Leads: Synthesis and Insecticidal Activity of β-Dihydroagarofuran Derivatives.

    Science.gov (United States)

    Zhao, Ximei; Xi, Xin; Hu, Zhan; Wu, Wenjun; Zhang, Jiwen

    2016-02-24

    The discovery of novel leads and new mechanisms of action is of vital significance to the development of pesticides. To explore lead compounds for botanical insecticides, 77 β-dihydroagarofuran derivatives were designed and synthesized. Their structures were mainly confirmed by (1)H NMR, (13)C NMR, DEPT-135°, IR, MS, and HRMS. Their insecticidal activity was evaluated against the third-instar larvae of Mythimna separata Walker, and the results indicated that, of these derivatives, eight exhibited more promising insecticidal activity than the positive control, celangulin-V. Particularly, compounds 5.7, 6.6, and 6.7 showed LD50 values of 37.9, 85.1, and 21.1 μg/g, respectively, which were much lower than that of celangulin-V (327.6 μg/g). These results illustrated that β-dihydroagarofuran ketal derivatives can be promising lead compounds for developing novel mechanism-based and highly effective botanical insecticides. Moreover, some newly discovered structure-activity relationships are discussed, which may provide some important guidance for insecticide development.

  8. Possibilities of Botanical Insecticides in Plant Protection

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Sajfrtová, Marie; Sovová, Helena; Bárnet, M.

    2008-01-01

    Roč. 2, č. 1 (2008), s. 16-23 ISSN 1313-2563 Grant - others:MŠk(CZ) 2B08049 Institutional support: RVO:67985858 Keywords : botanical insecticides * plant extracts * supercritical fluid extraction Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  9. Application of nanotechnology for the encapsulation of botanical insecticides for sustainable agriculture: prospects and promises.

    Science.gov (United States)

    de Oliveira, Jhones Luiz; Campos, Estefânia Vangelie Ramos; Bakshi, Mansi; Abhilash, P C; Fraceto, Leonardo Fernandes

    2014-12-01

    This review article discusses the use of nanotechnology in combination with botanical insecticides in order to develop systems for pest control in agriculture. The main types of botanical insecticides are described, together with different carrier systems and their potential uses. The botanical insecticides include those based on active principles isolated from plant extracts, as well as essential oils derived from certain plants. The advantages offered by the systems are highlighted, together with the main technological challenges that must be resolved prior to future implementation of the systems for agricultural pest control. The use of botanical insecticides associated with nanotechnology offers considerable potential for increasing agricultural productivity, while at the same time reducing impacts on the environment and human health.

  10. Application of full 42 Factorial Design for the Development and Characterization of Insecticidal Soap from Neem Oil

    Directory of Open Access Journals (Sweden)

    A. S. KOVO

    2006-01-01

    Full Text Available The aim of this paper was to investigate the extraction, characterization and production of insecticidal soap from Neem oil using full 42 factorial design. Soxhlet extractor was used for the extraction purpose and two solvent was chosen to determine which is better. N-hexane gives a Neem oil yield of 45.43% while ethanol gives a yield of 46.38%, confirming the earlier literature result giving ethanol as better solvent for Neem oil extraction. The basic properties of the oil were determined as follows, saponification value 215.95ml/g, acid value 1.122g/mol, unsaponifiable matter 19.66 etc. The Neem oil was found to have a colour of golden yellow due to the presence of Nimbidin.Full 42 factorial design and mathematical model was applied to the extraction process and a first order regression equation of the form:Y = 9.548 + 0.144X1 + 0.1931X2 + 0.1892 X12was obtained growing the individual effect of time and solvent type as parameter and their interaction in the entire extraction process the Neem insecticidal soap was found to be effective in insect and pest control.

  11. Insecticidal activity of neem oil against Gyropsylla spegazziniana (Hemiptera: Psyllidae nymphs on Paraguay tea seedlings

    Directory of Open Access Journals (Sweden)

    M. A. Formentini

    Full Text Available Abstract Gyropsylla spegazziniana (Paraguay tea ampul is one of the most important pests of Paraguay tea plants, and prohibition of synthetic insecticide use for control of this pest has led to the search for alternative methods. This laboratory study aimed to compare different control strategies for G. spegazziniana, utilizing a commercial neem seed oil product. Paraguay tea seedlings were treated with neem oil solution both pre- and post-infestation with 5th instar nymphs. The systemic action of neem oil was also evaluated by treating plant soil with the neem oil solution, followed by transfer of the insects to plants 24 h post-treatment. Spray treatments were effective against the pest, especially post-infestation (80% mortality, demonstrating the potential of neem oil for control of the Paraguay tea ampul. No significant effects were observed with respect to systemic activity.

  12. Residual insecticides, inert dusts and botanicals for the protection of durable stored products against pest infestation in developing countries

    Directory of Open Access Journals (Sweden)

    Obeng-Ofori, D.

    2010-09-01

    Full Text Available Insect pests associated with durable grains and processed food cause considerable quantitative and qualitative losses throughout the world. Insect infestation can occur just prior to harvest, during storage in traditional storage structures, cribs, metal or concrete bins, and in warehouses, food handling facilities, retail grocery stores as well as in-transit. Many tools are available for managing insects associated with grains and processed food. Although pest management strategies are changing to meet consumer’s demand for food free of insecticide residues, address concerns about safety of insecticides to humans, delay insecticide resistance development in insects and comply with stricter insecticide regulations, the use of synthetic residual insecticides will continue to be a major component of stored-product pest management programmes. Selective use of residual insecticides requires a through understanding and evaluation of risks, costs and benefits. The use of plant and inert materials may be a safe, cost-effective and environmentally friendly method of grain preservation against pest infestation among low-resource poor farmers who store small amounts of grains. There is a dearth of information on the use of plant materials by rural farmers in Africa for stored-product protection. The most promising candidate plant materials for future utilization as grain protectants are Azadirachta, Acorus, Chenopodium, Eucalyptus, Mentha, Ocimum, Piper and Tetradenia together with vegetable oils from various sources. Neem is the only plant from which several commercial products have been developed worldwide. However, unlike synthetic insecticides these alternatives often do not provide effective or rapid suppression of pest populations and may not be effective against all species of pests. These alternatives are also more expensive than synthetic insecticides, and have not been tested extensively under field conditions in the tropics. This paper

  13. Possibilities of Botanical Insecticides in Plant Protection

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Sajfrtová, Marie; Sovová, Helena; Bárnet, M.

    2008-01-01

    Roč. 2, č. 1 (2008), s. 16-23 ISSN 1313-2563 Grant - others:GA MŠMT(CZ) 2B08049 Institutional research plan: CEZ:AV0Z40720504 Keywords : botanical insecticides * plant exctracts * supercritical fluid extraction Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  14. The use of HPLC in the control of Neem commercial products quality: reproduction of the insecticide action

    International Nuclear Information System (INIS)

    Forim, Moacir Rossi; Matos, Andreia Pereira; Silva, Maria Fatima das Gracas Fernandes da; Cass, Quezia Bezerra; Vieira, Paulo Cezar; Fernandes, Joao Batista

    2010-01-01

    The Neem tree, Azadirachta indica, provides many useful compounds that are used as pesticides. However, the efficiency in field of products like neem oil can be committed because they have not been observed reproductive content of secondary metabolic like azadirachtin. Based on reverse-phase high-performance liquid chromatography (HPLC) a new method was developed to permit the rapid quantitative analysis of azadirachtin from seeds, extracts and oil of Neem. In the present study it was evaluated the azadirachtin quantitative variation among various Neem's extracts and seeds showing the importance of quality control for reproduction of the insecticide efficiency, using S. frugiperda as target insect. (author)

  15. The Effectiveness of Lemongrass, Garlic, and Tree Marigold as Botanical Insecticides in Controlling of Cocoa Mirid,Helopeltis antonii

    Directory of Open Access Journals (Sweden)

    Endang Sulistyowati

    2014-05-01

    Full Text Available Control of cocoa mirid, Helopeltis antoniiso far uses chemicalinsecticides as the main alternative. Therefore, it is necessary to find out the environment friendly control techniques. Lemongrass, garlic, and tree marigold have been known as an efectiveness botanical insecticides for horticulture. A research with aim to study the effectiveness of lemongrass (Cymbopogon nardus, garlic (Allium sativum and tree marigold (Tithonia diversifoliafor controlling H. antoniihave been carried out in cocoa plantation at Kaliwining experimental garden of Indonesian Coffee and Cocoa Research Institute. The research was arranged in split plot design in three replication, with the main plot infestation time of H. antoniiand sub-plot kind of botanical insecticides. Concentration of botanical insecticides used in this study was 5% and applied on 12 cm cocoa pod in length by using knapsack sprayer. Infestation of H. antonii nymphes were conducted before and after insecticide applications. Observation was conducted on the mortality and the lesion of H. antonii. The results of orthogonal contrast test on feeding activity based on the number of lesion and percentage of mortality of H. antoniishowed that there were significantly different between insecticide treatment and control, between chemical insecticide and botanical insecticides, but there was no significant different on kind of botanical insecticides. The lowest number of lesion due to H. antonii was shown by chemical insecticide with an average 34.0, followed by garlic and lemongrass botanical insecticide with number of lesion were 51.2 and 64.7 respectively, whereas the number of lesion in the control reached 84.2. The highest percentage mortality of H. antoniiwas shown by chemical insecticide with active ingredient teta-cypermethrin at 84.3%, followed by garlic, lemon grass and tree marigold botanical insecticide were 65.8%; 65.0%; and 63.8% respectively and significantly different with control by 8

  16. COMPARATIVE EFFICACY OF SYNTHETIC AND BOTANICAL INSECTICIDES AGAINST SUCKING INSECT PEST AND THEIR NATURAL ENEMIES ON COTTON CROP

    Directory of Open Access Journals (Sweden)

    M. A. Baker

    2016-08-01

    Full Text Available The Synthetic and botanical insecticides are relatively safer for environment and beneficial insects. The study was conducted in Rahim Yar Khan during the cotton cropping season 2014 to evaluate the comparative efficacy of two Synthetic insecticides i.e. Nitenpyram (Jasper 10% SL and Pyriproxyfen (Bruce 10.8% EC and two botanical extracts of Calotropic procera and Azadirachta indica, against sucking insect pest complex of cotton and their natural enemies. Upon reaching economic thresholds, the recommended field doses of all the insecticides were applied on cotton cultivar MNH-886. Data against sucking pests and their natural enemies was recorded 24 hours prior to insecticidal application and then 24, 48, 72 and 96 hours after insecticidal application. Results revealed that Nitenpyram was much toxic against sucking pests followed by Pyriproxyfen as compared to two botanical extracts. On the other hand, the synthetic insecticides did not prove safer for natural enemies as compared to botanical extracts. It was concluded that as an Integrated Pest Management (IPM strategy, botanical extracts can be used at low infestation levels so that ecosystem service of biological control may be sustained.

  17. Management of Mango Hopper, Idioscopus clypealis, Using Chemical Insecticides and Neem Oil

    OpenAIRE

    Adnan, S. M.; Uddin, M. M.; Alam, M. J.; Islam, M. S.; Kashem, M. A.; Rafii, M. Y.; Latif, M. A.

    2014-01-01

    An experiment was conducted in Field Laboratory, Department of Entomology at Bangladesh Agricultural University, Mymensingh, during 2013 to manage the mango hopper, Idioscopus clypealis L, using three chemical insecticides, Imidacloprid (0.3%), Endosulfan (0.5%), and Cypermethrin (0.4%), and natural Neem oil (3%) with three replications of each. All the treatments were significantly effective in managing mango hopper in comparison to the control. Imidacloprid showed the highest efficacy in pe...

  18. MULTI-INSECTICIDE EXTRACTIVE TECHNOLOGY OF NEEM SEEDS FOR SMALL GROWERS

    Directory of Open Access Journals (Sweden)

    Gabriela Esparza-Díaz

    2011-11-01

    Full Text Available The neem tree (Azadirachta indica A. Juss. is known for its insecticidal properties. In this study an extraction method for neem seeds based on cold extrusion with methanol was applied. On the resulting extract (azadirex, limonoids azadirachtin A and B (AZA and AZB, salannin, and nimbin were quantified by HPLC. A 10 years old neem orchard was used (19° 11.65’ N, 96° 20.07’ W. The extrusion of 1.0 kg of dry endocarp, ground seeds previously immersed in 150 mL of methanol during 20 min, was performed in a manual hydraulic press, at 20 kg cm-2 and room temperature. Concentration of limonoids underwent an analysis of variance and means separation (Tukey, P < 0.05. The seed with endocarp showed a salannin concentration of 4500 mg kg-1, 3450 mg kg-1 of nimbin and 2784 mg kg-1 of the azadirachtins A and B mixture. Azadirex had a typical composition of AZA, AZB, nimbin and salannin, however the latter (3866 mg kg-1 was found in a significantly higher proportion compared to the others (Tukey, P < 0.05. No significant differences were found between the mixture of AZA + AZB (1818 mg kg-1 and nimbin (1280 mg kg-1.

  19. Management of Mango Hopper, Idioscopus clypealis, Using Chemical Insecticides and Neem Oil

    Directory of Open Access Journals (Sweden)

    S. M. Adnan

    2014-01-01

    Full Text Available An experiment was conducted in Field Laboratory, Department of Entomology at Bangladesh Agricultural University, Mymensingh, during 2013 to manage the mango hopper, Idioscopus clypealis L, using three chemical insecticides, Imidacloprid (0.3%, Endosulfan (0.5%, and Cypermethrin (0.4%, and natural Neem oil (3% with three replications of each. All the treatments were significantly effective in managing mango hopper in comparison to the control. Imidacloprid showed the highest efficacy in percentage of reduction of hopper population (92.50 ± 9.02 at 72 hours after treatment in case of 2nd spray. It also showed the highest overall percentage of reduction (88.59 ± 8.64 of hopper population and less toxicity to natural enemies including green ant, spider, and lacewing of mango hopper. In case of biopesticide, azadirachtin based Neem oil was found effective against mango hopper as 48.35, 60.15, and 56.54% reduction after 24, 72, and 168 hours of spraying, respectively, which was comparable with Cypermethrin as there was no statistically significant difference after 168 hours of spray. Natural enemies were also higher after 1st and 2nd spray in case of Neem oil.

  20. Management of mango hopper, Idioscopus clypealis, using chemical insecticides and Neem oil.

    Science.gov (United States)

    Adnan, S M; Uddin, M M; Alam, M J; Islam, M S; Kashem, M A; Rafii, M Y; Latif, M A

    2014-01-01

    An experiment was conducted in Field Laboratory, Department of Entomology at Bangladesh Agricultural University, Mymensingh, during 2013 to manage the mango hopper, Idioscopus clypealis L, using three chemical insecticides, Imidacloprid (0.3%), Endosulfan (0.5%), and Cypermethrin (0.4%), and natural Neem oil (3%) with three replications of each. All the treatments were significantly effective in managing mango hopper in comparison to the control. Imidacloprid showed the highest efficacy in percentage of reduction of hopper population (92.50 ± 9.02) at 72 hours after treatment in case of 2nd spray. It also showed the highest overall percentage of reduction (88.59 ± 8.64) of hopper population and less toxicity to natural enemies including green ant, spider, and lacewing of mango hopper. In case of biopesticide, azadirachtin based Neem oil was found effective against mango hopper as 48.35, 60.15, and 56.54% reduction after 24, 72, and 168 hours of spraying, respectively, which was comparable with Cypermethrin as there was no statistically significant difference after 168 hours of spray. Natural enemies were also higher after 1st and 2nd spray in case of Neem oil.

  1. Management of Mango Hopper, Idioscopus clypealis, Using Chemical Insecticides and Neem Oil

    Science.gov (United States)

    Adnan, S. M.; Uddin, M. M.; Alam, M. J.; Islam, M. S.; Kashem, M. A.; Rafii, M. Y.; Latif, M. A.

    2014-01-01

    An experiment was conducted in Field Laboratory, Department of Entomology at Bangladesh Agricultural University, Mymensingh, during 2013 to manage the mango hopper, Idioscopus clypealis L, using three chemical insecticides, Imidacloprid (0.3%), Endosulfan (0.5%), and Cypermethrin (0.4%), and natural Neem oil (3%) with three replications of each. All the treatments were significantly effective in managing mango hopper in comparison to the control. Imidacloprid showed the highest efficacy in percentage of reduction of hopper population (92.50 ± 9.02) at 72 hours after treatment in case of 2nd spray. It also showed the highest overall percentage of reduction (88.59 ± 8.64) of hopper population and less toxicity to natural enemies including green ant, spider, and lacewing of mango hopper. In case of biopesticide, azadirachtin based Neem oil was found effective against mango hopper as 48.35, 60.15, and 56.54% reduction after 24, 72, and 168 hours of spraying, respectively, which was comparable with Cypermethrin as there was no statistically significant difference after 168 hours of spray. Natural enemies were also higher after 1st and 2nd spray in case of Neem oil. PMID:25140344

  2. Botanical insecticides in controlling Kelly's citrus thrips (Thysanoptera: Thripidae) on organic grapefruits.

    Science.gov (United States)

    Vassiliou, V A

    2011-12-01

    Kelly's citrus thrips, Pezothrips kellyanus (Bagnall) (Thysanoptera: Thripidae) was first recorded in Cyprus in 1996 and became an economic citrus pest. In Cyprus, Kelly's citrus thrips larvae cause feeding damage mainly on immature lemon and grapefruit fruits. Use of botanical insecticides is considered an alternative tool compared with synthetic chemicals, in offering solutions for healthy and sustainable citrus production. During 2008-2010, the efficacy of the botanical insecticides azadirachtin (Neemex 0.3%W/W and Oikos 10 EC), garlic extract (Alsa), and pyrethrins (Vioryl 5%SC) was evaluated in field trials against Kelly's citrus thrips larval stage I and II aiming at controlling the pest's population and damage to organic grapefruit fruits. In each of the trial years treatments with pyrethrins and azadirachtin (Neemex 0.3%W/W) were the most effective against Kelly's citrus thrips compared with the untreated control (for 2008: P extract showed the lowest effect from all the botanicals used compared with the untreated control.

  3. Developing a neem-based pest management product: laboratory evaluations of neem extracts on insect pests resistance to synthetic pesticides

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.; Permana, A.D.; Rahadian, R.; Wibowo, S.A

    1998-12-16

    Laboratory studies has been conducted as a part of a project aimed at the development of a neem-based insecticide for pest management purposes. Permethrin, a pyrethroid insecticide, and neem (Azadirachta indica) products were tested against larvae of Diamondback Moth Plutella xylostella, and Helicoverpa armigera collected from several locations in West Java, Indonesia. The results of bioassay showed that the average LC{sub 50} values of permethrin for Plutella xylostella had been 60-100 fold higher as compared with the normal dosage recommended. Similarly, the LC{sub 50} values obtained for Helicoverpa armigera had been 46-73 fold as compared with the recommended dosage. These facts suggest that both insects have developed resistance to permethrin. The results of bioassay with neem-products tested against Plutella xylostella and Helicoverpa armigera larvae showed that statistically LC{sub 50} values of neem-products for each strain of either Plutella xylostella or Helicoverpa armigera were not significantly different one to another. We also found that neem-treated insects, even though they were not killed directly by the insecticide, were not able to molt to the next instar or pupae, so that very low percentage of adults emerged. The susceptibility of neem-products could not be easily determined by only measuring the LC{sub 50} values from the larval stage, but the disruption of the growth and development of the insect should be considered as well. Our findings suggest that neem-products could be used effectively to control insects which have developed resistance to conventional insecticide. (author)

  4. The potentiality of botanicals and their products as an alternative to chemical insecticides to sandflies (Diptera: Psychodidae): a review.

    Science.gov (United States)

    Dinesh, Diwakar Singh; Kumari, Seema; Kumar, Vijay; Das, Pradeep

    2014-03-01

    Use of chemical pesticides is the current method for controlling sandflies. However, resistance is being developed in sandflies against the insecticide of choice that is DDT (dichlorodiphenyl trichloroethane). Botanicals have potential to act as an alternative to chemical insecticides as the crude extracts and active molecules of some plants show insecticidal effect to sandflies. This will lead to safe, easy and environment friendly method for control of sandflies. Therefore, information regarding botanicals acting as alternative to chemical insecticide against sandflies assumes importance in the context of development of resistance to insecticides as well as to prevent environment from contamination. This review deals with some plants and their products having repellent and insecticidal effect to sandflies in India and abroad. Different methods of extraction and their bioassay on sandflies have been emphasized in the text. Various extracts of some plants like Ricinus communis (Euphorbiaceae), Solanum jasminoides (Solanaceae), Bougainvillea glabra (Nyctaginaceae), Capparis spinosa (Capparidaceae), Acalypha fruticosa (Euphorbiaceae) and Tagetes minuta (Asteraceae) had shown repellent/insecticidal effect on sandflies. This review will be useful in conducting the research work to find out botanicals of Indian context having insecticidal effect on sandflies.

  5. Effects of Botanical Insecticides on Hymenopteran Parasitoids: a Meta-analysis Approach.

    Science.gov (United States)

    Monsreal-Ceballos, R J; Ruiz-Sánchez, E; Ballina-Gómez, H S; Reyes-Ramírez, A; González-Moreno, A

    2018-02-10

    Botanical insecticides (BIs) are considered a valuable alternative for plant protection in sustainable agriculture. The use of both BIs and parasitoids are presumed to be mutually compatible pest management practices. However, there is controversy on this subject, as various studies have reported lethal and sublethal effects of BIs on hymenopteran parasitoids. To shed new light on this controversy, a meta-analytic approach of the effects of BIs on adult mortality, parasitism, and parasitoid emergence under laboratory conditions was performed. We show that BIs increased mortality, decreased parasitism, and decreased parasitoid emergence. Botanical insecticides derived from Nicotiana tabacum and Caceolaria andina were particulary lethal. Most of the parasitoid groups showed susceptibility to BIs, but the families Scelionidae and Ichneumonidae were not significantly affected. The negative effects of BIs were seen regardless of the type of exposure (topical, ingestion, or residual). In conclusion, this meta-analysis showed that under laboratory conditions, exposure of hymenopteran parasitoids to BIs had significant negative effects on adult mortality, parasitism, and parasitoid emergence.

  6. Sustainable Agriculture: enhancement of the 'neem cake'

    International Nuclear Information System (INIS)

    Susanna, Mariani

    2015-01-01

    The 'neem cake' scrap processing of the industrial chain producing neem oil and azadirachtin. The ENEA laboratories have developed a promising trial to promote the use of neem cake as a low-cost insecticide and fertilizer in sustainable agriculture. [it

  7. EVALUATION OF NEEM (AZADIRACHTA IND/CA) DERIVATIVES ...

    African Journals Online (AJOL)

    The list continues to expand, as neem derivatives are tested ..... various stages stem borers and best integration of various management options are necessary. ... This may be an additional line of future neem study in the field of insecticides.

  8. COMPARATIVE EFFICACY OF SYNTHETIC AND BOTANICAL INSECTICIDES AGAINST SUCKING INSECT PEST AND THEIR NATURAL ENEMIES ON COTTON CROP

    OpenAIRE

    M. A. Baker; A. H. Makhdum; M. Nasir; A. Imran; A. Ahmad; F. Tufail

    2016-01-01

    The Synthetic and botanical insecticides are relatively safer for environment and beneficial insects. The study was conducted in Rahim Yar Khan during the cotton cropping season 2014 to evaluate the comparative efficacy of two Synthetic insecticides i.e. Nitenpyram (Jasper 10% SL) and Pyriproxyfen (Bruce 10.8% EC) and two botanical extracts of Calotropic procera and Azadirachta indica, against sucking insect pest complex of cotton and their natural enemies. Upon reaching economic thresholds, ...

  9. Sustainable Agriculture: enhancing the 'neem cake'

    International Nuclear Information System (INIS)

    Mariani, Susanna

    2015-01-01

    The 'neem cake' is the scrap processing of the industrial chain producing neem oil and azadirachtin. The ENEA Technical Unit Environment and Sustainable Development Innovation the Agro-Industrial System, developed a promising experiment to promote the use of 'neem cake' as an insecticide, and fertilizer of low cost in sustainable agriculture. [it

  10. Behavioural responses of diamondback moth Plutella xylostella (Lepidoptera: Plutellidae) to extracts derived from Melia azedarach and Azadirachta indica

    NARCIS (Netherlands)

    Charleston, D.S.; Kfir, R.; Vet, L.E.M.; Dicke, M.

    2005-01-01

    The impact of three different doses of botanical insecticide derived from the syringa tree, Melia azedarach and the neem tree, Azadirachta indica was tested on the behaviour of the diamondback moth, Plutella xylostella (Linnaeus). Both botanical insecticides had a significant impact on larval

  11. Sublethal effects of some synthetic and botanical insecticides on Bemisia tabaci (Hemiptera: Aleyrodidae

    Directory of Open Access Journals (Sweden)

    Esmaeily Saeideh

    2014-07-01

    Full Text Available In addition to direct mortality caused by insecticides, some biological traits of insects may also be affected by sublethal insecticide doses. In this study, we used the age-stage, two-sex life table method to evaluate the sublethal effects of the four synthetic insecticides: abamectin, imidacloprid, diazinon, and pymetrozin as well as the botanical insecticide taken from Calotropis procera (Asclepiadaceae extract, on eggs of the cotton whitefly, Bemisia tabaci (Hem.: Aleyrodidae. The lowest and highest survival rates and oviposition periods were observed in whiteflies treated by diazinon and imidacloprid, respectively. We found significant differences in the net reproductive rate (R0, the intrinsic rate of increase (r, the finite rate of increase (?, and the gross reproductive rate (GRR among different insecticides. Altogether, our results showed that pymetrozin and C. procera induced the most sublethal effects, thus they may be suitable candidates for use in integrated pest management programs of B. tabaci.

  12. Toxicity of Commercial Neem Extract to Earthworms (Pheretima peguana

    Directory of Open Access Journals (Sweden)

    Ptumporn Muangphra

    2011-01-01

    Full Text Available The LC50 of commercial neem extract (Sadao Thai III containing azadirachtin; NEEM on filter paper in the earthworm Pheretima peguana at 48 h and 72 h was 3.79 and 3.33 g cm−2, respectively. In earthworms exposed to five NEEM concentrations from 0.39 (~10% of 48-h LC50 to 3.13 (~80% of 48-h LC50 g cm−2, the radial thickness of the epidermis and body wall significantly (<.05 decreased, and thickness of intestinal epithelium increased but only at high doses, approximately 25-fold above the concentration permitted for use as an insecticide in field applications (0.09 g cm−2. NEEM significantly (<.05 increased the number of binucleated coelomocytes in the micronucleus test (detects chromosomal aberrations at 3.13 g cm−2, approximately 35-fold higher than the recommended dose, but it did not cause coelomocyte DNA single-strand breaks in the comet assay. Thus, NEEM is cytotoxic (increase in binucleates through the inhibition of cytokinesis but not genotoxic to earthworm coelomocytes. This study demonstrates that the recommended dosage of commercial neem extract as an insecticide in agricultural practices is safe for earthworms.

  13. Target and non-target toxicity of botanical insecticide derived from Couroupita guianensis L. flower against generalist herbivore, Spodoptera litura Fab. and an earthworm, Eisenia foetida Savigny

    Science.gov (United States)

    Novel chemistries in botanical insecticides may provide alternatives to, or development of synthetic insecticides suitable for controlling the Lepidopteran pests, like Spodoptera litura (F.). Many botanical chemistries are biodegradable, and have lower mammalian toxicity. Eight natural chemical comp...

  14. Larvicidal activity of neem oil (Azadirachta indica formulation against mosquitoes

    Directory of Open Access Journals (Sweden)

    Dua Virendra K

    2009-06-01

    Full Text Available Abstract Background Mosquitoes transmit serious human diseases, causing millions of deaths every year. Use of synthetic insecticides to control vector mosquitoes has caused physiological resistance and adverse environmental effects in addition to high operational cost. Insecticides of botanical origin have been reported as useful for control of mosquitoes. Azadirachta indica (Meliaceae and its derived products have shown a variety of insecticidal properties. The present paper discusses the larvicidal activity of neem-based biopesticide for the control of mosquitoes. Methods Larvicidal efficacy of an emulsified concentrate of neem oil formulation (neem oil with polyoxyethylene ether, sorbitan dioleate and epichlorohydrin developed by BMR & Company, Pune, India, was evaluated against late 3rd and early 4th instar larvae of different genera of mosquitoes. The larvae were exposed to different concentrations (0.5–5.0 ppm of the formulation along with untreated control. Larvicidal activity of the formulation was also evaluated in field against Anopheles, Culex, and Aedes mosquitoes. The formulation was diluted with equal volumes of water and applied @ 140 mg a.i./m2 to different mosquito breeding sites with the help of pre calibrated knapsack sprayer. Larval density was determined at pre and post application of the formulation using a standard dipper. Results Median lethal concentration (LC50 of the formulation against Anopheles stephensi, Culex quinquefasciatus and Aedes aegypti was found to be 1.6, 1.8 and 1.7 ppm respectively. LC50 values of the formulation stored at 26°C, 40°C and 45°C for 48 hours against Ae. aegypti were 1.7, 1.7, 1.8 ppm while LC90 values were 3.7, 3.7 and 3.8 ppm respectively. Further no significant difference in LC50 and LC90 values of the formulation was observed against Ae. aegypti during 18 months storage period at room temperature. An application of the formulation at the rate of 140 mg a.i./m2 in different breeding

  15. Control of Green Apple Aphid (Aphis pomi De Geer in Organic Apple Production

    Directory of Open Access Journals (Sweden)

    Slobodan Milenković

    2013-12-01

    Full Text Available The efficacy of different methods for controlling populations of green apple aphid (Aphis pomi De Geer in organic apple orchard was compared over three consecutive years. The following three control methods were tested: a predator activity (Coccinela septempunctata, b predator activity (C. septempunctata + selective spraying of trees with infestation level exceeding 10% with a botanical insecticide (NeemAzal T/S, and c predator activity (C. septempunctata + total spraying of all orchard trees with the botanical insecticide (NeemAzal T/S. In terms of maintaining a biological balance within an orchard, the combination of natural regulation by C. septempunctata and selective spraying of individual trees with NeemAzal T/S proved to be the most efficient method.

  16. Mating behavior of the predator Podisus nigrispinus (Heteroptera: Pentatomidae under exposure to neem: Comportamiento de apareamiento del depredador Podisus nigrispinus (Heteroptera: Pentatomidae expuesto al neem

    Directory of Open Access Journals (Sweden)

    Sharrine Omari Domingues de Oliveira

    2012-12-01

    Full Text Available The preservation of natural enemies is one of the basic foundations for integrated pest management. Botanical insecticides have shown low impact on beneficial arthropods in relation to survival. Insecticides studies usually focus on the direct physiological effects of insecticides, whereas relatively little attention is placed on the behavioral response to exposure. A study was conducted to evaluate the effect of the botanical insecticide neem (Azadirachta indica A. Juss.; Meliaceae on the mating behavior of the predatory stinkbug Podisus nigrispinus (Heteroptera: Pentatomidae. Unmated 5 to 7 d-old adults, separate by sex, were exposed to azadirachtin per contact on the treated surface. The treatments were composed for: untreated male and female; untreated male and treated female; treated male and untreated female; and treated male and female. Azadirachtin affected the duration of first mating (Wilcoxon test, χ2 = 13.38, df = 3, p = 0.004, which resulted in a higher effective average time of mating (EATM50 for treatment whose only female was treated with azadirachtin. This finding points to a sublethal effect of azadirachtin on mating behavior of P. nigrispinus that may compromise its reproduction.La preservación de los enemigos naturales es la base fundamental para el manejo integrado de las plagas. Los insecticidas botánicos han demostrado un bajo impacto sobre los artrópodos benéficos en relación a la supervivencia. Se desarrolló un estudio para evaluar el efecto del insecticida botánico neem (Azadirachta indica A. Juss.; Meliaceae sobre el comportamiento de apareamiento del chinche depredador Podisus nigrispinus (Heteroptera: Pentatomidae. Se expusieron adultos vírgenes de 5-7 días de edad, separados por sexo, a residuos secos de este extracto. Machos y hembras vírgenes entre 5 y 7 d de edad fueron expuestos a la azadiractina, por contacto directo con superficies tratadas. Los tratamientos fueron: machos y hembras no tratados

  17. Comunicação científica eficiência de inseticidas à base de nim no controle de Grapholita molesta (Busck, 1916 (Lepidoptera: Tortricidae Efficiency of neem insecticides in the control of Grapholita molesta (Busck, 1916 (Lepidoptera: Tortricidae

    Directory of Open Access Journals (Sweden)

    Oderlei Bernardi

    2010-03-01

    Full Text Available O objetivo foi avaliar a eficiência de inseticidas à base de nim no controle da mariposa-oriental G. molesta em laboratório. A dieta artificial foi cortada em cubos e imersa nas caldas dos respectivos tratamentos; em seguida, lagartas recém-eclodidas foram transferidas para tubos de vidro, contendo os cubos de dieta tratados. Os produtos testados foram: NeemAzal-T/S®, Dalneem emulsionável®, Organic Neem® e Natuneem Agrícola® na concentração de 0,5% do produto comercial (p.c. em comparação com o inseticida químico fenitrotion (Sumithion 500 CE® a 0,15% p.c. e uma testemunha (água. Os inseticidas NeemAzal-T/S® e Dalneem emulsionável® apresentaram a mortalidade de 100% das lagartas, sendo eficientes no controle do inseto em condições de laboratório. Organic Neem® e Natuneem Agrícola® demonstraram menor atividade inseticida, ocasionando mortalidade de 73,5% e 22,5%, respectivamente; no entanto, afetaram significativamente a viabilidade larval.The objective was to evaluate the efficiency of neem insecticides in the control of oriental fruit moth Grapholita molesta at laboratory. The artificial diet was cut in cubes and immersed in the syrups of the respective treatments, soon afterwards, recently-emerged caterpillars were transferred, for glass tubes, containing the diet cubes treated. The tested products were: NeemAzal-T/S®, Dalneem emulsionável®, Organic Neem® and Natuneem Agrícola® in the concentration of 0.5% of the commercial product (p.c. compared with the chemical insecticide fenitrotion (Sumithion 500 CE® to 0.15% p.c. and a witness (water. The insecticides NeemAzal-T/S® and Dalneem emulsionável® presented a mortality of 100% of the caterpillars being efficient in the control of the insect in laboratory conditions. Organic Neem® and Natuneem Agrícola® demonstrated lower insecticidal activity, causing mortality of 73.5% and 22.5% respectively, however, significantly affect the larval viability.

  18. The use of HPLC in the control of Neem commercial products quality: reproduction of the insecticide action; Uso de CLAE no controle de qualidade em produtos comerciais de Nim: reprodutibilidade da acao inseticida

    Energy Technology Data Exchange (ETDEWEB)

    Forim, Moacir Rossi; Matos, Andreia Pereira; Silva, Maria Fatima das Gracas Fernandes da; Cass, Quezia Bezerra; Vieira, Paulo Cezar; Fernandes, Joao Batista, E-mail: mrforim@ufscar.b [Universidade Federal de Sao Carlos (DQ/UFSCar), SP (Brazil). Dept. de Quimica

    2010-07-01

    The Neem tree, Azadirachta indica, provides many useful compounds that are used as pesticides. However, the efficiency in field of products like neem oil can be committed because they have not been observed reproductive content of secondary metabolic like azadirachtin. Based on reverse-phase high-performance liquid chromatography (HPLC) a new method was developed to permit the rapid quantitative analysis of azadirachtin from seeds, extracts and oil of Neem. In the present study it was evaluated the azadirachtin quantitative variation among various Neem's extracts and seeds showing the importance of quality control for reproduction of the insecticide efficiency, using S. frugiperda as target insect. (author)

  19. Impact Of Different Time Planting In Soybeans And Neem Seed Extract Application To Insect Population On Rice Field

    OpenAIRE

    Tamrin Abdullah; Ahdin Gassa; Sri Nur Aminah Ngatimin; Nurariaty Agus And Abdul Fattah

    2015-01-01

    Abstract The purpose of research is to study impact of different time planting of soybean and neem seed extract application to pest insect population on rice field. The research was used Random Block Design in three treatment of insecticides application i.e neem seed extract together with rice planting neem seed extract on soybean 17 days after rice planting synthetic insecticides on 17 days after rice planting Delthametrin on soybean and Chlorpirifos on rice respectively. Research was conduc...

  20. Impact Of Different Time Planting In Soybeans And Neem Seed Extract Application To Insect Population On Rice Field

    OpenAIRE

    Abdullah, Tamrin; Gassa, Ahdin; Ngatimin, Sri Nur Aminah; Agus, Nurariaty; Fattah, Abdul

    2015-01-01

    The purpose of research is to study impact of different time planting of soybean and neem seed extract application to pest insect population on rice field. The research was used Random Block Design in three treatment of insecticides application i.e: neem seed extract together with rice planting, neem seed extract on soybean 17 days after rice planting, synthetic insecticides on 17 days after rice planting (Delthametrin on soybean and Chlorpirifos on rice), respectively. Research was conducted...

  1. Uso de CLAE no controle de qualidade em produtos comerciais de Nim: reprodutibilidade da ação inseticida The use of HPLC in the control of Neem commercial products quality: reproduction of the insecticide action

    Directory of Open Access Journals (Sweden)

    Moacir Rossi Forim

    2010-01-01

    Full Text Available The Neem tree, Azadirachta indica, provides many useful compounds that are used as pesticides. However, the efficiency in field of products like neem oil can be committed because they have not been observed reproductive content of secondary metabolic like azadirachtin. Based on reverse-phase high-performance liquid chromatography (HPLC a new method was developed to permit the rapid quantitative analysis of azadirachtin from seeds, extracts and oil of Neem. In the present study it was evaluated the azadirachtin quantitative variation among various Neem's extracts and seeds showing the importance of quality control for reproduction of the insecticide efficiency, using S. frugiperda as target insect.

  2. et du neem (Azadirachta indica A. Juss.)

    African Journals Online (AJOL)

    SARAH

    30 nov. 2015 ... Mots clés : tomate ; ravageurs, extraits végétaux, activité insecticide. ABSTRACT. Objective: ... obtained with the decis unlike Lippia that has been mitigated. Indeed, neem extract can be recommended as an alternative against ...

  3. COMPARATIVE EFFICACY OF NEEM (Azadirachta indica), FALSE ...

    African Journals Online (AJOL)

    Osondu

    Abstract. A study to evaluate the insecticidal properties of some plants was undertaken. Powder and aqueous extracts of Neem, Azadirachta indica, False sesame, Ceratotheca sesamoides and the Physic nut, Jatropha curcas were evaluated as grain protectants against the cowpea seed beetle, Callosobruchus maculatus.

  4. Impact Of Different Time Planting In Soybeans And Neem Seed Extract Application To Insect Population On Rice Field

    Directory of Open Access Journals (Sweden)

    Tamrin Abdullah

    2015-08-01

    Full Text Available Abstract The purpose of research is to study impact of different time planting of soybean and neem seed extract application to pest insect population on rice field. The research was used Random Block Design in three treatment of insecticides application i.e neem seed extract together with rice planting neem seed extract on soybean 17 days after rice planting synthetic insecticides on 17 days after rice planting Delthametrin on soybean and Chlorpirifos on rice respectively. Research was conducted in rice fields with irrigation channels. The land area is 0.8 hectares with extensive experiments each rice terraces approximately 900 m2 with separate by rice terraces for every treatment. Each treatment consisted of three groups and using nine rice terraces. Samples of the rice plant population is 25 plants per sample unit. The results was showed treatment by neem seed extract with different time planting of soybeans able to reduce number of pest insects populations such as N. virescens 80.38 N. lugens 67.17 S. incertulas 66.5 and L. oratorius 93.46 when compared to treatment with synthetic insecticides Delthamethrin and Chlorpyrifos.

  5. Perceptions paysannes et protection de l'environnement : gestion ...

    African Journals Online (AJOL)

    The majority of women on average use botanical extracts and pheromone traps. Nearly 60% of men use insecticides recommended by extension services and ... the laboriousness of pounding neem and papaya leaves for large cowpea areas.

  6. Assessment of the insecticidal potency of neem ( Azadirachta Indica ...

    African Journals Online (AJOL)

    The potency of aqueous and methanolic extracts of neem (Azadirachta indica A. Juss) seed kernel, in inhibiting and disrupting development of Anopheles mosquito was assessed in the laboratory. Different concentrations of aqueous and methanolic extracts were tested on eggs, larvae and pupae. Both extracts were found ...

  7. Efficacité des extraits de neem ( Azadirachta indica ) et de papayer ...

    African Journals Online (AJOL)

    Efficacité des extraits de neem ( Azadirachta indica ) et de papayer ( Carica papaya ) dans ... Log in or Register to get access to full text downloads. ... non traité, un témoin traité avec un insecticide homologué à base de cartap, six traitements ...

  8. Insect growth regulator effects of azadirachtin and neem oil on survivorship, development and fecundity of Aphis glycines (Homoptera: Aphididae) and its predator, Harmonia axyridis (Coleoptera: Coccinellidae).

    Science.gov (United States)

    Kraiss, Heidi; Cullen, Eileen M

    2008-06-01

    Aphis glycines Matsumura, an invasive insect pest in North American soybeans, is fed upon by a key biological control agent, Harmonia axyridis Pallas. Although biological control is preferentially relied upon to suppress insect pests in organic agriculture, approved insecticides, such as neem, are periodically utilized to reduce damaging pest populations. The authors evaluated direct spray treatments of two neem formulations, azadirachtin and neem seed oil, under controlled conditions for effects on survivorship, development time and fecundity in A. glycines and H. axyridis. Both azadirachtin and neem seed oil significantly increased aphid nymphal mortality (80 and 77% respectively) while significantly increasing development time of those surviving to adulthood. First-instar H. axyridis survival to adulthood was also significantly reduced by both neem formulations, while only azadirachtin reduced third-instar survivorship. Azadirachtin increased H. axyridis development time to adult when applied to both instars, while neem oil only increased time to adult when applied to first instar. Neither neem formulation affected the fecundity of either insect. Results are discussed within the context of future laboratory and field studies aimed at clarifying if neem-derived insecticides can be effectively integrated with biological control for soybean aphid management in organic soybeans. Copyright (c) 2008 Society of Chemical Industry.

  9. USE OF BOTANICAL INSECTICIDES AS AN ALTERNATIVE FOR THE MANAGEMENT OF THE MEXICAN BEAN WEEVIL

    Directory of Open Access Journals (Sweden)

    KAREN FERREIRA DA SILVA

    2016-01-01

    Full Text Available This study aimed to evaluate the insecticidal activity of eight botanical species in the behavior and biological development of Zabrotes subfasciatus (Coleoptera: Chrysomelidae: Bruchinae under laboratory conditions. The botanical species were applied on bean grains (Phaseolus vulgaris Linnaeus directly as powder or indirectly within TNT bags. Three laboratory assays were performed. First, a repellent activity test was performed by exposing twenty couples of Z. subfasciatus adults in a choice-test arena. Second, a mortality test was performed for seven days after infestation. Finally, the oviposition and emergency rates of adults (% and the development from egg to adult (in days were evaluated in seven couples (males and females for seven days inside of a vial containing 0.3g of the powder from each botanical species and 10 g of bean grains (3% w.w-1. The study was conducted in a completely randomized design, and the treatments were arranged as a factorial design (2 x 9 with two factors (factor 1= powder and TNT bag application forms and factor 2= eight botanical species and control with eight replications. The powder application form was more efficient in controlling Z. subfasciatus. Azadirachta indica (powder application, Ruta graveolens (powder application, and Piper aduncum (TNT bag reduced the infestation of adults. The species A. inidica, Piper tuberculatum, Trichilia catigua, Pfaffia glomerata, R. graveolens, and Mentha pulegium inhibited the oviposition of the insects regardless of the formulation applied. R. graveolens (powder application caused 100% of mortality. The powder application of R. graveolens and M. pulegium reduced egg viability and insect emergence; therefore, they are very promising alternatives to control Z. subfasciatus in stored grains.

  10. The joint action of destruxins and botanical insecticides (rotenone, azadirachtin and paeonolum) against the cotton aphid, Aphis gossypii Glover.

    Science.gov (United States)

    Yi, Fei; Zou, Chunhua; Hu, Qiongbo; Hu, Meiying

    2012-06-18

    The joint action of destruxins and three botanical insecticides, rotenone (Rot), azadirachtin (Aza) and paeonolum (Pae) against the cotton aphid, Aphis gossypii, was bioassayed. In laboratory experiment, several synergistic groups of destruxins with botanical insecticides were found by means of Sun's Co-toxicity Coefficients (CTC) and Finney's Synergistic Coefficient (SC). The best synergistic effect was discovered in the ratio group Des/Rot 1/9 with the CTC or SC and LC₅₀ values of 479.93 or 4.8 and 0.06 μg/mL, respectively. The second and third synergistic effects were recorded in the ratio groups Des/Rot 7/3 and 9/1. Although the ratio groups Des/Aza 6/4, Des/Pae 4/6, 3/7 and 2/8 indicated synergism by Sun's CTC, they were determined as additive actions by Finney's SC. Additive actions were also found in most of the ratio groups, but antagonism were recorded only in three ratio groups: Des/Pae 9/1, 7/3 and 6/4. In greenhouse tests, the highest mortality was 98.9% with the treatment Des/Rot 1/9 at 0.60 μg/mL, meanwhile, the treatments Des/Pae 4/6 and Des/Aza 6/4 had approximately 88% mortality.

  11. POSSIBILITIES TO USE NATURAL EXTRACTS FROM MEDICINAL AND AROMATIC PLANTS (MAP LIKE BOTANICAL REPELLENT OR INSECTICIDE COMPOUNDS AGAINST PEST INSECTS IN ECOLOGICAL CROPS (II

    Directory of Open Access Journals (Sweden)

    Irina IONESCU-MĂLĂNCUŞ

    2013-12-01

    Full Text Available Botanical insecticides have long been touted as attractive alternatives to synthetic chemical insecticides for pest management because botanicals reputedly pose little threat to the environment or to human health. The body of scientific literature documenting bioactivity of plant derivatives to arthropods pests continues to expand i.e. repellents based on essential oils extracted from Chenopodium ambrosioides, Eucalyptus saligna, Rosmarinus officinalis to mosquitoes, or cinnamon oil, sandalwood oil and turmeric oil are previously reported as insect repellents evaluatede in the laboratory conditions. With the constantly increasing problems of insecticide resistance and increasing public concerns regarding pesticide safety, new, safer active ingredients are becoming necessary to replace existing compounds on the market. The present study carried out in the period 2010-2012 comprises a review of two insect repellents, followed by some new research conducted in our laboratory on plant-derived insect repellents. The two alkaloids tested against the Colorado potato beetle, Leptinotarsa decemlineata Say in laboratory conditions was obtained by water and alchohol extraction from two vegetal species, Cichorium intybus L. (Asterales:Asteraceae and Delphinium consolida L. (Ranales:Ranunculaceae. The tests carried out in laboratory and field experimentally plots under cages permit to evaluate several other compounds for repellent activity of lacctucin alkaloids.

  12. Neem oil increases the efficiency of the entomopathogenic fungus Metarhizium anisopliae for the control of Aedes aegypti (Diptera: Culicidae) larvae

    OpenAIRE

    Gomes, Simone A.; Paula, Adriano R.; Ribeiro, Anderson; Moraes, Catia O. P.; Santos, Jonathan W. A. B.; Silva, Carlos P.; Samuels, Richard I.

    2015-01-01

    Background Entomopathogenic fungi are potential candidates for use in integrated vector management and many isolates are compatible with synthetic and natural insecticides. Neem oil was tested separately and in combination with the entomopathogenic fungus Metarhizium anisopliae against larvae of the dengue vector Aedes aegypti. Our aim was to increase the effectiveness of the fungus for the control of larval mosquito populations. Methods Commercially available neem oil was used at concentrati...

  13. Oral (Systemic) Botanical Agents for the Treatment of Psoriasis: A Review.

    Science.gov (United States)

    Farahnik, Benjamin; Sharma, Divya; Alban, Joseph; Sivamani, Raja

    2017-06-01

    Patients with psoriasis often use botanical therapies as part of their treatment. It is important for clinicians to be aware of the current evidence regarding these agents as they treat patients. A systematic literature search was conducted using the PubMed, MEDLINE, and EMBASE database for randomized clinical trials assessing the use of botanical therapeutics for psoriasis. The search included the following keywords: "psoriasis" and "plant" or "herbal" or "botanical." Citations within articles were also reviewed to identify relevant sources. The results were then further refined by route of administration, and the oral (systemic) botanical agents are reviewed herein. A total of 12 controlled and uncontrolled clinical trials addressing the use of oral, systemic botanical agents for psoriasis were assessed in this review. While overall evidence is limited in quantity and quality, HESA-A, curcumin, neem extract, and, to a lesser degree, Traditional Chinese Medicine seem to be the most efficacious agents. The literature addresses a large amount of studies in regards to botanicals for the treatment of psoriasis. While most agents appear to be safe, further research is necessary for evidence-based recommendation of oral botanical agents to psoriasis patients.

  14. Effect of natural and chemical insecticides on Hyalopterus pruni and ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-06-17

    Jun 17, 2008 ... Anthmis pseudocotula and their mixtures with chemical insecticide (Malathion) on growth of ... ed the use of natural extracts of Fagonia arabica, Salix ..... Studies on the efficacy of neem products against the aphid Aphis.

  15. Development of an attract-and-kill co-formulation containing Saccharomyces cerevisiae and neem extract attractive towards wireworms.

    Science.gov (United States)

    Humbert, Pascal; Vemmer, Marina; Mävers, Frauke; Schumann, Mario; Vidal, Stefan; Patel, Anant V

    2017-12-27

    Wireworms (Coleoptera: Elateridae) are major insect pests of worldwide relevance. Owing to the progressive phasing-out of chemical insecticides, there is great demand for innovative control options. This study reports on the development of an attract-and-kill co-formulation based on Ca-alginate beads, which release CO 2 and contain neem extract as a bioinsecticidal compound. The objectives of this study were to discover: (1) whether neem extract can be immobilized efficiently, (2) whether CO 2 -releasing Saccharomyces cerevisiae and neem extract are suitable for co-encapsulation, and (3) whether co-encapsulated neem extract affects the attractiveness of CO 2 -releasing beads towards wireworms. Neem extract was co-encapsulated together with S. cerevisiae, starch and amyloglucosidase with a high encapsulation efficiency of 98.6% (based on measurement of azadirachtin A as the main active ingredient). Even at enhanced concentrations, neem extract allowed growth of S. cerevisiae, and beads containing neem extract exhibited CO 2 -emission comparable with beads without neem extract. When applied to the soil, the beads established a CO 2 gradient of >15 cm. The co-formulation containing neem extract showed no repellent effects and was attractive for wireworms within the first 24 h after exposure. Co-encapsulation of S. cerevisiae and neem extract is a promising approach for the development of attract-and-kill formulations for the control of wireworms. This study offers new options for the application of neem extracts in soil. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  16. Lack of genotoxic potential of pesticides, spinosad, imidacloprid and neem oil in mice (Mus musculus).

    Science.gov (United States)

    Saxena, Ankita; Kesari, V P

    2016-03-01

    Pesticides, spinosad, imidacloprid and neem oil are widely used both in residential and agricultural environments because of its broad spectrum insecticidal activity and effectiveness. The present study was undertaken to estimate genotoxicity of formulations of some pesticides in mice. Three pesticides of diverse group studied were spinosad (45% w/v), imidacloprid (17.8%, w/v) and neem oil. Animals were exposed 37, 4.5 and 50 mg kg⁻¹ b.wt. for spinosad, imidacloprid and neem oil, respectively, through oral gavage for 5 consecutive days. A vehicle control group and one positive control (cyclophosphamide; 20 mg kg⁻¹ b. wt.) were also selected. The results showed that cyclophosphamide produced 1.12% micronuclei in mice, as against 0.18 in vehicle control, 0.30 in spinosad, 0.28 in imidacloprid and 0.22% in neem oil, respectively. The gross percentage of chromosomal aberration in mice were 28.5% in cyclophosphamide against 6.5% in vehicle control, 8.0% in spinosad, 9.5% in imidacloprid and 7.0% in neem oil, respectively. The overall findings of the present study revealed that all the three pesticide formulations, imidacloprid, spinosad and neem oil at tested dose did not show any genotoxic effect in mice.

  17. Neem (Azadirachta indica a. Juss) components: candidates for the control of Crinipellis perniciosa and Phytophthora ssp.

    Science.gov (United States)

    de Rezende Ramos, Alessandra; Lüdke Falcão, Loeni; Salviano Barbosa, Guilherme; Helena Marcellino, Lucilia; Silvano Gander, Eugen

    2007-01-01

    Witches' broom and pod rot are the two most devastating diseases of cocoa in South America and Africa, respectively. Their control by means of phytosanitation and chemical fungicides is labor-intensive, costly and, in many cases, environmentally undesirable. Therefore efforts are made in order to identify alternative, environmentally safe and cost-efficient methods for the control of these pathogens. Promising candidates are components of the neem tree (Azadirachta indica), that have been used for centuries in Asia as insecticides, fungicides, anticonceptionals in popular medicine. Here we report about tests on the effect of various concentrations of extracts from neem leaves on growth of mycelia of Crinipellis and Phytophthora and on germination of spores of Crinipellis. We show a 35% growth reduction of mycelia of Phytophthora on neem leaf extract media, whereas growth of mycelia of Crinipellis was not affected, even at the highest concentration of neem leaf extracts used (35%). However, the most dramatic effect of neem leaf extracts is observed on Crinipellis spore germination, here the extracts (20-35%) reduced germination almost completely. Based on these results, we believe that the neem tree might be a source for the production, on small and medium scale, of an effective and cheap formulation for the control of Crinipellis and Phytophthora.

  18. The Joint Action of Destruxins and Botanical Insecticides (Rotenone, Azadirachtin and Paeonolum Against the Cotton Aphid, Aphis gossypii Glover

    Directory of Open Access Journals (Sweden)

    Meiying Hu

    2012-06-01

    Full Text Available The joint action of destruxins and three botanical insecticides, rotenone (Rot, azadirachtin (Aza and paeonolum (Pae against the cotton aphid, Aphis gossypii, was bioassayed. In laboratory experiment, several synergistic groups of destruxins with botanical insecticides were found by means of Sun’s Co-toxicity Coefficients (CTC and Finney’s Synergistic Coefficient (SC. The best synergistic effect was discovered in the ratio group Des/Rot 1/9 with the CTC or SC and LC50 values of 479.93 or 4.8 and 0.06 μg/mL, respectively. The second and third synergistic effects were recorded in the ratio groups Des/Rot 7/3 and 9/1. Although the ratio groups Des/Aza 6/4, Des/Pae 4/6, 3/7 and 2/8 indicated synergism by Sun’s CTC, they were determined as additive actions by Finney’s SC. Additive actions were also found in most of the ratio groups, but antagonism were recorded only in three ratio groups: Des/Pae 9/1, 7/3 and 6/4. In greenhouse tests, the highest mortality was 98.9% with the treatment Des/Rot 1/9 at 0.60 μg/mL, meanwhile, the treatments Des/Pae 4/6 and Des/Aza 6/4 had approximately 88% mortality.

  19. Effect of Neem (Azadirachta indica on the Survival of Escherichia coli O157:H7 in Dairy Manure

    Directory of Open Access Journals (Sweden)

    Subbarao V. Ravva

    2015-07-01

    Full Text Available Escherichia coli O157:H7 (EcO157 shed in cattle manure can survive for extended periods of time and intervention strategies to control this pathogen at the source are critical as produce crops are often grown in proximity to animal raising operations. This study evaluated whether neem (Azadirachta indica, known for its antimicrobial and insecticidal properties, can be used to amend manure to control EcO157. The influence of neem materials (leaf, bark, and oil on the survival of an apple juice outbreak strain of EcO157 in dairy manure was monitored. Neem leaf and bark supplements eliminated the pathogen in less than 10 d with a D-value (days for 90% elimination of 1.3 d. In contrast, nearly 4 log CFU EcO157/g remained after 10 d in neem-free manure control. The ethyl acetate extractable fraction of neem leaves was inhibitory to the growth of EcO157 in LB broth. Azadirachtin, a neem product with insect antifeedant properties, failed to inhibit EcO157. Application of inexpensive neem supplements to control pathogens in manure and possibly in produce fields may be an option for controlling the transfer of foodborne pathogens from farm to fork.

  20. Cytotoxic effects of delfin insecticide (Bacillus thuringiensis) on cell ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-08-04

    Aug 4, 2008 ... In acute exposure cells showed deformities such as swelling of cells, oval shaped deformity, and ... Commercial grade of delfin insecticide used in this study was manufactured by .... exposure to cigarette extracts. Antibiotics caused .... administration of a neem pesticide on rat metabolic enzymes. J. Environ.

  1. Tri-trophic insecticidal effects of African plants against cabbage pests.

    Directory of Open Access Journals (Sweden)

    Blankson W Amoabeng

    Full Text Available Botanical insecticides are increasingly attracting research attention as they offer novel modes of action that may provide effective control of pests that have already developed resistance to conventional insecticides. They potentially offer cost-effective pest control to smallholder farmers in developing countries if highly active extracts can be prepared simply from readily available plants. Field cage and open field experiments were conducted to evaluate the insecticidal potential of nine common Ghanaian plants: goat weed, Ageratum conyzoides (Asteraceae, Siam weed, Chromolaena odorata (Asteraceae, Cinderella weed, Synedrella nodiflora (Asteraceae, chili pepper, Capsicum frutescens (Solanaceae, tobacco, Nicotiana tabacum (Solanaceae cassia, Cassia sophera (Leguminosae, physic nut, Jatropha curcas (Euphorbiaceae, castor oil plant, Ricinus communis (Euphorbiaceae and basil, Ocimum gratissimum (Lamiaceae. In field cage experiments, simple detergent and water extracts of all botanical treatments gave control of cabbage aphid, Brevicoryne brassicae and diamondback moth, Plutella xylostella, equivalent to the synthetic insecticide Attack® (emamectin benzoate and superior to water or detergent solution. In open field experiments in the major and minor rainy seasons using a sub-set of plant extracts (A. conyzoides, C. odorata, S. nodiflora, N. tabacum and R. communis, all controlled B. brassicae and P. xylostella more effectively than water control and comparably with or better than Attack®. Botanical and water control treatments were more benign to third trophic level predators than Attack®. Effects cascaded to the first trophic level with all botanical treatments giving cabbage head weights, comparable to Attack® in the minor season. In the major season, R. communis and A conyzoides treatment gave lower head yields than Attack® but the remaining botanicals were equivalent or superior to this synthetic insecticide. Simply-prepared extracts from

  2. Tri-trophic insecticidal effects of African plants against cabbage pests.

    Science.gov (United States)

    Amoabeng, Blankson W; Gurr, Geoff M; Gitau, Catherine W; Nicol, Helen I; Munyakazi, Louis; Stevenson, Phil C

    2013-01-01

    Botanical insecticides are increasingly attracting research attention as they offer novel modes of action that may provide effective control of pests that have already developed resistance to conventional insecticides. They potentially offer cost-effective pest control to smallholder farmers in developing countries if highly active extracts can be prepared simply from readily available plants. Field cage and open field experiments were conducted to evaluate the insecticidal potential of nine common Ghanaian plants: goat weed, Ageratum conyzoides (Asteraceae), Siam weed, Chromolaena odorata (Asteraceae), Cinderella weed, Synedrella nodiflora (Asteraceae), chili pepper, Capsicum frutescens (Solanaceae), tobacco, Nicotiana tabacum (Solanaceae) cassia, Cassia sophera (Leguminosae), physic nut, Jatropha curcas (Euphorbiaceae), castor oil plant, Ricinus communis (Euphorbiaceae) and basil, Ocimum gratissimum (Lamiaceae). In field cage experiments, simple detergent and water extracts of all botanical treatments gave control of cabbage aphid, Brevicoryne brassicae and diamondback moth, Plutella xylostella, equivalent to the synthetic insecticide Attack® (emamectin benzoate) and superior to water or detergent solution. In open field experiments in the major and minor rainy seasons using a sub-set of plant extracts (A. conyzoides, C. odorata, S. nodiflora, N. tabacum and R. communis), all controlled B. brassicae and P. xylostella more effectively than water control and comparably with or better than Attack®. Botanical and water control treatments were more benign to third trophic level predators than Attack®. Effects cascaded to the first trophic level with all botanical treatments giving cabbage head weights, comparable to Attack® in the minor season. In the major season, R. communis and A conyzoides treatment gave lower head yields than Attack® but the remaining botanicals were equivalent or superior to this synthetic insecticide. Simply-prepared extracts from readily

  3. Tri-Trophic Insecticidal Effects of African Plants against Cabbage Pests

    Science.gov (United States)

    Amoabeng, Blankson W.; Gurr, Geoff M.; Gitau, Catherine W.; Nicol, Helen I.; Stevenson, Phil C.

    2013-01-01

    Botanical insecticides are increasingly attracting research attention as they offer novel modes of action that may provide effective control of pests that have already developed resistance to conventional insecticides. They potentially offer cost-effective pest control to smallholder farmers in developing countries if highly active extracts can be prepared simply from readily available plants. Field cage and open field experiments were conducted to evaluate the insecticidal potential of nine common Ghanaian plants: goat weed, Ageratum conyzoides (Asteraceae), Siam weed, Chromolaena odorata (Asteraceae), Cinderella weed, Synedrella nodiflora (Asteraceae), chili pepper, Capsicum frutescens (Solanaceae), tobacco, Nicotiana tabacum (Solanaceae) cassia, Cassia sophera (Leguminosae), physic nut, Jatropha curcas (Euphorbiaceae), castor oil plant, Ricinus communis (Euphorbiaceae) and basil, Ocimum gratissimum (Lamiaceae). In field cage experiments, simple detergent and water extracts of all botanical treatments gave control of cabbage aphid, Brevicoryne brassicae and diamondback moth, Plutella xylostella, equivalent to the synthetic insecticide Attack® (emamectin benzoate) and superior to water or detergent solution. In open field experiments in the major and minor rainy seasons using a sub-set of plant extracts (A. conyzoides, C. odorata, S. nodiflora, N. tabacum and R. communis), all controlled B. brassicae and P. xylostella more effectively than water control and comparably with or better than Attack®. Botanical and water control treatments were more benign to third trophic level predators than Attack®. Effects cascaded to the first trophic level with all botanical treatments giving cabbage head weights, comparable to Attack® in the minor season. In the major season, R. communis and A conyzoides treatment gave lower head yields than Attack® but the remaining botanicals were equivalent or superior to this synthetic insecticide. Simply-prepared extracts from readily

  4. Ethnobotanical uses of neem (Azadirachta indica A.Juss.; Meliaceae) leaves in Bali (Indonesia) and the Indian subcontinent in relation with historical background and phytochemical properties.

    Science.gov (United States)

    Sujarwo, Wawan; Keim, Ary P; Caneva, Giulia; Toniolo, Chiara; Nicoletti, Marcello

    2016-08-02

    Neem (Azadirachta indica; Meliaceae) is widely known for its cold pressed seed oil, mainly used as insecticide, but also for cosmetic, medicinal and agricultural uses. The seed oil is widely employed in the Indian subcontinent, and the leaves seem to have a lower relevance, but the ethnobotanical information of Bali (Indonesia) considers the utilisation of leaves for medicinal properties. We report ethnopharmacological information about current uses of neem, in particular of the leaves, besides the insecticidal one, we discuss on the historical background of their uses. Ethnobotanical data were collected using both literature and scientific references and semi-structured interviews with 50 informants (ages ranged between 14 and 76 years old) through the snowball method in thirteen aga (indigenous Balinese) villages, following Ethic code procedures. The informants were asked to specify: which part of the plant was used, and how that plant part was used. Plant specimens were collected, identified and made into herbarium voucher. In consideration of the high variability and complex chemical constituent of neem, a HPTLC analysis of neem leaves coming from both the Indonesian island of Bali and the Indian subcontinent was carried out. The data on the medical use of traditional preparations from leaves of neem display a wide spectrum of applications. In the Indian subcontinent, neem leaves are used to treat dental and gastrointestinal disorders, malaria fevers, skin diseases, and as insects repellent, while the Balinese used neem leaves as a diuretic and for diabetes, headache, heartburn, and stimulating the appetite. Differences in utilisation cannot be related to chemical differences and other constituents besides limonoids must be investigated and related to the multipurpose activity of neem. This study revealed that neem leaves are believed to treat diabetes in both Balinese and Indian communities. Limonoids can not be considered the only responsible of digestive

  5. Efficacy of local neem extracts for sustainable malaria vector control in an African village

    Directory of Open Access Journals (Sweden)

    Duchemin Jean-Bernard

    2008-07-01

    Full Text Available Abstract Background Larval control of malaria vectors has been historically successful in reducing malaria transmission, but largely fell out of favour with the introduction of synthetic insecticides and bed nets. However, an integrated approach to malaria control, including larval control methods, continues to be the best chance for success, in view of insecticide resistance, the behavioural adaptation of the vectors to changing environments and the difficulties of reaching the poorest populations most at risk,. Laboratory studies investigating the effects of neem seed (Azadirachta indica extracts on Anopheles larvae have shown high rates of larval mortality and reductions in adult longevity, as well as low potential for resistance development. Methods This paper describes a method whereby seeds of the neem tree can be used to reduce adult Anopheles gambiae s.l. abundance in a way that is low cost and can be implemented by residents of rural villages in western Niger. The study was conducted in Banizoumbou village, western Niger. Neem seeds were collected from around the village. Dried seeds were ground into a coarse powder, which was then sprinkled onto known Anopheles larvae breeding habitats twice weekly during the rainy season 2007. Adult mosquitoes were captured on a weekly basis in the village and captures compared to those from 2005 and 2006 over the same period. Adult mosquitoes were also captured in a nearby village, Zindarou, as a control data set and compared to those from Banizoumbou. Results It was found that twice-weekly applications of the powder to known breeding habitats of Anopheles larvae in 2007 resulted in 49% fewer adult female Anopheles gambiae s.l. mosquitoes in Banizoumbou, compared with previous captures under similar environmental conditions and with similar habitat characteristics in 2005 and 2006. The productivity of the system in 2007 was found to be suppressed compared to the mean behaviour of 2005 and 2006 in

  6. Application of diethanolamide surfactant derived from palm oil to improve the performance of biopesticide from neem oil

    Science.gov (United States)

    Nisya, F. N.; Prijono, D.; Nurkania, A.

    2017-05-01

    The purpose of this research was to improve the performance of organic pesticide derived from neem plant using diethanolamide surfactant (DEA) derived from palm oil in controlling armyworms. The pesticide was made of neem oil. Neem oil is a neem plant product containing several active components, i.e. azadirachtin, salanin, nimbin, and meliantriol which act as a pesticide. DEA surfactant acts as a wetting, dispersing and spreading agent in neem oil pesticide. The neem oil was obtained by pressing neem seeds using a screw press machine and a hydraulic press machine. DEA surfactant was synthesized from methyl esters of palm oil olein. Pesticide formulation was conducted by stirring the ingredients by using a homogenizer at 5,000 rpm for 30 minutes. Surfactant was added to the formulation by up to 5%. Glycerol, as an emulsifier, was added in to pesticide formulations of neem oil. The efficacy of the pesticides in controlling armyworms fed soybean leaves in laboratory was measured at six concentrations, i.e. 10, 13, 16, 19, 22, and 25 ml/L. Results showed that the neem oil used in this study had a density of 0.91 g/cm3, viscosity of 58.94 cPoise, refractive index of 1.4695, surface tension of 40.69 dyne/cm, azadirachtin content of 343.82-1.604 ppm. Meanwhile, the azadirachtin content of neem seed cake was 242.20 ppm. It was also found that palmitic (31.4%) and oleic (22.5%) acids were the main fatty acids contained in neem oil. As the additive material used in neem oil in this study, diethanolamide surfactant had a pH of 10.6, density of 0.9930 g/cm3, viscosity of 708.20 cP, and surface tension of 25.37 dyne/cm. Results of CMC, contact angle, and droplet size analyzes showed that diethanolamide surfactant could be added into insecticide formulation by 5%. Results of LC tests showed that on Spodoptera litura the LC50 and LC95 values were 13 and 22 ml/L, respectively. Neem oil was found to inhibit the development of Spodoptera litura and its larval molting process.

  7. Insecticidal properties of the neem tree (Azadirachta indica): it’s for the birds!

    NARCIS (Netherlands)

    Veldkamp, J.F.

    1986-01-01

    New Scientist (6 June 1985, p. 10) reported that Azadirachta indica (Meliaceae), the Indian neem tree, would be a ’new’ wonder plant. Its medical properties have been known for ages to local people and western botanists (e.g. Garcia de Orta, 1567). In India about 14 million trees, typically planted

  8. Field evaluation of the efficacy of neem oil (Azadirachta indica A. Juss) and Beauveria bassiana (Bals.) Vuill. in cotton production

    NARCIS (Netherlands)

    Togbe, C.E.; Haagsma, R.; Zannou, E.; Gbehounou, G.; Déguénon, J.M.; Vodouhe, S.; Kossou, D.; Huis, van A.

    2015-01-01

    Neem oil (Azadirachta indica A. Juss) alone and combined with the entomopathogenic fungus Beauveria bassiana (Balsamo) Vuillemin (isolate Bb11) was applied to control cotton pests. The efficacy of these treatments was compared with that of synthetic insecticides applied either in a calendar-based

  9. Control of green apple aphid (Aphis pomi De Geer) in organic apple production

    OpenAIRE

    Milenković Slobodan; Marčić Dejan; Ružičić Lazar

    2013-01-01

    The efficacy of different methods for controlling populations of green apple aphid (Aphis pomi De Geer) in organic apple orchard was compared over three consecutive years. The following three control methods were tested: a) predator activity (Coccinela septempunctata), b) predator activity (C. septempunctata) + selective spraying of trees with infestation level exceeding 10% with a botanical insecticide (NeemAzal T/S), and c) predator activity (C. septempun...

  10. Influence of insecticidal plant materials used during storage on sensory attributes and instrumental hardness of dry edible beans (Phaseolus vulgaris L.).

    Science.gov (United States)

    Dunkel, F V; Serugendo, A; Breene, W M; Sriharan, S

    1995-07-01

    Three plant products with known insecticidal properties, a dry extract of flowers of Chrysanthemum cinerariaefolium (Trevir.) Vis. produced in Rwanda, an ethanol extract of seeds of neem, Azadirachta indica A. Juss, and crushed leaves of Tetradenia riparia Hochst Codd, a traditional Rwandan medicine, were mixed with beans, Phaseolus vulgaris L., for storage protection. These plant-protected beans were compared with "off the shelf' beans that were being sold to consumers by the Rwandan National Agricultural Products Marketing Organization (OPROVIA). A trained sensory panel determined that beans treated with neem and C. cinerariaefolium were as acceptable after 8 months storage as those being sold throughout Rwanda by the marketing organization. Beans marketed by this organization were all treated with the standard insecticide application in Rwanda, 0.01% weight/weight pirimiphos methyl in a powder formulation. Instrumental hardness (% hard-to-cook/mean gram force) after 20 months of storage was acceptable for beans stored with neem or with C. cinerariaefolium or with the conventional government application of pirimiphos methyl. Use of either neem or C. cinerariaefolium for storage protection should not affect consumer acceptance of dry beans.

  11. Impact of botanical pesticides derived from Melia azedarach and Azadirachta indica on the biology of two parasitoid species of the diamondback moth

    NARCIS (Netherlands)

    Charleston, D.S.; Kfir, R.; Dicke, M.; Vet, L.E.M.

    2005-01-01

    The effect of two botanical pesticides was tested on two species of parasitoids, Cotesia plutellae and Diadromus collaris. Aqueous leaf extracts from the syringa tree, Melia azedarach and commercial formulations from the neem tree, Azadirachta indica, Neemix 4.5 were investigated in the laboratory

  12. Contact Allergy to Neem Oil.

    NARCIS (Netherlands)

    de Groot, Anton; Jagtman, Berend A; Woutersen, Marjolijn

    2018-01-01

    A case of allergic contact dermatitis from neem oil is presented. Neem oil (synonyms: Melia azadirachta seed oil [INCI name], nim oil, margosa oil) is a vegetable (fixed) oil obtained from the seed of the neem tree Azadirachta indica by cold pressing. Contact allergy to neem oil has been described

  13. PRODUCT NEEM AZAL T/S - BROAD-SPECTRUM PHYPOPESTICIDE FOR CONTROL OF PESTS ON VEGETABLE CROPS

    Directory of Open Access Journals (Sweden)

    Vinelina Yankova

    2016-09-01

    Full Text Available Experiments for determination of the effectiveness of product Neem Azal T/S (a. i. azadirachtin were conducted at a concentration of 0,3% against some major pests in vegetable crops grown in greenhouses at the Maritsa Vegetable Crops research Institute, Plovdiv during the period 2010-2016. It was established very good insecticidal and acaricidal action of phytopesticide against: cotton aphid (Aphis gossypii Glov.; green peach aphid (Myzus persicae Sulz.; western flower trips (Frankliniella occidentalis Perg.; cotton bollworm (Helicoverpa armigera Hubn.; tomato borer (Tuta absoluta Meyrick and two-spotted spider mite (Tetranichus urticae Koch.. This product is a successful alternative to using chemical insecticides and acaricides.

  14. Some ecological implications of a neem (azadirachtin) insecticide disturbance to zooplankton communities in forest pond enclosures.

    Science.gov (United States)

    Kreutzweiser, David P; Sutton, Trent M; Back, Richard C; Pangle, Kevin L; Thompson, Dean G

    2004-04-28

    A neem-based insecticide, Neemix 4.5, was applied to forest pond enclosures at concentrations of 10, 17, and 28 microg l(-1) azadirachtin (the active ingredient). At these test concentrations, significant, concentration-dependent reductions in numbers of adult copepods were observed, but immature copepod and cladoceran populations were unaffected. There was no evidence of recovery of adult copepods within the sampling season (May to October). The ecological significance of this disturbance to the zooplankton community was examined by determining biomass as a measure of food availability for higher predators, plankton community respiration, dissolved oxygen (DO) concentrations, and conductivity as functional indicators of ecosystem stress, and zooplankton food web stability as a measure of effects on trophic structure. The selective removal or reduction of adult copepods was sufficient to measurably reduce total zooplankton biomass for several weeks mid-season. During the period of maximal impact (about 4-9 weeks after the applications), total plankton community respiration was significantly reduced, and this appeared to contribute to significant, concentration-dependent increases in dissolved oxygen and decreases in conductivity among treated enclosures. The reductions in adult copepods resulted in negative effects on zooplankton food web stability through eliminations of a trophic link and reduced interactions and connectance. Comparing the results here to those from a previous study with tebufenozide, which was selectively toxic to cladocerans and had little effect on food web stability, indicates that differential sensitivity among taxa can influence the ecological significance of pesticide effects on zooplankton communities.

  15. Potentiality of botanical agents for the management of post harvest insects of maize: a review.

    Science.gov (United States)

    Soujanya, P Lakshmi; Sekhar, J C; Kumar, P; Sunil, N; Prasad, Ch Vara; Mallavadhani, U V

    2016-05-01

    Natural products derived from plants are emerging as potent biorational alternatives to synthetic insecticides for the integrated management of post harvest insects of maize. In this paper, effectiveness of botanicals including plant extracts, essential oils, their isolated pure compounds, plant based nano formulations and their mode of action against storage insects have been reviewed with special reference to maize. Plant based insecticides found to be the most promising means of controlling storage insects of maize in an eco friendly and sustainable manner. This article also throws light on the commercialization of botanicals, their limitations, challenges and future trends of storage insect management.

  16. AKTIVITAS INSEKTISIDA EKSTRAK BIJI TRICHILIA TRIJUGA ROXB. (MELIACEAE TERHADAP ULAT DAUN MELATI PALPITA UNIONALIS (HÜBNER

    Directory of Open Access Journals (Sweden)

    Ika Sartika , Djoko Prijono Gustini Syahbirin , dan Maryam Abn.

    2011-10-01

    Full Text Available Insecticidal activity of Trichilia trijuga Roxb. (Meliaceae seed extracts against jasmine leaf caterpillar Palpita unionalis (Hübner.  The insecticidal activity of Trichilia trijuga seed extracts was evaluated in the laboratory against the jasmine leaf caterpillar Palpita unionalis.  Acetone neem (Azadirachta indica seed extract and NeemAzal T/S formulation (a.i.: 1% azadirachtin were included in the test as positive controls.  First-instar larvae of P. unionalis were fed with treated jasmine leaves for 2 days, then surviving larvae were fed with untreated leaves and observed daily until reaching third-instar stage.  The treatments with acetone extract and aqueous extract of T. trijuga at concentrations of 0.175% and 21 g of seeds/l of water (2.1%, respectively, caused a complete kill in the test larvae.  The insecticidal activity of T. trijuga acetone extract at 0.175% was comparable with that of NeemAzal preparation containing azadirachtin of about 10 – 17.5 ppm.  Based on larval mortality until the third instar, LC50 of acetone extract and aqueous extract of T. trijuga were 0.024% and 0.307%, respectively (LC50 of acetone neem seed extract was 0.018%.  In addition to lethal effect, T. trijuga seed extracts also delayed the development of the surviving larvae; for example, the treatment with T. trijuga acetone extract at 0.1% prolonged the developmental time of P. unionalis larvae to the third instar by 3 days compared to control.  It is concluded that T. trijuga seeds serve as a potential source of botanical insecticides, particularly against P. unionalis.

  17. NEEM: UNUSUALLY VERSATILE PLANT GENUS AZADIRACHTA WITH MANY USEFUL AND SO FAR INSUFFICIENTLY EXPLOITED PROPERTIES FOR AGRICULTURE, MEDICINE, AND INDUSTRY.

    Science.gov (United States)

    Hummel, H E; Langner, S S; Leithold, G; Schmutterer, H

    2014-01-01

    Neem plants (Rutales: Meliaceae) are well known for their multitude of human benefits in various fields. Specifically well investigated are the Indian neem tree Azadirachta indica A. Juss., the Thai neem A. siamensis Val., the originally Malaysian/Philippinean neem A. excelsa (Jack) and, as a close relative, the Persian lilac, Melia azedarach. The major and most active natural products are azadirachtin, salannin, nimbin and marrangin from Azadirachta species, and azadirachtin analogues like meliantriol from Melia species. Neem fruits, leaves, bark, and roots have specific virtues. They have been traditionally exploited for a considerable part of human history and are documented in Sanskrit texts. Due to human activity in trade and travel both at land and sea, the plant species has been distributed around the globe and is cultivated in many tropical, and subtropical regions. A multitude of natural products of neem have been isolated, chemically characterized or identified, and investigated for their properties in the management of insects, Acarina, Crustacea, nematodes, bacteria, fungi, viruses and soil fertility (for reviews see Kraus, 2002; Schmutterer, 2002A; Rembold, 2002; Koul, 2004; Schmutterer and Huber, 2005; Kleeberg and Strang, 2009; Hummel et al., 2008, 2011, 2012). Neem products are virtually nontoxic, compatible with beneficial insects, pollinators and bees. They are environmentally benign, sustainable, renewable, and of a price affordable for developed countries. In conclusion, neem is a prime example of a natural resource with many beneficial applications in agriculture, human and veterinary medicine. So far, its use is practically free of resistance problems which are frustratingly prevalent in many areas of synthetic insecticide and drug development. Investigating more neem applications will increase future human welfare and health while being of general ecological benefit to the planet.

  18. Efecto insecticida del extracto de semillas de Neem (Azadirachta indica sobre Collaria scenica, Stal (Hemiptera: Miridae

    Directory of Open Access Journals (Sweden)

    Daniel Villamil Montero

    2012-07-01

    Abstract. This work was developed with the objetive to evaluate the insecticidal effect of the Neem (Azadirachta indica A. Juss seeds against grass bug nymphs Collaria scenica Stal. For that, an extract was prepared from green fruits of Neem by rotaevaporación. The extract was diluted in three ppm concentrations corresponding to treatments. Using thin-layer chromatography we identified the presence of Azaridactina. DCA essay was carried out with 4 treatments and 5 repetitions that included the three extract concentrations and a control. In each repetition were used 15 nymphs, randomly placed in plastic boxes with food and the corresponding concentration. Every day an extract application was made and recorded mortality percentage, number of exuviae and number of individuals who came to adulthood in each treatment. The results were analyzed using Kruskal-Wallis and Games-Howell for each variable. The three concentrations of Neem seed extract had a negative effect on the development of the bugs. The more concentrated treatment (250 ppm was the most effective, showing a 97% mortality, fewer exuvias and and fewer adults in the end of the experiment.

  19. Larvicidal activity of Neem oil and three plant essential oils from Senegal against Chrysodeixis chalcites (Esper, 1789

    Directory of Open Access Journals (Sweden)

    Saliou Ngom

    2018-01-01

    Full Text Available Objective: To evaluate the insecticide, larvicidal and repellent activity of the essential oils from Callistemon viminalis, Melaleuca leucadendron, and Hyptis suaveolens against Chrysodeixis chalcites and to compare it with neem oil (Azadirachta indica. Methods: The essential oils of the leaves of these aromatiques plants were extracted by steam distillation and contacts tests were carried out. Results: Essential oils in ethanol from Callistemon viminalis showed a higher biological activity than the neem with 100% larval mortality at the concentration of 2 μg/mL for 6 h, 100% and 90% in ethanol from Melaleuca leucadendron and Hyptis suaveolens, respectively at the concentration of 4 μg/mL for 24 h. By inhalation, the essential oils from Melaleuca leucadendron and of Hyptis suaveolens were more effective with mortality rates of larvae 100% and 50% respectively at 2 μg/L air applied after 24 h. Nevertheless, the neem has shown to be a repulsive plant and anti-nutritional plant. A significant difference in the percentages of consumption between leaves treated with neem oil and the control samples was observed (Newman-Keuls test except for Melaleuca leucadendron. Conclusions: The results of the study highlight remarkable biocide, properties of tested extracts, which provides important opportunities for the development of biopesticides.

  20. Morphology of the alimentary canal of Spodoptera frugiperda (J E Smith) larvae (Lepidoptera: Noctuidae) fed on neem-treated leaves

    International Nuclear Information System (INIS)

    Correia, Alicely A.; Wanderley-Teixeira, Valeria; Oliveira, Jose V. de; Torres, Jorge B.; Teixeira, Alvaro A.C.

    2009-01-01

    Research involving plants with insecticide activity evolved significantly in the last decades. Among these plants, the neem tree, Azadirachta indica, is commonly used against several insects, mainly Lepidoptera. The neem efficiency depends on the target insect and on the concentration used. A barrier against potential toxic agents ingested together with the food is the alimentary canal. Thus, this research aimed to describe the histology of the alimentary canal of Spodoptera frugiperda (J E Smith) larvae fed on leaves treated with neem (Neemseto R ) at a concentration of 0.5% and 1.0% and non treated, at different intervals (48, 96, 144, 192 and 240 h), by quantifying the regenerative cells and analyzing the secretion of the mesenteron histochemically. Larvae were immobilized at low temperatures (-4 deg C), the alimentary canal was removed, fixed in Bouein's aqueous, embedded in paraplast and historesin, sectioned and stained with hematoxylin-eosin and periodic acid- Schiff. The histology of the alimentary canal of S. frugiperda was similar to other lepidopterans. Neem effects on morphology were seen only in the mesenteron, depending on the time and concentration used, such as: epithelium, reduction on regenerative cells and on the secretory activity in this region, confirmed by the histochemistry in both neem concentrations. These alterations were observed after 96 h at 1.0%, and 144 h at 0.5%. These results indicate that neem (Neemseto R ), at the concentrations studied, may be effective to control S. frugiperda because it promotes meaningful morphological alterations in the mesenteron. (author)

  1. DETERMINATION OF THE EFFICACY OF BEST ACTION, FURADAN, AND NEEM EMULSION IN THE CONTROL OF MAJOR INSECT PESTS OF COWPEA [Vigna unguiculata (L. WALP

    Directory of Open Access Journals (Sweden)

    2016-11-01

    Full Text Available Field experiments to determine the efficacy of Best Action (30g/litre cypermethrine plus 250g/litre dimethoate as water emulsifiable concentrates, Furadan 10G (carbofuran, Neem emulsion (Azadiracta indica as insecticide treatments in the control of major insect pests of cowpea were conducted in two agro-environments simultaneously in Enugu Area, South Eastern Nigeria in 2014 cropping season using two cowpea varieties (Ife brown, and Potiskum as test crops. The experimental design was a split plot in a randomized compete block (RCB replicated three times. Best Action was more effective in controlling cowpea insect pests, followed by Furandan 10G, and Neem emulsion respectively and their effectiveness was not affected by climatic factors variations in the two agro-environments (Nsukka and Agbani. Ife brown and Potiskum did not significantly resist the attack of major insect pests of cowpea. Insecticides and cowpea varieties did not have a significant interaction effect on the control of major insect pests of cowpea.

  2. POTENTIATION OF COPAÍBA OIL-RESIN WITH SYNTHETIC INSECTICIDES TO CONTROL OF FALL ARMYWORM

    OpenAIRE

    ALMEIDA, WALDIANE ARAÚJO DE; SILVA, IGOR HONORATO LEDUÍNO DA; SANTOS, ANA CLÁUDIA VIEIRA DOS; BARROS JÚNIOR, AURÉLIO PAES; SOUSA, ADALBERTO HIPÓLITO DE

    2017-01-01

    ABSTRACT The control of Spodoptera frugiperda (J. E. SMITH) (Lepidoptera: Noctuidae) has been carried out mainly with pyrethroids and organophosphates insecticides. The continuous and indiscriminate use of synthetic insecticides, for decades, has led to the selection of resistant populations and has caused concerns for human health and the environment. An alternative is the use of botanical insecticides, including through the mixtures with synthetic insecticides. This study aimed to investiga...

  3. Selective effects of natural and synthetic insecticides on mortality of Spodoptera frugiperda (Lepidoptera: Noctuidae) and its predator Eriopis connexa (Coleoptera: Coccinellidae).

    Science.gov (United States)

    Tavares, Wagner S; Costa, Mariana A; Cruz, Ivan; Silveira, Rodrigo D; Serrao, Jose E; Zanuncio, Jose C

    2010-08-01

    Spodoptera frugiperda Smith (Lepidoptera: Noctuidae) is a serious pest of corn in several American countries. It is mainly controlled with synthetic insecticides. The objectives of this study were to evaluate the effects of the natural products, neem oil and pyroligneous extract, and the synthetic insecticide, lufenuron, at 2.50 mL water (0.25%) on the mortality of 2-, 4- and 6-day-old caterpillars of S. frugiperda, and their selectivities against fourth instar larvae of Eriopis connnexa Germar (Coleoptera: Coccinellidae). Four- and 6-day-old S. frugiperda caterpillars showed higher mortality after exposure to neem oil (83.33 +/- 0.83 and 89.58 +/- 0.90%, respectively) and lufenuron (95.83 +/- 0.96 and 85.41 +/- 0.83%), compared to pyroligneous extract (68.75 +/- 0.69 and 31.25 +/- 0.31%). The deleterious effect of pyroligneous extract was higher in 2- (83.33 +/- 0.83% mortality) and 4-day-old (68.75 +/- 0.69%) S. frugiperda caterpillars than in 6-day-old caterpillars (31.25 +/- 0.31%). Larval mortality of the predator E. connexa was lower with neem oil and pyroligneous extract (25.00 +/- 0.33%) than with lufenuron (91.66 +/- 1.22%). Neem oil is thus recommended for control of S. frugiperda because of its high toxicity, combined with its relatively low toxicity to larvae of the natural enemy E. connexa.

  4. Factors determining the use of botanical insect pest control methods ...

    African Journals Online (AJOL)

    A farm survey was conducted in three representative administrative districts of the Lake Victoria Basin (LVB), Kenya to document farmers' indigenous knowledge and the factors that influence the use of botanicals instead of synthetic insecticides in insect pest management. A total of 65 farm households were randomly ...

  5. Neem oil increases the efficiency of the entomopathogenic fungus Metarhizium anisopliae for the control of Aedes aegypti (Diptera: Culicidae) larvae.

    Science.gov (United States)

    Gomes, Simone A; Paula, Adriano R; Ribeiro, Anderson; Moraes, Catia O P; Santos, Jonathan W A B; Silva, Carlos P; Samuels, Richard I

    2015-12-30

    Entomopathogenic fungi are potential candidates for use in integrated vector management and many isolates are compatible with synthetic and natural insecticides. Neem oil was tested separately and in combination with the entomopathogenic fungus Metarhizium anisopliae against larvae of the dengue vector Aedes aegypti. Our aim was to increase the effectiveness of the fungus for the control of larval mosquito populations. Commercially available neem oil was used at concentrations ranging from 0.0001 to 1%. Larval survival rates were monitored over a 7 day period following exposure to neem. The virulence of the fungus M. anisopliae was confirmed using five conidial concentrations (1 × 10(5) to 1 × 10(9) conidia mL(-1)) and survival monitored over 7 days. Two concentrations of fungal conidia were then tested together with neem (0.001%). Survival curve comparisons were carried out using the Log-rank test and end-point survival rates were compared using one-way ANOVA. 1% neem was toxic to A. aegypti larvae reducing survival to 18% with S50 of 2 days. Neem had no effect on conidial germination or fungal vegetative growth in vitro. Larval survival rates were reduced to 24% (S50 = 3 days) when using 1 × 10(9) conidia mL(-1). Using 1 × 10(8) conidia mL(-1), 30% survival (S50 = 3 days) was observed. We tested a "sub-lethal" neem concentration (0.001%) together with these concentrations of conidia. For combinations of neem + fungus, the survival rates were significantly lower than the survival rates seen for fungus alone or for neem alone. Using a combination of 1 × 10(7) conidia mL(-1) + neem (0.001%), the survival rates were 36%, whereas exposure to the fungus alone resulted in 74% survival and exposure to neem alone resulted in 78% survival. When using 1 × 10(8) conidia mL(-1), the survival curves were modified, with a combination of the fungus + neem resulting in 12% survival, whilst the fungus alone at this concentration also

  6. Side-effects of cowpea treatment with botanical insecticides on two parasitoids of Callosobruchus maculatus

    NARCIS (Netherlands)

    Boeke, S.J.; Sinzogan, A.A.C.; Almeida, de R.P.; Boer, de P.W.M.; Jeong, G.S.; Kossou, D.K.; Loon, van J.J.A.

    2003-01-01

    Studies on the protective effect of botanical products against pest insects have infrequently been extended to side-effects on natural enemies. Indirect effects of botanicals on the storability of seeds could occur through their possible negative impact on biological control agents. Four plant

  7. Comprehensive analyses of genomes, transcriptomes and metabolites of neem tree

    Directory of Open Access Journals (Sweden)

    Nagesh A. Kuravadi

    2015-08-01

    Full Text Available Neem (Azadirachta indica A. Juss is one of the most versatile tropical evergreen tree species known in India since the Vedic period (1500 BC–600 BC. Neem tree is a rich source of limonoids, having a wide spectrum of activity against insect pests and microbial pathogens. Complex tetranortriterpenoids such as azadirachtin, salanin and nimbin are the major active principles isolated from neem seed. Absolutely nothing is known about the biochemical pathways of these metabolites in neem tree. To identify genes and pathways in neem, we sequenced neem genomes and transcriptomes using next generation sequencing technologies. Assembly of Illumina and 454 sequencing reads resulted in 267 Mb, which accounts for 70% of estimated size of neem genome. We predicted 44,495 genes in the neem genome, of which 32,278 genes were expressed in neem tissues. Neem genome consists about 32.5% (87 Mb of repetitive DNA elements. Neem tree is phylogenetically related to citrus, Citrus sinensis. Comparative analysis anchored 62% (161 Mb of assembled neem genomic contigs onto citrus chromomes. Ultrahigh performance liquid chromatography-mass spectrometry-selected reaction monitoring (UHPLC-MS/SRM method was used to quantify azadirachtin, nimbin, and salanin from neem tissues. Weighted Correlation Network Analysis (WCGNA of expressed genes and metabolites resulted in identification of possible candidate genes involved in azadirachtin biosynthesis pathway. This study provides genomic, transcriptomic and quantity of top three neem metabolites resource, which will accelerate basic research in neem to understand biochemical pathways.

  8. Comprehensive analyses of genomes, transcriptomes and metabolites of neem tree

    Science.gov (United States)

    Rangiah, Kannan; Mahesh, HB; Rajamani, Anantharamanan; Shirke, Meghana D.; Russiachand, Heikham; Loganathan, Ramya Malarini; Shankara Lingu, Chandana; Siddappa, Shilpa; Ramamurthy, Aishwarya; Sathyanarayana, BN

    2015-01-01

    Neem (Azadirachta indica A. Juss) is one of the most versatile tropical evergreen tree species known in India since the Vedic period (1500 BC–600 BC). Neem tree is a rich source of limonoids, having a wide spectrum of activity against insect pests and microbial pathogens. Complex tetranortriterpenoids such as azadirachtin, salanin and nimbin are the major active principles isolated from neem seed. Absolutely nothing is known about the biochemical pathways of these metabolites in neem tree. To identify genes and pathways in neem, we sequenced neem genomes and transcriptomes using next generation sequencing technologies. Assembly of Illumina and 454 sequencing reads resulted in 267 Mb, which accounts for 70% of estimated size of neem genome. We predicted 44,495 genes in the neem genome, of which 32,278 genes were expressed in neem tissues. Neem genome consists about 32.5% (87 Mb) of repetitive DNA elements. Neem tree is phylogenetically related to citrus, Citrus sinensis. Comparative analysis anchored 62% (161 Mb) of assembled neem genomic contigs onto citrus chromomes. Ultrahigh performance liquid chromatography-mass spectrometry-selected reaction monitoring (UHPLC-MS/SRM) method was used to quantify azadirachtin, nimbin, and salanin from neem tissues. Weighted Correlation Network Analysis (WCGNA) of expressed genes and metabolites resulted in identification of possible candidate genes involved in azadirachtin biosynthesis pathway. This study provides genomic, transcriptomic and quantity of top three neem metabolites resource, which will accelerate basic research in neem to understand biochemical pathways. PMID:26290780

  9. Insecticidal effect of furanocoumarins from fruits of Angelica archangelica L. against larvae Spodoptera littoralis Boisd

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Vrchotová, Naděžda

    2013-01-01

    Roč. 43, MAY 2013 (2013), s. 33-39 ISSN 0926-6690 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073 Keywords : Angelica archangelica * furanocoumarins * essential oils * plant extracts * spodoptera littoralis * botanical insecticides * insecticidal activity Subject RIV: EH - Ecology, Behaviour Impact factor: 3.208, year: 2013

  10. Neem oil limonoids induces p53-independent apoptosis and autophagy.

    Science.gov (United States)

    Srivastava, Pragya; Yadav, Neelu; Lella, Ravi; Schneider, Andrea; Jones, Anthony; Marlowe, Timothy; Lovett, Gabrielle; O'Loughlin, Kieran; Minderman, Hans; Gogada, Raghu; Chandra, Dhyan

    2012-11-01

    Azadirachta indica, commonly known as neem, has a wide range of medicinal properties. Neem extracts and its purified products have been examined for induction of apoptosis in multiple cancer cell types; however, its underlying mechanisms remain undefined. We show that neem oil (i.e., neem), which contains majority of neem limonoids including azadirachtin, induced apoptotic and autophagic cell death. Gene silencing demonstrated that caspase cascade was initiated by the activation of caspase-9, whereas caspase-8 was also activated late during neem-induced apoptosis. Pretreatment of cancer cells with pan caspase inhibitor, z-VAD inhibited activities of both initiator caspases (e.g., caspase-8 and -9) and executioner caspase-3. Neem induced the release of cytochrome c and apoptosis-inducing factor (AIF) from mitochondria, suggesting the involvement of both caspase-dependent and AIF-mediated apoptosis. p21 deficiency caused an increase in caspase activities at lower doses of neem, whereas p53 deficiency did not modulate neem-induced caspase activation. Additionally, neem treatment resulted in the accumulation of LC3-II in cancer cells, suggesting the involvement of autophagy in neem-induced cancer cell death. Low doses of autophagy inhibitors (i.e., 3-methyladenine and LY294002) did not prevent accumulation of neem-induced LC3-II in cancer cells. Silencing of ATG5 or Beclin-1 further enhanced neem-induced cell death. Phosphoinositide 3-kinase (PI3K) or autophagy inhibitors increased neem-induced caspase-3 activation and inhibition of caspases enhanced neem-induced autophagy. Together, for the first time, we demonstrate that neem induces caspase-dependent and AIF-mediated apoptosis, and autophagy in cancer cells.

  11. Neem oil limonoids induces p53-independent apoptosis and autophagy

    Science.gov (United States)

    Chandra, Dhyan

    2012-01-01

    Azadirachta indica, commonly known as neem, has a wide range of medicinal properties. Neem extracts and its purified products have been examined for induction of apoptosis in multiple cancer cell types; however, its underlying mechanisms remain undefined. We show that neem oil (i.e., neem), which contains majority of neem limonoids including azadirachtin, induced apoptotic and autophagic cell death. Gene silencing demonstrated that caspase cascade was initiated by the activation of caspase-9, whereas caspase-8 was also activated late during neem-induced apoptosis. Pretreatment of cancer cells with pan caspase inhibitor, z-VAD inhibited activities of both initiator caspases (e.g., caspase-8 and -9) and executioner caspase-3. Neem induced the release of cytochrome c and apoptosis-inducing factor (AIF) from mitochondria, suggesting the involvement of both caspase-dependent and AIF-mediated apoptosis. p21 deficiency caused an increase in caspase activities at lower doses of neem, whereas p53 deficiency did not modulate neem-induced caspase activation. Additionally, neem treatment resulted in the accumulation of LC3-II in cancer cells, suggesting the involvement of autophagy in neem-induced cancer cell death. Low doses of autophagy inhibitors (i.e., 3-methyladenine and LY294002) did not prevent accumulation of neem-induced LC3-II in cancer cells. Silencing of ATG5 or Beclin-1 further enhanced neem-induced cell death. Phosphoinositide 3-kinase (PI3K) or autophagy inhibitors increased neem-induced caspase-3 activation and inhibition of caspases enhanced neem-induced autophagy. Together, for the first time, we demonstrate that neem induces caspase-dependent and AIF-mediated apoptosis, and autophagy in cancer cells. PMID:22915764

  12. Efficacy evaluation of a commercial neem cake for control of Haematobia irritans on Nelore cattle Avaliação da eficácia de uma torta comercial de nim para o controle de Haematobia irritans em bovinos Nelore

    Directory of Open Access Journals (Sweden)

    Ana Carolina de Souza Chagas

    2010-12-01

    Full Text Available Much attention has been given to the development of botanical insecticides to provide effective natural control of cattle ectoparasites without harming animals, consumers, and environment. This study evaluated the efficacy of a commercial neem cake in controlling Haematobia irritans infestation on cattle. The study was conducted at the Embrapa Southeast Cattle Research Center (CPPSE, in São Carlos, SP, Brazil, from April to July 2008. The neem cake mixed in mineral salt in a 2% concentration was provided to 20 Nelore cows during nine weeks and had its efficacy evaluated by comparison of the infestation level against a control group. Fly infestations were recorded weekly by digital photographs of each animal from both groups and the number of flies was later counted in a computer-assisted image analyzer. Quantification of neem cake components by high-performance liquid chromatography revealed the presence of azadirachtin (421 mg.kg-1 and 3-tigloyl-azadirachtol (151 mg.kg-1 in the tested neem cake. Addition of the 2% neem cake reduced mineral salt intake in about 22%. The 2% neem cake treatment failed to reduce horn fly infestations on cattle during the 9-week study period.Muita atenção tem sido dada ao desenvolvimento de inseticidas vegetais buscando-se um efetivo controle de ectoparasitas de bovinos, sem prejudicar animais, consumidores e meio ambiente. Este estudo, realizado de abril a julho de 2008, na Embrapa Pecuária Sudeste, em São Carlos, SP, Brasil, avaliou a eficácia de uma torta comercial de nim (Azadirachta indica no controle da mosca-dos-chifres (Haematobia irritans em bovinos. A torta de nim, misturada ao sal mineral na concentração de 2%, foi fornecida a 20 vacas Nelore, durante nove semanas, e sua eficácia foi monitorada através de contagens semanais nos grupos tratado e controle. Infestações individuais foram registradas por meio de fotos digitais em todos os animais de ambos os grupos, e o número de moscas foi

  13. Conifer flavonoid compounds inhibit detoxification enzymes and synergize insecticides.

    Science.gov (United States)

    Wang, Zhiling; Zhao, Zhong; Cheng, Xiaofei; Liu, Suqi; Wei, Qin; Scott, Ian M

    2016-02-01

    Detoxification by glutathione S-transferases (GSTs) and esterases are important mechanisms associated with insecticide resistance. Discovery of novel GST and esterase inhibitors from phytochemicals could provide potential new insecticide synergists. Conifer tree species contain flavonoids, such as taxifolin, that inhibit in vitro GST activity. The objectives were to test the relative effectiveness of taxifolin as an enzyme inhibitor and as an insecticide synergist in combination with the organophosphorous insecticide, Guthion (50% azinphos-methyl), and the botanical insecticide, pyrethrum, using an insecticide-resistant Colorado potato beetle (CPB) Leptinotarsa decemlineata (Say) strain. Both taxifolin and its isomer, quercetin, increased the mortality of 1(st) instar CPB larvae after 48h when combined with Guthion, but not pyrethrum. Taxifolin had greater in vitro esterase inhibition compared with the commonly used esterase inhibitor, S, S, S-tributyl phosphorotrithioate (DEF). An in vivo esterase and GST inhibition effect after ingestion of taxifolin was measured, however DEF caused a greater suppression of esterase activity. This study demonstrated that flavonoid compounds have both in vitro and in vivo esterase inhibition, which is likely responsible for the insecticide synergism observed in insecticide-resistant CPB. Crown Copyright © 2015. Published by Elsevier Inc. All rights reserved.

  14. Neeme Jõgi usub Pan-Balti piimanduskontserni rajamisse / Neeme Jõgi ; interv. Viljar Rääsk

    Index Scriptorium Estoniae

    Jõgi, Neeme

    2008-01-01

    Läti piimatööstuse Rigas Piensaimnieksi juhatuse esimees Neeme Jõgi vastab küsimustele, mis puudutavad ettevõtte olukorda, ülebaltikumilise piimafirma tulekut, ärikultuuri erinevusi Lätis, sisulise austuse saavutamist, tema põhimõtteid äritegevuses, vajadust skaneerimisoskustega juhi järele ning Parexiga juhtunu mõju lätlastele. Lisa: Neeme Jõgi

  15. Comparative role of neem seed extract, moringa leaf extract and imidacloprid in the management of wheat aphids in relation to yield losses in Pakistan.

    Science.gov (United States)

    Shah, Farhan Mahmood; Razaq, Muhammad; Ali, Abid; Han, Peng; Chen, Julian

    2017-01-01

    Wheat being staple food of Pakistan is constantly attacked by major wheat aphid species, Schizaphis graminum (R.), Rhopalosiphum padi (L.) and Sitobion avenae (F.). Due to concern on synthetic chemical use in wheat, it is imperative to search for alternative environment- and human- friendly control measures such as botanical pesticides. In the present study, we evaluated the comparative role of neem seed extract (NSE), moringa leaf extract (MLE) and imidacloprid (I) in the management of the aphid as well as the yield losses parameters in late planted wheat fields. Imidacloprid reduced significantly aphids infestation compared to the other treatments, hence resulting in higher yield, particularly when applied with MLE. The percentages of yield increase in I+MLE treated plots over the control were 19.15-81.89% for grains per spike, 5.33-37.62% for thousand grain weight and 27.59-61.12% for yield kg/ha. NSE was the second most effective control measure in suppressing aphid population, but the yield protected by NSE treatment over the control was comparable to that by imidacloprid. Population densities of coccinellids and syrphids in the plots treated with NSE-2 were higher than those treated with imidacloprid in two out of three experiments during 2013-14. Low predator density in imidacloprid-treated plots was attributed to the lower availability of prey aphids. The efficacy of NSE against aphids varied depending on degree of synchronization among the application timing, the activity of aphids, crop variety and environmental conditions. Despite that, we suggested NSE to be a promising alternative botanical insecticide compared to the most commonly recommended imidiacloprid. Further studies should consider the side effects of biopesticides on non-target organisms in order to provide better management practices in the field.

  16. Proteomic and properties analysis of botanical insecticide rhodojaponin III-induced response of the diamondback moth, Plutella xyllostella (L..

    Directory of Open Access Journals (Sweden)

    Xiaolin Dong

    Full Text Available BACKGROUND: Rhodojaponin III, as a botanical insecticide, affects a wide variety of biological processes in insects, including reduction of feeding, suspension of development, and oviposition deterring of adults in a dose-dependent manner. However, the mode of these actions remains obscure. PRINCIPAL FINDINGS: In this study, a comparative proteomic approach was adopted to examine the effect of rhodojaponin III on the Plutella xyllostella (L.. Following treating 48 hours, newly emergence moths were collected and protein samples were prepared. The proteins were separated by 2-DE, and total 31 proteins were significantly affected by rhodojaponin III compared to the control identified by MALDI-TOF/TOF-MS/MS. These differentially expressed proteins act in the nervous transduction, odorant degradation and metabolic change pathways. Further, gene expression patterns in treated and untreated moths were confirmed by qRT-PCR and western blot analysis. RNAi of the chemosensory protein (PxCSP gene resulted in oviposition significantly increased on cabbage plants treated with rhodojaponin III. CONCLUSIONS: These rhodojaponin III-induced proteins and gene properties analysis would be essential for a better understanding of the potential molecular mechanism of the response to rhodojaponin III from moths of P. xylostella.

  17. Toxic effects of neem products ( Azadirachta indica A. Juss) on ...

    African Journals Online (AJOL)

    Treatment and comparative analysis of the properties of aqueous extracts of seed kernel of Azadirachta indica A. Juss (neem) was carried out on Aedes aegypti larvae. The aim of this work was to evaluate lethal effects of neem products (1% Suneem, formulated neem oil and neem powder) on A. aegypti larvae. Assays ...

  18. neem

    African Journals Online (AJOL)

    29 nov. 2017 ... Chemical fertilizers massively used by the farmers to increase yields have ... The different doses tested with this compost on onion, potato, cabbage, .... Brassica oleracea .... Crop yields (t/ha) according to the doses of neem and cashew .... Effects of compost produced from town wastes and sewage sludge ...

  19. Effect of picung (Pangium edule plant extracts as a botanical pesticide on mortality of coffee berry borer (Hypothenemus hampei

    Directory of Open Access Journals (Sweden)

    soekadar wiryadiputra

    2014-12-01

    Full Text Available Coffee pests known as coffe berry borer (CBB, Hypothenemus hampei were main pests which decreasing the productivity of Indonesian coffee. One of pests controlling was done by insecticides. Generally, plant uses for insecticide show high security level, because the breaking molecule was easy as not dangerous compound. Pangium edule contains of flavanoide, cyanide acid and saponin had potential as an botanical insecticide. The purpose of this research was to prove the potential extract of seed and leaves of picung (Pangium edule as an botanical insecticide for CBB. This research used a complete random design. There were 8 treatments with the concentration of the extract from leaves and seed of picung, one positive control treatment (Carbaril 0,02% formulation and one negative control treatment (aquades. The treatment was repeated four times and carried out observation on every day until six days. The concentrations leaf and seed extracts were 1.0%, 2.5% and 5.0%. The result of the research show that between concentration applied the were no significant different and at observation six days after application the mortality of CBB only around 35 -40% on both extracts (ewater and methanol. The result of the research also show that there were no real differentiation between leaves and seed of picung. LT-50 values were 1.25% and 0.96%, for leaves and seed extract in water for six day observation. From this observation could be concluded that picung tree (Pangium edule is not effective in the controlling CBB in the interval concentration applied and extraction method used. Key words: Botanical pesticide, picung tree, Pangium edule, mortality, Hypothenemus hampei, water extraction, methanol extraction.

  20. Azadirachta indica (Neem) Seed Extracts: A Supplement for Culture ...

    African Journals Online (AJOL)

    The effectiveness of Neem seed extracts (Azadirachta indica A. Juss) was tested against Aspergillus niger isolated from soil to determine whether the neem seed extracts will inhibit or enhance the growth of Aspergillus niger . Three different concentrations of neem seed extracts were prepared 10%, 20% and 50%.

  1. Neem components as potential agents for cancer prevention and treatment

    Science.gov (United States)

    Hao, Fang; Kumar, Sandeep; Yadav, Neelu; Chandra, Dhyan

    2016-01-01

    Azadirachta indica, also known as neem, is commonly found in many semi-tropical and tropical countries including India, Pakistan, and Bangladesh. The components extracted from neem plant have been used in traditional medicine for the cure of multiple diseases including cancer for centuries. The extracts of seeds, leaves, flowers, and fruits of neem have consistently shown chemopreventive and antitumor effects in different types of cancer. Azadirachtin and nimbolide are among the few bioactive components in neem that have been studied extensively, but research on a great number of additional bioactive components is warranted. The key anticancer effects of neem components on malignant cells include inhibition of cell proliferation, induction of cell death, suppression of cancer angiogenesis, restoration of cellular reduction/oxidation (redox) balance, and enhancement of the host immune responses against tumor cells. While the underlying mechanisms of these effects are mostly unclear, the suppression of NF-κB signaling pathway is, at least partially, involved in the anticancer functions of neem components. Importantly, the anti-proliferative and apoptosis-inducing effects of neem components are tumor selective as the effects on normal cells are significantly weaker. In addition, neem extracts sensitize cancer cells to immunotherapy and radiotherapy, and enhance the efficacy of certain cancer chemotherapeutic agents. This review summarizes the current updates on the anticancer effects of neem components and their possible impact on managing cancer incidence and treatment. PMID:25016141

  2. Atividade de extrato aquoso de folhas de nim (Azadirachta indica sobre Spodoptera frugiperda Activity of neem tree (Azadirachta indica leaves aqueous extract on Spodoptera frugiperda

    Directory of Open Access Journals (Sweden)

    Hélio Teixeira Prates

    2003-03-01

    Full Text Available A lagarta-do-cartucho do milho (Spodoptera frugiperda (J. E. Smith tem sido controlada com inseticidas sintéticos. Uma das caracteristicas do nim (Azadirachta indica A. Juss é sua atividade inseticida contra pragas, como sucedâneo aos sintéticos. O objetivo deste trabalho foi avaliar a atividade inseticida do extrato aquoso das folhas do nim sobre a lagarta-do-cartucho do milho, em laboratório. Bioensaios com diferentes concentrações de extrato em dieta artificial, tendo o inseticida chlorpyrifos como testemunha, revelaram, 15 dias após infestação com larvas, eficiência equivalente entre as concen- trações 3,60 a 10,00 mg mL-1. A análise de Probit mostrou CL50 = 2,67 mg mL-1; o extrato aquoso das folhas de nim apresenta, portanto, efeito inseticida sobre a lagarta-do-cartucho do milho.The fall armyworm (Spodoptera frugiperda (J. E. Smith has been controlled with synthetic insecticides bringing risk to the environment. Neem (Azadirachta indica A. Juss is reported to be a natural alternative to synthetic insecticides against many insect species. The objective of this work was to evaluate the activity of neem leaves aqueous extract on fall armyworm, in laboratory. Bioassays carried out using artificial feed with various extract concentrations, and chlorpyrifos as control, indicated, 15 days after larvae infestation, similar efficiency in concentrations from 3.60 to 10.00 mg mL-1. Probit analysis showed LC50 = 2.67 mg mL-1. Hence, aqueous extract from neem leaves are active against fall armyworm.

  3. Elemental contents in leaves and bark of neem (Azadirachta Indica) - a versatile medicinal plant by neutron activation analysis

    International Nuclear Information System (INIS)

    Garg, A.N.; Verma, Kavita; Choudhury, R.P.; Reddy, A.V.R.

    2010-01-01

    Full text: Azadirachta Indica, commonly known as neem touches the daily life of every Indian as all of its parts are widely used. Neem leaves are used as insecticide and antiseptic whereas its extracts and oil are clinically effective in curing eczema and other skin diseases. Fresh leaves and bark of Neem (Azadirachta Indica) collected from different locations in Roorkee were analyzed for 7 minor (Al, Ca, CI, K, Mg, Na and P) and 15 trace (As, Ba, Br, Co, Cr, Cs, Fe, Hg, Mn, Rb, Sb, Sm, Th, V and Zn) elements by short (1 min) and long (7 h) neutron irradiation neutron followed by high resolution γ-ray spectrometry. Also Ni, Cu, Cd and Pb were determined using atomic absorption spectrophotometry (AAS). P was determined by counting the β-activity from 32 P using an end-window GM counter. Peach leaves (SRM 1547) from NIST, USA and Mixed Polish Herbs (MPH-2) from INCT, Poland were analyzed for data validation. Most elemental contents varied in a wide range. However, mean and median values in most cases are comparable. Elemental contents of V, Cr, Mn, Fe and Zn in leaves have been particularly attributed to its use in the treatment of diabetes. Linear correlations were observed between K and CI (r =0.96) and Rb and Cs (r = 0.97) in Neem leaves. Leaves were particularly enriched in K, Mg, Zn and Rb whereas bark was enriched in Ca, Mn and Fe. Petroleum ether extract of dried Neem leaves was analyzed for organic constituents; 1,1,2,3-tetramethyl cyclopropane, methyl phenyl sulfone, n-hexanedecanoic acid and 9,12,15-octadecatrienal in soluble fraction and bicyclo octa 1,3,5 triene 7-(3-butenyl) and 2-hydroxymethyl 1-methoxy 9,10 anthracenediene in insoluble fraction. Compounds were separated by column and thin layer chromatography and identified by gas chromatography-mass spectrometry (GC-MS)

  4. Control of coffee berry borer, Hypothenemus hampei (Ferrari (Coleoptera: Curculionidae: Scolytinae with botanical insecticides and mineral oils

    Directory of Open Access Journals (Sweden)

    Flávio Neves Celestino

    2016-01-01

    Full Text Available The objective of this study was to evaluate botanical oils, mineral oils and an insecticide that contained azadirachtin (ICA for the control of Hypothenemus hampei, in addition to the effects of residual castor oil. We evaluated the effectiveness of the vegetable oils of canola, sunflower, corn, soybean and castor, two mineral oils (assist® and naturol®, and the ICA for the control of H. hampei. The compounds were tested at a concentration of 3.0% (v v-1. The median lethal concentration (LC50 was estimated with Probit analysis. The oil of castor bean and extract of castor bean cake were also evaluated at concentrations of 3.0% (v v-1 and 3.0% (m v-1, respectively. The mortality rates for H. hampei caused by the ICA and the castor oil were 40.8 and 53.7%, with LC50 values of 6.71 and 3.49% (v v-1, respectively. In the castor oil, the methyl esters of the fatty acids were palmitic (1.10%, linoleic (4.50%, oleic (4.02%, stearic (0.50% and ricinoleic acids (88.04%. The extract of the castor bean cake was not toxic to H. hampei. The persistence of the castor oil in the environment was low, and the cause of mortality for H. hampei was most likely the blockage of the spiracles, which prevented the insects from breathing.

  5. Neeme Külm in abstract autarchic ambience / Johannes Saar

    Index Scriptorium Estoniae

    Saar, Johannes, 1965-

    2013-01-01

    Neeme Külma ruumiinstallatsioonidest. Neeme Külma isikunäitus "Pinnavirvendus" ("Shimmer on the Surface") Hobusepea galeriis 11.-24.04.2012. Näituse eest pälvis kunstnik Eesti Kultuurkapitali kujutava ja rakenduskunsti sihtkapitali 2012. aasta aastapreemia. Neeme Külma ja Krista Möldri näitus "Kohalolu" ("Being Present") Tallinna Kunstihoone galeriis 30.11.-28.12.2012

  6. by fermented plant extracts of neem leaf and wild garlic

    African Journals Online (AJOL)

    Bombiti

    1Department of Soil Science, Plant Production and Agricultural Engineering, Faculty of Science and Agriculture,. University of ... Additionally, due to frequent use of .... Average number of whitefly adults as affected by fermented plant extracts of garlic, neem and garlic + neem (CarNeem) at five sampling intervals. Application.

  7. Antifeedant and insecticidal activity of Polygonum persicaria extracts on Nomophila indistinctalis

    Directory of Open Access Journals (Sweden)

    Luisa Quesada-Romero

    2017-05-01

    Full Text Available Context: Vegetal extracts represent an alternative to control against agricultural pests that have become resistant to pesticides. Using natural products is considered to be more friendly to the environment and safe. Aims: To determine the insecticidal and antifeedant activity of Polygonum persicaria extracts of two differents populations in Chile (Valparaiso and Curico against Nomophila indistinctalis larvae. Methods: Insecticide Resistance Action Committee (IRAC susceptibility test was used to evaluate the insecticidal activity of the extracts at concentrations of 100, 250, 500 and 1000 mg/L; against first instar larvae of Nomophila indistinctalis. The antifeedant activity was evaluated to determine the percentage of consumption in third instar larvae on treatment. Results: When comparing the control and the treatment groups in the antifeedant activity assay, significant differences (p<0.05 were observed after 90 minutes of exposure. With respect to the insecticidal activity, all extracts showed significant effects at the applied concentrations compared to the negative control. Moreover, the dichloromethane extracts of Curico and Valparaiso at concentrations greater than 500 mg/L showed a similar insecticidal activity as compared to the commercial formulation Neem. Conclusions: This work presents for the first time the results of the anti-feeding and insecticide activity of ethanol, methanol, and dichloromethane extracts from Polygonum persicaria on Nomophila indistinctalis. The results show that the extracts of this species can be used as an alternative for biological control. In addition, the results obtained allow a bioguided fractionation for the identification of secondary metabolites present in these extracts.

  8. Effect of Neem Seed Husk Ash on Concrete Strength Properties ...

    African Journals Online (AJOL)

    Neem Seed Husk is a by-product obtained during industrial processing of Neem Seed to extract oil and produce fertilizer. Laboratory tests on Neem seed husk ash (NSHA) mixed with cement were conducted to find its effect on concrete strength and workability. Tests including slump test, compressive strength test, concrete ...

  9. Medicinal properties of fractionated acetone/water neem ...

    African Journals Online (AJOL)

    The global scenario is now supporting the development of modern drugs from less toxic plant products with proven medicinal properties. Each part of neem plant (Azadirachta indica A. Juss) reportedly has various medicinal properties and has been in use in many continents for centuries. Recently, a fractionated neem-leaf ...

  10. A review of neem biopesticide utilization and challenges in Central ...

    African Journals Online (AJOL)

    The status of neem biopesticide research, utilization and challenges in the central part of northern Nigeria was reviewed. In the sampled areas such as the Federal Capital Territory (FCT), Abuja and Niger State, the highest category of neem users (17.19%) were the rural farmers. Majority of the neem users obtained their ...

  11. Effect of pest controlling neem and mata-raton leaf extracts on greenhouse gas emissions from urea-amended soil cultivated with beans: A greenhouse experiment

    International Nuclear Information System (INIS)

    Mendez-Bautista, Joaquin; Fernandez-Luqueno, Fabian; Lopez-Valdez, Fernando; Mendoza-Cristino, Reyna; Montes-Molina, Joaquin A.; Gutierrez-Miceli, Federico A.; Dendooven, L.

    2010-01-01

    In a previous laboratory experiment, extracts of neem (Azadirachta indica A. Juss.) and Gliricidia sepium Jacquin, locally known as mata-raton, used to control pests on crops, inhibited emissions of CO 2 from a urea-amended soil, but not nitrification and N 2 O emissions. We investigated if these extracts when applied to beans (Phaseolus vulgaris L.) affected their development, soil characteristics and emissions of carbon dioxide (CO 2 ) and nitrous oxide (N 2 O) in a greenhouse environment. Untreated beans and beans planted with lambda-cyhalothrin, a commercial insecticide, served as controls. After 117 days, shoots of plants cultivated in soil amended with urea or treated with lambda-cyhalothrin, or extracts of neem or G. sepium were significantly higher than when cultivated in the unamended soil, while the roots were significantly longer when plants were amended with urea or treated with leaf extracts of neem or G. sepium than when treated with lambda-cyhalothrin. The number of pods, fresh and dry pod weight and seed yield was significantly higher when bean plants were treated with leaf extracts of neem or G. sepium treatments than when left untreated and unfertilized. The number of seeds was similar for the different treatments. The number of nodules was lower in plants fertilized with urea, treated with leaf extracts of neem or G. sepium, or with lambda-cyhalothrin compared to the unfertilized plants. The concentrations of NH 4 + , NO 2 - and NO 3 - decreased significantly over time with the lowest concentrations generally found at harvest. Treatment had no significant effect on the concentrations of NH 4 + and NO 2 - , but the concentration of NO 3 - was significantly lower in the unfertilized soil compared to the other treatments. It was found that applying extracts of neem or G. sepium leaves to beans favored their development when compared to untreated plants, but had no significant effect on nitrification in soil.

  12. Effect of pest controlling neem and mata-raton leaf extracts on greenhouse gas emissions from urea-amended soil cultivated with beans: A greenhouse experiment

    Energy Technology Data Exchange (ETDEWEB)

    Mendez-Bautista, Joaquin [Laboratory of Soil Ecology, Cinvestav, Mexico D.F. (Mexico); Fernandez-Luqueno, Fabian [Laboratory of Soil Ecology, Cinvestav, Mexico D.F. (Mexico); Department of Electromechanics, Renewable Energy Engineering, UTTulancingo, Hidalgo (Mexico); Lopez-Valdez, Fernando [Laboratory of Soil Ecology, Cinvestav, Mexico D.F. (Mexico); C.I.B.A.-I.P.N., Tepetitla de Lardizabal, Tlaxcala (Mexico); Mendoza-Cristino, Reyna [Laboratory of Soil Ecology, Cinvestav, Mexico D.F. (Mexico); Montes-Molina, Joaquin A.; Gutierrez-Miceli, Federico A. [Laboratorio de Biotecnologia Vegetal, Instituto Tecnologico de Tuxtla-Gutierrez, Tuxtla-Gutierrez (Mexico); Dendooven, L., E-mail: dendoove@cinvestav.mx [Laboratory of Soil Ecology, Cinvestav, Mexico D.F. (Mexico)

    2010-10-01

    In a previous laboratory experiment, extracts of neem (Azadirachta indica A. Juss.) and Gliricidia sepium Jacquin, locally known as mata-raton, used to control pests on crops, inhibited emissions of CO{sub 2} from a urea-amended soil, but not nitrification and N{sub 2}O emissions. We investigated if these extracts when applied to beans (Phaseolus vulgaris L.) affected their development, soil characteristics and emissions of carbon dioxide (CO{sub 2}) and nitrous oxide (N{sub 2}O) in a greenhouse environment. Untreated beans and beans planted with lambda-cyhalothrin, a commercial insecticide, served as controls. After 117 days, shoots of plants cultivated in soil amended with urea or treated with lambda-cyhalothrin, or extracts of neem or G. sepium were significantly higher than when cultivated in the unamended soil, while the roots were significantly longer when plants were amended with urea or treated with leaf extracts of neem or G. sepium than when treated with lambda-cyhalothrin. The number of pods, fresh and dry pod weight and seed yield was significantly higher when bean plants were treated with leaf extracts of neem or G. sepium treatments than when left untreated and unfertilized. The number of seeds was similar for the different treatments. The number of nodules was lower in plants fertilized with urea, treated with leaf extracts of neem or G. sepium, or with lambda-cyhalothrin compared to the unfertilized plants. The concentrations of NH{sub 4}{sup +}, NO{sub 2}{sup -} and NO{sub 3}{sup -} decreased significantly over time with the lowest concentrations generally found at harvest. Treatment had no significant effect on the concentrations of NH{sub 4}{sup +} and NO{sub 2}{sup -}, but the concentration of NO{sub 3}{sup -} was significantly lower in the unfertilized soil compared to the other treatments. It was found that applying extracts of neem or G. sepium leaves to beans favored their development when compared to untreated plants, but had no significant

  13. Analysis of neem oils by LC-MS and degradation kinetics of azadirachtin-A in a controlled environment. Characterization of degradation products by HPLC-MS-MS.

    Science.gov (United States)

    Barrek, Sami; Paisse, Olivier; Grenier-Loustalot, Marie-Florence

    2004-02-01

    Since it was first isolated, the oil extracted from seeds of neem (Azadirachtin indica A juss) has been extensively studied in terms of its efficacy as an insecticide. Several industrial formulations are produced as emulsifiable solutions containing a stated titer of the active ingredient azadirachtin-A (AZ-A). The work reported here is the characterization of a formulation of this insecticide marketed under the name of Neem-azal T/S and kinetic studies of the major active ingredient of this formulation. We initially performed liquid-liquid extraction to isolate the neem oil from other ingredients in the commercial mixture. This was followed by a purification using flash chromatography and semi-preparative chromatography, leading to (13)C NMR identification of structures such as azadirachtin-A, azadirachtin-B, and azadirachtin-H. The neem extract was also characterized by HPLC-MS using two ionization sources, APCI (atmospheric pressure chemical ionization) and ESI (electrospray ionization) in positive and negative ion modes of detection. This led to the identification of other compounds present in the extract-azadirachtin-D, azadirachtin-I, deacetylnimbin, deacetylsalannin, nimbin, and salannin. The comparative study of data gathered by use of the two ionization sources is discussed and shows that the ESI source enables the largest number of structures to be identified. In a second part, kinetic changes in the main product (AZ-A) were studied under precise conditions of pH (2, 4, 6, and 8), temperature (40 to 70 degrees C), and light (UV, dark room and in daylight). This enabled us to determine the degradation kinetics of the product (AZ-A) over time. The activation energy of the molecule (75+/-9 kJ mol(-1)) was determined by examining thermal stability in the range 40 to 70 degrees C. The degradation products of this compound were identified by use of HPLC-MS and HPLC-MS-MS. The results enabled proposal of a chemical degradation reaction route for AZ-A under

  14. Pemanfaatan Azadirachtin dari Mimba (Azadirachta Indica A. Juss) untuk Sediaan Anti Semut

    OpenAIRE

    Hartanto, Eddy Sapto; Hutajulu, Tiurlan Farida

    2014-01-01

    Nowadays, the use of natural plant source insecticides is one of the best choice due to its characteristic, which is safer and easily degradable by nature (biodegradable) compared to synthetic materials. One of plant sources which consists of active components for insecticides is neem plant. The extraction of seed (a1) and leaf of neem (a2) produce neem's active compound was conducted by using Effective Microorganism. The efficacy test of the neem seed and leaf was conducted by using extra...

  15. 750-IJBCS-Article-Dr Danho Mathias

    African Journals Online (AJOL)

    DR GATSING

    des extraits de feuilles et de graines de neem (Azadirachta indica) sur le ... insecticide homologué à base de cartap, six traitements avec trois différentes ...... Effects of different neem preparations in comparison to synthetic insecticides on.

  16. Azadirachtin induced larval avoidance and antifeeding by disruption of food intake and digestive enzymes in Drosophila melanogaster (Diptera: Drosophilidae).

    Science.gov (United States)

    Bezzar-Bendjazia, Radia; Kilani-Morakchi, Samira; Maroua, Ferdenache; Aribi, Nadia

    2017-11-01

    Botanical insecticides are a promising alternative to reduce the harmful effects of synthetic chemicals. Among the botanical biopesticides, azadirachtin obtained from the Indian neem tree Azadirachta indica A. Juss. (Meliaceae) is probably the biorational insecticide with greatest agriculture use nowadays due to its broad insecticide activity. The current study, evaluated the lethal and sublethal effects of azadirachtin on larval avoidance, food intake and digestive enzymes of Drosophila melanogaster larvae as biological model. Azadirachtin was applied topically at two doses LD 25 (0.28μg) and LD 50 (0.67μg) on early third instars larvae. Results evaluated 24h after treatment showed that larvae exhibited significant repellence to azadirachtin and prefer keeping in untreated arenas rather than moving to treated one. In addition, azadirachtin avoidance was more marked in larvae previously treated with this compound as compared with naïf larvae (controls). Moreover, azadirachtin treatment decreased significantly the amount of larval food intake. Finally, azadirachtin reduced significantly the activity of larval α-amylase, chitinase and protease and increased the activity of lipase. This finding showed that azadirachtin induced behavioral and physiological disruption affecting the ability of the insect to digest food. This rapid installation of avoidance and long term antifeedancy might reinforce the action of azadirachtin and provide a new behavioral strategy for integrated pest management programs. Copyright © 2017 Elsevier Inc. All rights reserved.

  17. The use of Neem biomass for the biosorption of zinc from aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Arshad, Mamoona [Department of Chemistry, University of Agriculture, Faisalabad 38040 (Pakistan); Bioprocess Technology Division, National Institute for Biotechnology and Genetic Engineering (NIBGE), P.O. Box 577, Faisalabad (Pakistan); Zafar, Muhammad Nadeem [Department of Chemistry, University of Agriculture, Faisalabad 38040 (Pakistan); Department of Analytical Chemistry, Lund University, P.O. Box 124, SE-221 00 Lund (Sweden)], E-mail: MNadeem.Zafar@analykem.lu.se; Younis, Sadaf; Nadeem, Raziya [Department of Chemistry, University of Agriculture, Faisalabad 38040 (Pakistan)

    2008-09-15

    An adsorbent was developed from mature leaves and stem bark of the Neem (Azadirachta indica) tree for removing zinc from water. Adsorption was carried out in a batch process with several different concentrations of zinc by varying pH. The uptake of metal was very fast initially, but gradually slowed down indicating penetration into the interior of the adsorbent particles. The data showed that optimum pH for efficient biosorption of zinc by Neem leaves and stem bark was 4 and 5, respectively. The maximum adsorption capacity showed that the Neem biomass had a mass capacity for zinc (147.08 mg Zn/g for Neem leaves and 137.67 mg Zn/g Neem bark). The experimental results were analyzed in terms of Langmuir and Freundlich isotherms. The adsorption followed pseudo-second-order kinetic model. The thermodynamic assessment of the metal ion-Neem tree biomass system indicated the feasibility and spontaneous nature of the process and {delta}G{sup o} values were evaluated as ranging from -26.84 to -32.75 (Neem leaves) kJ/mol and -26.04 to -29.50 (Neem bark) kJ/mol for zinc biosorption. Due to its outstanding zinc uptake capacity, the Neem tree was proved to be an excellent biomaterial for accumulating zinc from aqueous solutions.

  18. Botanical insecticides on Liriomyza huidobrensis Blanchard (Diptera: Agromyzidae and its parasitoids in string beans cultivated in a plastic greenhouse

    Directory of Open Access Journals (Sweden)

    Sônia Thereza Bastos Dequech

    2010-06-01

    Full Text Available The string bean (Phaseolus vulgaris L. is Sul. Liriomyza huidobrensis (Dip.: Agromyzidae is one of the most important insect pests occurring in this culture. This research was conducted to evaluate the effect of aqueous extracts of plants and the commercial product DalNeem on L. huidobrensis and its parasitoids, as well as to analyse the population fluctuation of L. huidobrensis and parasitoids of this insect pest. The experiment was carried out on string beans cultivated in a greenhouse, where in each of the four central lines of culture, five plots were established with five plants per plot. The experimental design was random blocks with four replications. DalNeem was the treatment that best controlled L. huidobrensis. On the other hand, the treatments did not affect the parasitoids Chrysocharis bedius (Hym.: Eulophidae or Opius sp. (Hym.: Braconidae. In plants without the use of these treatments, the population of L. huidobrensis exhibited a sharp decline with the increase of the parasitoids C. bedius, Opius sp., Eucoilinae (Hym.: Figitidae and Diptera.

  19. In vitro clonal propagation of the neem tree ( Azadirachta indica A ...

    African Journals Online (AJOL)

    In vitro clonal propagation of the neem tree (Azadirachta indica A. Juss.) M Shahin-uz-zaman, M Ashrafuzzaman, MS Haque, LN Luna. Abstract. A study was conducted with root and shoot tip explants of neem to develop an efficient protocol of regeneration. Shoot tips and root tips from 10 - 20 days old seedlings of neem ...

  20. Systems of organic farming in spring vetch II: Biological response of Aeolothrips intermedius Bagnall and Coccinella septempunctata L.

    Directory of Open Access Journals (Sweden)

    Ivelina Nikolova

    2015-09-01

    Full Text Available The effects of four systems of organic farming of spring vetsch on Aeolothrips intermedius Bagnall (Thysanoptera: Aeolothripidae and Coccinella septempunctata L. (Coleoptera: Coccinellidae population density and the toxicity of several products on predatory insects were studied. The variants were: Control (without using any biological products; combined treatment with Polyversum (biological foliar fertilizer and Biofa (biological plant growth regulator; treatment with NeemAzal T/S (biological insecticide, a.i. azadirachtin and treatment with a combination of NeemAzal with Polyversum and Biofa. Variant V was a conventional farming system in which a combination of Nurelle D (synthetic insecticide, Masterblend (foliar fertilizer and Flordimex 420 (growth regulator was used as a standard treatment. In the organic farming system that included treatment of plants with the biological insecticide NeemAzal (azadirachtin, the reduction in A. intermedius abundance was 20.7% when it was applied alone and 24.6 % in combination with the organic products Polyversum and Biofa. NeemAzal achieved a lower reduction in the counts of predatory ladybirds C. septempunctata, from 14.9% (alone to 21.9% (combination. The biological insecticide, applied alone or in combination, was mostly harmless and rarely harmful to A. intermedius. NeemAzal manifested harmlessness to C. septempunctata as its toxic action did not exceed 25%. An analysis of variance regarding product toxicity to A. intermedius and C. septempunctata demonstrated that the type of treatment (the application of insecticides alone or in combination had the strongest effect on product toxicity. Тhe use of neem-based insecticides can be a substantial contribution towards preservation of biodiversity in ecosystems.

  1. Mechanism of neem limonoids-induced cell death in cancer: Role of oxidative phosphorylation.

    Science.gov (United States)

    Yadav, Neelu; Kumar, Sandeep; Kumar, Rahul; Srivastava, Pragya; Sun, Leimin; Rapali, Peter; Marlowe, Timothy; Schneider, Andrea; Inigo, Joseph R; O'Malley, Jordan; Londonkar, Ramesh; Gogada, Raghu; Chaudhary, Ajay K; Yadava, Nagendra; Chandra, Dhyan

    2016-01-01

    We have previously reported that neem limonoids (neem) induce multiple cancer cell death pathways. Here we dissect the underlying mechanisms of neem-induced apoptotic cell death in cancer. We observed that neem-induced caspase activation does not require Bax/Bak channel-mediated mitochondrial outer membrane permeabilization, permeability transition pore, and mitochondrial fragmentation. Neem enhanced mitochondrial DNA and mitochondrial biomass. While oxidative phosphorylation (OXPHOS) Complex-I activity was decreased, the activities of other OXPHOS complexes including Complex-II and -IV were unaltered. Increased reactive oxygen species (ROS) levels were associated with an increase in mitochondrial biomass and apoptosis upon neem exposure. Complex-I deficiency due to the loss of Ndufa1-encoded MWFE protein inhibited neem-induced caspase activation and apoptosis, but cell death induction was enhanced. Complex II-deficiency due to the loss of succinate dehydrogenase complex subunit C (SDHC) robustly decreased caspase activation, apoptosis, and cell death. Additionally, the ablation of Complexes-I, -III, -IV, and -V together did not inhibit caspase activation. Together, we demonstrate that neem limonoids target OXPHOS system to induce cancer cell death, which does not require upregulation or activation of proapoptotic Bcl-2 family proteins. Copyright © 2015 Elsevier Inc. All rights reserved.

  2. Morphology of the alimentary canal of Spodoptera frugiperda (J E Smith) larvae (Lepidoptera: Noctuidae) fed on neem-treated leaves; Morfologia do canal alimentar de lagartas de Spodoptera frugiperda (J E Smith) (Lepidoptera: Noctuidae) alimentadas com folhas tratadas com nim

    Energy Technology Data Exchange (ETDEWEB)

    Correia, Alicely A.; Wanderley-Teixeira, Valeria; Oliveira, Jose V. de; Torres, Jorge B. [Universidade Federal Rural de Pernambuco (UFRPE), Recife, PE (Brazil). Programa de Pos-Graduacao em Entomologia Agricola]. E-mail: aliceliac@yahoo.com.br; valeria@dmfa.ufrpe.br; Teixeira, Alvaro A.C. [Universidade Federal Rural de Pernambuco (UFRPE), Recife, PE (Brazil). Dept. de Morfologia e Fisiologia Animal

    2009-01-15

    Research involving plants with insecticide activity evolved significantly in the last decades. Among these plants, the neem tree, Azadirachta indica, is commonly used against several insects, mainly Lepidoptera. The neem efficiency depends on the target insect and on the concentration used. A barrier against potential toxic agents ingested together with the food is the alimentary canal. Thus, this research aimed to describe the histology of the alimentary canal of Spodoptera frugiperda (J E Smith) larvae fed on leaves treated with neem (Neemseto{sup R}) at a concentration of 0.5% and 1.0% and non treated, at different intervals (48, 96, 144, 192 and 240 h), by quantifying the regenerative cells and analyzing the secretion of the mesenteron histochemically. Larvae were immobilized at low temperatures (-4 deg C), the alimentary canal was removed, fixed in Bouein's aqueous, embedded in paraplast and historesin, sectioned and stained with hematoxylin-eosin and periodic acid- Schiff. The histology of the alimentary canal of S. frugiperda was similar to other lepidopterans. Neem effects on morphology were seen only in the mesenteron, depending on the time and concentration used, such as: epithelium, reduction on regenerative cells and on the secretory activity in this region, confirmed by the histochemistry in both neem concentrations. These alterations were observed after 96 h at 1.0%, and 144 h at 0.5%. These results indicate that neem (Neemseto{sup R}), at the concentrations studied, may be effective to control S. frugiperda because it promotes meaningful morphological alterations in the mesenteron. (author)

  3. Effect of stacking sequence on mechanical properties neem wood veneer plastic composites

    Science.gov (United States)

    Nagamadhu, M.; Kumar, G. C. Mohan; Jeyaraj, P.

    2018-04-01

    This study investigates the effect of wood veneer stacking sequence on mechanical properties of neem wood polymer composite (WPC) experimentally. Wood laminated samples were fabricated by conventional hand layup technique in a mold and cured under pressure at room temperature and then post cured at elevated temperature. Initially, the tensile, flexural, and impact test were conducted to understand the effect of weight fraction of fiber on mechanical properties. The mechanical properties have increased with the weight fraction of fiber. Moreover the stacking sequence of neem wood plays an important role. As it has a significant impact on the mechanical properties. The results indicated that 0°/0° WPC shows highest mechanical properties as compared to other sequences (90°/90°, 0°/90°, 45°/90°, 45°/45°). The Fourier Transform Infrared Spectroscopy (FTIR) Analysis were carried out to identify chemical compounds both in raw neem wood and neem wood epoxy composite. The microstructure raw/neat neem wood and the interfacial bonding characteristics of neem wood composite investigated using Scanning electron microscopy images.

  4. Use of Lignins from Sugarcane Bagasse for Assembling Microparticles Loaded with Azadirachta indica Extracts for Use as Neem-Based Organic Insecticides

    OpenAIRE

    Costa, Eveline S.; Perlatti, Bruno; Silva, Everton M. da; Matos, Andreia P.; Silva, Maria Fátima G. F. da; Fernandes, João B.; Zuin, Vânia G.; Silva, Caio M. P. da; Forim, Moacir R.

    2017-01-01

    Microcapsules of sugarcane bagasse lignin loaded with organic extracts of neem (Azadirachta indica) were prepared and evaluated as potential bioinsecticides. Lignins were extracted and modified by oxidation and acetylation reactions providing different biopolymers. Afterwards, they were characterized through several analytical techniques. The formulations were initially prepared as colloidal suspension of lignin nanoparticles, which were then spray-dried. The products were submitted to qualit...

  5. [In vitro insecticidal activity of seed neem oil on Lutzomyia longipalpis (Diptera: Psychodidae)].

    Science.gov (United States)

    Maciel, Michelline V; Morais, Selene M; Bevilaqua, Claudia M L; Silva, Rafaella A; Barros, Renata S; Sousa, Raimundo N; Sousa, Lindemberg C; Machado, Lyeghyna K A; Brito, Edy S; Souza-Neto, Manoel A

    2010-01-01

    Lutzomyia longipalpis is the main vector of visceral leishmaniasis in Brazil. The objective was to evaluate the effect of oil from (Azadirachta indica) neem seeds on eggs, larvae and adults of the vector. The insects were captured in the field and kept in the laboratory at +/- 27 °C and 80% relative humidity. Five treatments with different concentrations were performed using two negative controls (distilled water and Tween 80) and a positive control. The eggs were sprayed with the oil at different concentrations and the number of hatched larvae evaluated for 10 days. Mortality of larvae was observed to pupation and adult mortality was observed after 24, 48, and 72 hours. Statistical analysis was performed by Tukey test at 5% probability. The highest oil concentration of eggs obtained 65.16 +/- 3.24% efficacy for reducing egg hatching. The test with larvae showed 67.75 +/- 2.21% efficacy at a concentration of 100 mg.mL⁻¹. In adults, the efficacy of the 100 mg.mL⁻¹ concentration was 96.64 +/- 4.11% after 24 hours. The phytochemical analysis revealed the presence of triterpenes. These results demonstrate the potential use of this oil in the control of this vector.

  6. Botanical insecticides on Liriomyza huidobrensis Blanchard (Diptera: Agromyzidae and its parasitoids in string beans cultivated in a plastic greenhouse

    Directory of Open Access Journals (Sweden)

    Sônia Thereza Bastos Dequech

    2010-04-01

    Full Text Available The string bean (Phaseolus vulgaris L. is one of the most cultivated vegetables in plastic greenhouses in the central region of the state of Rio Grande do Sul. Liriomyza huidobrensis (Dip.: Agromyzidae is one of the most important insect pests occurring in this culture. This research was conducted to evaluate the effect of aqueous extracts of plants and the commercial product DalNeem on L. huidobrensis and its parasitoids, as well as to analyse the population fluctuation of L. huidobrensis and parasitoids of this insect pest. The experiment was carried out on string beans cultivated in a greenhouse, where in each of the four central lines of culture, five plots were established with five plants per plot. The experimental design was random blocks with four replications. DalNeem was the treatment that best controlled L. huidobrensis. On the other hand, the treatments did not affect the parasitoids Chrysocharis bedius (Hym.: Eulophidae or Opius sp. (Hym.: Braconidae. In plants without the use of these treatments, the population of L. huidobrensis exhibited a sharp decline with the increase of the parasitoids C. bedius, Opius sp., Eucoilinae (Hym.: Figitidae and Diptera.

  7. Assessment of biofuel potential of dead neem leaves ( Azadirachta ...

    African Journals Online (AJOL)

    Unfortunately, the lack of information on the biomass and energy potentials of these wastes empedes any initiative for its industrial biomethanization. This study was investigated with the aim of evaluating the biofuel potentials of dead neem leaves in Maroua town. The number of neem trees, as well as biomass produced by ...

  8. Neem ( Azadirachta indica a. Juss) fruit yield determination in ...

    African Journals Online (AJOL)

    This study determined fruit yield of Neem (Azadirachta indica A. Juss) in the guinea savanna of Nigeria at Makurdi. Fifteen mature neem trees which had no overlapping canopies and had not been previously pruned were purposively selected out of 207 stands growing at the study site. All ripped fruits felling from the ...

  9. In vitro evaluation of the effect of botanical formulations used in the control of Aedes aegypti L. (Diptera: Culicidae) on liver enzymes.

    Science.gov (United States)

    Porto, Karla Rejane de Andrade; Motti, Priscilla Rezende; Machado, Alexandre Alves; Roel, Antonia Railda

    2016-01-01

    Dengue fever is a viral disease transmitted by the Aedes aegypti Linn. (1792) (Diptera: Culicidae) mosquito, which is endemic in several regions of Brazil. Alternative methods for the control of the vector include botanical insecticides, which offer advantages such as lower environmental contamination levels and less likelihood of resistant populations. Thus, in this study, the ability of botanical insecticide formulations to inhibit the activity of the liver enzymes serum cholinesterase and malate dehydrogenase was evaluated. Inhibition profiles were assessed using in vitro assays for cholinesterase and malate dehydrogenase activity and quantitated by ultraviolet-visible spectroscopy at 410nm to 340nm. Insecticide products formulated from cashew nutshell liquid [A] and ricinoleic acid [B] showed cholinesterase activity levels of 6.26IU/mL and 6.61IU/mL, respectively, while the control level for cholinesterase was 5-12IU/mL. The products did not affect the level of 0.44IU/mL established for malate dehydrogenase, as the levels produced by [A] and [B] were 0.43IU/mL and 0.45IU/mL, respectively. Our findings show that in vitro testing of the formulated products at concentrations lethal to A. aegypti did not affect the activity of cholinesterase and malate dehydrogenase, indicating the safety of these products.

  10. Effects of neem seed derivatives on behavioral and physiological responses of the Cosmopolites sordidus (Coleoptera: Curculionidae).

    Science.gov (United States)

    Musabyimana, T; Saxena, R C; Kairu, E W; Ogol, C P; Khan, Z R

    2001-04-01

    Both in a choice and multi-choice laboratory tests, fewer adults of the banana root borer, Cosmopolites sordidus (Germar), settled under the corms of the susceptible banana "Nakyetengu" treated with 5% aqueous extract of neem seed powder or cake or 2.5 and 5% emulsified neem oil than on water-treated corms. Feeding damage by larvae on banana pseudostem discs treated with 5% extract of powdered neem seed, kernel, or cake, or 5% emulsified neem oil was significantly less than on untreated discs. The larvae took much longer to locate feeding sites, initiate feeding and bore into pseudostem discs treated with extract of powdered neem seed or kernel. Few larvae survived when confined for 14 d on neem-treated banana pseudostems; the survivors weighed two to four times less than the larvae developing on untreated pseudostems. Females deposited up to 75% fewer eggs on neem-treated corms. In addition, egg hatching was reduced on neem-treated corms. The higher the concentration of neem materials the more severe the effect.

  11. The Insecticidal Activity of Tanacetum parthenium (L.) Schultz Bip. Extracts Obtained by Supercritical Fluid Extraction and Hydrodistillation

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Sajfrtová, Marie; Sovová, Helena; Bárnet, M.; Karban, Jindřich

    2010-01-01

    Roč. 31, č. 3 (2010), s. 449-454 ISSN 0926-6690 R&D Projects: GA MŠk 2B06049 Institutional research plan: CEZ:AV0Z40720504 Keywords : botanical insecticides * spodoptera littoralis * tanacetum parthenium Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.507, year: 2010

  12. Actividad antifúngica de extractos de biomasa celular de neem sobre aislamientos de dermatofitos

    OpenAIRE

    Ospina Salazar, Daniel Iván; Hoyos Sánchez, Rodrigo Alberto; Arango Arteaga, Myrtha; Orozco Sánchez, Fernando; Ríos Salazar, Jhon Diego

    2014-01-01

    Título en español: Actividad antifúngica de extractos de biomasa celular de neem sobre aislamientos de dermatofitos Título en ingles: Antifungal activity of neem cellular biomass extracts on dermatophytes isolates Título corto: Actividad antifúngica de extractos de biomasa celular de neem Resumen:  Las líneas celulares de neem (Azadirachta indica A. Juss.) cultivadas en suspensión líquida han demostrado producir metabolitos secundarios bioactivos, particularmente triterpenoides. E...

  13. Azadirachta indica A. Juss. Neem, margosa. Meliaceae. Mahogany family.

    Science.gov (United States)

    J. A. Parrotta; A. N. Chaturvedi

    1994-01-01

    AzadirachJa indica A. Juss., commonly known as neem in English and Hindi and margosa and paraiso de India in Spanish, is a medium-sized to large tree characterized by its short, straight bole, furrowed, dark-brown to gray bark. and dense, rounded crown of pinnate leaves. Native to south Asia, neem is widely planted and naturalized in semiarid areas throughout Asia and...

  14. Neem (Azadirachta indica): prehistory to contemporary medicinal uses to humankind.

    Science.gov (United States)

    Kumar, Venugopalan Santhosh; Navaratnam, Visweswaran

    2013-07-01

    The divine tree neem (Azadirachta indica) is mainly cultivated in the Indian subcontinent. Neem has been used extensively by humankind to treat various ailments before the availability of written records which recorded the beginning of history. The world health organization estimates that 80% of the population living in the developing countries relies exclusively on traditional medicine for their primary health care. More than half of the world's population still relies entirely on plants for medicines, and plants supply the active ingredients of most traditional medical products. The review shows the neem has been used by humankind to treat various ailments from prehistory to contemporary.

  15. Evaluation of the Susceptibility of the Pea Aphid, Acyrthosiphon pisum, to a Selection of Novel Biorational Insecticides using an Artificial Diet

    Science.gov (United States)

    Sadeghi, Amin; Van Damme, Els J.M.; Smagghe, Guy

    2009-01-01

    An improved technique was developed to assay the toxicity of insecticides against aphids using an artificial diet. The susceptibility of the pea aphid Acyrthosiphon pisum (Harris) (Hemiptera: Aphidoidea) was determined for a selection of novel biorational insecticides, each representing a novel mode of action. Flonicamid, a novel systemic insecticide with selective activity as feeding blocker against sucking insects, showed high toxicity against first-instar A. pisum nymphs with an LC50 of 20.4 μg/ml after 24 h, and of 0.24 µg/ml after 72 h. The toxicity was compared with another feeding blocker, pymetrozine, and the neonicotinoid, imidacloprid. In addition, four insect growth regulators were tested. The chitin synthesis inhibitor flufenoxuron, the juvenile hormone analogue pyriproxyfen, and the azadirachtin compound Neem Azal-T/S showed strong effects and reduced the aphid population by 50% after 3 days of treatment at a concentration of 7–9 µg/ml. The ecdysone agonist tested, halofenozide, was less potent. In conclusion, the improved aphid feeding apparatus can be useful as a miniature screening device for insecticides against different aphid pests. The present study demonstrated rapid and strong toxicity of flonicamid, and other biorational insecticides towards A. pisum. PMID:20053120

  16. Effects of Dietary Neem ( Azadirachta indica ) Leaf Extract on the ...

    African Journals Online (AJOL)

    The effects of dietary neem (Azadirachta indica) leaf extract (NLE) on egg production, egg quality characteristics and blood indices of laying hens were investigated. Dry matter content of fresh neem leaves was determined and used to determine the quantity of the fresh leaves to be extracted to correspond with the required ...

  17. Efficacy of Neem Oil on Cardamom Thrips, Sciothrips cardamomi Ramk., and Organoleptic Studies

    Directory of Open Access Journals (Sweden)

    Johnson Stanley

    2014-01-01

    Full Text Available The neem tree contains promising pest control substances which are effective against many pests. Oil extracted from neem seeds was used against cardamom thrips, Sciothrips cardamomi, a severe and economic pest of cardamom. Neem oil formulations, namely, Tamil Nadu Agricultural univeristy neem oil (TNAU NO (acetic acid & citric acid, were found effective against the pest with a overall damage reduction of 30% after 14 days of treatment. The percent damage reduction in capsules over control after three consecutive sprays of TNAU NO(C 2% and TNAU NO(A 2% was 78.3 and 75.2 percent, respectively. The newly extracted and unformulated neem oil, though found inferior to the formulated one, still found to cause 50% and 70% reduction in damage caused by thrips at two and three rounds of sprays, making it useful in pest management. Organoleptic tests conducted on cardamom capsules sprayed with neem oil revealed no significant difference in taste, aroma, and overall acceptability of cow milk boiled with cardamom. Thus, TNAU NO (A and C 2% was found effective against cardamom thrips with no adverse organoleptic properties and can be recommended.

  18. Sustainable management of root-knot disease of tomato by neem cake and Glomus fasciculatum

    Directory of Open Access Journals (Sweden)

    Rose Rizvi

    2015-12-01

    Full Text Available A pot experiment was conducted during winter season of 2009–2010 in the department of Botany, AMU, Aligarh, India, to determine the nematicidal potential of organic matter, neem cake at third level of dose, and bioagent, Glomus fasciculatum in terms of various growth parameters of tomato, when inoculated individually as well as concomitantly with respect to root-knot development. Neem cake and G. fasciculatum showed potential for sustainable management while providing nutrient sources for proper plant growth. Disease intensity of root-knot nematode decreased while increasing the doses of neem cake along with the G. fasciculatum. Chlorophyll contents have been found to be increased in single and combined application as well. There is a progressive increase in growth parameters raised in soil amended with 10, 20, and 30 g neem cake/kg soil and inoculated with G. fasciculatum. Significant improvement in the plant growth was observed when G. fasciculatum and neem cake were inoculated simultaneously. Neem cake plus G. fasciculatum reduced the nematodes’ multiplication and root-galling, and increased the plant growth of tomato as compared to unamended and Meloidogyne incognita-inoculated plants. Mycorrhyzation and agronomic parameters were increased due to application of G. fasciculatum alone, but enhanced further when inoculated with neem cake.

  19. Azadirachta indica A. Juss. (English: Margosa or Neem tree; Hindi ...

    Indian Academy of Sciences (India)

    (English: Margosa or Neem tree; Hindi: Neem) ofMeliaceae a large evergreen tree with spreading crown and brownish bark is either pLanted or se(f-sown. Leaves are compound and the LeafLets are somewhat oblique with toothed margin. Flowers are small and white and borne on branched inflorescence. Fruit is about ...

  20. Effect of dietary substitution with solvent extracted neem seed cake ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-07-06

    Jul 6, 2009 ... Nutritional indices (true nitrogen digestibility, biological value and protein ... Salt. 0.50. 0.50. 0.50. 0.50. -. 0.50. Vitamin Premix2. 0.20. 0.20. 0.20 ... WNSC = Water processed neem seed cake, MNSC = Methanol processed neem seed ... were given ad libitum and pre-measured quantity of food calculated.

  1. In vitro evaluation of the effect of botanical formulations used in the control of Aedes aegypti L. (Diptera: Culicidae on liver enzymes.

    Directory of Open Access Journals (Sweden)

    Karla Rejane de Andrade Porto

    Full Text Available Abstract: INTRODUCTION: Dengue fever is a viral disease transmitted by the Aedes aegypti Linn. (1792 (Diptera: Culicidae mosquito, which is endemic in several regions of Brazil. Alternative methods for the control of the vector include botanical insecticides, which offer advantages such as lower environmental contamination levels and less likelihood of resistant populations. Thus, in this study, the ability of botanical insecticide formulations to inhibit the activity of the liver enzymes serum cholinesterase and malate dehydrogenase was evaluated. METHODS: Inhibition profiles were assessed using in vitro assays for cholinesterase and malate dehydrogenase activity and quantitated by ultraviolet-visible spectroscopy at 410nm to 340nm. RESULTS Insecticide products formulated from cashew nutshell liquid [A] and ricinoleic acid [B] showed cholinesterase activity levels of 6.26IU/mL and 6.61IU/mL, respectively, while the control level for cholinesterase was 5-12IU/mL. The products did not affect the level of 0.44IU/mL established for malate dehydrogenase, as the levels produced by [A] and [B] were 0.43IU/mL and 0.45IU/mL, respectively. CONCLUSIONS Our findings show that in vitro testing of the formulated products at concentrations lethal to A. aegypti did not affect the activity of cholinesterase and malate dehydrogenase, indicating the safety of these products.

  2. Synthesis and characterization of antiseptic soap from neem oil and ...

    African Journals Online (AJOL)

    In this work, neem oil and shea butter oil were mixed in various proportions and used in preparing soaps which were subsequently characterized. The combination of Neem oil to Shea butter oil considered were 100:0, 80:20, 60:40, 50:50, 40:60, 20:80 and 0:100 (wt:wt). The physical properties of the prepared soap ...

  3. Impact of azadirachtin, an insecticidal allelochemical from neem on soil microflora, enzyme and respiratory activities.

    Science.gov (United States)

    Gopal, Murali; Gupta, Alka; Arunachalam, V; Magu, S P

    2007-11-01

    The effect of 10% azadirachtin granules (alcoholic extract of neem seed kernel mixed with China clay) was studied on the population of bacteria, actinomycetes, fungi, Azotobacter and nitrifying bacteria; soil dehydrogenase, phosphatase and respiratory activities on 0, 15th, 30th, 60th and 90th days after application in sandy loam soil collected from the fields. It was observed that baring the Azotobacter sp., azadirachtin at all the doses exerted a suppressive effect on the rest of the microbial communities and enzyme activities in the initial 15 day period. The population of bacteria, actinomycetes besides phosphatase and respiratory activities recovered after 60th day and subsequently increased significantly. The fungi and nitrifiers were most sensitive groups as their numbers were reduced significantly throughout the studies. The two times and five times recommended dose of azadirachtin had very high biocidal effects on the soil microorganisms and its activities. However, analysis of the data by the Shannon Weaver index showed that azadirachtin reduces both the form and functional microbial diversity at all doses.

  4. inhibition of germination and growth behavior of some cowpea

    African Journals Online (AJOL)

    DR. AMIN

    2011-12-02

    Dec 2, 2011 ... COWPEA VARIETIES USING NEEM (AZADIRACTA INDICA) LEAF WATER. EXTRACTS ... Keywords: Neem, Allelopathic effect, Leaf extract, Germination, Growth behavior ... and lotion today, as well as biological insecticide.

  5. New knowledge for yield, composition and insecticidal activity ofessential oils obtained from the aerial parts or seeds of fennel(Foeniculum vulgare Mill.)

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Žabka, M.; Bednář, Jan; Tříska, Jan; Vrchotová, Naděžda

    2016-01-01

    Roč. 83, may (2016), s. 275-282 ISSN 0926-6690 R&D Projects: GA MZe(CZ) QJ1510160 Institutional support: RVO:67179843 Keywords : foeniculum vulgare * botanical insecticides * essential oils * medicinal plants * aromatic plants Subject RIV: EH - Ecology, Behaviour Impact factor: 3.181, year: 2016

  6. Neem leaf extract as potential modifier of free radical interaction with RBC membrane

    International Nuclear Information System (INIS)

    Patil, Shilpa M.; Kulkarni, Satish G.; Rane, Charusheela

    2004-01-01

    Full text: Neem tree (Azadirachta indica) is well known as village pharmacy due to its multifaceted medicinal action in curing countless health problems. The leaf extract of Neem is known to purify blood by removing toxins and neutralizing free radicals. Using gamma irradiation as free radical generation process the efficacy of neem leaf extract in combating free radical attack on RBC membrane has been explored. The results narrating role of concentration and dose dependency in this radio modulation will be discussed

  7. Hexane neem leaf extract more potent than ethanol extract against Aspergillus flavus

    Directory of Open Access Journals (Sweden)

    Jenny Hidayat

    2015-12-01

    Full Text Available BACKGROUND Aspergillus flavus is one of the causes of aspergillosis, with a high virulence and resistance to standard antifungals, resulting in a high mortality rate. Medicinal plants are increasingly used as they are relatively safer with minimal side effects. Previously we found that the ethanol extract of neem (Azadirachta indica A Juss leaves inhibits A. flavus growth in vitro. However, most chemical compounds with antifungal effect are nonpolar. The purpose of this research was to compare the antifungal effect of neem leaves extracted in a nonpolar solvent to that of leaves extracted in a polar solvent. METHODS An in vitro experimental research was conducted between October 2013 and January 2014. Neem leaves were extracted in ethanol or hexane at various concentrations. A macrodilution test with 48-hour incubation time was done in triplicate on 8 groups of samples. These comprised the neem leaf ethanol extract (NLEE at 0.5, 1.0, and 2.0 g/dL, neem leaf hexane extract (NLHE at 0.5, 1.0, and 2.0 g/dL, positive control, and negative control groups. Fungal growth was detected on Sabouroud dextrose agar. Statistical analysis used Chi square and Fisher’s exact test. RESULTS NLHE had a higher, but statistically non-significant, inhibitory effect on A. flavus than NLEE (p=0.996. At higher concentrations, the antifungal effect of NLHE is better than that of NLEE. CONCLUSION There is no significant difference in in-vitro inhibitory effectivity on A. flavus of neem leaves between extracts in polar and nonpolar solvents.

  8. Bioatividade de nanoformulações de nim sobre a traça-do-tomateiro Bioactivity of neem nanoformulations on tomato pinworm

    Directory of Open Access Journals (Sweden)

    Fátima Teresinha Rampelotti Ferreira

    2012-08-01

    Full Text Available O uso de plantas inseticidas é uma importante ferramenta para o manejo de insetos-praga. Visando ao controle de Tuta absoluta (Meyrick (Lepidoptera: Gelechiidae, nanoformulações de nim foram avaliadas. Após a estimativa de uma CL50 para uma formulação de óleo comercial de nim, bioensaios de seleção foram realizados com 22 nanoformulações. Para isso, lagartas neonatas foram alimentadas sobre folíolos tratados com soluções das nanoformulações durante 10 dias. Com as duas nanoformulações mais promissoras, NC40 aquoso e NC40 pó (NC 40=nanocápsulas de Poli- β-hidroxibutirato, foi avaliado o efeito sobre o desenvolvimento e a longevidade do inseto. A CL50 para o óleo de nim foi estimada em 0,20% ou 1,31mgL-1 de azadiractina. As nanoformulações NC40 aquoso e NC40 pó afetaram o desenvolvimento do inseto.The use of insecticide plants is an important tool in the management of insect pests. Aiming to control Tuta absoluta (Meyrick (Lepidoptera: Gelechiidae, neem nanoformulations were evaluated. After estimating the LC50 for a commercial neem oil formulation, selection bioassays were performed with 22 nanoformulations. In order to do that, newly emerged caterpillars were fed on leaflets treated with nanoformulation solutions for 10 days. The effect on the development and longevity of the insect was evaluated with the two most promising nanoformulations, aqueous NC40 and powdered NC40 (NC 40 = Poly-β-hydroxibutirate nanocapsules. The LC50 for neem oil was estimated in 0.20% or 1.31mgL-1 of azadiractin. The nanoformulations aqueous NC40 and powdered NC40 affected the insect development.

  9. Antifungal activity of neem (Azadirachta indica: Meliaceae extracts against dermatophytes

    Directory of Open Access Journals (Sweden)

    Daniel Iván Ospina Salazar

    2015-09-01

    Full Text Available In order to assess the antifungal activity of methanolic extracts from neem tree (Azadirachta indica A. Juss., several bioassays were conducted following M38-A2 broth microdilution method on 14 isolates of the dermatophytes Trichophyton mentagrophytes, Trichophyton rubrum, Microsporum canis and Epidermophyton floccosum. Neem extracts were obtained through methanol-hexane partitioning of mature green leaves and seed oil. Furthermore, high performance liquid chromatography (HPLC analyses were carried out to relate the chemical profile with their content of terpenoids, of widely known antifungal activity. The antimycotic Terbinafine served as a positive control. Results showed that there was total growth inhibition of the dermatophytes isolates at minimal inhibitory concentrations (MIC between 50 μg/mL and 200 μg/mL for leaves extract, and between 625 μg/mL and 2500 μg/mL for seed oil extract. The MIC of positive control (Terbinafine ranged between 0.0019 μg/mL and 0.0313 μg/mL. Both neem leaves and seed oil methanol extracts exhibited different chromatographic profiles by HPLC, which could explain the differences observed in their antifungal activity. This analysis revealed the possible presence of terpenoids in both extracts, which are known to have biological activity. The results of this research are a new report on the therapeutic potential of neem to the control of dermatophytosis.  Actividad antifúngica de extractos de neem (Azadirachta indica: Meliaceae sobre hongos dermatofitos Se determinó la actividad antifúngica de extractos metanólicos de la especie Azadirachta indica A. Juss. (Meliaceae, conocida comúnmente como neem, empleando el método de microdilución en caldo M38-A2 de referencia para hongos filamentosos y dermatofitos. Se evaluaron 14 aislamientos de los dermatofitos Trichophyton mentagrophytes, Trichophyton rubrum, Microsporum canis y Epidermophyton floccosum. Los extractos de neem fueron obtenidos mediante partici

  10. Lethal and sublethal effects of azadirachtin and cypermethrin on Habrobracon hebetor (Hymenoptera: Braconidae).

    Science.gov (United States)

    Abedi, Zahra; Saber, Moosa; Gharekhani, Gholamhossein; Mehrvar, Ali; Kamita, Shizuo George

    2014-04-01

    Habrobracon hebetor Say is an ectoparasitoid of larval stage of various lepidopteran pests. Lethal and sublethal effects of azadirachtin and cypermethrin were evaluated on adult and preimaginal stages of H. hebetor under laboratory conditions. Contact exposure bioassays with adults indicated that the lethal concentration (LC50) of two commercial azadirachtin-containing formulations, NeemGuard and BioNeem, were 43.5 and 10.2 microg a.i./ml, respectively. The LC50 of cypermethrin was 5.4 microg a.i./ml. When larval stage of H. hebetor was exposed to these insecticides with a field recommended concentration of NeemGuard, BioNeem, or cypermethrin by a dip protocol, the emergence rate was reduced by 39.0, 36.6, and 97.6%, respectively. To assay the sublethal effects of these insecticides, adult wasps were exposed to an LC30 concentration of the insecticides, and then demographic parameters of the surviving wasps were determined. Fecundity, fertility, and parameters including the intrinsic rate of increase (r(m)) were affected negatively. The r(m) values following exposure to NeemGuard, BioNeem, cypermethrin, or mock treatment were 0.143, 0.149, 0.160, and 0.179, respectively, female offspring per female per day, respectively. The current study showed that cypermethrin had more acute toxicity on larval and adult stages of H. hebetor compared with azadirachin. The commercial formulations of azadirachtin and cypermethrin negatively affected most of the life table parameters of the parasitoid. Semifield and field studies are needed for obtaining more applicable results on combining H. hebetor and the tested insecticides for an integrated pest management-based strategy for crop protection.

  11. Bioefficacy of powdery formulations based on kaolin powder and ...

    African Journals Online (AJOL)

    extracts had less seeds damaged than hot extracts. F1 progeny decreased with ... reported that the use of chemical insecticides have a high ... uncontrolled chemicals insecticides use for preservation of ...... (Neem) as a model. Insecticides- ...

  12. Effects of a botanical larvicide derived from Azadirachta indica (the neem tree) on oviposition behaviour in Anopheles gambiae s.s. mosquitoes

    NARCIS (Netherlands)

    Howard, A.F.V.; Adongo, E.A.; Vulule, J.; Githure, J.

    2011-01-01

    More focus is given to mosquito larval control due to the necessity to use several control techniques together in integrated vector management programmes. Botanical products are thought to be able to provide effective, sustainable and cheap mosquito larval control tools. However, bio-larvicides like

  13. Colour and spreadability of Neem (Azadirachta Indica A. juss) ointment and cream formulations

    Science.gov (United States)

    Zawiyyah, Azierah; Shamsul Anuar, Mohd

    2018-04-01

    Herbal plants are a major source of raw material for traditional medicines. Recently there has been an increase of interest to study the therapeutic potential of herbal plants as herbal care products. In this study, a preliminary study on the formulation of neem (Azadirachta Indica) ointment and cream have been conducted. The neem leaves were extracted and formulated into ointment and cream. The raw neem extract is added into the ointment and cream bases at four different concentrations (0% w/w, 0.5% w/w, 1% w/w and 2% w/w) and stored at three different storage temperatures (4°C, 25°C and 45°C). The semambu ointment and cream formulated were evaluated in terms of their colour and spreadability. It has been found that the extract content and storage temperature influence the colour and spreadability of the formulated neem ointment and cream.

  14. Comparision of the Efficiency of the Current Oils and Insecticide Compounds in Control of Greenhouse Whitefly, Trialeurodes vaporariorum (Westwood, (Hem.: Aleyrodidae on Rose and their Interaction

    Directory of Open Access Journals (Sweden)

    Asghar Hosseininia

    2017-03-01

    block design with 20 treatments, 3 blocks and 4 replications. In addition, the bioassay of neem oil, citowett and volk on nymphal stages (2-4 as well as whiteflies adult were assayed in the greenhouse condition. The bioassay was carried out in clear plastic cages containing a leaf with three leaflets connected to the plant, containing 30 nymphs or 30 adults. Moreover, the bioassay of deltamethrin on adults and buprofezin on the nymphs and also synergistic rate (SR of three oils including neem oil, citowett and volk on deltamethrin and buprofezin were estimated. The followed formula {SR= (Lc50A +Lc50B/Lc50 (A+B} was used for calculating synergistic rate. For bioassay testes, the clear plastic cages containing three leaflets as well as 30 nymphs and also 30 adult whiteflies were used. Results and Discussion: Based on the result of the mortality rate of oils and common insecticide, the treatment control, which was neem oil (1 ml/L mixed with deltamethrin (0.5 ml/L, was caused 91.72 and 90.79 % MR of nymphs and adult whiteflies, respectively. Also the neem oil (0.5 ml/L and citowett (0.25 ml/L after water treatment had the lowest effect on the adult and nymphal stages mortality. When the oils separately were used, their LC50 were higher than they used simultaneously with deltamethrin and buprofezin. The results of the bioassay showed the Lc50 of deltamethrin mixed with neem oil, citowett and volk as: 417.55, 290.51 and 639.07 ppm, respectively. The synergistic effect of neem oil, citowett and volk with deltamethrin on the mortality rate of adult whitefly was estimated as 3.62, 5.45 and 2.56, respectively. The highest SR (7.24 of buprofezin for nymphal stage was occurred when it mixed with citowett. In addition, the SR of this pesticide was 4.86 and 3.55 for neem and volk, respectively. Also the Lc50 of buprofezin mixed with neem, citowett and volk were 214.26, 177.32 and 559.56 ppm, respectively. Conclusion: According to the effect of buprofezin on insect moulting, using of

  15. Effects of a neem extract on blood feeding, oviposition and oocyte ultrastructure in Anopheles stephensi Liston (Diptera: Culicidae).

    Science.gov (United States)

    Lucantoni, L; Giusti, F; Cristofaro, M; Pasqualini, L; Esposito, F; Lupetti, P; Habluetzel, A

    2006-12-01

    Secondary metabolites of the neem tree (Azadirachta indica A. Juss., Meliaceae) exhibit a wide range of biological activities in insects. However, few studies have addressed the effects of neem extracts or compounds in arthropods of medical importance. In this study, a laboratory strain of Anopheles stephensi was used to assess the effects of a commercial formulation (Neem Azal) (NA)), containing azadirachtin A at 34%, on blood feeding, oviposition and oocyte ultrastructure. Oral administration of Neem Azal) to A. stephensi females through artificial blood meals did impair blood intake and oviposition in a concentration dependent manner. Similar results were obtained on females, which had consumed Neem Azal) in sucrose solution before taking a blood meal of plain blood. Neem treated females displayed a delay in oocyte development in both the phase of vitellogenesis and the phase of choriogenesis. The ultrastructural studies on ovaries from Neem Azal) treated females revealed distinct structural modifications indicative of: (i) a complete block of oogenesis, (ii) impairment of vitellogenesis and vitelline envelope formation, (iii) a severe degeneration of follicle cells. In agreement with results obtained in other insects, this study indicates that Neem Azal) impairs hormone control of oogenesis and exerts a cytotoxic effect on both follicular cells and oocytes of the Asian malaria vector A. stephensi.

  16. Credentialing of practitioners of botanical medicine.

    Science.gov (United States)

    Yarnell, Eric; Abascal, Kathy; Greenfield, Russell Howard; Romm, Aviva; Sudberg, Sidney

    2002-01-01

    This article discusses how practitioners, regardless of other professional licenses they may hold, could be credentialed in botanical medicine. The article reviews the field of clinical botanical medicine and the history and modern status of botanical medicine, as well as organizations currently involved in botanical medicine credentialing. Many different types of professionals prescribe botanical medicines, and the potential for collaboration among them is great. The current trend treats botanical medicine as a narrow subdivision of allopathic medicine and does not acknowledge the breadth, depth, and diversity of botanical medicine and ultimately will not provide maximum benefits for patients. An alternative approach that instead credentials practitioners skilled in the use of a wide variety of botanical medicines in a responsible, scientific fashion is presented.

  17. Education Function of Botanical Gardens

    OpenAIRE

    Ruhugül Özge Ocak; Banu Öztürk Kurtaslan

    2015-01-01

    Botanical gardens are very significant organizations which protect the environment against the increasing environmental problems, provide environmental education for people, offer recreation possibilities, etc. This article describes botanical gardens and their functions. The most important function of botanical garden is to provide environmental education for people and improve environmental awareness. Considering this function, some botanical gardens were examined and o...

  18. Combined antioxidant effects of Neem extract, bacteria, red blood cells and Lysozyme: possible relation to periodontal disease.

    Science.gov (United States)

    Heyman, Leali; Houri-Haddad, Yael; Heyman, Samuel N; Ginsburg, Isaac; Gleitman, Yossi; Feuerstein, Osnat

    2017-08-10

    The common usage of chewing sticks prepared from Neem tree (Azadirachta indica) in India suggests its potential efficacy in periodontal diseases. The objective of this study is to explore the antibacterial effects of Neem leaf extract on the periodontophatic bacteria Porphyromonas gingivalis and Fusobacterium nucleatum, and its antioxidant capacities alone and in combination with bacteria and polycationic peptides that may be at the site of inflammation. Neem leaf extract was prepared by ethanol extraction. The growth kinetics of P. gingivalis and F. nucleatum under anaerobic conditions in the presence of Neem leaf extract were measured. Broth microdilution test was used to determine the Minimal Inhibitory Concentration (MIC) of Neem leaf extract against each bacterial strain. The effect of Neem leaf extract on the coaggregation of the bacteria was assessed by a visual semi-quantitative assay. The antioxidant capacities of Neem leaf extract alone and in combination with bacteria, with the addition of red blood cells or the polycationic peptides chlorhexidine and lisozyme, were determined using a chemiluminescence assay. Neem leaf extract showed prominent dose-dependent antibacterial activity against P. gingivalis, however, had no effect on the growth of F. nucleatum nor on the coaggregation of the two bacteria. Yet, it showed intense antioxidant activity, which was amplified following adherence to bacteria and with the addition of red blood cells or the polycationic peptides. Neem leaf extract, containing polyphenols that adhere to oral surfaces, have the potential to provide long-lasting antibacterial as well as synergic antioxidant activities when in complex with bacteria, red blood cells and lisozyme. Thus, it might be especially effective in periodontal diseases.

  19. Neeme Järvi lahkub Detroidi orkestrist

    Index Scriptorium Estoniae

    2005-01-01

    Detroidi orkestriga hüvastijätupeol "Järvi Fest" esinevad flötist Maarika Järvi ja dirigent Kristjan Järvi. Detroidi sümfooniaorkestrit 15 aastat juhtinud Neeme Järvi töötab edasi New Jersey sümfooniaorkestri Haagi orkestriga

  20. Application of Neem Gum for Aqueous Film Coating of Ciprofloxacin Tablets

    OpenAIRE

    A P Kulkarni; Y R Shaikh; MH GR Dehghan

    2013-01-01

    Summary. At present the pharmaceutical industry and academia are focusing on the use of natural materials and resources for development of pharmaceutical product. In previous study, neem gum (NG), obtained from Azadirachata indica plant revealed satisfactory film forming ability. The present study evaluates the application potential of neem gum, as an aqueous film coating material, using ciprofloxacin hydrchloride (drug) as a model drug. Initial study of physical mixture indicated absence of ...

  1. Lethal and sublethal effects of neem on Aphis gossypii and Cycloneda sanguinea in watermelon

    Directory of Open Access Journals (Sweden)

    Cíntia Ribeiro Souza

    2015-05-01

    Full Text Available The objective of this study was to evaluate the impact of oil extract of neem, Azadirachta indica, on the watermelon aphid Aphis gossypii and its natural enemy Cycloneda sanguinea. Toxicity bioassays were conducted with the commercial product DalNeem (1,475 g L-1 azadirachtin at 0.0037 µg a.i. mL-1, 0.0074 µg a.i. mL-1 and 0.0148 µg a.i. mL-1, Malathion at 1 µg a.i. mL-1 and distilled water as a control treatment. The products were sprayed to watermelon leaf discs, and the insects were exposed to the product residues. The instantaneous population growth rate of A. gossypii and the survival of C. sanguinea larvae exposed to the different treatments were calculated. A decrease in the instantaneous population growth rate of A. gossypii with increasing concentrations of neem was observed, and the aphids did not reproduce on the leaf discs treated with malathion during the first 24 hours of exposure due to its rapid lethal effect on adult insects. The larvae of the predator C. sanguinea exposed to malathion survived only for 24 hours. The survival of the predator exposed to different concentrations of neem was also significantly reduced compared to the predators exposed only to water. However, laboratory experiments may overestimate the effect of neem on predators because the individuals cannot employ escape behavior caused by neem repellency.

  2. Drug-botanical interactions: a review of the laboratory, animal, and human data for 8 common botanicals.

    Science.gov (United States)

    Shord, Stacy S; Shah, Kanan; Lukose, Alvina

    2009-09-01

    Many Americans use complementary and alternative medicine (CAM) to prevent or alleviate common illnesses, and these medicines are commonly used by individuals with cancer.These medicines or botanicals share the same metabolic and transport proteins, including cytochrome P450 enzymes (CYP), glucuronosyltransferases (UGTs), and P-glycoprotein (Pgp), with over-the-counter and prescription medicines increasing the likelihood of drug-botanical interactions.This review provides a brief description of the different proteins, such as CYPs, UGTs, and Pgp.The potential effects of drug-botanical interactions on the pharmacokinetics and pharmacodynamics of the drug or botanical and a summary of the more common models used to study drug metabolism are described.The remaining portion of this review summarizes the data extracted from several laboratory, animal, and clinical studies that describe the metabolism, transport, and potential interactions of 8 selected botanicals. The 8 botanicals include black cohosh, Echinacea, garlic, Gingko biloba, green tea, kava, milk thistle, and St John's wort; these botanicals are among some of the more common botanicals taken by individuals with cancer.These examples are included to demonstrate how to interpret the different studies and how to use these data to predict the likelihood of a clinically significant drug-botanical interaction.

  3. Actividad antifúngica de extractos de biomasa celular de neem sobre aislamientos de dermatofitos

    Directory of Open Access Journals (Sweden)

    Daniel Iván Ospina Salazar

    2014-07-01

    Full Text Available Título en español: Actividad antifúngica de extractos de biomasa celular de neem sobre aislamientos de dermatofitos Título en ingles: Antifungal activity of neem cellular biomass extracts on dermatophytes isolates Título corto: Actividad antifúngica de extractos de biomasa celular de neem Resumen:  Las líneas celulares de neem (Azadirachta indica A. Juss. cultivadas en suspensión líquida han demostrado producir metabolitos secundarios bioactivos, particularmente triterpenoides. En consecuencia, se han realizado estudios para el control de microorganismos de importancia médica, como los hongos dermatofitos. El objetivo principal de este trabajo fue evaluar a través de un método de referencia in vitro la actividad antifúngica de diferentes extractos de cultivos celulares de neem sobre varios aislamientos de Trichophyton mentagrophytes, Trichophyton rubrum y Epidermophyton floccosum. Se realizó un escalado de cultivos de suspensiones celulares de neem, a partir de los cuales se obtuvo un extracto crudo metanólico. Éste extracto fue fraccionado posteriormente por cromatografía en columna de silica gel. Con los extractos obtenidos se determinó la Concentración Mínima Inhibitoria (CMI, siguiendo el método de microdilución en caldo M38-A2, con cinco aislamientos de T. mentagrophytes, cinco de T. rubrum y tres de E. floccosum. Se usó como control positivo el antimicótico Terbinafina. Los resultados mostraron que el extracto crudo de biomasa celular de neem inhibe el crecimiento hasta en 100 % de T. mentagrophytes, T. rubrum y E.  floccosum. Al evaluar las fracciones por separado, se observó que las de menor polaridad exhibieron en general mayor actividad antifúngica (CMI=109 µg/mL que el extracto crudo per se (CMI=2500 µg/mL y las fracciones más polares (CMI=7000 µg/mL. Lo anterior indica que las células de neem cultivadas en suspensión producen compuestos con actividad antifúngica, siendo más bioactivos los presentes

  4. Inhibition of Citrinin Production in Penicillium citrinum Cultures by Neem [Azadirachta indica A. Juss (Meliaceae

    Directory of Open Access Journals (Sweden)

    Carlos Kemmelmeier

    2008-09-01

    Full Text Available The efficacy of different concentrations of aqueous neem leaf extract (3.12 to 50 mg/mL on growth and citrinin production in three isolates of Penicillium citrinum was investigated under laboratory conditions. Mycotoxin production by the isolates was suppressed, depending on the concentration of the plant extract added to culture media at the time of spore inoculation. Citrinin production in fungal mycelia grown for 21 days in culture media containing 3.12 mg/mL of the aqueous extract of neem leaf was inhibited by approximately 80% in three isolates of P. citrinum. High-performance liquid chromatography was performed to confirm the spectrophotometric results. Vegetative growth was assessed, but neem extract failed to inhibit it. Neem leaf extract showed inhibition of toxin production without retardation in fungal mycelia growth.

  5. Botanical-drug interactions: a scientific perspective.

    Science.gov (United States)

    de Lima Toccafondo Vieira, Manuela; Huang, Shiew-Mei

    2012-09-01

    There is a continued predisposition of concurrent use of drugs and botanical products. A general lack of knowledge of the interaction potential together with an under-reporting of botanical use poses a challenge for the health care providers and a safety concern for patients. Botanical-drug interactions increase the patient risk, especially with regard to drugs with a narrow therapeutic index (e.g., warfarin, cyclosporine, and digoxin). Examples of case reports and clinical studies evaluating botanical-drug interactions of commonly used botanicals in the US are presented. The potential pharmacokinetic and pharmacodynamic bases of such interactions are discussed, as well as the challenges associated with the interpretation of the available data and prediction of botanical-drug interactions. Recent FDA experiences with botanical products and interactions including labeling implications as a risk management strategy are highlighted. Georg Thieme Verlag KG Stuttgart · New York.

  6. Behavioral responses of Schistocerca americana (Orthoptera: Acrididae) to Azadirex (neem)-treated host plants.

    Science.gov (United States)

    Capinera, John L; Froeba, Jason G

    2007-02-01

    Azadirex (azadirachtin and other biologically active extracts from neem trees) has been shown to have considerable potential to be used in integrated pest management systems based on its growth regulator/insecticide properties. Less well known are the antifeedant properties. The feeding-deterrent properties of a commercial azadirex formulation (Azatrol EC) were evaluated using both no-choice and choice tests, the American grasshopper, Schistocerca americana (Drury), and four host plants [savoy cabbage, Brassica oleracea variety capitata L.; cos (romaine) lettuce, Lactuca sativa variety longifolia Lam.; sweet orange, Citrus sinensis variety Hamlin L.; and peregrina, Jatropha integerrima Jacq.]. These studies demonstrated that azadirex application can significantly affect the feeding behavior of grasshoppers. Some degree of protection can be afforded to plants that differ markedly in their innate attractiveness to the insect, although the level of protection varies among hosts. The tendency of grasshoppers to sometimes feed on azadirex-treated foliage suggests that it will be difficult to prevent damage from occurring at all times, on all hosts. No evidence of rapid habituation to azadirex was detected. Rapid loss of efficacy was observed under field conditions, suggesting that daily retreatment might be necessary to maintain protection of plants from feeding.

  7. Botanic garden as an environment for informal education: experience of Kaunas Botanical Garden

    OpenAIRE

    Jurkonis, Nerijus

    2017-01-01

    According to Willison (1994), botanic gardens have an obvious and vital role to play in conserving plants, but conservation cannot succeed without education. Kaunas botanical garden (KBG) of Vytautas Magnus University, Lithuania has experience in a diverse range of education activities: from traditional guided excursions which present botanical collections, to informal education for preschoolers and schoolchildren. KBG is a partner in the Lithuanian Academy of Science’s project for the ‘Devel...

  8. Effects of Neem (Azadirachta indic and Custard Apple (Annona reticulata Diets on Sterility of House Rat (Rattus rattus

    Directory of Open Access Journals (Sweden)

    Prem Nidhi Sharma

    2015-12-01

    Full Text Available Three different plant products diets – i neem (Azadirachta indic A. Juss oil mixed diet (neem oil mixed @ 80 ml/kg of normal diet, ii neem seed powder mixed diet (neem seed powder mixed @ 80 g/kg of normal diet and iii custard apple (Annona reticulata L. seed powder mixed diet (custard apple seed powder mixed @ 80 g/kg of normal diet were separately fed to mature rats (Rattus rattus with single dose feeding of 80 g per pair in a day on 13th week-age during the experimenting years, 2012/013 and 2013/014. In control group only normal diet without neem and custard apple constituents were fed. Sterility test of rat was conducted up to 38 and 28 weeks-age in first and second year, respectively. The test rats were fed normal diet during whole experimenting periods except the one day when they were fed only the neem or custard apple mixed diet on the age of 13th week. Efficacy of the mixed diets on rat-sterility was determined based on pregnancy and parturition by the rats. The two years' results confirmed that all the tested three mixed diets – neem oil mixed diet, neem seed powder mixed diet, and custard apple seed powder mixed diet were effective to stop pregnancy and parturition in rats during whole experimenting periods up to 38 and 28 weeks-age with single dose feeding of 80 g per pair (40 gm/rat in a day on 13th week-age of the rats; whereas the pregnancy and parturition were observed in the rats that were fed only the normal diet. It is expected, neem and custard apple mixed diets can be utilized in reducing the economically important rodent populations in rice-wheat cropping system in future.

  9. Grieg: Works for String Orchestra. Gothenburg Symphony Orchestra, Neeme Järvi / Sanders, Alan

    Index Scriptorium Estoniae

    Sanders, Alan

    1993-01-01

    Uuest heliplaadist "Grieg: Works for String Orchestra. Gothenburg Symphony Orchestra, Neeme Järvi. CD 437 520 - 2GH Grieg: Land Sighting, Op.32, Olav Trygvason, Op.50, Per Gynt Suites N1,Op.46, N2,Op.55. Randi Stene, Anne Gjevang, Hakan Hagegard, Gothenburg Symphony Chorus, Gothenburg Symphony Orchestra, Neeme Järvi. CD 437 523 - 2 GH

  10. Effect of neem cake/fertilizers on symbiotic and non-symbiotic N2 fixing bacteria

    International Nuclear Information System (INIS)

    Akhtar, S.; Solangi, A.H.; Gilani, G.; Pirzada, M.H.

    2002-01-01

    Neem cake amendment in soil at 1.3% no adverse effect on the population of four symbiotic Rhizobium species viz., japonicum, R. leguminosarum, R. Phaseoli and R. Fredii and three non-symbiotic free living nitrogen fixers bacteria viz., Pseudomonas diazotrophicus, Klebsiella planticola and Enterobacter cloacae. Neem cake extracted with n-hexane stimulated the growth of Rhizobium species in vitro, whereas Neem cake expeller extracted neither inhibited nor stimulated the growth of Rhizobium species except for R. Fredii, whose was slightly retarded. The fertilizers (urea, NPK and DAP) had no adverse effect on these bacteria even at the dosage ten times higher the recommended dose. (author)

  11. Formulation and characterization of solid lipid nanoparticles loaded Neem oil for topical treatment of acne

    Directory of Open Access Journals (Sweden)

    V. Vijayan

    2013-01-01

    Conclusion: The result concluded that Neem oil loaded solid lipid nanoparticles with more lecithin content in their colloid exhibit sustained effect which satisfactorily produced the antibacterial action on Acne microbes. Therefore Neem oil loaded SLN was used successfully for prolonged treatment of Acne.

  12. Effectiveness of Azadirachta indica (neem) mouthrinse in plaque and gingivitis control: a systematic review.

    Science.gov (United States)

    Dhingra, K; Vandana, K L

    2017-02-01

    The aim of this systematic review was to evaluate the effectiveness of Azadirachta indica (neem)-based herbal mouthrinse in improving plaque control and gingival health. Literature search was accomplished using electronic databases (PubMed, Cochrane Central Register of Controlled Trials and EMBASE) and manual searching, up to February 2015, for randomized controlled trials (RCTs) presenting clinical data for efficacy of neem mouthrinses when used alone or as an adjunct to mechanical oral hygiene as compared to chlorhexidine mouthrinses for controlling plaque and gingival inflammation in patients with gingivitis. Of the total 206 articles searched, three randomized controlled trials evaluating neem-based herbal mouthrinses were included. Due to marked heterogeneity observed in study characteristics, meta-analysis was not performed. These studies reported that neem mouthrinse was as effective as chlorhexidine mouthrinse when used as an adjunct to toothbrushing in reducing plaque and gingival inflammation in gingivitis patients. However, the quality of reporting and evidence along with methods of studies was generally flawed with unclear risk of bias. Despite the promising results shown in existing randomized controlled trials, the evidence concerning the clinical use of neem mouthrinses is lacking and needs further reinforcement with high-quality randomized controlled trials based on the reporting guidelines of herbal CONSORT statement. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  13. Stress, storage and survival of neem seed

    NARCIS (Netherlands)

    Sacandé, M.

    2000-01-01

    Neem ( Azadirachta indica ) is an important multipurpose tropical tree species, frequently used in planting programmes in the arid tropics. However, its seeds are difficult to store for extended periods of time, as are those of many other tropical species which display

  14. The effect of different concentrations of Neem (Azadiractha indica leaves extract on the inhibition of Streptococcus mutans (In vitro

    Directory of Open Access Journals (Sweden)

    Sri Kavi Subramaniam

    2005-12-01

    Full Text Available The Neem plant has a history for treating gum and teeth problems and this plant is used for oral care in India. The active component (Azadirachta indica has been proven to exhibit antibacterial properties. The objective of this study was to determine the influence of different concentrations of Neem leaves extract on the inhibition of Streptococcus mutans. Neem leaves extract at concentrations of 10%, 20%, 40%, 60%, 80%, and 100% was prepared. Fifty milliliters of each concentration were dropped into holes of 6 millimeters in diameter on a MHA agar that has been inoculated with Streptococcus mutans. Distilled water was used as a control. After 24 hours of incubation, the inhibition diameters were measured and analyzed. The statistical results of the one-way analysis of variance (ANOVA illustrated that the different concentrations of Neem extract had a significant influence on the inhibition of Streptococcus mutans. This was followed with the Least Significant Difference (LSD which implied that there were significant differences between all the concentrations of Neem leaves extract used in this experiment. The conclusion of this study was that Neem leaves extract exhibited antibacterial effect towards Streptococcus mutans and different concentration of Neem leaves extract influenced the inhibition of Streptococcus mutans.

  15. DOI: 10.18697/ajfand.81.17095 13254 POTENTIALISATION DE L ...

    African Journals Online (AJOL)

    therefore to determine the insecticidal potential in powdery formulations of ... and seeds of neem tree Azadirachta indica A. Juss (Meliaceae ) in formulation with the ..... Candido ACS and MTLP Peres Insecticide irritability of plant extracts.

  16. Scalable synthesis of aligned carbon nanotubes bundles using green natural precursor: neem oil

    Directory of Open Access Journals (Sweden)

    Kumar Rajesh

    2011-01-01

    Full Text Available Abstract Practical application of aligned carbon nanotubes (ACNTs would have to be determined by a matter of its economical and large-scale preparation. In this study, neem oil (also named Margoaa oil, extracted from the seeds of the neem--Azadirachta indica was used as carbon source to fabricate the bundles of ACNTs. ACNTs have been synthesized by spray pyrolysis of neem oil and ferrocene mixture at 825°C. The major components of neem oil are hydrocarbon with less amount of oxygen, which provided the precursor species in spray pyrolysis growth of CNTs. The bundles of ACNTs have been grown directly inside the quartz tube. The as-grown ACNTs have been characterized through Raman spectroscopy, scanning and transmission electron microscopic (SEM/TEM techniques. SEM images reveal that the bundles of ACNTs are densely packed and are of several microns in length. High-resolution TEM analysis reveals these nanotubes to be multi-walled CNTs. These multi-walled CNTs were found to have inner diameter between 15 and 30 nm. It was found that present technique gives high yield with high density of bundles of ACNTs.

  17. Nimbolide B and Nimbic Acid B, Phytotoxic Substances in Neem Leaves with Allelopathic Activity

    Directory of Open Access Journals (Sweden)

    Hisashi Kato-Noguchi

    2014-05-01

    Full Text Available Neem (Azadirachta indica has been widely used as a traditional medicine and several bioactive compounds have been isolated from this species, but to date no potent allelopathic active substance has been reported. Therefore, we investigated possible allelopathic property and phytotoxic substances with allelopathic activity in neem. An aqueous methanol extract of neem leaves inhibited the growth of roots and shoots of cress, lettuce, alfalfa, timothy, crabgrass, ryegrass, barnyard grass and jungle rice. The extracts were then purified by several chromatographic runs while monitoring the inhibitory activity and two phytotoxic substances were isolated. The chemical structures of the two substances were determined by spectral data to correspond to novel compounds, nimbolide B (1 and nimbic acid B (2. Nimbolide B inhibited the growth of cress and barnyard grass at concentrations greater than 0.1‒3.0 μM. Nimbic acid B inhibited the growth of cress and barnyard grass at concentrations greater than 0.3–1.0 μM. These results suggest that nimbolide B and nimbic acid B may contribute to the allelopathic effects caused by neem leaves.

  18. Efficacy of the stem powder of an invasive alien plant, Chromolaena ...

    African Journals Online (AJOL)

    ADOWIE PERE

    2018-03-15

    Mar 15, 2018 ... insecticidal activities of C. odorata stem powder and further suggests its usage as an ... insecticides in the management of C. maculatus infestation in Nigeria and elsewhere. ..... efficacy of neem (Azadirachta indica), false.

  19. Quantitative analyses of shrinkage characteristics of neem ...

    African Journals Online (AJOL)

    Quantitative analyses of shrinkage characteristics of neem (Azadirachta indica A. Juss.) wood were carried out. Forty five wood specimens were prepared from the three ecological zones of north eastern Nigeria, viz: sahel savanna, sudan savanna and guinea savanna for the research. The results indicated that the wood ...

  20. Old tropical botanical collections

    DEFF Research Database (Denmark)

    Friis, Ib

    2017-01-01

    The early history of botanical collections is reviewed, with particular emphasis on old collections from the tropics. The information available about older and newer botanical collections from the tropics was much improved after World War Two, including better lists of validly published names, more...

  1. The control and protection of cotton plants using natural insecticides against the colonization by Aphis gossypii Glover (Hemiptera: Aphididae - doi: 10.4025/actasciagron.v35i2.15764

    Directory of Open Access Journals (Sweden)

    Ezio Santos Pinto

    2012-12-01

    Full Text Available The cotton aphid, Aphis gossypii Glover (Hemiptera: Aphididae, is a key pest of cotton, irrespective of the use of conventional or organic management. In organic systems, however, the use of synthetic insecticides is not allowed, increasing the difficulty of controlling this pest. This work evaluated aphid control and the ability of products to prevent aphid infestation using natural insecticides compared to a standard synthetic insecticide. The control trial was conducted with four products [Beauveria bassiana (Boveril®, neem oil (Neemseto®, and cotton seed oil compared to thiamethoxam (Actara®], and untreated plants served as the control group. The trial testing the efficacy of these products in preventing aphid infestation was conducted using the same products, excluding Boveril®. The evaluations were conducted 72 and 120h post-treatment for the efficacy and the protection against colonization trials, respectively. The aphid control by cotton seed oil, Neemseto®, and thiamethoxam was similar, with 100% control being achieved on the thiamethoxam-treated plants. Regarding the plant protection against aphid colonization, the insecticide thiamethoxam exhibited a better performance compared to the other tested products with steady results over the evaluation period. The natural products exhibited variable results with low protection against plant colonization throughout the evaluation period.

  2. Management of the Greater Wax Moth Galleria mellonella with Neem Azal- T/S, in the Laboratory and under Semi-Field Conditions

    Directory of Open Access Journals (Sweden)

    Elbehery Huda

    2016-12-01

    Full Text Available Different concentrations of Neem Azal-T/S were used in an artificial diet, to study the mortality of the greater wax moth Galleria mellonella. A Neem formulation and different ages of natural beeswax combs were used for the effective management of the wax moth. While the diet was being prepared, Neem Azal-T/S was directly added ensure that the Neem formulation was distributed evenly in the diet at concentrations of 0.25, 0.5, 1, 2, and 4%. The obtained results showed that the different concentrations of Neem Azal-T/S mixed in the prepared artificial diet had a significant efficacy against the tested 2nd instar larvae. An outstanding elongation of the 2nd larval instar was clear in comparison with the control, even at the least tested concentration (0.25%. Neem Azal-T/S at 4, 2,1, and 0.5% caused 100% mortality for all tested larvae. When using a 4% concentration, all the tested larvae died in the 2nd instar. However, when using a 2% concentration, the larvae died in the fifth instar. When using a decreased concentration of 1.0 and 0.5%, some of the larvae were tolerant and lived till the 6th instar. Feeding the larvae on beeswax combs treated with 2% Neem Azal-T/S, caused 100% mortality when fed on very old wax. When the diet was old wax treated with 2% Neem Azal-T/S, a 91% mortality was recorded. When the diet was new wax treated with 2% Neem Azal-T/S, a 90% mortality was recorded. A 4% Neem formulation caused mortality for all larvae during the first week of treatment on the different tested ages of beeswax combs.

  3. Field evaluation of the synergistic effects of neem oil with Beauveria bassiana (Hypocreales: Clavicipitaceae) and Bacillus thuringiensis var. kurstaki (Bacillales: Bacillaceae)

    NARCIS (Netherlands)

    Togbe, C.E.; Zannou, E.; Gbehounou, G.; Kossou, D.; Huis, van A.

    2014-01-01

    In the present study, the synergistic effects of Beauveria bassiana (Bals.-Criv. Vuill.) (isolate Bb11) and Bacillus thuringiensis var. kurstaki (Berliner) with neem oil were evaluated in three agroecological zones in Be´nin. Four bioinsecticide treatments (neem oil, neem oil and B. bassiana used

  4. Can neem oil help eliminate lice? Randomised controlled trial with and without louse combing

    Directory of Open Access Journals (Sweden)

    Christine M. Brown

    2017-06-01

    Full Text Available Background: Neem oil and wet combing with conditioner are both claimed to facilitate elimination of head louse infestation. The aim of this pilot study was to identify whether a 1% neem oil lotion showed activity itself and/or enhanced the effectiveness of combing in treating infestation. Methods: We treated 47 participants with 1% neem-based lotion on four occasions 3-4 days apart in a randomised, community based trial, analysed by intention to treat. The participants were randomly divided between two groups: One group used a grooming comb (placebo and the other a head louse detection and removal comb (wet combing with conditioner method to systematically comb the hair. Cure was defined as no lice on both Day 10 and Day 14. Results: The cure rates of 6/24 (25.0% for the placebo comb group and 8/23 (34.8% for the louse comb group were not significantly different. Conclusion: These results indicate that this formulation of neem oil was ineffective in the treatment of head louse infestations, even when accompanied by combing. Both combing methods were also ineffective, despite being implemented throughout by trained professionals.

  5. Safety evaluation of neem (Azadirachta indica) derived pesticides

    NARCIS (Netherlands)

    Boeke, S.J.; Boersma, M.G.; Alink, G.M.; Loon, van J.J.A.; Huis, van A.; Dicke, M.; Rietjens, I.M.C.M.

    2004-01-01

    The neem tree, Azadirachta indica, provides many useful compounds that are used as pesticides and could be applied to protect stored seeds against insects. However in addition to possible beneficial health effects, such as blood sugar lowering properties, anti-parasitic, anti-inflammatory,

  6. In Vitro Bioactivity and Antimicrobial Tuning of Bioactive Glass Nanoparticles Added with Neem (Azadirachta indica) Leaf Powder

    Science.gov (United States)

    Prabhu, M.; Ruby Priscilla, S.; Kavitha, K.; Manivasakan, P.; Rajendran, V.; Kulandaivelu, P.

    2014-01-01

    Silica and phosphate based bioactive glass nanoparticles (58SiO2-33CaO-9P2O5) with doping of neem (Azadirachta indica) leaf powder and silver nanoparticles were prepared and characterised. Bioactive glass nanoparticles were produced using sol-gel technique. In vitro bioactivity of the prepared samples was investigated using simulated body fluid. X-ray diffraction (XRD) pattern of prepared glass particles reveals amorphous phase and spherical morphology with a particle size of less than 50 nm. When compared to neem doped glass, better bioactivity was attained in silver doped glass through formation of hydroxyapatite layer on the surface, which was confirmed through XRD, Fourier transform infrared (FTIR), and scanning electron microscopy (SEM) analysis. However, neem leaf powder doped bioactive glass nanoparticles show good antimicrobial activity against Staphylococcus aureus and Escherichia coli and less bioactivity compared with silver doped glass particles. In addition, the biocompatibility of the prepared nanocomposites reveals better results for neem doped and silver doped glasses at lower concentration. Therefore, neem doped bioactive glass may act as a potent antimicrobial agent for preventing microbial infection in tissue engineering applications. PMID:25276834

  7. In vitro bioactivity and antimicrobial tuning of bioactive glass nanoparticles added with neem (Azadirachta indica) leaf powder.

    Science.gov (United States)

    Prabhu, M; Ruby Priscilla, S; Kavitha, K; Manivasakan, P; Rajendran, V; Kulandaivelu, P

    2014-01-01

    Silica and phosphate based bioactive glass nanoparticles (58SiO2-33CaO-9P2O5) with doping of neem (Azadirachta indica) leaf powder and silver nanoparticles were prepared and characterised. Bioactive glass nanoparticles were produced using sol-gel technique. In vitro bioactivity of the prepared samples was investigated using simulated body fluid. X-ray diffraction (XRD) pattern of prepared glass particles reveals amorphous phase and spherical morphology with a particle size of less than 50 nm. When compared to neem doped glass, better bioactivity was attained in silver doped glass through formation of hydroxyapatite layer on the surface, which was confirmed through XRD, Fourier transform infrared (FTIR), and scanning electron microscopy (SEM) analysis. However, neem leaf powder doped bioactive glass nanoparticles show good antimicrobial activity against Staphylococcus aureus and Escherichia coli and less bioactivity compared with silver doped glass particles. In addition, the biocompatibility of the prepared nanocomposites reveals better results for neem doped and silver doped glasses at lower concentration. Therefore, neem doped bioactive glass may act as a potent antimicrobial agent for preventing microbial infection in tissue engineering applications.

  8. Kapten Brus : "Tank on argument." / Neeme Brus ; interv. Rainer Kerge

    Index Scriptorium Estoniae

    Brus, Neeme, 1957-

    2005-01-01

    Bagdadis avalike suhete ohvitserina teeniv kapten Neeme Brus Iraagi elanike suhtumisest rahutagamismissioonil olevatesse sõduritesse, koalitsioonivägede omavahelisest suhtlemisest, terrorismiohust. Lisa: Valitsus toetas missiooni pikendamist

  9. Safety assessment of botanicals and botanical preparations used as ingredients in food supplements: Testing an EFS tired approach

    NARCIS (Netherlands)

    Speijers, G.; Bottex, B.; Dusemund, B.; Lugasi, A.; Toth, J.; Amberg-Muller, J.; Galli, C.; Silano, V.; Rietjens, I.

    2010-01-01

    This article describes results obtained by testing the European Food Safety Authority-tiered guidance approach for safety assessment of botanicals and botanical preparations intended for use in food supplements. Main conclusions emerging are as follows. (i) Botanical ingredients must be identified

  10. EFFICIENCY OF COMPOSTING PARTHENIUM PLANT AND NEEM LEAVES IN THE PRESENCE AND ABSENCE OF AN OLIGOCHAETE, EISENIA FETIDA

    Directory of Open Access Journals (Sweden)

    S. Sivakumar ، H. Kasthuri ، P. Senthilkumar ، C. V. Subbhuraam ، Y. C. Song

    2009-07-01

    Full Text Available Parthenium plants and neem leaves were composted using the epigeic earthworm, Eisenia fetida (worm-worked compost to study the growth and reproductive indices of earthworm involved in the process of composting. Similarly, parthenium plants and neem leaves were composted without worms (worm-unworked compost. Efficacy of the resulting composts in supporting the growth of plant was tested with the germination and growth of Vigna radiate seedlings. The results showed that higher parthenium amendment significantly reduced the growth and reproduction of Eisenia fetida compared with control. The two-way ANOVA results showed a significant difference in the growth rate of worms when exposed to different amended concentrations of parthenium plants and neem leaves at different durations as fixed factors. The following compost parameters were not significantly different when compared with control: pH, nitrogen, phosphorus, iron for parthenium worm-worked compost; nitrogen, phosphorus, magnesium, iron, organic carbon and carbon/nitrogen ratio for neem worm-worked compost; nitrogen, phosphorus and organic carbon for parthenium worm-unworked compost and pH, nitrogen, phosphorus, zinc and carbon/nitrogen ratio for neem worm-unworked compost. Between parthenium plant composts and neem leaves composts, significant differences were not observed in any of the plant biometric parameters. The results obtained from the present study indicated that the parthenium composting at low amendments with cow dung may help its eradication for better utilization.

  11. diets containing gliricidia ( Gliricidia sepium ) and neem ...

    African Journals Online (AJOL)

    This study investigated the effect of Gliricidia sepium with neem leaves supplementation on nutrient retentions for body weight gain in ewe-lambs. Twelve West African dwarf ewe-lambs with an average weight of 7.00 ± 0.32kg were randomly allotted to three dietary tratments with four ewe-lambs per treatment in a ...

  12. Moisture Sorption Isotherms and Properties of Sorbed Water of Neem ( Azadirichta indica A. Juss) Kernels

    Science.gov (United States)

    Ngono Mbarga, M. C.; Bup Nde, D.; Mohagir, A.; Kapseu, C.; Elambo Nkeng, G.

    2017-01-01

    A neem tree growing abundantly in India as well as in some regions of Asia and Africa gives fruits whose kernels have about 40-50% oil. This oil has high therapeutic and cosmetic qualities and is recently projected to be an important raw material for the production of biodiesel. Its seed is harvested at high moisture contents, which leads tohigh post-harvest losses. In the paper, the sorption isotherms are determined by the static gravimetric method at 40, 50, and 60°C to establish a database useful in defining drying and storage conditions of neem kernels. Five different equations are validated for modeling the sorption isotherms of neem kernels. The properties of sorbed water, such as the monolayer moisture content, surface area of adsorbent, number of adsorbed monolayers, and the percent of bound water are also defined. The critical moisture content necessary for the safe storage of dried neem kernels is shown to range from 5 to 10% dry basis, which can be obtained at a relative humidity less than 65%. The isosteric heats of sorption at 5% moisture content are 7.40 and 22.5 kJ/kg for the adsorption and desorption processes, respectively. This work is the first, to the best of our knowledge, to give the important parameters necessary for drying and storage of neem kernels, a potential raw material for the production of oil to be used in pharmaceutics, cosmetics, and biodiesel manufacturing.

  13. Larvicidal effects of a neem (Azadirachta indica oil formulation on the malaria vector Anopheles gambiae

    Directory of Open Access Journals (Sweden)

    Knols Bart GJ

    2007-05-01

    Full Text Available Abstract Background Larviciding is a key strategy used in many vector control programmes around the world. Costs could be reduced if larvicides could be manufactured locally. The potential of natural products as larvicides against the main African malaria vector, Anopheles gambiae s.s was evaluated. Methods To assess the larvicidal efficacy of a neem (Azadirachta indica oil formulation (azadirachtin content of 0.03% w/v on An. gambiae s.s., larvae were exposed as third and fourth instars to a normal diet supplemented with the neem oil formulations in different concentrations. A control group of larvae was exposed to a corn oil formulation in similar concentrations. Results Neem oil had an LC50 value of 11 ppm after 8 days, which was nearly five times more toxic than the corn oil formulation. Adult emergence was inhibited by 50% at a concentration of 6 ppm. Significant reductions on growth indices and pupation, besides prolonged larval periods, were observed at neem oil concentrations above 8 ppm. The corn oil formulation, in contrast, produced no growth disruption within the tested range of concentrations. Conclusion Neem oil has good larvicidal properties for An. gambiae s.s. and suppresses successful adult emergence at very low concentrations. Considering the wide distribution and availability of this tree and its products along the East African coast, this may prove a readily available and cheap alternative to conventional larvicides.

  14. LC-MS/MS analysis of neonicotinoid insecticides: Residue findings in chilean honeys

    Directory of Open Access Journals (Sweden)

    Raquel Bridi

    Full Text Available ABSTRACT Neonicotinoids are a relatively new generation of insecticides that have been used for control of pests such as aphids, leafhoppers and whiteflies. This paper presents for the first time a determination of residues of four neonicotinoid insecticides (acetamiprid, thiamethoxam, thiacloprid and imidacloprid in Chilean honey using QuEChERS extraction and UHPLC-MS/MS analysis. The limits of detection and quantification found for all analytes ranging from 0.34 to 1.43 μg kg-1 and from 0.30 to 4.76 μg kg-1, respectively. The extraction using QuEChERS method provided recoveries over 79% and the precision showed coefficient of variation lower than 20%. These data are in agreement with the international criteria that recommend general recovery limits of 70 - 120%. Of the 16 samples analyzed, in three honey samples neonicotinoids pesticides were detected. These three samples were collected from the same geographical area (Rengo. Fruit and grain production characterize the province of Rengo. The analysis of the botanical origin of these honeys showed the absence of pollen grains of crops and the majority presence of pollen grains of weeds such as Medicago sativa, Galega officinalis and Brassica rapa, which could be associated with crops. Although the residue levels found were low, the results also confirm the actual occurrence of a transfer of neonicotinoid insecticides from exposed honeybees into honey.

  15. Neem by-products in the fight against mosquito-borne diseases: Biotoxicity of neem cake fractions towards the rural malaria vector Anopheles culicifacies (Diptera: Culicidae

    Directory of Open Access Journals (Sweden)

    Balamurugan Chandramohan

    2016-06-01

    Conclusions: Overall, this study suggests that the methanolic fractions of neem cake may be considered as a new and cheap source of highly effective compounds against the rural malaria vector An. culicifacies.

  16. Comparison of Insecticide Susceptibilities of Empoasca vitis (Hemiptera: Cicadellidae) from Three Main Tea-Growing Regions in China.

    Science.gov (United States)

    Wei, Qi; Yu, Hua-Yang; Niu, Chun-Dong; Yao, Rong; Wu, Shun-Fan; Chen, Zhuo; Gao, Cong-Fen

    2015-06-01

    Empoasca vitis (Göthe) is an important insect pest in tea-growing areas of China, and chemical control is the main tactic for the management of this pest. Due to the pressure of increasing insecticide resistance and more stringent food safety regulations, development of sound IPM strategies for E. vitis is an urgent matter. This study comparatively evaluated four field populations of E. vitis from three different tea-growing regions in China for their susceptibilities to eight insecticides using a simple leaf-dip methodology. E. vitis was found to be most sensitive to indoxacarb (LC505 mg/liter) and sophocarpidine (LC50>95 mg/liter, a botanical pesticide) regardless of populations. Population (geographical) variations were higher for indoxacarb and imidacloprid than other compounds. Judging by the 95% fiducial limits of LC50 values, all populations had similar susceptibilities to chlorfenapyr, bifenthrin, and acetamiprid or imidacloprid. Correlation analysis suggested that chlorfenapyr and indoxacarb or isoprocarb may have a high risk of cross resistance. Considering potency (LC50) and maximum residual levels, chlorfenapyr and bifenthrin are good insecticide options followed by acetamiprid and indoxacarb. These results provide valuable information to intelligently select insecticides for IPM programs that are efficacious against E. vitis while also managing insecticide resistance and maximum residual levels for tea production in China. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  17. A solvent induced crystallisation method to imbue bioactive ingredients of neem oil into the compact structure of poly (ethylene terephthalate) polyester

    Energy Technology Data Exchange (ETDEWEB)

    Ali, Wazed [Department of Textile Technology, Indian Institute of Technology, Hauz Khas, New Delhi 110016 (India); Sultana, Parveen [Department of Physics, Jadavpur University, Kolkata 700032 (India); Joshi, Mangala [Department of Textile Technology, Indian Institute of Technology, Hauz Khas, New Delhi 110016 (India); Rajendran, Subbiyan, E-mail: sr2@bolton.ac.uk [Institute for Materials Research and Innovation, The University of Bolton, Bolton BL3 5AB (United Kingdom)

    2016-07-01

    Neem oil, a natural antibacterial agent from neem tree (Azadarichtaindica) has been used to impart antibacterial activity to polyester fabrics. Solvent induced polymer modification method was used and that facilitated the easy entry of neem molecules into the compact structure of polyethylene terephthalate (PET) polyester. The polyester fabric was treated with trichloroacetic acid-methylene chloride (TCAMC) solvent system at room temperature prior to treatment with neem oil. The concentration of TCAMC and the treatment time were optimised. XRD and SEM results showed that the TCAMC treatment causes polymer modification and morphological changes in the PET polyester. Antibacterial activity of TCAMC pre-treated and neem-oil-treated polyester fabric was tested using AATCC qualitative and quantitative methods. Both Gram-positive and Gram-negative organisms were used to determine the antimicrobial activity. It was observed that the treated fabric registers substantial antimicrobial activity against both the Staphylococcus aureus (Gram-positive) and the Escherichia coli (Gram-negative) and the effect increases with the increase in concentration of TCAMC treatment. The antibacterial effect remains substantial even after 25 launderings. A kinetic growth study involving the effect of antibacterial activity at various incubation times was carried out. - Highlights: • A novel technique whereby the antibacterial components of neem oil are imbued into the compact structure of PET polyester • Trichloroacetic acid-Methylene Chloride treatment facilitated the easy entry of neem ingredients into the PET structure • Neem oil treated PET registered substantial antibacterial efficacy • Antibacterial effect is retained even after multiple use-wash cycles.

  18. Visualization of DNA in highly processed botanical materials.

    Science.gov (United States)

    Lu, Zhengfei; Rubinsky, Maria; Babajanian, Silva; Zhang, Yanjun; Chang, Peter; Swanson, Gary

    2018-04-15

    DNA-based methods have been gaining recognition as a tool for botanical authentication in herbal medicine; however, their application in processed botanical materials is challenging due to the low quality and quantity of DNA left after extensive manufacturing processes. The low amount of DNA recovered from processed materials, especially extracts, is "invisible" by current technology, which has casted doubt on the presence of amplifiable botanical DNA. A method using adapter-ligation and PCR amplification was successfully applied to visualize the "invisible" DNA in botanical extracts. The size of the "invisible" DNA fragments in botanical extracts was around 20-220 bp compared to fragments of around 600 bp for the more easily visualized DNA in botanical powders. This technique is the first to allow characterization and visualization of small fragments of DNA in processed botanical materials and will provide key information to guide the development of appropriate DNA-based botanical authentication methods in the future. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Morphological alterations in salivary glands of Rhipicephalus sanguineus ticks (Acari: Ixodidae) exposed to neem seed oil with known azadirachtin concentration.

    Science.gov (United States)

    Remedio, R N; Nunes, P H; Anholeto, L A; Oliveira, P R; Sá, I C G; Camargo-Mathias, M I

    2016-04-01

    Neem (Azadirachta indica) has attracted the attention of researchers worldwide due to its repellent properties and recognized effects on the morphology and physiology of arthropods, including ticks. Therefore, this study aimed to demonstrate the effects of neem seed oil enriched with azadirachtin on salivary glands of Rhipicephalus sanguineus ticks, targets of great veterinary interest because of their ability to transmit pathogens to dogs. For this, R. sanguineus semi-engorged females were subjected to treatment with neem seed oil, with known azadirachtin concentrations (200, 400 and 600ppm). After dissection, salivary glands were collected and evaluated through morphological techniques in light microscopy, confocal scanning laser microscopy and transmission electron microscopy, so that the possible relation between neem action and further impairment in these ectoparasites feed performance could be established. Neem oil demonstrated a clear dose-dependent effect in the analyzed samples. The agranular (type I) and granular acini (types II and III) showed, particularly in individuals treated with the highest concentrations of the product, cells with irregular shape, intense cytoplasmic disorganization and vacuolation, dilation of rough endoplasmic reticulum lumen, besides alterations in mitochondrial intermembrane space. These morphological damages may indicate modifications in salivary glands physiology, demonstrating the harmful effects of compounds present in neem oil on ticks. These results reinforce the potential of neem as an alternative method for controlling R. sanguineus ticks, instead of synthetic acaricides. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. Effects of Fusarium verticilloides , its metabolites and neem leaf ...

    African Journals Online (AJOL)

    41.18%), Fusarium spp. (29.41%) and Rhizopus spp. (23.53%). F. verticilloides metabolite was extracted using dichloromethane and phosphoric acid (10:1) while powdered neem leaf was extracted with ethanol for 72 h. The experiment, which ...

  1. Repellent Action of Neem (Azadirachta indica) Seed Oil Cream ...

    African Journals Online (AJOL)

    Nekky Umera

    hemorrahagic fever (DHF) and filariasis, are serious public health problems in tropical ... mosquito bites is one of the main strategies to control or minimize incidence .... The neem seed kernel yields an acrid bitter greenish yellow to brown fixed.

  2. Susceptibility of Aedes aegypti pupae to neem seed kernal extracts ...

    African Journals Online (AJOL)

    Azadirachta indica) seed kernel extracts (NSKE) on Aedes aegypti. The neem seed kernel powder was sequentially extracted with hexane, benzene, ethyl acetate, acetone, DMSO, 2-propanol, ethanol, methanol and dstiledwater.

  3. Antimicrobial effectiveness of Neem (Azadirachta indica and Babool (Acacia nilotica on Streptococcus mutans: An in vitro study

    Directory of Open Access Journals (Sweden)

    R Pandya Sajankumar

    2015-01-01

    Full Text Available Introduction: There is an exponential growth in the field of herbal medicine because of their natural origin, easy availability, efficacy, and safety. Aim: To compare the antimicrobial effectiveness of Neem and Babool on Streptococcus mutans. Materials and Methods: An in vitro study was conducted to compare the effectiveness of 5%, 10%, and 50% of Neem and Babool aqueous extract with 5%, 10%, and 50% of 0.2% chlorhexidine mouthwash on S. mutans. The ditch plate method was used to test the antimicrobial activity. Ditches were prepared on blood agar plates with the help of punch having 7 mm diameter. The plates were left for 1 h at room temperature and then incubated at 37°C for 48 h and examined for zone of inhibition. Results: Inhibitory effect of 5% Neem is significantly better than 5% Babool and 5% chlorhexidine mouthwash (P < 0.05. At 10% and 50%, Neem and Babool are significantly better than chlorhexidine mouthwash (P < 0.05. Inhibitory effect of Babool increases as the concentration increases (P < 0.05. The inhibitory effect of 5% and 50% chlorhexidine mouthwash is better than 10% chlorhexidine mouthwash (P < 0.05. Conclusion: Aqueous extract of Neem exhibited the highest antimicrobial activity compared with Babool and chlorhexidine mouthwash.

  4. GROWTH AND MINERAL NUTRITION OF NEEM (Azadirachta indica A. Juss. AND CINNAMOMUM (Melia azedarach Linn. SUBMITTED TO SALINITY

    Directory of Open Access Journals (Sweden)

    Antonio Lucineudo de Oliveira Freire

    2010-08-01

    Full Text Available The objective of this study was to verify the effects of soil salinity on growth and nutrient and sodium accumulation in neem (Azadirachta indica and cinnamomum (Melia azedarach. The experimental delineation was completely randomized in a 2 x 4 factorial arrangement, with two species (neem and cinnamomum, four salinity levels (electrical conductivity 0.49 (non saline soil, 4.15, 6.33 and 10.45 dS m-1 and four replications. Initially, plants were grown in tubes, and 60 days after emergence, they were transferred to pots containing 3 kg of substrate [soil + manure (2:1], according to the saline treatment. After 45 days, plant height, dry matter (leaves, stem, shoot (stem + leaves, roots and total and N, P, K, Ca, Mg, S and Na+ shoot accumulation were evaluated. Salinity reduced the plant height in both species, but the effect was more pronounced in neem. Increases in soil salinity caused an increase in the accumulation of Na + and reduced the accumulation of nutrients in shoots of both species, especially in neem. The cinnamomum was more tolerant to salinity levels of soils than neem.

  5. Insecticidal and Repellent Properties of Subtropical Plant Extracts Against Pulse Beetle, Callosobruchus chinensis

    Directory of Open Access Journals (Sweden)

    H.T. AI Lawati

    2002-01-01

    Full Text Available Extracts of eight plants local to Oman, namely Qarat (Acacia nilotica, Mustafal (Annona squamosa, Shereesh (Azadirachta indica, Luban (Boswellia sacra, Kheshkhash (Crotolaria juncea, Zebrot (Jatropha dhofarica Yas, (Myrtus communis and Suwwad (Suaeda aegyptiaca were prepared by steeping shaded dried leaf/ seed powder of each plant in water and solvent (methanol or ethanol. The extracts were tested for their insecticidal and repellent properties against the pulse beetles, Callosobruchus chinensis. The extracts from the seeds of A. squamosa recorded l00% mortality of beetles within twenty and four hours of their exposure to methanol and ethanol extracts, respectively. The other extracts that caused high mortality were from A. nilotica, C. juncea, M. communis and S. aegzptiaca in methanol and B. sacra, J. dhofarica, S. aegptiaca and commercial neem in ethanol. Extracts of M. communis in methanol were highly repellent to the beetles compared to other extracts. Legume seeds treated with extracts of A. squamosa were not repellent, rather the beetles were attracted to them.

  6. Molecular Insights into the Potential Insecticidal Interaction of β-Dihydroagarofuran Derivatives with the H Subunit of V-ATPase

    Directory of Open Access Journals (Sweden)

    Jielu Wei

    2017-10-01

    Full Text Available Celangulin V (CV, one of dihydroagarofuran sesquiterpene polyesters isolated from Chinese bittersweet (Celastrus angulatus Maxim, is famous natural botanical insecticide. Decades of research suggests that is displays excellent insecticidal activity against some insects, such as Mythimna separata Walker. Recently, it has been validated that the H subunit of V-ATPase is one of the target proteins of the insecticidal dihydroagarofuran sesquiterpene polyesters. As a continuation of the development of new pesticides from these natural products, a series of β-dihydroagarofuran derivatives have been designed and synthesized. The compound JW-3, an insecticidal derivative of CV with a p-fluorobenzyl group, exhibits higher insecticidal activity than CV. In this study, the potential inhibitory effect aused by the interaction of JW-3 with the H subunit of V-ATPase c was verified by confirmatory experiments at the molecular level. Both spectroscopic techniques and isothermal titration calorimetry measurements showed the binding of JW-3 to the subunit H of V-ATPase was specific and spontaneous. In addition, the possible mechanism of action of the compound was discussed. Docking results indicated compound JW-3 could bind well in ‘the interdomain cleft’ of the V-ATPase subunit H by the hydrogen bonding and make conformation of the ligand–protein complex become more stable. All results are the further validations of the hypothesis, that the target protein of insecticidal dihydroagarofuran sesquiterpene polyesters and their β-dihydroagarofuran derivatives is the subunit H of V-ATPase. The results also provide new ideas for developing pesticides acting on V-ATPase of insects.

  7. Systems of organic farming in spring vetch I: Biological response of sucking insect pests

    Directory of Open Access Journals (Sweden)

    Ivelina Nikolova

    2015-04-01

    Full Text Available Four systems of organic farming and a conventional farming system were studied over the period 2012-2014. The organic system trial variants included: I – an organic farming system without any biological products used (growth under natural soil fertility – Control; II – an organic farming system involving the use of a biological foliar fertilizer and a biological plant growth regulator (Polyversum+Biofa; III – an organic farming system in which a biological insecticide (NeemAzal T/S was used; IV – an organic farming system including a combination of three organic products: the foliar fertilizer, the plant growth regulator and the bioinsecticide (Polyversum+Biofa+NeemAzal T/S. Variant V represented a conventional farming system in which synthetic products were used in combination (foliar fertilizer, plant growth regulator and insecticide: Masterblend+Flordimex 420+Nurelle D. Treatment of vetch plants with the biological insecticide NeemAzal in combination with Biofa and Polyversum resulted in the lowest density of sucking pests, compared to all other organic farming methods tested (i.e. without NeemAzal, with NeemAzal alone, and its combination with Biofa and Polyversum. The greatest reduction in pest numbers during the vegetation period in that variant was observed in species of the order Thysanoptera (36.0-41.4%, followed by Hemiptera, and the families Aphididae (31.6-40.3% and Cicadellidae (27.3-28.6%. This combination showed an efficient synergistic interaction and an increase in biological efficacy as compared to individual application of NeemAzal. The highest toxic impact was found against Thrips tabaci, followed by Acyrthosiphon pisum. An analysis of variance regarding the efficacy against the species A. pisum, E. pteridis and T. tabaci showed that type of treatment had the most dominant influence and statistically significant impact.

  8. Schostakowitsch. Orchesterlieder (Vol. 2), Neeme Järvi / Werner Pfister

    Index Scriptorium Estoniae

    Pfister, Werner

    1996-01-01

    Uuest heliplaadist "Schostakowitsch. Orchesterlieder (Vol. 2): Sechs Romanzen op. 21, Sechs Gedichte op. 143a, Suite auf Verse von Michelangelo Buonarroti op. 145a. Göteborger Sinfoniker, Neeme Järvi". DG CD 447 085-2 (WD: 71'06") DDD

  9. field assessment of the nematicidal properties of neem (azadirachta

    African Journals Online (AJOL)

    iya beji

    AZADIRACHTA INDICA) ... yield of treated tomato plants. Key Words: Neem, Nematicidal Properties, Root Knot Nematode, Tomato. .... Means with the same letter in the same column do not differ significantly at P = 0.05 according to Duncan`s multiple ...

  10. Azadirachta indica (neem) leaf dietary effects on the immunity response and disease resistance of Asian seabass, Lates calcarifer challenged with Vibrio harveyi.

    Science.gov (United States)

    Talpur, Allah Dad; Ikhwanuddin, Mhd

    2013-01-01

    The present study was aimed to address the possible evaluation of Azadirachta indica (neem) leaf-supplemented diets on innate immune response in Asian seabass, Lates calcarifer fingerlings against Vibrio harveyi infection. Fish were fed for two weeks diets containing six graded levels of neem leaf at 0 g, 1 g, 2 g, 3 g, 4 g and 5 g per kg feed. Fish fed neem leaf-supplemented diet displayed significant differences (p growth rate (SGR) and feed conversion ratio (FCR) compared to the control group fed without neem leaf-supplemented diet. Various innate immune parameters were examined pre-challenge and post-challenge. Fish was injected intraperitoneally with a lethal dose of V. harveyi containing 10(8) cells mL(-1). Supplementation of neem leaf diet significantly increased phagocytic activity, superoxide anion production, serum lysozyme, serum bactericidal activity, serum anti-protease activity throughout the experimental period when compared with the control group. Dietary doses of neem leaf diet significantly influenced the immune parameters, haematological parameters and blood biochemical indices of treated fish. The results suggested that fish fed neem leaf-supplemented diet improved the immune system and increased survival rate in L. calcarifer fingerlings against V. harveyi infection. Copyright © 2012 Elsevier Ltd. All rights reserved.

  11. Eficiência e efeitos subletais de nim sobre Bonagota salubricola (Meyrick (Lepidoptera: Tortricidae Efficiency and sublethal effects of neem on Bonagota salubricola (Meyrick (Lepidoptera: Tortricidae

    Directory of Open Access Journals (Sweden)

    Daniel Bernardi

    2011-06-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência e os efeitos subletais de um inseticida à base de nim (10 g.L-1 de azadiractina A sobre a lagarta-enroladeira Bonagota salubricola em laboratório. Nos bioensaios, foi utilizado o produto à base de azadiractina NeemAzal-T/S® nas concentrações de 0,06%; 0,09%; 0,12%; 0,16%; 0,18% e 0,20% do produto comercial (p.c e uma testemunha (água destilada. A dieta artificial foi cortada em cubos e imersa nas caldas das respectivas concentrações do produto, e, em seguida, lagartas recém-eclodidas foram transferidas para tubos de vidro, contendo os cubos de dieta tratados. Quando a dieta artificial foi tratada com concentração de 0,20% do produto comercial, houve 100% da mortalidade aos 6 dias após a inoculação. Por outro lado, as concentrações de 0,16 e 0,18% prolongaram a fase larval, reduziram a viabilidade de pupas e afetaram negativamente a fecundidade do inseto.The objective of this study was to evaluate the efficiency of control and sublethal effects of neem insecticide (10 g.L-1 of azadirachtin A to the leafroller Bonagota salubricola at laboratory condition. In the bioassays, it was used an azadirachtin based product (NeemAzal-T/S® at concentrations of 0.06%, 0.09%, 0.12%, 0.16%, 0.18% and 0.20% of the commercial product (c.p. and a control (distilled water. The artificial diet was cut in cubes and immersed in the syrups of the respective product concentrations, soon afterwards recently-emerged caterpillars were transferred to glass tubes, containing the diet cubes treated. When the artificial diet was treated with a concentration of 0.20% of the commercial product, the mortality was 100% at the 6th day after inoculation. Additionally, concentrations of 0.16% and 0.18% extended the larval stages, reduced pupae viability and negatively affected the fecundity of the insect.

  12. Effectiveness of Azadirachtin (NeemAzal-T/S in Controlling Pear Psylla (Cacopsylla pyri and European Red Mite (Panonychus ulmi

    Directory of Open Access Journals (Sweden)

    Dejan Marčić

    2009-01-01

    Full Text Available Here we present the results of field trials conducted in Serbia to evaluate the effectiveness of a neem-based product, NeemAzal-T/S (containing azadirachtin-A as its active ingredient in the form of an emulsifiable concentrate against pear psylla (Cacopsylla pyri and European red mite (Panonychus ulmi. Efficacy evaluation against C. pyri was carried out in a commercial pear orchard of the Williams pear cultivar, located at Borkovac (Ruma. The insecticides were applied at BBCH 09 pear growth stage, several days before the beginning of hatching of the first generation larvae. The efficacy of azadirachtin was compared to that of mineral oil, abamectin and diflubenzuron. Efficacy evaluation 18 DAT showed total termination of egg laying by C. pyri after treatments with azadirachtin and abamectin, while some new (white eggs were found after treatment with mineral oil. Diflubenzuron treatment failed to fully stop egg laying, but the number of white eggs was significantly lower than it was in the control. Azadirachtin and abamectin achieved 100% efficacy, while the effectiveness of mineral oil was 97.4%, and that of diflubenzuron a mere 59%. All four insecticides significantly reduced the number of older (yellow eggs and larvae, the efficacy being 80.5-92.6% (yellow eggs, 69.8-79.3% (larvae I-III instar and 94.3-100% (larvae IV-V instar. In evaluation 38 DAT, azadirachtin,abamectin and mineral oil achieved 100% efficacy against white and yellow eggs, while diflubenzuron achieved 93% and 86.9% efficacy. All four insecticides were found to demonstrate high efficacy against I-III instar larvae (99.2-100%, but mineral oil treatmentalone achieved high efficacy against IV-V instar larvae (92.4% as well. Efficacy evaluation against P. ulmi was carried out in a commercial orchard of the Red Chief apple cultivar located at Morović (Šid. Azadirachtin efficacy in controlling a summerpopulation of European red mite was compared to a mineral oil, clofentezine and

  13. A regulatory science viewpoint on botanical-drug interactions.

    Science.gov (United States)

    Grimstein, Manuela; Huang, Shiew-Mei

    2018-04-01

    There is a continued predisposition of concurrent use of drugs and botanical products. Consumers often self-administer botanical products without informing their health care providers. The perceived safety of botanical products with lack of knowledge of the interaction potential poses a challenge for providers and both efficacy and safety concerns for patients. Botanical-drug combinations can produce untoward effects when botanical constituents modulate drug metabolizing enzymes and/or transporters impacting the systemic or tissue exposure of concomitant drugs. Examples of pertinent scientific literature evaluating the interaction potential of commonly used botanicals in the US are discussed. Current methodologies that can be applied to advance our efforts in predicting drug interaction liability is presented. This review also highlights the regulatory science viewpoint on botanical-drug interactions and labeling implications. Copyright © 2018. Published by Elsevier B.V.

  14. Environmental safety to decomposer invertebrates of azadirachtin (neem) as a systemic insecticide in trees to control emerald ash borer.

    Science.gov (United States)

    Kreutzweiser, David; Thompson, Dean; Grimalt, Susana; Chartrand, Derek; Good, Kevin; Scarr, Taylor

    2011-09-01

    The non-target effects of an azadirachtin-based systemic insecticide used for control of wood-boring insect pests in trees were assessed on litter-dwelling earthworms, leaf-shredding aquatic insects, and microbial communities in terrestrial and aquatic microcosms. The insecticide was injected into the trunks of ash trees at a rate of 0.2 gazadirachtin cm(-1) tree diameter in early summer. At the time of senescence, foliar concentrations in most (65%) leaves where at or below detection (azadirachtin) and the average concentration among leaves overall at senescence was 0.19 mg kg(-1). Leaves from the azadirachtin-treated trees at senescence were added to microcosms and responses by test organisms were compared to those in microcosms containing leaves from non-treated ash trees (controls). No significant reductions were detected among earthworm survival, leaf consumption rates, growth rates, or cocoon production, aquatic insect survival and leaf consumption rates, and among terrestrial and aquatic microbial decomposition of leaf material in comparison to controls. In a further set of microcosm tests containing leaves from intentional high-dose trees, the only significant, adverse effect detected was a reduction in microbial decomposition of leaf material, and only at the highest test concentration (∼6 mg kg(-1)). Results indicated no significant adverse effects on litter-dwelling earthworms or leaf-shredding aquatic insects at concentrations up to at least 30 × the expected field concentrations at operational rates, and at 6 × expected field concentrations for adverse effects on microbial decomposition. We conclude that when azadirachtin is used as a systemic insecticide in trees for control of insect pests such as the invasive wood-boring beetle, emerald ash borer, resultant foliar concentrations in senescent leaf material are likely to pose little risk of harm to decomposer invertebrates. Crown Copyright © 2011. Published by Elsevier Inc. All rights reserved.

  15. Scientific Opinion on a Qualified Presumption of Safety (QPS) approach for the safety assessment of botanicals and botanical preparations

    DEFF Research Database (Denmark)

    Pilegaard, Kirsten

    preparation for QPS status, it has been possible to develop a structured assessment scheme that provides a practical method for assessing botanicals and botanical preparations for which an adequate body of knowledge exists and therefore without the need for further testing. Reiterative applications...... in the development of a comprehensive, systematic and transparent methodology. The Scientific Committee recommends its use as an extension of the 2009 EFSA guidance for the safety assessment of botanicals and botanical preparations intended to be used in food supplements....

  16. 75 FR 52737 - Pesticide Product Registrations; Unconditional and Conditional Approvals

    Science.gov (United States)

    2010-08-27

    ...: Plasma Neem Oil Biological insecticide, EPA Registration Number 84185-4 for use on several food and non...) of the Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA), of registrations for pesticide... the end of the relevant registration approval summary using the instructions provided under FOR...

  17. 2215-IJBCS-Article-Abla Dela Mondedji

    African Journals Online (AJOL)

    hp

    Efficacité d'extraits de feuilles de neem Azadirachta indica (Sapindale) sur ... été comparée à celle d'un insecticide de synthèse (Cydim Super) et à celles d'un extrait aqueux de feuilles de ..... insecticides in Kangwon alpine vegetable.

  18. Response of finishing broiler chickens to supplemental Neem ...

    African Journals Online (AJOL)

    An eight weeks feeding trial was conducted to investigate the effects of feeding diets containing Neem Leaf Meal (NLM), Garlic Meal (GM) and their combinations (NLM +GM) on oocyst count, bacteria count and gut morphology of finishing broiler chickens. A total of 180 day-old Cobb broiler chickens were divided into twelve ...

  19. Toxic effects of neem products (Azadirachta indica A. Juss) on ...

    African Journals Online (AJOL)

    SERVER

    2007-12-17

    Dec 17, 2007 ... Key words: Azadirachta indica (neem), Aedes aegypti (mosquito), LC50, ... constitute a major problem of public health and lead to ... of Coleoptera Epilachnus varivestus and caused sterility .... with a balm of Canada.

  20. In vitro assay of the inhibitory effect of neem callus and leaf extracts on some phytopathogenes

    International Nuclear Information System (INIS)

    El Gaali, E.; Mukhtar, I.

    2006-01-01

    The effect of different concentrations of neem (Azadirachta indica) callus and leaf extracts on the radial growth of drechslera rostrata, fusarium oxysporum and alterneria alternata was assessed. Obvious inhibitory effect was observed on the mycelia radial growth of the three treated fungi. The level of inhibition increased with the increase of the extract concentration. The maximum inhibitory effect (84%) was recorded with drechslera rostrata when inoculated in media containing 20 mg/ml of neem callus extract, while the inhibition rate of the mycelial growth of the same species reached 61% when inoculated in a medium containing the same concentration of neem leaf extract. The subsequent concentrations of the callus and leaf extracts gave similar trends of inhibition on the fungi cultured on extract amended agar plates. (Author)

  1. Effect of extracts of plants with insecticidal activity on the control of Microtheca ochroloma Stal (Col: Chrysomelidae in the laboratory

    Directory of Open Access Journals (Sweden)

    Cíntia Grendene Lima

    2008-03-01

    Full Text Available Extracts of plants with insecticidal activity were tested on the control of Microtheca ochroloma (Col.: Chrysomelidae, an important insect-pest of Brassicaceae, in the larval and adult phases. Two 3-day-old larvae, kept under laboratory conditions (25ºC temperature, 70% relative humidity and 14 hours of photophase, were placed in a glass tube with a leaf of Chinese cabbage (Brassica chinensis previously treated with aqueous extracts (10% p/v of chinaberry leaf (Melia azedarach, chinaberry branch, and tobacco powder (Nicotiana tabacum. The same procedure was repeated in two assays with adult insects. In the first assay, all the previously-mentioned extracts were used, in addition to DalNeem (commercial product of Azadirachta indica. In the second, the insects were exposed to extracts of tabasco pepper fruits (Capsicum frutescens, Surinam cherry (Eugenia unifl ora, jambolan (Syzygium cuminii and eucalyptus leaves (Eucalyptus sp.. All the tests consisted of 10 insects per treatment, with five repetitions in the first test using adult insects and six repetitions in the others. Observations were made daily up to the fifth day, aiming to evaluate the mortality of the insects. All the tested extracts resulted in an effective control of the larvae of M. ochroloma. In relation to the adult insects, only the extracts of tobacco powder and DalNeem showed effective control.

  2. The crop-residue of fiber hemp cv. Futura 75: from a waste product to a source of botanical insecticides.

    Science.gov (United States)

    Benelli, Giovanni; Pavela, Roman; Lupidi, Giulio; Nabissi, Massimo; Petrelli, Riccardo; Ngahang Kamte, Stephane L; Cappellacci, Loredana; Fiorini, Dennis; Sut, Stefania; Dall'Acqua, Stefano; Maggi, Filippo

    2018-04-01

    In the attempt to exploit the potential of the monoecious fiber hemp cv. Futura 75 in new fields besides textile, cosmetics and food industry, its crop-residue given by leaves and inflorescences was subjected to hydrodistillation to obtain the essential oils. These are niche products representing an ideal candidate for the development of natural insecticides for the control and management of mosquito vectors, houseflies and moth pests. After GC-MS analysis highlighting a safe and legal chemical profile (THC in the range 0.004-0.012% dw), the leaf and inflorescence essential oils were investigated for the insecticidal potential against three insect targets: the larvae of Culex quinquefasciatus and Spodoptera littoralis and the adults of Musca domestica. The essential oil from inflorescences, showing (E)-caryophyllene (21.4%), myrcene (11.3%), cannabidiol (CBD, 11.1%), α-pinene (7.8%), terpinolene (7.6%), and α-humulene (7.1%) as the main components, was more effective than leaf oil against these insects, with LD 50 values of 65.8 μg/larva on S. littoralis, 122.1 μg/adult on M. domestica, and LC 50 of 124.5 μl/l on C. quinquefasciatus larvae. The hemp essential oil moderately inhibited the acetylcholinesterase (AChE), which is a target enzyme in pesticide science. Overall, these results shed light on the future application of fiber hemp crop-residue for the development of effective, eco-friendly and sustainable insecticides.

  3. Estimation of Heavy Metals in Neem Tree Leaves along Katsina ...

    African Journals Online (AJOL)

    Michael Horsfall

    Key Words: Neem tree, Heavy metals, Pollution. Determination ... concentrations of pollutants in the tree bark correlate with those of ... hence are not readily detoxified and removed by .... levels can severely damage the brain and kidneys and.

  4. SINERGISME CENDAWAN ENTOMOPATOGEN Lecanicillium lecanii DENGAN INSEKTISIDA NABATI UNTUK MENINGKATKAN EFIKASI PENGENDALIAN TELUR KEPIK COKLAT Riptortus linearis PADA KEDELAI

    Directory of Open Access Journals (Sweden)

    Yusmani Prayogo

    2011-11-01

    Full Text Available The aim of the research was to study the synergism of entomopathogenic fungi Lecanicillium lecanii with botanical insecticides to control brown stink bug. The research was carried out in the field experiment station (Kendalpayak of Indonesian Legume and Tuber Crops Research Institute (ILETRI. Randomized block design (RBD was used, each treatment was repeated  three times. The treatments were three types of botanical insecticides i.e; Aglaia odorata leaf powder (ALP, Annona squamosa seed powder (ASP, and Jatropha curcas seed powder (JSP of 25, 50 and 75 g/l respectively were combined with the conidia of L. lecanii. The results showed that the addition of botanical insecticides into the media can improve growth and development of the fungus L. lecanii. The higher dose of botanical insecticide in combination with the L. lecanii, the greater efficacy of both agents are in controlling brown stink bug eggs. Synergism of combination of L. lecanii and botanical insecticides were shown from the number of unhatched eggs (above 77% compared with a single application. The fewer number of brown stink bug eggs hatching, caused the limited number of brown stink bug can developed become adult, resulting reduced soybean seeds and pods damaged. The combination of L. lecanii and botanical insecticides was able to maintain weight of soybean seed up to 35% compared to single treatment (control. The combination of L. lecanii and ASP and JSP botanical pesticides were more synergist compared with combination of L. lecanii with ALP. Dose of 50 g/l botanical pesticide JSP and ALP were combined with the L. lecanii was an optimal dose to control of brown stink bug eggs.

  5. Insecticide solvents: interference with insecticidal action.

    Science.gov (United States)

    Brattsten, L B; Wilkinson, C F

    1977-06-10

    Several commercial solvent mixtures commonly used as insecticide carriers in spray formulations increase by more than threefold the microsomal N-demethylation of p-chloro N-methylaniline in midgut preparations of southern army-worm (Spodoptera eridania) larvae exposed orally to the test solvents. Under laboratory conditions, the same solvent mixtures exhibit a protective action against the in vivo toxicity of the insecticide carbaryl to the larvae. The data are discussed with respect to possible solvent-insecticide interactions occurring under field conditions and, more broadly, to potential toxicological hazards of these solvents to humans.

  6. Progress on Azadirachta indica Based Biopesticides in Replacing Synthetic Toxic Pesticides.

    Science.gov (United States)

    Chaudhary, Suman; Kanwar, Rupinder K; Sehgal, Alka; Cahill, David M; Barrow, Colin J; Sehgal, Rakesh; Kanwar, Jagat R

    2017-01-01

    Over the years, extensive use of commercially available synthetic pesticides against phytophagous insects has led to their bioaccumulation in the environment causing increased resistance and reduction in soil biodiversity. Further, 90% of the applied pesticides enter the various environmental resources as a result of run-off, exposing the farmers as well as consumers of the agricultural produce to severe health issues. Therefore, growing attention has been given toward the development of alternate environmentally friendly pesticides/insecticides that would aid an efficient pest management system and also prevent chronic exposures leading to diseases. One such strategy is, the use of neem plant's (Binomial name: Azadirachta indica ) active ingredients which exhibit agro-medicinal properties conferring insecticidal as well as immunomodulatory and anti-cancer properties. The most prominent constituent of neem is azadirachtin, which has been established as a pivotal insecticidal ingredient. It acts as an antifeedant, repellent, and repugnant agent and induces sterility in insects by preventing oviposition and interrupting sperm production in males. This review discusses, key neem pesticidal components, their active functional ingredients along with recent strategies on employing nanocarriers, to provide controlled release of the active ingredients and to improve their stability and sustainability.

  7. Progress on Azadirachta indica Based Biopesticides in Replacing Synthetic Toxic Pesticides

    Directory of Open Access Journals (Sweden)

    Suman Chaudhary

    2017-05-01

    Full Text Available Over the years, extensive use of commercially available synthetic pesticides against phytophagous insects has led to their bioaccumulation in the environment causing increased resistance and reduction in soil biodiversity. Further, 90% of the applied pesticides enter the various environmental resources as a result of run-off, exposing the farmers as well as consumers of the agricultural produce to severe health issues. Therefore, growing attention has been given toward the development of alternate environmentally friendly pesticides/insecticides that would aid an efficient pest management system and also prevent chronic exposures leading to diseases. One such strategy is, the use of neem plant's (Binomial name: Azadirachta indica active ingredients which exhibit agro-medicinal properties conferring insecticidal as well as immunomodulatory and anti-cancer properties. The most prominent constituent of neem is azadirachtin, which has been established as a pivotal insecticidal ingredient. It acts as an antifeedant, repellent, and repugnant agent and induces sterility in insects by preventing oviposition and interrupting sperm production in males. This review discusses, key neem pesticidal components, their active functional ingredients along with recent strategies on employing nanocarriers, to provide controlled release of the active ingredients and to improve their stability and sustainability.

  8. Progress on Azadirachta indica Based Biopesticides in Replacing Synthetic Toxic Pesticides

    Science.gov (United States)

    Chaudhary, Suman; Kanwar, Rupinder K.; Sehgal, Alka; Cahill, David M.; Barrow, Colin J.; Sehgal, Rakesh; Kanwar, Jagat R.

    2017-01-01

    Over the years, extensive use of commercially available synthetic pesticides against phytophagous insects has led to their bioaccumulation in the environment causing increased resistance and reduction in soil biodiversity. Further, 90% of the applied pesticides enter the various environmental resources as a result of run-off, exposing the farmers as well as consumers of the agricultural produce to severe health issues. Therefore, growing attention has been given toward the development of alternate environmentally friendly pesticides/insecticides that would aid an efficient pest management system and also prevent chronic exposures leading to diseases. One such strategy is, the use of neem plant's (Binomial name: Azadirachta indica) active ingredients which exhibit agro-medicinal properties conferring insecticidal as well as immunomodulatory and anti-cancer properties. The most prominent constituent of neem is azadirachtin, which has been established as a pivotal insecticidal ingredient. It acts as an antifeedant, repellent, and repugnant agent and induces sterility in insects by preventing oviposition and interrupting sperm production in males. This review discusses, key neem pesticidal components, their active functional ingredients along with recent strategies on employing nanocarriers, to provide controlled release of the active ingredients and to improve their stability and sustainability. PMID:28533783

  9. In vitro clonal propagation of the neem tree (Azadirachta indica A ...

    African Journals Online (AJOL)

    SERVER

    2008-02-19

    2202, Bangladesh. 2Department of Crop Botany, Bangladesh Agricultural University, ... However, comer- cialization of neem products (oil and azadirachtin) is greatly hindered by the limitation of natural resources. (Isman ...

  10. Sibelius: Scaramouche op. 71, Neeme Järvi / Rainer Wagner

    Index Scriptorium Estoniae

    Wagner, Rainer

    1991-01-01

    Uuest heliplaadist "Sibelius: Scaramouche op. 71 [World Premiere REcording of the Complete Score]. Hochzeitmarsch aus der Musik zum Drama Die Sprache der Vögel [Wedding March "The Language of the Birds"]. Göteborger Sinfoniker, Neeme Järvi. BIS/Disco-Ccenter CD 502 (WD:68'28") DDD

  11. Insecticidal activities and phytochemical screening of crude extracts and its derived fractions from three medicinal plants Nepeta leavigata, Nepeta kurramensis and Rhynchosia reniformis

    International Nuclear Information System (INIS)

    Ahmad, N.; Shinwari, Z.K.

    2016-01-01

    The extracts and its derived fractions from three medicinal plants species Nepeta leavigata, Nepeta kurramensis and Rhynchosia reniformis were tested for insecticidal activities and preliminary phytochemical evaluation with the intention of standardization and proper manage of bioactive principles in such heterogonous botanicals and to encourage drug finding work with plants. The crude extracts and fractions from Nepeta plants showed moderate to strong insecticidal activity. Among the fractions from Nepeta kurramensis the n-butanol fraction showed strongest insecticidal activity with 89% mortality rate against Tribolium castaneum followed by methanol extract with 88% mortality ratio and in case of Nepeta leavigata the potential activity was showed by methanol extracts with 93% mortality rate against the tested insect. Surprisingly none of the extract / fractions obtained from Rhynchosia reniformis plant exhibited any insecticidal activity. The phytochemicals screening results revealed that both species of Nepeta showed similar phytochemicals profile. The group of chemicals terpenes, flavonoids and glycosides were observed in all the extracts/fractions of Nepeta plants. While phenolic compounds, acidic compounds and alkaloids were found in methanolic extracts, chloroform fraction and ethyl acetate fraction. The Rhynchosia reniformis was observed to be a good source of phenolic compounds, flavonoids, terpenes, alkaloids and fats. (author)

  12. Safety assessment of botanicals and botanical preparations used as ingredients in food supplements: testing an European Food Safety Authority-tiered approach.

    Science.gov (United States)

    Speijers, Gerrit; Bottex, Bernard; Dusemund, Birgit; Lugasi, Andrea; Tóth, Jaroslav; Amberg-Müller, Judith; Galli, Corrado L; Silano, Vittorio; Rietjens, Ivonne M C M

    2010-02-01

    This article describes results obtained by testing the European Food Safety Authority-tiered guidance approach for safety assessment of botanicals and botanical preparations intended for use in food supplements. Main conclusions emerging are as follows. (i) Botanical ingredients must be identified by their scientific (binomial) name, in most cases down to the subspecies level or lower. (ii) Adequate characterization and description of the botanical parts and preparation methodology used is needed. Safety of a botanical ingredient cannot be assumed only relying on the long-term safe use of other preparations of the same botanical. (iii) Because of possible adulterations, misclassifications, replacements or falsifications, and restorations, establishment of adequate quality control is necessary. (iv) The strength of the evidence underlying concerns over a botanical ingredient should be included in the safety assessment. (v) The matrix effect should be taken into account in the safety assessment on a case-by-case basis. (vi) Adequate data and methods for appropriate exposure assessment are often missing. (vii) Safety regulations concerning toxic contaminants have to be complied with. The application of the guidance approach can result in the conclusion that safety can be presumed, that the botanical ingredient is of safety concern, or that further data are needed to assess safety.

  13. Toxicity of neem's oil, a potential biocide against the invasive mussel Limnoperna fortunei (Dunker 1857

    Directory of Open Access Journals (Sweden)

    Patricio J. Pereyra

    2012-12-01

    Full Text Available The golden mussel Limnoperna fortunei (Dunker 1857 is one of the most distributed Nuisance Invasive Species (NIS in South America, and a threat of great concern for the industry of the area. In this study, we carried out toxicity tests made with a Neem's oil solution with L. fortunei larvae and benthonic adults (7, 13 and 19 ± 1 mm. Tests with non-target species (Daphnia magna, Lactuca sativa and Cnesterodon decemmculatus were also made with the aim to evaluate the potential toxicity of the Neem's solution in the environment. The LC100 of Neem's solution obtained for larvae was 500 µl/L, a value much higher than the one obtained for D. magna and C. decemmaculatus. Thus, we recommend that it should not be used in open waters. However, since the adults were killed in 72 h and the larvae in 24 h, this product can be used in closed systems, in man-made facilities.O Mexilhão dourado Limnoperna fortunei (Dunker 1857 é uma das espécies invasoras melhor distribuídas na América do Sul, sendo motivo de grande preocupação para a indústria local. Neste estudo, nós realizamos ensaios de toxicidade de soluções de Óleo de Neem em larvas e adultos bentônicos de L. fortune (7, 13 e 19 ± 1 mm. Com o objetivo de avaliar o potencial tóxico do Óleo de Neem no ambiente também foram realizados testes com organismos não alvo (Daphnia magna, Lactuca sativa e Cnesterodon decemmculatus. A LC100 da solução de Neem para larvas foi 500 µl/L, um valor muito superior ao obtido para D. magna e C. decemmaculatus. Desta forma, nossa recomendação é que este óleo não deve ser utilizado em ambientes naturais abertos. No entanto, uma vez que os adultos morreram em 72h e as larvas em 24h, este produto pode ser utilizado em sistemas fechados construídos pelo homem.

  14. Botanical polysaccharides: macrophage immunomodulation and therapeutic potential.

    Science.gov (United States)

    Schepetkin, Igor A; Quinn, Mark T

    2006-03-01

    Botanical polysaccharides exhibit a number of beneficial therapeutic properties, and it is thought that the mechanisms involved in these effects are due to the modulation of innate immunity and, more specifically, macrophage function. In this review, we summarize our current state of understanding of the macrophage modulatory effects of botanical polysaccharides isolated from a wide array of different species of flora, including higher plants, mushrooms, lichens and algae. Overall, the primary effect of botanical polysaccharides is to enhance and/or activate macrophage immune responses, leading to immunomodulation, anti-tumor activity, wound-healing and other therapeutic effects. Furthermore, botanical and microbial polysaccharides bind to common surface receptors and induce similar immunomodulatory responses in macrophages, suggesting that evolutionarily conserved polysaccharide structural features are shared between these organisms. Thus, the evaluation of botanical polysaccharides provides a unique opportunity for the discovery of novel therapeutic agents and adjuvants that exhibit beneficial immunomodulatory properties.

  15. Comparative evaluation of the antimicrobial efficacy of neem, green tea, triphala and sodium hypochlorite: An in vitro study

    Directory of Open Access Journals (Sweden)

    Karan Bhargava

    2015-01-01

    Full Text Available Introduction: The main objective of root canal treatment is to disinfect the entire root canal system. Although cleaning and shaping and use of antimicrobial medicaments are effective in reducing the bacterial load some bacteria do remain behind and multiply, causing reinfection of the canal. Considering the ineffectiveness, potential side effects and safety concerns of synthetic drugs, the herbal alternatives for endodontic usage might prove to be advantageous. Aim: To check the antimicrobial efficacy of Neem, Green Tea, Triphala and sodium hypochlorite against the endodontic microflora. Materials and Methods: Mixed cultures of bacteria were isolated from patients, with carious teeth and associated with periapical radiolucencies. A paper point was inserted into the canal to obtain a sample of a mixed culture of micro organisms. These paper points were cultured and agar diffusion test was done for the different irrigants. The irrigants were divided into Group I: Neem (60mg/ml in 10% DMSO,Group II: Green Tea Polyphenols (60mg/ml in 10% DMSO, Group III: Triphala (60 mg/ml in 10% DMSO, Group IV: 3% NaOCI, Group V: Sterile saline. Results: Sodium hypochlorite showed the maximum antimicrobial activity, followed by Neem. There was no statistical difference between the activity of sodium hypochlorite and Neem. This was followed by Triphala and Green Tea, respectively. Conclusion: Neem is as effective as Sodium Hypochlorite against endodontic microflora.

  16. Sibelius: Der Sturm, Op. 109, Neeme Järvi / Gerhard Pätzig

    Index Scriptorium Estoniae

    Pätzig, Gerhard

    1990-01-01

    Uuest heliplaadist "Sibelius: Der Sturm, Op. 109, (Vorspiel und Konzertsuiten zu Shakespeares Drama), Cassazione, Op.6, Preludio, Tiera. Sinfonieorchester Göteborg, Neeme Järvi". BIS/ Disco-Center CD 448 71'43") DDD

  17. Indirect effect of neem oil on Podisus nigrispinus (Hemiptera, Pentatomidae: biology and predatory capacity

    Directory of Open Access Journals (Sweden)

    Aniele Pianoscki de Campos

    2014-10-01

    Full Text Available This study evaluated the effects on the development and predatory capacity of Podisus nigrispinus fed on Spodoptera frugiperda that have ingested different concentrations of neem oil. The predatory capacity of Podisus nigrispinus was assessed, separating nymphs (fourth instar and adults (males and females. The treatments consisted of S. frugiperda larvae reared in neem oil aqueous solutions (0.077, 0.359 and 0.599%, deltamethrin EC 25 (0.100% and control arranged in a completely randomized design, with ten replicates. Insects were offered three larval densities (one, three and six, in the third or fourth instars. The predated larvae were examined at 24 and 48 hours after the beginning of the experiment. Biological parameters of Podisus nigrispinus were evaluated in groups of ten second-instar nymphs transferred to pots, in five replicates. Insects were offered 2-6 third and/or fourth-instar larvae reared in the same neem oil concentrations in a completely randomized design. The following parameters were evaluated: duration of each nymph stage (days, nymph mortality (%, weight of fifth-instar nymphs (mg, sex ratio, weight of males and females (mg and longevity of unfed adults (days. The predatory capacity of nymphs and adults of Podisus nigrispinus was influenced by the neem oil at the concentrations of 0.359% and 0.599% in the highest density. The concentration of 0.359% lengthened the nymphal stage and the concentration of 0.599% reduced the weight of males.

  18. The use of botanical products and vitamins in sunscreens.

    Science.gov (United States)

    Monico, Gabriela; Leo, Micheal; Ma, Brian; Johal, Ritika S; Ma, Thomas; Sivamani, Raja K

    2015-11-18

    The use of botanical products and vitamins in skin care creams and sunscreens is prevalent. Herein we conduct an evaluation of sunscreens to quantitatively assess how often sunscreens incorporate botanically derived products and vitamins. The most commonly used botanicals products and vitamins are identified and stratified based on the sunscreen sun protection factor (SPF). The overall prevalence for the use of botanical agents and vitamins was 62% and 79%, respectively. Aloe vera and licorice root extracts were the most common botanical agents used in sunscreens. Retinyl palmitate was the most common vitamin derivative utilized in sunscreens. The prices of sunscreens significantly increased when more than one botanical product was added. Botanical products and vitamins are widely utilized in sunscreens and more research is needed to assess how their inclusion may enhance or alter the function of sunscreens.

  19. Insecticidal effects of Ocimum sanctum var. cubensis essential oil on the diseases vector Chrysomya putoria

    Directory of Open Access Journals (Sweden)

    Idelsy Chil-Núñez

    2018-05-01

    Full Text Available Context: The blowfly Chrysomya putoria is widely distributed throughout the Neotropical region and, besides transmitting pathogens; they could cause secondary myiasis. Botanical insecticides provide an alternative to synthetic pesticides because the excessive use of synthetic insecticides resulted in a progressive resistance of the pests to these chemicals, diminishing their effectiveness and generating consequences with negative environmental impact. The essential oil extracted from Ocimum sanctum (basil has showed insecticidal activity against some insects but has no reported studies on the activity of this plant against flies. Aims: To evaluate the insecticidal effects of Ocimum sanctum var. cubensis Gomes essential oil on the post embryonic development of Chrysomya putoria. Methods: The colonies of Chrysomya putoria were established and maintained at the Laboratório de Entomologia Médica e Forense (FIOCRUZ, Rio de Janeiro, Brazil. The basil essential oil was tested in six concentrations (4.13, 8.25, 20.63, 41.25, 61.87 and 80,25 mg/mL. Mortality and changes in life cycle were recorded daily. Results: β-caryophyllene, β-selinene and eugenol, were the main constituents of the basil essential oil. The experiments demonstrated that in all concentrations tested, this essential oil shortening the duration of all post embryonic stages having a direct impact in the viability of this fly estimating the LC50 in 7.47 mg/mL of concentration. In addition, the essential oil caused morphological alterations in abdomen, wings and ptilinum at lower concentrations. Conclusions: This essential oil emerge as a good option for the control of the disease vector blowfly Chrysomya putoria.

  20. Effects of Fusarium verticilloides, its metabolites and neem leaf ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-07-18

    Jul 18, 2008 ... from the seeds samples were Aspergillus spp. (41.18%), Fusarium spp. (29.41%) and Rhizopus spp. (23.53%). F. verticilloides metabolite was extracted using dichloromethane and phosphoric acid (10:1) while powdered neem leaf was extracted with ethanol for 72 h. The experiment, which was made up of.

  1. Aqueous Neem Extract Versus Neem Powder on Culex quinquefasciatus: Implications for Control in Anthropogenic Habitats

    OpenAIRE

    Kudom, Andreas A.; Mensah, Ben A.; Botchey, Mary A.

    2011-01-01

    Control programs using conventional insecticides to target anthropogenic mosquito habitats are very expensive because these habitats are widespread, particularly in cities of most African countries. Additionally, there are serious environmental concerns regarding large-scale application of most conventional insecticides. Clearly there is a need for alternative methods that are more effective, less expensive, and environmentally friendly. One such method would be the application of preparation...

  2. Botanical Literature in India 1973-1983.

    Science.gov (United States)

    Maheswarappa, B. S.; Nagaraju, A.

    1988-01-01

    Describes a study that used bibliometrics to examine botanical research activity in India. The findings discussed include the growth of botanical literature, authorship patterns and collaborative research, important research centers and their rankings, journals preferred by Indian botanists, subfields of research, and the applicability of…

  3. Larvaecidal effects of aqueous extracts of Azadirachta indica (neem ...

    African Journals Online (AJOL)

    The effect of crude aqueous extracts of Azadirachta indica (neem) against the larvae of Anopheles mosquito was investigated. Exposure of the larvae to undiluted extracts of seed oil, leaf and bark for 12 hours led to 100, 98, and 48% mortality, respectively. Dilution of these extracts also resulted in mortality of the larvae.

  4. Application of neem tree in agriculture, industry, medicine, and ...

    African Journals Online (AJOL)

    The objective of this review was to consult and discuss the application of the Neem ... and it purifies the blood and prevents damage caused by free radicals to the body, ... The oil is removed from the seed for pharmaceuticals, paper, and food. ... to drug discovery and in chemotherapy in cancer prevention and development.

  5. Botanicals and Their Bioactive Phytochemicals for Women's Health.

    Science.gov (United States)

    Dietz, Birgit M; Hajirahimkhan, Atieh; Dunlap, Tareisha L; Bolton, Judy L

    2016-10-01

    Botanical dietary supplements are increasingly popular for women's health, particularly for older women. The specific botanicals women take vary as a function of age. Younger women will use botanicals for urinary tract infections, especially Vaccinium macrocarpon (cranberry), where there is evidence for efficacy. Botanical dietary supplements for premenstrual syndrome (PMS) are less commonly used, and rigorous clinical trials have not been done. Some examples include Vitex agnus-castus (chasteberry), Angelica sinensis (dong quai), Viburnum opulus/prunifolium (cramp bark and black haw), and Zingiber officinale (ginger). Pregnant women have also used ginger for relief from nausea. Natural galactagogues for lactating women include Trigonella foenum-graecum (fenugreek) and Silybum marianum (milk thistle); however, rigorous safety and efficacy studies are lacking. Older women suffering menopausal symptoms are increasingly likely to use botanicals, especially since the Women's Health Initiative showed an increased risk for breast cancer associated with traditional hormone therapy. Serotonergic mechanisms similar to antidepressants have been proposed for Actaea/Cimicifuga racemosa (black cohosh) and Valeriana officinalis (valerian). Plant extracts with estrogenic activities for menopausal symptom relief include Glycine max (soy), Trifolium pratense (red clover), Pueraria lobata (kudzu), Humulus lupulus (hops), Glycyrrhiza species (licorice), Rheum rhaponticum (rhubarb), Vitex agnus-castus (chasteberry), Linum usitatissimum (flaxseed), Epimedium species (herba Epimedii, horny goat weed), and Medicago sativa (alfalfa). Some of the estrogenic botanicals have also been shown to have protective effects against osteoporosis. Several of these botanicals could have additional breast cancer preventive effects linked to hormonal, chemical, inflammatory, and/or epigenetic pathways. Finally, although botanicals are perceived as natural safe remedies, it is important for women and

  6. Hawaiian propolis: comparative analysis and botanical origin.

    Science.gov (United States)

    Inui, Saori; Hosoya, Takahiro; Kumazaw, Shigenori

    2014-02-01

    Propolis is a resinous mixture of substances collected and processed from various botanical sources by honeybees (Apis mellifera). We recently obtained Hawaiian propolis, the study of which, to our knowledge, has not been reported. The purpose of this study was to analyze the composition of Hawaiian propolis and to identify its botanical origin. A comparative analysis of Hawaiian and Okinawan propolis and of the glandular trichomes on Macaranga tanarius fruit (the botanical origin of Okinawan propolis) was performed using reversed-phase high-performance liquid chromatography coupled with high resolution-electrospray mass spectrometry. Hawaiian propolis contained nine prenylflavonoids that were also isolated from Okinawan propolis. In conclusion, we suggest that the botanical origin of Hawaiian propolis is M. tanarius, the same as that of Okinawan propolis.

  7. [Potential of Metarhizium anisopliae and Beauveria bassiana isolates and neem oil to control the Aphid Lipaphis erysimi (Kalt.) (Hemiptera: Aphididae)].

    Science.gov (United States)

    de Araujo, José M; Marques, Edmilson J; de Oliveira, José V

    2009-01-01

    This work aimed to determine the efficiency of the entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera: Aphididae) in kale Brassica oleracea var acephala D.C., as well as their compatibility with a neem oil formulation (Neemseto). Ten isolates of both fungi were tested and the most pathogenic ones were B. bassiana CG001 and M. anisopliae CG30 with 90% and 4.4 days, and 64% and 3.8 days of mortality and median lethal time, respectively. Bioassays with neem at concentrations of 0.5, 1.0 and 2.0% were done either by leaf discs dipping or spraying the aphids on the leaf discs. The neem spraying treatment at 2.0% provided 90% mortality. The use of B. bassiana isolate CG001 or M. anisopliae isolate CG30 with neem at 0.125, 0.25, and 0.5%, demonstrated that these isolates could have their spore viability or colony growth affected when exposed to neem concentrations higher than 0.25%. In absolute values, the isolates B. bassiana CG001 and M. anisopliae CG30 are the most virulent to L. erysimi, and could be utilized in the management of this pest.

  8. Potential of Metarrhizium anisopliae and Beauveria bassiana isolates and Neem oil to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera: Aphididae)

    International Nuclear Information System (INIS)

    Araujo Junior, Jose M. de; Marques, Edmilson J.; Oliveira, Jose V. de

    2009-01-01

    This work aimed to determine the efficiency of the entomopathogenic fungi Metarrhizium anisopliae and Beauveria bassiana to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera:Aphididae) in kale Brassica oleracea var acephala D.C., as well as their compatibility with a neem oil formulation (Neemseto R ). Ten isolates of both fungi were tested and the most pathogenic ones were B. bassiana CG001 and M. anisopliae CG30 with 90% and 4.4 days, and 64% and 3.8 days of mortality and median lethal time, respectively. Bioassays with neem at concentrations of 0.5, 1.0 and 2.0% were done either by leaf discs dipping or spraying the aphids on the leaf discs. The neem spraying treatment at 2.0% provided 90% mortality. The use of B. bassiana isolate CG001 or M. anisopliae isolate CG30 with neem at 0.125, 0.25, and 0.5%, demonstrated that these isolates could have their spore viability or colony growth affected when exposed to neem concentrations higher than 0.25%. In absolute values, the isolates B. bassiana CG001 and M. anisopliae CG30 are the most virulent to L. erysimi, and could be utilized in the management of this pest. (author)

  9. Effect of Neem Seed Kernel Extracts in the Management of Rice ...

    African Journals Online (AJOL)

    user

    conducted to determine the comparative efficacy of neem seed kernel ... sustainable production of rice and are generally not affordable to African peasant farmers. ... system where the use of natural enemies are being emphasized as a major ...

  10. Performance of broiler chickens fed neem ( Azadirachta indica ) leaf ...

    African Journals Online (AJOL)

    One hundred and ninety-two day-old marshal broilers were used in an eight weeks feeding trial to evaluate the effects of neem (Azadirachta indica) leaf meal on growth performance and haematological parameters of broiler chickens. The birds were randomly assigned into four (4) groups of forty eight (48) birds each in a ...

  11. Effects of Fusarium verticilloides, its metabolites and neem leaf ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-07-18

    Jul 18, 2008 ... effect of neem leaf extracts on F. verticilloides, its meta- bolites on germination and ... blended into powder using an electric blender (National Mx 319 M). ... Niger State was measured into eight Buchuner flasks and added with 200 ml of .... been implicated in seed viability, wilting of plants, stem flaccidity and ...

  12. Barber: Sinfonie Nr. 1, Op. 9, Neeme Järvi / Bernhard Uske

    Index Scriptorium Estoniae

    Uske, Bernhard

    1991-01-01

    Uuest heliplaadist "Barber: Sinfonie Nr. 1, Op. 9. Ouvertüre School for Scandal, Op. 5; Beach: Sinfonie e-Moll, Op. 32, "Gaelic". Detroit Symphony Orchestra /Neeme Järvi". Chandes cassette ABTD 1550; CD CHAN 8958 (72 minutes)

  13. Stabilization of azadirachtin A in neem formulations: effect of some solid carriers, neem oil, and stabilizers.

    Science.gov (United States)

    Kumar, J; Parmar, B S

    1999-04-01

    Formulation of azadirachtin A on attapulgite, kaolinite, fuller's earth, hydrated calcium silicate, and fly ash revealed that it degraded to the tune of 70-95% on different solid carriers as compared to 56% in neem oil, during the 14 day heat storage studies at 54 +/- 1 degrees C in the laboratory. The degradation was reduced by 26-60% on different carriers by employing either anthraquinone or epichlorohydrin as stabilizer. Pyrogallol and hydroquinone enhanced the degradation. The cation exchange capacity and surface area of the carriers revealed a significant negative correlation with t(1/2) of azadirachtin A.

  14. (BST) and some bioassays using Neem ( Azadirachta indica A. Juss )

    African Journals Online (AJOL)

    The leaves of Neem (Azadirachta indica A.Juss) and Wild custard-apple (Annona senegalensis Pers) were extracted using ethanol and extracts were screened for bioactivity against brine shrimp larvae. The bioactive extracts in the brine shrimp test (BST) were investigated for correlation with aphid nematode and ...

  15. Estimation of Heavy Metals in Neem Tree Leaves along Katsina ...

    African Journals Online (AJOL)

    Widespread and growing use of medicinal plants has created public health challenges in terms of quality, safety and effectiveness. Using Atomic Absorption Spectrophotometer (AAS), concentrations of Ni, Zn, Mn, Cu, Cr and Pb, , were determined in samples of neem tree (Azadirachta indica) leaves obtained from Katsina, ...

  16. Neem ( Azadirachta indica a. juss) seedling growth as influenced by ...

    African Journals Online (AJOL)

    The effect of Arbuscular mycorrhizal fungus (AMF), specifically, Glomus moseae and cow dung on the growth of Neem (Azadiracchta indica, A. Juss) seedlings was investigated at the forestry quarters, Lagos Street, Maiduguri, Borno State, Nigeria. The study included three treatments: the cow dung, mycorrhizal treatments ...

  17. Pharmacokinetic Interactions between Drugs and Botanical Dietary Supplements

    Science.gov (United States)

    Sprouse, Alyssa A.

    2016-01-01

    The use of botanical dietary supplements has grown steadily over the last 20 years despite incomplete information regarding active constituents, mechanisms of action, efficacy, and safety. An important but underinvestigated safety concern is the potential for popular botanical dietary supplements to interfere with the absorption, transport, and/or metabolism of pharmaceutical agents. Clinical trials of drug–botanical interactions are the gold standard and are usually carried out only when indicated by unexpected consumer side effects or, preferably, by predictive preclinical studies. For example, phase 1 clinical trials have confirmed preclinical studies and clinical case reports that St. John’s wort (Hypericum perforatum) induces CYP3A4/CYP3A5. However, clinical studies of most botanicals that were predicted to interact with drugs have shown no clinically significant effects. For example, clinical trials did not substantiate preclinical predictions that milk thistle (Silybum marianum) would inhibit CYP1A2, CYP2C9, CYP2D6, CYP2E1, and/or CYP3A4. Here, we highlight discrepancies between preclinical and clinical data concerning drug–botanical interactions and critically evaluate why some preclinical models perform better than others in predicting the potential for drug–botanical interactions. Gaps in knowledge are also highlighted for the potential of some popular botanical dietary supplements to interact with therapeutic agents with respect to absorption, transport, and metabolism. PMID:26438626

  18. Insecticide control of vector-borne diseases: when is insecticide resistance a problem?

    Directory of Open Access Journals (Sweden)

    Ana Rivero

    Full Text Available Many of the most dangerous human diseases are transmitted by insect vectors. After decades of repeated insecticide use, all of these vector species have demonstrated the capacity to evolve resistance to insecticides. Insecticide resistance is generally considered to undermine control of vector-transmitted diseases because it increases the number of vectors that survive the insecticide treatment. Disease control failure, however, need not follow from vector control failure. Here, we review evidence that insecticide resistance may have an impact on the quality of vectors and, specifically, on three key determinants of parasite transmission: vector longevity, competence, and behaviour. We argue that, in some instances, insecticide resistance is likely to result in a decrease in vector longevity, a decrease in infectiousness, or in a change in behaviour, all of which will reduce the vectorial capacity of the insect. If this effect is sufficiently large, the impact of insecticide resistance on disease management may not be as detrimental as previously thought. In other instances, however, insecticide resistance may have the opposite effect, increasing the insect's vectorial capacity, which may lead to a dramatic increase in the transmission of the disease and even to a higher prevalence than in the absence of insecticides. Either way-and there may be no simple generality-the consequence of the evolution of insecticide resistance for disease ecology deserves additional attention.

  19. Transmission blocking activity of a standardized neem (Azadirachta indica) seed extract on the rodent malaria parasite Plasmodium berghei in its vector Anopheles stephensi

    Science.gov (United States)

    2010-01-01

    Background The wide use of gametocytocidal artemisinin-based combination therapy (ACT) lead to a reduction of Plasmodium falciparum transmission in several African endemic settings. An increased impact on malaria burden may be achieved through the development of improved transmission-blocking formulations, including molecules complementing the gametocytocidal effects of artemisinin derivatives and/or acting on Plasmodium stages developing in the vector. Azadirachtin, a limonoid (tetranortriterpenoid) abundant in neem (Azadirachta indica, Meliaceae) seeds, is a promising candidate, inhibiting Plasmodium exflagellation in vitro at low concentrations. This work aimed at assessing the transmission-blocking potential of NeemAzal®, an azadirachtin-enriched extract of neem seeds, using the rodent malaria in vivo model Plasmodium berghei/Anopheles stephensi. Methods Anopheles stephensi females were offered a blood-meal on P. berghei infected, gametocytaemic BALB/c mice, treated intraperitoneally with NeemAzal, one hour before feeding. The transmission-blocking activity of the product was evaluated by assessing oocyst prevalence, oocyst density and capacity to infect healthy mice. To characterize the anti-plasmodial effects of NeemAzal® on early midgut stages, i.e. zygotes and ookinetes, Giemsa-stained mosquito midgut smears were examined. Results NeemAzal® completely blocked P. berghei development in the vector, at an azadirachtin dose of 50 mg/kg mouse body weight. The totally 138 examined, treated mosquitoes (three experimental replications) did not reveal any oocyst and none of the healthy mice exposed to their bites developed parasitaemia. The examination of midgut content smears revealed a reduced number of zygotes and post-zygotic forms and the absence of mature ookinetes in treated mosquitoes. Post-zygotic forms showed several morphological alterations, compatible with the hypothesis of an azadirachtin interference with the functionality of the microtubule

  20. Transmission blocking activity of a standardized neem (Azadirachta indica seed extract on the rodent malaria parasite Plasmodium berghei in its vector Anopheles stephensi

    Directory of Open Access Journals (Sweden)

    Esposito Fulvio

    2010-03-01

    Full Text Available Abstract Background The wide use of gametocytocidal artemisinin-based combination therapy (ACT lead to a reduction of Plasmodium falciparum transmission in several African endemic settings. An increased impact on malaria burden may be achieved through the development of improved transmission-blocking formulations, including molecules complementing the gametocytocidal effects of artemisinin derivatives and/or acting on Plasmodium stages developing in the vector. Azadirachtin, a limonoid (tetranortriterpenoid abundant in neem (Azadirachta indica, Meliaceae seeds, is a promising candidate, inhibiting Plasmodium exflagellation in vitro at low concentrations. This work aimed at assessing the transmission-blocking potential of NeemAzal®, an azadirachtin-enriched extract of neem seeds, using the rodent malaria in vivo model Plasmodium berghei/Anopheles stephensi. Methods Anopheles stephensi females were offered a blood-meal on P. berghei infected, gametocytaemic BALB/c mice, treated intraperitoneally with NeemAzal, one hour before feeding. The transmission-blocking activity of the product was evaluated by assessing oocyst prevalence, oocyst density and capacity to infect healthy mice. To characterize the anti-plasmodial effects of NeemAzal® on early midgut stages, i.e. zygotes and ookinetes, Giemsa-stained mosquito midgut smears were examined. Results NeemAzal® completely blocked P. berghei development in the vector, at an azadirachtin dose of 50 mg/kg mouse body weight. The totally 138 examined, treated mosquitoes (three experimental replications did not reveal any oocyst and none of the healthy mice exposed to their bites developed parasitaemia. The examination of midgut content smears revealed a reduced number of zygotes and post-zygotic forms and the absence of mature ookinetes in treated mosquitoes. Post-zygotic forms showed several morphological alterations, compatible with the hypothesis of an azadirachtin interference with the functionality

  1. Safety issues of botanicals and botanical preparations in functional foods

    International Nuclear Information System (INIS)

    Kroes, R.; Walker, R.

    2004-01-01

    Although botanicals have played a role in the marketing of health products for ages, there is an increased interest today due to their perceived health benefits. Not only do consumers increasingly take charge of their health, but the scientific information and understanding of the beneficial health effects of bioactive substances in food, functional foods and food supplements have improved. Increasing use of these products has also led to concerns about their actual safety. Recorded cases of intoxications have triggered such concerns. The safety assessment of these substances is complicated by, amongst others, the variability of composition. Furthermore, consumption of such functional products is expected to produce physiological effects, which may lead to low margins of safety as the margin between exposure of such products and the safe level of intake are likely to be small. The safety assessment of botanicals and botanical preparations in food and food supplement should at least involve: - the characterisation and quality of the material, its quality control; - the intended use and consequent exposure; - history of use and exposure; - product comparison(s); - toxicological information gathering; - Risk characterisation/safety assessment; As a guidance tool, a decision tree approach is proposed to assist in determining the extent of data requirements based on the nature of the such product. This guidance tool in safety assessment was developed by an expert group of the International Life Sciences Institute (ILSI), European Branch, and is currently in press. In this paper a summarised version of this tool is presented

  2. Toxic effects of neem products (Azadirachta indica A. Juss) on ...

    African Journals Online (AJOL)

    SERVER

    2007-12-17

    Dec 17, 2007 ... *Corresponding author. E-mail. E-mail: raymondndione@yahoo.fr. Phone: (221) ... others related compounds in neem products exhibit various modes of action .... microscope "Motic" connected to a computer, permitting us to get ..... Bacillus sphaericus Neide as a pathogen of mosquitoes. J. Invert. Pathol., 7: ...

  3. Development of Safe and Effective Botanical Dietary Supplements.

    Science.gov (United States)

    van Breemen, Richard B

    2015-11-12

    Regulated differently than drugs or foods, the market for botanical dietary supplements continues to grow worldwide. The recently implemented U.S. FDA regulation that all botanical dietary supplements must be produced using good manufacturing practice is an important step toward enhancing the safety of these products, but additional safeguards could be implemented, and unlike drugs, there are currently no efficacy requirements. To ensure a safe and effective product, botanical dietary supplements should be developed in a manner analogous to pharmaceuticals that involves identification of mechanisms of action and active constituents, chemical standardization based on the active compounds, biological standardization based on pharmacological activity, preclinical evaluation of toxicity and potential for drug-botanical interactions, metabolism of active compounds, and finally, clinical studies of safety and efficacy. Completing these steps will enable the translation of botanicals from the field to safe human use as dietary supplements.

  4. Development of Safe and Effective Botanical Dietary Supplements

    Science.gov (United States)

    2015-01-01

    Regulated differently than drugs or foods, the market for botanical dietary supplements continues to grow worldwide. The recently implemented U.S. FDA regulation that all botanical dietary supplements must be produced using good manufacturing practice is an important step toward enhancing the safety of these products, but additional safeguards could be implemented, and unlike drugs, there are currently no efficacy requirements. To ensure a safe and effective product, botanical dietary supplements should be developed in a manner analogous to pharmaceuticals that involves identification of mechanisms of action and active constituents, chemical standardization based on the active compounds, biological standardization based on pharmacological activity, preclinical evaluation of toxicity and potential for drug–botanical interactions, metabolism of active compounds, and finally, clinical studies of safety and efficacy. Completing these steps will enable the translation of botanicals from the field to safe human use as dietary supplements. PMID:26125082

  5. Pharmacokinetics of Botanical Drugs and Plant Extracts.

    Science.gov (United States)

    Dominguez More, Gina Paola; Cardenas, Paola Andrea; Costa, Geison M; Simoes, Claudia M O; Aragon, Diana Marcela

    2017-01-01

    Botanical drugs contain plant extracts, which are complex mixtures of compounds. As with conventional drugs, it is necessary to validate their efficacy and safety through preclinical and clinical studies. However, pharmacokinetic studies for active constituents or characteristic markers in botanical drugs are rare. The objective of this review was to investigate the global state of the art in pharmacokinetic studies of active ingredients present in plant extracts and botanical drugs. A review of pharmacokinetics studies of chemical constituents of plant extracts and botanical drugs was performed, with a total of 135 studies published between January 2004 and February 2015 available in recognized scientific databases. Botanical preparations were mainly found in the form of aqueous extracts of roots and rhizomes. The most widely studied species was Salvia miltiorrhiza Bunge, and the compound most frequently used as a pharmacokinetic marker was berberine. Most studies were performed using the Sprague Dawley rat model, and the preparations were mainly administered orally in a single dose. Quantification of plasma concentrations of pharmacokinetic markers was performed mainly by liquid-liquid extraction, followed by high performance liquid chromatography coupled to mass spectrometry detector. In conclusion, in recent years there has been an increasing interest among researchers worldwide in the study of pharmacokinetics of bioactive compounds in botanical drugs and plant extracts, especially those from the Traditional Chinese Medicine. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  6. Integrated analytical assets aid botanical authenticity and adulteration management.

    Science.gov (United States)

    Simmler, Charlotte; Graham, James G; Chen, Shao-Nong; Pauli, Guido F

    2017-11-22

    This article reviews and develops a perspective for the meaning of authenticity in the context of quality assessment of botanical materials and the challenges associated with discerning adulterations vs. contaminations vs. impurities. Authentic botanicals are by definition non-adulterated, a mutually exclusive relationship that is confirmed through the application of a multilayered set of analytical methods designed to validate the (chemo)taxonomic identity of a botanical and certify that it is devoid of any adulteration. In practice, the ever-increasing sophistication in the process of intentional adulteration, as well as the growing number of botanicals entering the market, altogether necessitate a constant adaptation and reinforcement of authentication methods with new approaches, especially new technologies. This article summarizes the set of analytical methods - classical and contemporary - that can be employed in the authentication of botanicals. Particular emphasis is placed on the application of untargeted metabolomics and chemometrics. An NMR-based untargeted metabolomic model is proposed as a rapid, systematic, and complementary screening for the discrimination of authentic vs. potentially adulterated botanicals. Such analytical model can help advance the evaluation of botanical integrity in natural product research. Copyright © 2017. Published by Elsevier B.V.

  7. Insecticidal Properties of a Highly Potent Wax Isolated from Dolichandra cynanchoides Cham

    Directory of Open Access Journals (Sweden)

    Georgina Díaz Napal

    2016-08-01

    Full Text Available Bioassay-guided fractionation of an ethanolic extract of the aerial parts of Dolichandra cynanchoides Cham. (Bignoniaceae led to the isolation of a natural wax with anti-insect activity against Spodoptera frugiperda (Noctuidae and Epilachna paenulata (Coleptera. The compound was identified spectroscopically as an ester of a C27 fatty acid and a C25 alcohol, pentacosyl heptacosanoate (1. The effective doses of 1 for 50% feeding inhibition (ED50 of S. frugiperda and E. paenulata were 0.82 and 8.53 µg/cm2, respectively, in a choice test, while azadirachtin showed ED50 of 0.10 and 0.59 µg/cm2, respectively. In a no-choice test, both insects refused to feed on leaves treated with 1 at doses of 0.1 µg/cm2 or greater inhibiting larval growth and dramatically reducing survival. The lethal doses 50 (LD50 of 1 were 0.39 and 0.68 µg/cm2 for S. frugiperda and E. paenulata, respectively. These results indicate that 1 has potential for development as botanical insecticides. Similar esters might be obtainable in large quantities as many edible crops produce wax esters that are discarded during food processing. Research on these materials could lead to the detection of similar waxes with insecticidal activity.

  8. Pharmacokinetic Interactions between Drugs and Botanical Dietary Supplements.

    Science.gov (United States)

    Sprouse, Alyssa A; van Breemen, Richard B

    2016-02-01

    The use of botanical dietary supplements has grown steadily over the last 20 years despite incomplete information regarding active constituents, mechanisms of action, efficacy, and safety. An important but underinvestigated safety concern is the potential for popular botanical dietary supplements to interfere with the absorption, transport, and/or metabolism of pharmaceutical agents. Clinical trials of drug-botanical interactions are the gold standard and are usually carried out only when indicated by unexpected consumer side effects or, preferably, by predictive preclinical studies. For example, phase 1 clinical trials have confirmed preclinical studies and clinical case reports that St. John's wort (Hypericum perforatum) induces CYP3A4/CYP3A5. However, clinical studies of most botanicals that were predicted to interact with drugs have shown no clinically significant effects. For example, clinical trials did not substantiate preclinical predictions that milk thistle (Silybum marianum) would inhibit CYP1A2, CYP2C9, CYP2D6, CYP2E1, and/or CYP3A4. Here, we highlight discrepancies between preclinical and clinical data concerning drug-botanical interactions and critically evaluate why some preclinical models perform better than others in predicting the potential for drug-botanical interactions. Gaps in knowledge are also highlighted for the potential of some popular botanical dietary supplements to interact with therapeutic agents with respect to absorption, transport, and metabolism. Copyright © 2016 by The American Society for Pharmacology and Experimental Therapeutics.

  9. Phytochemical and Botanical Therapies for Rosacea: A Systematic Review.

    Science.gov (United States)

    Fisk, Whitney A; Lev-Tov, Hadar A; Clark, Ashley K; Sivamani, Raja K

    2015-10-01

    Botanical and cosmeceutical therapies are commonly used to treat symptoms of rosacea such as facial erythema, papules/pustule counts, and telangiectasia. These products may contain plant extracts, phytochemicals, and herbal formulations. The objective of this study was to review clinical studies evaluating the use of botanical agents for the treatment of rosacea. MEDLINE and Embase databases were searched for clinical studies evaluating botanical therapies for rosacea. Major results were summarized, and study methodology was analyzed. Several botanical therapies may be promising for rosacea symptoms, but few studies are methodologically rigorous. Several plant extract and phytochemicals effectively improved facial erythema and papule/pustule counts caused by rosacea. Many studies are not methodologically rigorous. Further research is critical, as many botanicals have been evaluated in only one study. Botanical agents may reduce facial erythema and effectively improve papule/pustule counts associated with rosacea. Although promising, further research in the area is imperative. Copyright © 2015 John Wiley & Sons, Ltd.

  10. Brahms J. Hungarian Dances. London Symphony Orchestra, Neeme Järvi / Jonathan Swain

    Index Scriptorium Estoniae

    Swain, Jonathan

    1991-01-01

    Uuest heliplaadist "Brahms J. Hungarian Dances. London Symphony Orchestra, Neeme Järvi. Chandos MC ABTD 1496; CD CHAN 8885 (57 minutes). Brahms J. Hungarian Dances. Staatskapelle Berlin. Otmar Suitner." Denon CD CO- 74597 (53 minutes)

  11. Effect of some biorational insecticides on Spodoptera eridania in organic cabbage.

    Science.gov (United States)

    Michereff-Filho, Miguel; Torres, Jorge B; Andrade, Luzia Nt; Nunes, Maria Urbana C

    2008-07-01

    To reduce pest attack, several biorational products are allowed for use on organic vegetables in Brazil. This study investigated eight biorational products applied singly or in combination against Spodoptera eridania Cramer in field plots of cabbage intercropped with coriander. The treatments were applied once a week over a 5 week period, beginning 34 days after transplanting. The evaluations consisted of counting the larvae of S. eridania on the day before and 7 and 21 days after spraying. The damage to leaves and cabbage head, the commercial weight of head and the percentage of head losses were evaluated. Leaf injury in plots treated with Beauveria bassiana and neem oil (Dalneem) yielded scores of 1.3 and 2.5 (scale ranging from 0 to 4) respectively, in comparison with a score of 3.6 from untreated plots. Head weight losses were 6.1, 5.3 and 4.9% with an aqueous extract of neem leaves, neem oil and B. bassiana respectively, compared with 24.6% lost from untreated plots. Dalneem, B. bassiana and the extract of neem leaves at 20% exhibited the best performance for control of S. eridania.

  12. Nematicidal influence of P.tuberreguim and neem extract on the ...

    African Journals Online (AJOL)

    Efficacy of Pleurotus tuberregium, Neem-leaf ash, carbofuram and combination of the three above were tested in the control of root-knot nematode (Meloidogyne incognita) on Hausa potato. In the green house, twenty-five polythene bags were filled with 10kg of steam-sterilized sandy loam soil and Hausa potato seedlings ...

  13. Oil and Azadirachtin contents of neem ( Azadirachta indica A. Juss ...

    African Journals Online (AJOL)

    This study aimed to quantify and evaluate the level of Azadirachtin in neem seed kernel from ten ecotypes in Sudan over two seasons and establish relationship to the agro-ecological attributes. Extraction was done in two replicates using 12 g. After extraction, separation and concentration to 10 ml the samples quantified ...

  14. Effect of water treated and urea treated neem ( Azadirachta indica ...

    African Journals Online (AJOL)

    In a study to evaluate the carcass haematological and biochemical characteristics of broiler birds fed graded levels of water and urea-treated neem kernel cake (NKC), 300 day-old broilers (Cobb, 500) were randomly assigned to five dietary treatments for 56 days. Water and feed were fed adlibitum. The diets were ...

  15. ESolvent-free, enzyme-catalyzed biodiesel production from mango, neem, and shea oils via response surface methodology.

    Science.gov (United States)

    Nde, Divine Bup; Astete, Carlos; Boldor, Dorin

    2015-12-01

    Mango, neem and shea kernels produce non-conventional oils whose potentials are not fully exploited. To give an added value to these oils, they were transesterified into biodiesel in a solvent-free system using immobilized enzyme lipozyme from Mucor miehei. The Doehlert experimental design was used to evaluate the methyl ester (ME) yields as influenced by enzyme concentration-EC, temperature-T, added water content-AWC, and reaction time-RT. Biodiesel yields were quantified by (1)H NMR spectroscopy and subsequently modeled by a second order polynomial equation with interactions. Lipozyme enzymes were more tolerant to high temperatures in neem and shea oils reaction media compared to that of mango oil. The optimum reaction conditions EC, T, AWC, and RT assuring near complete conversion were as follows: mango oil 7.25 %, 36.6 °C, 10.9 %, 36.4 h; neem oil EC = 7.19 %, T = 45.7 °C, AWC = 8.43 %, RT = 25.08 h; and shea oil EC = 4.43 %, T = 45.65 °C, AWC = 6.21 % and RT = 25.08 h. Validation experiments of these optimum conditions gave ME yields of 98.1 ± 1.0, 98.5 ± 1.6 and 99.3 ± 0.4 % for mango, neem and shea oils, respectively, which all met ASTM biodiesel standards.

  16. Botanicals and Their Bioactive Phytochemicals for Women’s Health

    Science.gov (United States)

    Dietz, Birgit M.; Hajirahimkhan, Atieh; Dunlap, Tareisha L.

    2016-01-01

    Botanical dietary supplements are increasingly popular for women’s health, particularly for older women. The specific botanicals women take vary as a function of age. Younger women will use botanicals for urinary tract infections, especially Vaccinium macrocarpon (cranberry), where there is evidence for efficacy. Botanical dietary supplements for premenstrual syndrome (PMS) are less commonly used, and rigorous clinical trials have not been done. Some examples include Vitex agnus-castus (chasteberry), Angelica sinensis (dong quai), Viburnum opulus/prunifolium (cramp bark and black haw), and Zingiber officinale (ginger). Pregnant women have also used ginger for relief from nausea. Natural galactagogues for lactating women include Trigonella foenum-graecum (fenugreek) and Silybum marianum (milk thistle); however, rigorous safety and efficacy studies are lacking. Older women suffering menopausal symptoms are increasingly likely to use botanicals, especially since the Women’s Health Initiative showed an increased risk for breast cancer associated with traditional hormone therapy. Serotonergic mechanisms similar to antidepressants have been proposed for Actaea/Cimicifuga racemosa (black cohosh) and Valeriana officinalis (valerian). Plant extracts with estrogenic activities for menopausal symptom relief include Glycine max (soy), Trifolium pratense (red clover), Pueraria lobata (kudzu), Humulus lupulus (hops), Glycyrrhiza species (licorice), Rheum rhaponticum (rhubarb), Vitex agnus-castus (chasteberry), Linum usitatissimum (flaxseed), Epimedium species (herba Epimedii, horny goat weed), and Medicago sativa (alfalfa). Some of the estrogenic botanicals have also been shown to have protective effects against osteoporosis. Several of these botanicals could have additional breast cancer preventive effects linked to hormonal, chemical, inflammatory, and/or epigenetic pathways. Finally, although botanicals are perceived as natural safe remedies, it is important for women and

  17. Turmeric powder and its derivatives from Curcuma longa rhizomes: Insecticidal effects on cabbage looper and the role of synergists.

    Science.gov (United States)

    de Souza Tavares, Wagner; Akhtar, Yasmin; Gonçalves, Gabriel Luiz Padoan; Zanuncio, José Cola; Isman, Murray B

    2016-11-02

    Curcuma longa has well-known insecticidal and repellent effects on insect pests, but its impact on Trichoplusia ni is unknown. In this study, the compound ar-turmerone, extracted and purified from C. longa rhizomes, was identified, and its insecticidal effects, along with turmeric powder, curcuminoid pigments and crude essential oil were evaluated against this important agricultural pest. The role of natural (sesamol and piperonal) and synthetic [piperonyl butoxide (PBO)] synergists under laboratory and greenhouse conditions were also evaluated. The concentration of ar-turmerone in C. longa rhizomes harvested was 0.32% (dwt). Turmeric powder and its derivatives caused 10-20% mortality in third instar T. ni at a very low dose (10 μg/larva). Addition of PBO increased toxicity of turmeric powder and its derivatives (90-97% mortality) in most binary combinations (5 μg of turmeric powder or its derivatives +5 μg of PBO), but neither piperonal nor sesamol were active as synergists. The compound ar-turmerone alone and the combination with PBO reduced larval weight on treated Brassica oleracea in the laboratory and in greenhouse experiments, compared with the negative control. The compound ar-turmerone could be used as a low cost botanical insecticide for integrated management of cabbage looper in vegetable production.

  18. Turmeric powder and its derivatives from Curcuma longa rhizomes: Insecticidal effects on cabbage looper and the role of synergists

    Science.gov (United States)

    de Souza Tavares, Wagner; Akhtar, Yasmin; Gonçalves, Gabriel Luiz Padoan; Zanuncio, José Cola; Isman, Murray B.

    2016-01-01

    Curcuma longa has well-known insecticidal and repellent effects on insect pests, but its impact on Trichoplusia ni is unknown. In this study, the compound ar-turmerone, extracted and purified from C. longa rhizomes, was identified, and its insecticidal effects, along with turmeric powder, curcuminoid pigments and crude essential oil were evaluated against this important agricultural pest. The role of natural (sesamol and piperonal) and synthetic [piperonyl butoxide (PBO)] synergists under laboratory and greenhouse conditions were also evaluated. The concentration of ar-turmerone in C. longa rhizomes harvested was 0.32% (dwt). Turmeric powder and its derivatives caused 10–20% mortality in third instar T. ni at a very low dose (10 μg/larva). Addition of PBO increased toxicity of turmeric powder and its derivatives (90–97% mortality) in most binary combinations (5 μg of turmeric powder or its derivatives +5 μg of PBO), but neither piperonal nor sesamol were active as synergists. The compound ar-turmerone alone and the combination with PBO reduced larval weight on treated Brassica oleracea in the laboratory and in greenhouse experiments, compared with the negative control. The compound ar-turmerone could be used as a low cost botanical insecticide for integrated management of cabbage looper in vegetable production. PMID:27804972

  19. Practical uses of botanicals in skin care.

    Science.gov (United States)

    Stallings, Alison F; Lupo, Mary P

    2009-01-01

    Cosmeceuticals are the fastest growing sector of the cosmetic industry, and the future of antiaging cosmeceuticals in particular is very promising. Botanical extracts that support the health, texture, and integrity of the skin, hair, and nails are widely used in cosmetic formulations. They form the largest category of cosmeceutical additives found in the marketplace today due to the rising consumer interest and demand for natural products. Various plant extracts that formed the basis of medical treatments in ancient civilizations and many traditional cultures are still used today in cleansers, moisturizers, astringents, and many other skin care products. New botanical skin care treatments are emerging, presenting dermatologists and their patients the challenge of understanding the science behind these cosmeceuticals. Thus, dermatologists must have a working knowledge of these botanicals and keep up with how they evolve to provide optimal medical care and answer patient questions. The most popular botanicals commonly incorporated into skin care protocols are discussed.

  20. The contribution of agricultural insecticide use to increasing insecticide resistance in African malaria vectors

    OpenAIRE

    Reid, Molly C.; McKenzie, F. Ellis

    2016-01-01

    The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malari...

  1. Weight loss in bamboo ( Bambusa vulgaris ) treated with neem seed ...

    African Journals Online (AJOL)

    Split-bamboo samples conditioned to 11.76% moisture content were converted to test specimens for Percentage Weight Loss (PWL) and treated with mechanically extracted neem seed oil at two different treatment temperature regimes by completely soaking a set in oil at ambient room temperature of 25 ± 2oC for 24 hours ...

  2. Morphological effects of neem (Azadirachta indica A. Juss) seed oil with known azadirachtin concentrations on the oocytes of semi-engorged Rhipicephalus sanguineus ticks (Acari: Ixodidae).

    Science.gov (United States)

    Remedio, R N; Nunes, P H; Anholeto, L A; Oliveira, P R; Camargo-Mathias, M I

    2015-02-01

    The concern about the harmful effects caused by synthetic pesticides has led to the search for safe and ecological alternatives for pest control. In this context, the neem tree (Azadirachta indica) stands out due to its repellent properties and effects on various arthropods, including ticks. For this reason, this study aimed to demonstrate the potential of neem as a control method for Rhipicephalus sanguineus ticks, important vectors of diseases in the veterinary point of view. For this, R. sanguineus semi-engorged females were subjected to treatment with neem seed oil enriched with azadirachtin, its main compound, and ovaries were assessed by means of morphological techniques in conventional light microscopy, confocal laser scanning microscopy, and transmission electron microscopy. Neem demonstrated a clear dose-dependent effect in the analyzed samples. The observed oocytes presented, especially in the groups treated with higher concentrations of neem oil, obvious signs of cytoplasmic disorganization, cellular vacuolization, nuclear and nucleolar irregularity, dilation in mitochondrial cristae, alterations in mitochondrial matrix, and swelling of rough endoplasmic reticulum. Intracellular microorganisms were observed in all analyzed groups, reinforcing the importance of ticks in the transmission of pathogens. A greater quantity of microorganisms was noted as the concentration of neem increased, indicating that the damaged oocytes may be more susceptible for their development. Such morphological alterations may promote future damages in reproductive performance of these animals and demonstrate the potential of neem seed oil for the control of R. sanguineus ticks, paving the way for new, cheaper, and safer methods of control.

  3. Photooxidation of nimbin and salannin, tetranortriterpenoids from the neem tree (Azadirachta indica)

    International Nuclear Information System (INIS)

    Jarvis, A.P.; Johnson, S.; Morgan, E.D.; Simmonds, M.S.J.; Blaney, W.M.

    1997-01-01

    Nimbin and salannin, major triterpenoids accompanying azadirachtin in extracts of neem (Azadirachta indica) seeds, were photooxidized by UV light in the presence of oxygen to more polar, unstable intermediates that rearranged on silica gel to two final products in which the furan ring had been oxidized to isomeric hydroxybutenolides. The isomeric hydroxybutenolides were also readily formed when a crude extract of triterpenoids from neem seeds was irradiated, and both isomers of salannin have been isolated from seeds. Photooxidation of nimbin and salannin proceeded much faster than that of azadirachtin. All photoproducts showed some biological activity against Spodoptera littoralis, Locusta migratoria, and Schistocerca gregaria. Isonimbinolide was as potent as azadirachtin at inhibiting feeding in all three species, and it also inhibited the growth of S. littoralis. Isosalanninolide showed potent antifeedant and growth inhibitory activity against S. littoralis

  4. Effects of botanical insecticides on the instantaneous population growth rate of Aphis gossypii Glover (Hemiptera: Aphididae in cotton=Efeitos de inseticidas botânicos na taxa instantânea de crescimento populacional de Aphis gossypii Glover (Hemiptera: Aphididae em algodão

    Directory of Open Access Journals (Sweden)

    Edmilson Jacinto Marques

    2012-04-01

    Full Text Available Botanical insecticides have been studied aiming the alternative pest control. The present study investigated the effects of these insecticides on the instantaneous population growth rate (ri of Aphis gossypii. Botanical insecticides were tested in the following concentrations: Compostonat®, Rotenat-CE® and Neempro (0, 0.50, 0.75, 1.00, 1.25, 1.50 and 1.75%; Natuneem® and Neemseto® (0, 0.25, 0.50, 0.75 and 1.00% and essential oils of Foeniculum vulgare Mill., Cymbopogom winterianus (L., Chenopodium ambrosioides L. and Piper aduncum L (0, 0.0125, 0.025, 0.0375 and 0.05%. Cotton leaf discs, CNPA 8H cultivar with 5 cm in diameter were immersed for 30 seconds in products broth and dried for 30 minutes. Eight replicates per concentration were used and each disc was infested with five apterous adult females of A. gossypii uniform in size and confined for 10 days. Compostonat®, Rotenat® and Neempro provided negative ri decreasing A. gossypii population. Natuneem® and Neemseto® and the essential oil of F. vulgare showed positive ri increasing the population. The coefficients of determination (R2 of regression lines ranged from 0.46 to 0.85. The essential oils of C. winterianus, C. ambrosioides and P. aduncum were not statistically significant precluding the establishment of regression lines.Inseticidas botânicos têm sido estudados, visando o controle alternativo de pragas. O presente trabalho objetivou estudar os efeitos desses inseticidas sobre a taxa instantânea de crescimento populacional (ri de Aphis gossypii. Os inseticidas botânicos foram testados nas seguintes concentrações: Compostonat®, Rotenat-CE® e Neempro (0; 0,50; 0,75; 1,00; 1,25; 1,50 e 1,75%; Nautneem® e Neemseto® (0; 0,25; 0,50; 0,75 e 1,00%; e os óleos essenciais de Foeniculum vulgare Mill., Cymbopogom winterianus (L., Chenopodium ambrosioides L. e Piper aduncum L. (0; 0,0125; 0,025; 0,0375 e 0,05%. Discos de folhas de algodoeiro, cultivar CNPA 8H, com 5 cm de di

  5. Neem gum as a binder in a formulated paracetamol tablet with reference to Acacia gum BP.

    Science.gov (United States)

    Ogunjimi, Abayomi Tolulope; Alebiowu, Gbenga

    2014-04-01

    This study determined the physical, compressional, and binding properties of neem gum (NMG) obtained from the trunk of Azadirachta indica (A Juss) in a paracetamol tablet formulation in comparison with official Acacia gum BP (ACA). The physical and flow properties were evaluated using density parameters: porosity, Carr's index, Hausner's ratio, and flow rate. Compressional properties were analyzed using Heckel and Kawakita equations. The tensile strength, brittle fracture index, and crushing strength-friability/disintegration time ratio were used to evaluate the mechanical properties of paracetamol tablets while the drug release properties of the tablets were assessed using disintegration time and dissolution times. Tablet formulations containing NMG exhibited faster onset and higher amount of plastic deformation during compression than those containing ACA. Neem gum produced paracetamol tablets with lower mechanical strength; however, the tendency of the tablets to cap or laminate was lower when compared to those containing ACA. Inclusion of NMG improved the balance between binding and disintegration properties of paracetamol tablets produced than those containing ACA. Neem gum produced paracetamol tablets with lower disintegration and dissolution times than those containing ACA.

  6. Comparison of outcome expectancies for synthetic cannabinoids and botanical marijuana.

    Science.gov (United States)

    Lauritsen, Kirstin J; Rosenberg, Harold

    2016-07-01

    Although initially developed for medical purposes, synthetic cannabinoids have also been consumed for recreational purposes. To evaluate whether agreement with positive and negative outcome expectancies differed for synthetic cannabinoids versus botanical marijuana, and assess reported reasons for using synthetic cannabinoids. Using a web-based recruitment and data collection procedure, 186 adults who had used both synthetic cannabinoids and botanical marijuana and 181 adults who had used botanical marijuana but not synthetic cannabinoids, completed measures of outcome expectancies and other relevant questionnaires. A significant interaction revealed that participants who had used both synthetic cannabinoids and botanical marijuana indicated lower agreement with positive expectancies for synthetic cannabinoids, and higher agreement with positive expectancies for botanical marijuana, than did those participants who used only botanical marijuana. There was no interaction between type of drug and use history on agreement with negative expectancies, and participants agreed more strongly with negative outcome expectancies for synthetic cannabinoids than for botanical marijuana whether they had used one or both types of these drugs. The most frequently provided reasons for using synthetic cannabinoids included availability, perceived legality, cost, curiosity, and social interaction. Given growing public acceptance of recreational and medical marijuana, coupled with negative perceptions and increasing regulation of synthetic cannabinoid compounds, botanical marijuana is likely to remain more available and more popular than synthetic cannabinoids.

  7. Neeme Järvi. "The Early Recordings", vol. 1 a 6. / Hulot, Jean-Claude

    Index Scriptorium Estoniae

    Hulot, Jean-Claude

    1998-01-01

    Uuest heliplaadist "Neeme Järvi. "The Early Recordings", vol. 1 a 6. Paganini: Concerto pour violon no. 1; Tchaikovski: Concerto pour violon op. 35; Concerto pour piano no. 1; Saint-Saens: Concerto pour piano no. 2; Beethoven: Concerto pour piano no. 4; R. Strauss: Till Eulenspiegels lustige Streiche. Don Juan; Cherubini: Requiem en re mineur; Chostakovitch: Fidelite, 8 ballades pour choeur d'hommes op. 136; Haydn: Concerto pour violoncelle no. 2; Tchaikovski: Variations Rococo. Pezzo capriccioso. Andante cantabile. Nocturne. Choeur d'hommes Academique de l'Etat d'Estonie, Orchestre Philharmonique de Moscou, Orchestre Symphonique d'URSS, Grand Orchestre Symphonique de la Radio d'URSS, Orchestre Symphonique de la Radio d'Estonie, Gustav Ernesaks, Neeme Järvi. Melodiya 74 321 40 719-2 a 40 724-2, distribution BMG (6 CD:96 F chacun)

  8. The contribution of agricultural insecticide use to increasing insecticide resistance in African malaria vectors.

    Science.gov (United States)

    Reid, Molly C; McKenzie, F Ellis

    2016-02-19

    The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malaria vectors were identified. In 23 of the 25 relevant recent publications from across Africa, higher resistance in mosquito populations was associated with agricultural insecticide use. This association appears to be affected by crop type, farm pest management strategy and urban development.

  9. Traditional botanical medicine: an introduction.

    Science.gov (United States)

    Rosenbloom, Richard A; Chaudhary, Jayesh; Castro-Eschenbach, Diane

    2011-01-01

    The role of traditional medicine in the well-being of mankind has certainly journeyed a long way. From an ancient era, in which knowledge was limited to a few traditional healers and dominated by the use of whole plants or crude drugs, the science has gradually evolved into a complete healthcare system with global recognition. Technologic advancements have facilitated traditional science to deliver numerous breakthrough botanicals with potency equivalent to those of conventional drugs. The renewed interest in traditional medicine is mainly attributed to its ability to prevent disease, promote health, and improve quality of life. Despite the support received from public bodies and research organizations, development of botanical medicines continues to be a challenging process. The present article gives a summarized description of the various difficulties encountered in the development and evaluation of botanical drugs, including isolation of active compounds and standardization of plant ingredients. It indicates a future direction of traditional medicine toward evidence-based evaluation of health claims through well-controlled safety and efficacy studies.

  10. Influence of alumina oxide nanoparticles on the performance and emissions in a methyl ester of neem oil fuelled direct injection diesel engine

    Directory of Open Access Journals (Sweden)

    Balaji Gnanasikamani

    2017-01-01

    Full Text Available The experimental investigation of the influence of Al2O3 nanoadditive on performance and emissions in a methyl ester of neem oil fueled direct injection Diesel engine is reported in this paper. The Al2O3 nanoparticles are mixed in various proportions (100 to 300 ppm with methyl ester of neem oil. The performance and emissions are tested in a single cylinder computerized, 4-stroke, stationary, water-cooled Diesel engine of 3.5 kW rated power. Results show that the nanoadditive is effective in increasing the performance and controlling the NO emissions of methyl ester of neem oil fueled Diesel engines.

  11. The extraction of proteins from the neem seed ( Indica azadirachta A ...

    African Journals Online (AJOL)

    Techniques for maximizing the extraction of protein from the neem seed (Indica azadirachta A. Juss) were investigated. Extractants used were sodium chloride and sodium sulphate solutions of varying concentration and pH. Maximum extractions of 17.86 g of extractable protein was obtained from 1 kg of crude protein, using ...

  12. Actin cytoskeleton as a putative target of the neem limonoid Azadirachtin A.

    Science.gov (United States)

    Anuradha, Aritakula; Annadurai, Ramaswamy S; Shashidhara, L S

    2007-06-01

    Limonoids isolated from the Indian neem tree (Azadirachta indica) have been gaining global acceptance in agricultural applications and in contemporary medicine for their myriad but discrete properties. However, their mode of action is still not very well understood. We have studied the mode of action of Azadirachtin A, the major limonoid of neem seed extracts, using Drosophila melanogaster as the model system. Azadirachtin A induces moderate-to-severe phenotypes in different tissues in a dose-dependent manner. At the cellular level, Azadirachtin A induces depolymerization of Actin leading to arrest of cells and subsequently apoptosis in a caspase-independent manner. Azadirachtin A-induced phenotypes were rescued by the over-expression of Cyclin E in a tissue-dependent manner. Cyclin E, which caused global rescue of Azadirachtin A-induced phenotypes, also effected rearrangement of the actin filaments. These results suggest that probably actin is a target of Azadirachtin A activity.

  13. A short history of insecticides

    Directory of Open Access Journals (Sweden)

    Oberemok Volodymyr Volodymyrovych

    2015-07-01

    Full Text Available This review contains a brief history of the use of insecticides. The peculiarities, main advantages, and disadvantages of some modern insecticides are described. The names of the discoverers of some of the most popular insecticide preparations on the world market, are listed. The tendencies to find new insecticides to control the quantity of phytophagous insects are discussed. Special attention is paid to the perspective of creating preparations based on nucleic acids, in particular DNA insecticides. The use of insect-specific, short single-stranded DNA fragments as DNA insecticides, is paving the way in the field of “intellectual” insecticides that “think” before they act. It is worth noting, though, that in the near future, the quantity of produced insecticides will increase due to the challenges associated with food production for a rapidly growing population. It is concluded, that an agreeable interaction of scientists and manufacturers of insecticides should lead to the selection of the most optimal solutions for insect pest control, which would be safe, affordable, and effective at the same time.

  14. A model on how to obtain data from botanical practitioners.

    Science.gov (United States)

    Elsas, Siegward M

    2015-11-01

    This paper addresses the challenge on how to obtain information from practitioners with experience in using medicinal plants. Collecting information on medicinal uses of plants is very challenging; since botanical remedies are used within the context of multiple differing medical systems, practitioners differ in training from Western physicians and scientists, and active ingredients of botanicals vary with preparation method, growth, and harvest conditions. A model on how useful data on safety and efficacy can be obtained from botanical practitioners is presented, based on methods developed by the association of anthroposophic physicians in Europe, a system of integrative medicine which includes the use of botanicals and is practiced mostly by medical doctors. Decades of experience by hundreds of practitioners are summarized and made accessible in a manual, which alphabetically lists the most commonly used botanicals and describes the most successful therapeutic experiences which could be confirmed by several of the contributing practitioners. This approach of continuous, multilingual systematic collection of successful therapeutic experiences within a community of practitioners with similar goals and a common therapeutic framework can be used not only for the training of successful future botanical practitioners, but also for helping to identify promising botanicals for scientific research and to further their development, and could support their official registration with governing bodies in countries of their use. This article is part of a Special Issue entitled "Botanicals for Epilepsy". Copyright © 2015 Elsevier Inc. All rights reserved.

  15. Untitled

    African Journals Online (AJOL)

    2004-10-19

    Oct 19, 2004 ... Balanogastris kolae (Desbr). was investigated in the laboratory. The plant material was ... weaker concentration of such synthetic insecticides are utilized ... extracts from Neem (A. indica), pepper (Pipper total damage (100 ...

  16. Effect of extracts of Trichilia silvatica C. DC., on development and ...

    African Journals Online (AJOL)

    SAM

    2014-05-14

    May 14, 2014 ... indicate that the extracts affected the biology of S. frugiperda, with LTS being the most promising. Key words: Meliaceae, methanolic extracts, insecticides, ...... Effects of neem seed derivatives on behavioral and physiological.

  17. Topical Botanical Agents for the Treatment of Psoriasis: A Systematic Review.

    Science.gov (United States)

    Farahnik, Benjamin; Sharma, Divya; Alban, Joseph; Sivamani, Raja K

    2017-08-01

    Patients with psoriasis often enquire about the use of numerous botanical therapeutics. It is important for dermatologists to be aware of the current evidence regarding these agents. We conducted a systematic literature search using the PubMed, MEDLINE, and EMBASE databases for controlled and uncontrolled clinical trials that assessed the use of topical botanical therapeutics for psoriasis. The search included the following keywords: 'psoriasis' and 'plant' or 'herbal' or 'botanical'. We also reviewed citations within articles to identify additional relevant sources. We then further refined the results by route of administration and the topical botanical agents are reviewed herein. A total of 27 controlled and uncontrolled clinical trials addressing the use of topical botanical agents for psoriasis were assessed in this review. We found that the most highly studied and most efficacious topical botanical therapeutics were Mahonia aquifolium, indigo naturalis, aloe vera, and, to a lesser degree, capsaicin. The most commonly reported adverse effects were local skin irritation, erythema, pruritus, burning, and pain. However, the overall evidence for these therapeutics remains limited in quantity and quality. The literature addresses a large number of studies in regard to botanicals for the treatment of psoriasis. While most agents appear to be safe, further research is necessary before topical botanical agents can be consistently recommended to patients.

  18. Mr Napite's botanical knowledge: bridging farmers' and scientists ...

    African Journals Online (AJOL)

    Though his broad and detailed botanical knowledge is recognised by other local experts, this does not provide him any particular social status. Although he received extensive formal training, his botanical knowledge draws largely on personal and traditional concepts. Clear morphological characteristics, other than the ...

  19. Botanicals as Modulators of Neuroplasticity: Focus on BDNF

    Directory of Open Access Journals (Sweden)

    Enrico Sangiovanni

    2017-01-01

    Full Text Available The involvement of brain-derived neurotrophic factor (BDNF in different central nervous system (CNS diseases suggests that this neurotrophin may represent an interesting and reliable therapeutic target. Accordingly, the search for new compounds, also from natural sources, able to modulate BDNF has been increasingly explored. The present review considers the literature on the effects of botanicals on BDNF. Botanicals considered were Bacopa monnieri (L. Pennell, Coffea arabica L., Crocus sativus L., Eleutherococcus senticosus Maxim., Camellia sinensis (L. Kuntze (green tea, Ginkgo biloba L., Hypericum perforatum L., Olea europaea L. (olive oil, Panax ginseng C.A. Meyer, Rhodiola rosea L., Salvia miltiorrhiza Bunge, Vitis vinifera L., Withania somnifera (L. Dunal, and Perilla frutescens (L. Britton. The effect of the active principles responsible for the efficacy of the extracts is reviewed and discussed as well. The high number of articles published (more than one hundred manuscripts for 14 botanicals supports the growing interest in the use of natural products as BDNF modulators. The studies reported strengthen the hypothesis that botanicals may be considered useful modulators of BDNF in CNS diseases, without high side effects. Further clinical studies are mandatory to confirm botanicals as preventive agents or as useful adjuvant to the pharmacological treatment.

  20. Ageing increases the sensitivity of neem (Azadirachta indica) seeds to imbibitional stress

    NARCIS (Netherlands)

    Neya, O.; Golovina, E.A.; Nijsse, J.; Hoekstra, F.A.

    2004-01-01

    Imbibitional stress was imposed on neem (Azadirachta indica) seeds by letting them soak for 1 h in water at unfavourable, low temperatures before further incubation at 30degreesC. Sensitivity to low imbibition temperatures increased with a decrease in seed moisture content (MC). To investigate a

  1. Decrease of insecticide resistance over generations without exposure to insecticides in Nilaparvata lugens (Hemipteran: Delphacidae).

    Science.gov (United States)

    Yang, Yajun; Dong, Biqin; Xu, Hongxing; Zheng, Xusong; Tian, Junce; Heong, Kongleun; Lu, Zhongxian

    2014-08-01

    The brown planthopper, Nilaparvata lugens (Stål), is one of the most important insect pests on paddy rice in tropical and temperate Asia. Overuse and misuse of insecticides have resulted in the development of high resistance to many different insecticides in this pest. Studies were conducted to evaluate the change of resistance level to four insecticides over 15 generations without any exposure to insecticides in brown planthopper. After 15 generations' rearing without exposure to insecticide, brown planthopper could reverse the resistance to imidacloprid, chlorpyrifos, fipronil, and fenobucarb. The range and style of resistance reversal of brown planthopper differed when treated with four different insecticides. To monitor potential changes in insect physiological responses, we measured the activity of each of the three selected enzymes, including acetylcholinesterases (AChE), general esterases (EST), and glutathione S-transferases. After multiple generations' rearing without exposure to insecticide, AChE and EST activities of brown planthopper declined with the increased generations, suggesting that the brown planthopper population adjusted activities of EST and AChE to adapt to the non-insecticide environment. These findings suggest that the reducing, temporary stop, or rotation of insecticide application could be incorporated into the brown planthopper management.

  2. The centenary of the School Botanical Garden from Blaj

    OpenAIRE

    Leon Sorin MUNTEAN

    1982-01-01

    The development of the first school-botanical garden from Blaj is strongly connected with the development of botanical research at the University and Agronomy Insitute from Cluj-Napoca. The first curators of the garden A. Uilacan, A. Cheteanu, Al. Borza and I. Popu-Cimpeanu studied in Cluj. Prof. Al. Borza developed the medicinal and crop plant collections in collaboration with B. Pater, former head of our agrobotanical garden. Later the botanical garden of the University, became famous under...

  3. Removal of fluoride by thermally activated carbon prepared from neem (Azadirachta indica) and kikar (Acacia arabica) leaves.

    Science.gov (United States)

    Kumar, Sunil; Gupta, Asha; Yadav, J P

    2008-03-01

    The present investigation deals with fluoride removal from aqueous solution by thermally activated neem (Azadirachta indica) leaves carbon (ANC) and thermally activated kikar (Acacia arabica) leaves carbon (AKC) adsorbents. In this study neem leaves carbon and kikar leaves carbon prepared by heating the leaves at 400 degrees C in electric furnace was found to be useful for the removal of fluoride. The adsorbents of 0.3 mm and 1.0 mm sizes of neem and kikar leaves carbon was prepared by standard sieve. Batch experiments done to see the fluoride removal properties from synthetic solution of 5 ppm to study the influence of pH, adsorbent dose and contact time on adsorption efficiency The optimum pH was found to be 6 for both adsorbents. The optimum dose was found to be 0.5g/100 ml forANC (activated neem leaves carbon) and 0.7g/100 ml forAKC (activated kikar leaves carbon). The optimum time was found to be one hour for both the adsorbent. It was also found that adsorbent size of 0.3 mm was more efficient than the 1.0 mm size. The adsorption process obeyed Freundlich adsorption isotherm. The straight line of log (qe-q) vs time at ambient temperature indicated the validity of langergren equation consequently first order nature of the process involved in the present study. Results indicate that besides intraparticle diffusion there maybe other processes controlling the rate which may be operating simultaneously. All optimized conditions were applied for removal of fluoride from four natural water samples.

  4. Inquiry-based Investigation in Biology Laboratories: Does Neem Provide Bioprotection against Bean Beetles?

    Science.gov (United States)

    Pearce, Amy R.; Sale, Amanda Lovelace; Srivatsan, Malathi; Beck, Christopher W.; Blumer, Lawrence S.; Grippo, Anne A.

    2013-01-01

    We developed an inquiry-based biology laboratory exercise in which undergraduate students designed experiments addressing whether material from the neem tree ("Azadirachta indica") altered bean beetle ("Callosobruchus maculatus") movements and oviposition. Students were introduced to the bean beetle life cycle, experimental…

  5. Inert powders alone or in combination with neem oil for controlling Spodoptera eridania and Spodoptera frugiperda (Lepidoptera: Noctuidae larvae

    Directory of Open Access Journals (Sweden)

    Kelly Christiane Constanski Silva

    2016-08-01

    Full Text Available Laboratory studies was carry out to evaluated the potential of inert powders: bentonite, kaolin and diatomaceous earth (DE applied as dust and aqueous suspension alone and associated with neem oil to the control Spodoptera eridania and Spodoptera frugiperda second instar larvae. In dust applications, 100% mortality of S. eridania, at the concentrations of 1.5 and 2.0 grams of bentonite, and 93.3% of S. frugiperda, at the concentration of 2.0 g were observed. DE at the height concentration (2.0 g caused 76.2% mortality of S. eridania and 46.6% of S. frugiperda. Kaolin, in all concentrations, was the only treatment that did not differed from the control for S. eridania but was different, in the high concentration, for S. frugiperda. When the plants were treated, larvae of S. eridania fed in the treatment DE, had an increase of two days in larval period. For the sex ratio, the percentage of males was greater in the treatments with kaolin, for both species. When powders was applied suspended in water separately or combined with neem oil, the best results were observed in combined of the bentonite (10% + neem, with 100% mortality for both species, and kaolin (10% + neem with 78.5% and 95.6% mortality for S. frugiperda and S. eridania, respectively. These treatments were classified as non-additive synergistic.

  6. The Effects of Some Botanical Insecticides and Pymetrozine on Life Table Parameters of Silver Leaf Whitefly Bemisia tabaci Gennadius (Hemiptera: Aleyrodidae

    Directory of Open Access Journals (Sweden)

    Reihaneh Barati

    2013-01-01

    Full Text Available The objective of this research was to assess the effects of extracts of two medicinalplant species: Allium sativum (Linn and Calotropis procera (Aiton, and a formulation containingazadirachtin on life table parameters of silver leaf whitefly (SLW, Bemisia tabaci biotypeB (Gennadius (Hemiptera: Aleyrodidae, grown on greenhouse tomato plants. Theeffects were compared to that of pymetrozine, a synthetic insecticide. Bioassays were carriedout in a greenhouse under controlled conditions of 27 ± 2°C, R.H. of 55 ± 5% and 16:8h (L:D photo period.All treatments significantly affected the survivorship and fertility of SLW female adults,reducing the net reproduction rate, mean generation time and intrinsic rate of increase ofthis insect.The net reproductive rate [R0] values for the populations treated with garlic extract,milkweed extract, pymetrozine, azadirachtin, control for extracts (ethanol + distilled waterand control for pesticides (distilled water were 23.58, 19.32, 10.78, 8.23, 49.66, 57.55; theintrinsic rate of increases [rm] were 0.134, 0.139, 0.110, 0.090, 0.177, 0.178; the mean generationtimes [T] were 23.49, 21.23, 21.66, 23.50, 22.06, 22.69; the doubling times [DT] were 5.14,4.95, 6.27, 7.56, 3.91, 3.87, and the finite rates of increase [λ] were 1.144, 1.149, 1.116, 1.094, 1.193,1.195, respectively. Azadirachtin had the highest effect on the life table parameters of SLW.Our findings indicated that, although herbal extracts were not effective as much asthe chemical insecticides, they can be effective in pest control. Therefore, they are suitablechoices for replacing chemical insecticides and for alternative use with azadirachtin inSLW IPM program.

  7. Chemical composition and insecticidal property of Myrsine stolonifera (Koidz.) walker (Family: Myrsinaceae) on Musca domestica (Diptera: Muscidae).

    Science.gov (United States)

    Wang, Xue Gui; Li, Qian; Jiang, Su Rong; Li, Pei; Yang, Ji Zhi

    2017-06-01

    Musca domestica is one of the most important pests of human health, and has developed strong resistance to many chemicals used for its control. One important approach for creating new pesticides is the exploration of novel compounds from plants. During a wide screening of plants with insecticidal properties that grow in southern China, we found that the methanolic extracts of Myrsine stolonifera had insecticidal activity against the adults of M. domestica. However, the insecticidal constituents and mechanisms of the M. stolonifera extracts remain unclear. The insecticidal components of the methanolic extracts of M. stolonifera were isolated with activity-guided fractionation. From the spectra of nuclear magnetic resonance (NMR) and mass spectrometry (MS), the compounds were identified as syringing (1), 2,6-dimethoxy-4-hydroxyphenol-1-O-β-d-glu (2), kaempferol-3-O-glu-rha-glu (3), and quercetin-3-O-glu-rha-glu (4). This study is the first to report the spectral data for compounds 3 and 4, and their LC 50 values were 0.52mg/g sugar and 0.36mg/g sugar 24h after treatment of the adults of M. domestica, respectively. Compounds 3 and 4 (LC 25 ) also inhibited the activities of the enzymes carboxylesterase, glutathione S-transferase, mixed function oxidase, and acetylcholine esterase of adult M. domestica, particularly mixed function oxidase and acetylcholine esterase. The cytotoxic effects of compounds 3 and 4 on cell proliferation, mitochondrial membrane potentials (MMP) and reactive oxygen species (ROS) were demonstrated on SL-1 cells. From the extracts of M. stolonifera, quercetin-3-O-glu-rha-glu and kaempferol-3-O-glu-rha-glu have displayed comparable toxicities to rotenone on M. domestica and also exhibited cytotoxic effects on SL-1 cells; therefore, the extracts of M. stolonifera and their compounds have potential as botanical insecticides to control M. domestica. Copyright © 2017 Elsevier B.V. All rights reserved.

  8. Study on the acaricidal effects of Azadirachta indica and Phytolacca ...

    African Journals Online (AJOL)

    ta indica (neem) and Phytolacca dodecandra (locally known endod in Ethiopia) on. Amblyomma ... Even though, the use of acaricdes is still the basic procedure for controlling most ticks and ecto- ..... The insecticidal and acaricidal action of.

  9. Evaluation of biochemical changes in Clarias gariepinus adults ...

    African Journals Online (AJOL)

    user

    2010-12-17

    Dec 17, 2010 ... significantly (P < 0.05) with increasing extracts concentrations in fish exposed to ..... organophosphorus insecticide on certain metabolic levels in a fresh- .... Acute lethal and sub-lethal effects of neem leaf extracts on the.

  10. Larvicidal efficacy of Toddalia asiatica (Linn.) Lam against two ...

    African Journals Online (AJOL)

    STORAGESEVER

    2010-04-19

    Apr 19, 2010 ... these chemical insecticides is that they are non-selective and could be harmful ... extracts against the targeted mosquitoes were analyzed using the standard World .... Efficacy of neem extract against the blowfly and housefly.

  11. Field efficacy of azadirachtin-A, tetrahydroazadirachtin-A, NeemAzal and endosulfan against key pests of okra (Abelmoschus esculentus).

    Science.gov (United States)

    Dhingra, Swaran; Walia, Suresh; Kumar, Jitendra; Singh, Shivendra; Singh, Gyanendra; Parmar, Balraj S

    2008-11-01

    BACKGROUND Unlike synthetic pesticides, azadirachtin-based neem pesticides are environmentally friendly and are well known for their diverse pest control properties. Their use is, however, limited by the instability of azadirachtin, necessitating application at short intervals. The efficacy of relatively stable tetrahydroazadirachtin-A, therefore, needed to be established under field conditions. Azadirachtin-A (Aza-A), its stable derivative tetrahydroazadirachtin-A (THA) and other neem pesticides have been evaluated for their field efficacy against major insect pests of okra, Abelmoschus esculentus (L.) Moench., during summer (kharif) 2003 and 2004. The optimum doses of Aza-A and THA against the fruit borer, Earias vittella F., were also established. Reductions in population of whitefly, Bemisia tabaci (Genn.), and leafhopper (jassid), Amrasca biguttulla biguttulla Ishida, after application of THA or endosulfan was evident up to 10 days after treatment (DAT), whereas with Aza-A and NeemAzal (NZ) the effect was observed up to 7 DAT only. Endosulfan and THA also caused higher reduction in the larvae of shoot and fruit borer E. vittella and E. insulana Boisd., and recorded the highest yields of 4600 and 4180 kg ha(-1). The efficacy of THA (0.05 g L(-1) emulsion) was comparable with that of 0.5 g L(-1) endosulfan emulsion in reducing fruit borer infestation, the reduction over the control being 86.0 and 87.3%, 84.9 and 94.1% and 90.2 and 92.6% at first, second and third picking. THA 0.02 g L(-1) and Aza-A 0.05 g L(-1) were on a par. Laboratory-made neem oil emulsifiable concentrate was the least effective, but was superior to untreated check. Three consecutive sprays of THA, a neem-based biopesticide, and endosulfan have been found to be superior in controlling field pests of okra to Aza-A and NZ, which were on a par. THA thus holds potential as a component of pest management strategies against okra pests. Copyright (c) 2008 Society of Chemical Industry.

  12. Toxicity of Neem Leaf Extracts (Azadirachta indica A. Juss on Some Haematological, Ionoregulatory, Biochemical and Enzymological Parameters of Indian Major Carp, Cirrhinus mrigala

    Directory of Open Access Journals (Sweden)

    M. Saravanan

    2011-10-01

    Full Text Available In the present study, the median lethal concentration (LC 50 of neem leaf extract to Cirrhinus mrigala for 24 h was found to be 1.035 g l-l. During the study period, the haematological parameters including Hb, Hct, RBC, MCV, MCH and MCHC levels were significantly decreased in neem leaf extract exposed fish when compared to the control fish whereas WBC count was increased. Similarly, plasma Na+ and Cl- levels were significantly lower and K+ level were significantly higher when compared to the control. In biochemical study, elevated plasma glucose and induced protein levels were noticed. The enzymes, glutamate oxaloacetate transaminase (GOT and glutamate pyruvate transaminase (GPT activities were increased significantly in gill, liver and muscle of treated fish compared to that of their control groups. The results of the present investigation suggest that neem leaf extracts affects the hematological, ionoregulatory, biochemical and enzymological parameters of fish and alterations of these parameters can be useful in environmental biomonitoring of neem based products in freshwater environment.Keywords: Azadirachta indica, Acute toxicity, Cirrhinus mrigala, Haematology, Ion regulation, Biochemical and Enzymological parameters.

  13. Ex situ conservation of plant diversity in the world's botanic gardens.

    Science.gov (United States)

    Mounce, Ross; Smith, Paul; Brockington, Samuel

    2017-10-01

    Botanic gardens conserve plant diversity ex situ and can prevent extinction through integrated conservation action. Here we quantify how that diversity is conserved in ex situ collections across the world's botanic gardens. We reveal that botanic gardens manage at least 105,634 species, equating to 30% of all plant species diversity, and conserve over 41% of known threatened species. However, we also reveal that botanic gardens are disproportionately temperate, with 93% of species held in the Northern Hemisphere. Consequently, an estimated 76% of species absent from living collections are tropical in origin. Furthermore, phylogenetic bias ensures that over 50% of vascular genera, but barely 5% of non-vascular genera, are conserved ex situ. While botanic gardens are discernibly responding to the threat of species extinction, just 10% of network capacity is devoted to threatened species. We conclude that botanic gardens play a fundamental role in plant conservation, but identify actions to enhance future conservation of biodiversity.

  14. Prokofieff: Kantate zum 20. Jahrestag der Oktoberrevolution, Op.74, Neeme Järvi / Joachim Salau

    Index Scriptorium Estoniae

    Salau, Joachim

    1993-01-01

    Uuest heliplaadist "Prokofieff: Kantate zum 20. Jahrestag der Oktoberrevolution, Op.74, Auszüge aus Das Märchen von der steinernen Blume. Gennadij Roshdestwenskij (Sprecher), Philharmonia Chorus, Philharmonia Orchestra, Neeme Järvi. Chandos/Koch CD 9095

  15. Overview of Botanical Status in EU, USA, and Thailand

    Directory of Open Access Journals (Sweden)

    Weena Jiratchariyakul

    2013-01-01

    Full Text Available The botanical status in EU, USA, and Thailand is different owing to the regulatory status, the progress of science, and the influence of culture and society. In the EU, botanicals are positioned as herbal medicinal products and food supplements, in the US they are regulated as dietary supplements but often used as traditional medicines, and in Thailand, they are regulated and used as traditional medicines. Information for some of the most popular botanicals from each country is included in this review.

  16. Changes in the bee fauna of a German botanical garden between 1997 and 2017, attributable to climate warming, not other parameters.

    Science.gov (United States)

    Hofmann, Michaela M; Fleischmann, Andreas; Renner, Susanne S

    2018-03-14

    Botanical gardens represent artificial, but stable environments. With this premise, we analyzed the Munich Botanical Garden's bee fauna in 1997/1999 and again in 2015/2017. The garden covers 20 ha, uses no bee-relevant insecticides, has a protected layout, and on three sides abuts protected areas. Outdoors, it cultivates some 10,871 species/subspecies, many suitable as pollen and nectar sources for bees. The first survey found 79 species, the second 106, or 55% of the 192 species recorded for Munich since 1990. A Jackknife estimate for the second survey suggests 115 expected species. Classifying bees according to their thermal preferences (warm habitats, cool habitats, broad preferences, or unknown) revealed that 15 warm-loving species were gained (newly found), two lost (no longer found), and 12 retained, but only one cool-loving species was gained, three lost, and none retained, which multinomial models show to be significant differences. Of the 62 retained species, 27 changed in abundance, with 18 less frequent and nine more frequent by 2017 than they had been in 1997/1999. Retention, gain, or loss were unconnected to pollen specialization and Red List status of bee species. Between 1997 and 2017, average temperatures in Munich have increased by 0.5 °C, and climate warming over the past century is the most plausible explanation for the directional increase in warm-loving and the decrease in cool-adapted species. These results highlight the potential of botanic gardens with their artificially diverse and near-pesticide-free floras as systems in which to investigate climate change per se as a possible factor in shifting insect diversity.

  17. Extraction method for high free radical scavenging activity of Siamese neem tree flowers

    Directory of Open Access Journals (Sweden)

    Worarat Chaisawangwong

    2009-10-01

    Full Text Available Siamese neem tree (Azadirachta indica A. Juss. var. siamensis Valeton is a medicinal plant found in Thailand. Youngleaves and young flowers of this plant are commonly consumed as a bitter tonic vegetable. The flowers are also used fortreatment of fever. The flower extract has been reported to exhibit in vitro free radical scavenging activity and can inhibitlipid peroxidation of bronchogenic cancer cell line. Active compounds in the flowers are flavonoids such as rutin andquercetin. The content of these compounds in the crude extract depends on the method of extraction. Therefore, the appropriateextraction method promoting high yield of total flavonoids and high free radical scavenging activity was investigated inthis study. Six different extraction methods, i.e. maceration, percolation, decoction, soxhlet extraction, ultrasonic extraction(UE, and microwave assisted extraction (MA were carried out for extracting dried powder of Siamese neem tree young flowers. The solvent used for maceration, percolation, and soxhlet extraction was 50% ethanol, while distilled water was used for decoction and MA, and both solvents were used for UE. The content of crude extract, free radical scavenging activity, and total flavonoids content of each extract were investigated and compared. Comparing the various extraction methods, decoction provided an extract containing a high amount of total flavonoids (17.54 mgRE/g extract and promoting the highest scavenging activity at EC50 11.36 g/ml. Decoction is also simple, cheap, and convenient and could be used in developing countries. Thus, it should be the recommended extraction method for the flowers of Siamese neem tree for furtherdevelopment of antioxidant pharmaceutical preparations.

  18. Biological and Chemical Standardization of a Hop (Humulus lupulus) Botanical Dietary Supplement

    OpenAIRE

    Krause, Elizabeth; Yuan, Yang; Hajirahimkhan, Atieh; Dong, Huali; Dietz, Birgit M.; Nikolic, Dejan; Pauli, Guido F.; Bolton, Judy L.; van Breemen, Richard B.

    2014-01-01

    Concerned about the safety of conventional estrogen replacement therapy, women are using botanical dietary supplements as alternatives for the management of menopausal symptoms such as hot flashes. Before botanical dietary supplements can be evaluated clinically for safety and efficacy, botanically authenticated and standardized forms are required. To address the demand for a standardized, estrogenic botanical dietary supplement, an extract of hops (Humulus lupulus, L.) was developed. Althoug...

  19. ORANGE PEEL POWDER AND ITS EXTRACTS AS PRE ...

    African Journals Online (AJOL)

    User

    Ethanolic crude extract gave the least F1 adult emergence compared with other treatments and control. ... Synthetic chemical insecticides have been an important part of pest ..... Vigna unguiculata with the neem seed Pro- tection ecology 5: ...

  20. 204 - 207 Suleiman

    African Journals Online (AJOL)

    DR. AMIN

    2011-12-02

    Dec 2, 2011 ... important role in protection of stored grains from insect invasion during storage. Key words: ... for their insecticidal value, but there was no much progress in ... Neem. Dogon-Yaro. Meliaceae. Seeds. 2. Jatropha curcas L.

  1. (L.) Poit

    African Journals Online (AJOL)

    2015-12-31

    Dec 31, 2015 ... tannins, glycosides and essential oil isolated from the plant has ..... The aqueous extract with a lower dose of insecticides can control ..... Control of nematode pests of cowpea with Mocap(Ethoprop), leaf residues of neem.

  2. Antifungal activity of different extracts of Ageratum conyzoides for the ...

    African Journals Online (AJOL)

    Muhammad Arif Javed

    2012-06-19

    Jun 19, 2012 ... In case of aqueous extracts, the maximum reduction was observed in leaf extract (72%) ... antifungal and insecticidal agents (Hajlaoui et al., 2009). Extracts of many ..... growth reduction of mycelia of phytophthora on neem leaf.

  3. Botanical Scavenger Hunt

    Science.gov (United States)

    Walker-Livingston, Wendy

    2009-01-01

    Why not combine the use of technology with the excitement of a scavenger hunt that moves middle-level students out into the "wilds" of their school campus to classify plants? In the lesson plan described here, students embark on a botanical scavenger hunt and then document their findings using a digital camera. This project was designed to allow…

  4. The biological effects of gamma irradiation and/or plant extract (Neem) on the greater wax moth, Galleria Mollenella

    International Nuclear Information System (INIS)

    Mohamed, H. F.

    2012-12-01

    The present study was evaluating the effect of plant extract (Neem) with the concentrations 0, 10, 15, 20, 25, 50, 75 and 100 ppm on the percentage of observed mortality and corrected mortality of the greater wax moth, Galleria mellon ella zeller. Also the effect of the plant extract concentrations 0.25, 50, 75 and 100 ppm on the biology of this insect as percentage larval mortality, percentage larval weight, percentage larval and pupal duration, total development time, fecundity of resulting adults. Furthermore, we examined the effect of gamma irradiation with the doses 0, 100, 200, 300 and 400 Gray on some biological aspects of G. mellon ella. In addition, we studied the combined effect of gamma irradiation and plant extract (Neem) on some biological aspects of G. mellon ella by the doses 0,100, 200, 300, 400 Gray of gamma irradiation and the concentration 15 ppm of Neem as the percentage larval mortality, percentage pupation, percentage pupal mortality, percentage of emergence and the percentage of adult survival. (Author)

  5. Characterization and mosquitocidal potential of neem cake-synthesized silver nanoparticles: genotoxicity and impact on predation efficiency of mosquito natural enemies.

    Science.gov (United States)

    Chandramohan, Balamurugan; Murugan, Kadarkarai; Panneerselvam, Chellasamy; Madhiyazhagan, Pari; Chandirasekar, Ramachandran; Dinesh, Devakumar; Kumar, Palanisamy Mahesh; Kovendan, Kalimuthu; Suresh, Udaiyan; Subramaniam, Jayapal; Rajaganesh, Rajapandian; Aziz, Al Thabiani; Syuhei, Ban; Alsalhi, Mohamad Saleh; Devanesan, Sandhanasamy; Nicoletti, Marcello; Wei, Hui; Benelli, Giovanni

    2016-03-01

    Mosquitoes (Diptera: Culicidae) serve as important vectors for a wide number of parasites and pathogens of huge medical and veterinary importance. Aedes aegypti is a primary dengue vector in tropical and subtropical urban areas. There is an urgent need to develop eco-friendly mosquitocides. In this study, silver nanoparticles (AgNP) were biosynthesized using neem cake, a by-product of the neem oil extraction from the seed kernels of Azadirachta indica. AgNP were characterized using a variety of biophysical methods, including UV-vis spectrophotometry, FTIR, SEM, EDX, and XRD analyses. Furthermore, the neem cake extract and the biosynthesized AgNP were tested for acute toxicity against larvae and pupae of the dengue vector Ae. aegypti. LC50 values achieved by the neem cake extract ranged from 106.53 (larva I) to 235.36 ppm (pupa), while AgNP LC50 ranged from 3.969 (larva I) to 8.308 ppm (pupa). In standard laboratory conditions, the predation efficiency of a Carassius auratus per day was 7.9 (larva II) and 5.5 individuals (larva III). Post-treatment with sub-lethal doses of AgNP, the predation efficiency was boosted to 9.2 (larva II) and 8.1 individuals (larva III). The genotoxic effect of AgNP was studied on C. auratus using the comet assay and micronucleus frequency test. DNA damage was evaluated on peripheral erythrocytes sampled at different time intervals from the treatment; experiments showed no significant damages at doses below 12 ppm. Overall, this research pointed out that neem cake-fabricated AgNP are easy to produce, stable over time, and can be employed at low dosages to reduce populations of dengue vectors, with moderate detrimental effects on non-target mosquito natural enemies.

  6. The effect of different concentrations of water soluble azadirachtin (neem metabolite) on Streptococcus mutans compared with chlorhexidine.

    Science.gov (United States)

    Kankariya, Amit R; Patel, Alok R; Kunte, Sanket S

    2016-01-01

    Despite advances in the development of anticaries chemotherapy, the newer agents are unable to control the initiation of dental caries. Research and development of natural antibacterial agents that are safe for the host as well as specific for oral pathogens is awaited. Neem tree extracts have been used for thousands of years for maintaining overall well-being. Chewing neem sticks in the morning is the most common indigenous method of cleaning the mouth in rural population. This has generated the interest of the dentists for the use of neem for controlling dental diseases. This study aims to evaluate the quantitative and qualitative effect of different concentrations of water soluble azadirachtin (neem metabolite) on Streptococcus mutans (S. mutans) against chlorhexidine. Plaque was collected from 30 children aged 8-12 years reporting to the Department of Pediatric and Preventive Dentistry, Bharti Vidyapeeth Dental College, Pune and transported to the laboratory. After incubation of the plates the inhibitory zones were noted and the diameter of the zone of inhibition was measured and recorded to check the inhibition of growth of S. mutans. For testing the bacterial survival, the biofilms were prepared and colony forming units (CFU) was enumerated using a digital colony counter. Two-way analysis of variance (ANOVA) and Tukey's test. The results show that there was no statistically significant difference in the inhibition of S. mutans between 40% concentration of water soluble azadirachtin and chlorhexidine. This study concluded that 40% water soluble azadirachtin is as effective as 0.2% chlorhexidine mouthrinse in reducing the S. mutans count in dental plaque. Hence, a water soluble formulation of azadirachtin may provide the maximum benefit to mankind to prevent dental caries.

  7. Effect of pest controlling neem (Azadirachta indica A. Juss) and mata-raton (Gliricidia sepium Jacquin) leaf extracts on emission of green house gases and inorganic-N content in urea-amended soil.

    Science.gov (United States)

    Méndez-Bautista, Joaquín; Fernández-Luqueño, Fabián; López-Valdez, Fernando; Mendoza-Cristino, Reyna; Montes-Molina, Joaquín A; Gutierrez-Miceli, F A; Dendooven, L

    2009-07-01

    Extracts of neem (Azadirachta indica A. Juss.) and Gliricidia sepium Jacquin, locally known as 'mata-raton', are used to control pests of maize. Their application, however, is known to affect soil microorganisms. We investigated if these extracts affected emissions of methane (CH4), carbon dioxide (CO2) and nitrous oxide (N2O), important greenhouse gases, and dynamics of soil inorganic N. Soil was treated with extracts of neem, mata-raton or lambda-cyhalothrin, used as chemical control. The soil was amended with or without urea and incubated at 40% and 100% water holding capacity (WHC). Concentrations of ammonium (NH4+), nitrite (NO2(-)) and nitrate (NO3(-)) and emissions of CH4, CO2 and N2O were monitored for 7d. Treating urea-amended soil with extracts of neem, mata-raton or lambda-cyhalothrin reduced the emission of CO2 significantly compared to the untreated soil with the largest decrease found in the latter. Oxidation of CH4 was inhibited by extracts of neem in the unamended soil, and by neem, mata-raton and lambda-cyhalothrin in the urea-amended soil compared to the untreated soil. Neem, mata-raton and lambda-cyhalothrin reduced the N2O emission from the unamended soil incubated at 40%WHC compared to the untreated soil. Extracts of neem, mata-raton and lambda-cyhalothrin had no significant effect on dynamics of NH4(+), NO2(-) and NO(3)(-). It was found that emission of CO2 and oxidation of CH4 was inhibited in the urea-amended soil treated with extracts of neem, mata-raton and lambda-cyhalothrin, but ammonification, N2O emission and nitrification were not affected.

  8. Selection and authentication of botanical materials for the development of analytical methods.

    Science.gov (United States)

    Applequist, Wendy L; Miller, James S

    2013-05-01

    Herbal products, for example botanical dietary supplements, are widely used. Analytical methods are needed to ensure that botanical ingredients used in commercial products are correctly identified and that research materials are of adequate quality and are sufficiently characterized to enable research to be interpreted and replicated. Adulteration of botanical material in commerce is common for some species. The development of analytical methods for specific botanicals, and accurate reporting of research results, depend critically on correct identification of test materials. Conscious efforts must therefore be made to ensure that the botanical identity of test materials is rigorously confirmed and documented through preservation of vouchers, and that their geographic origin and handling are appropriate. Use of material with an associated herbarium voucher that can be botanically identified is always ideal. Indirect methods of authenticating bulk material in commerce, for example use of organoleptic, anatomical, chemical, or molecular characteristics, are not always acceptable for the chemist's purposes. Familiarity with botanical and pharmacognostic literature is necessary to determine what potential adulterants exist and how they may be distinguished.

  9. Strawinsky: Ragtime, Oktett für Bläser, Neeme Järvi / Werner Pfister

    Index Scriptorium Estoniae

    Pfister, Werner

    1995-01-01

    Uuest heliplaadist "Strawinsky: Ragtime, Oktett für Bläser, Die Geschichte vom Soldaten (Suite), Petruschka. Royal Scottish National Orchestra, Orchestre de la Suisse Romande, Neeme Järvi". (AD: 1986-93). Chandos/Koch CD 9291 (WD:74'40")

  10. THE MOCHE BOTANICAL FROG (La rana botánica mochica)

    OpenAIRE

    Donna McClelland †

    2011-01-01

    Plants and animals with features which identify them as supernaturals characterize the art of the Precolumbian Moche culture of northern Peru. Among these animals is a frog with feline attributes and a consistent association with manioc tubers, stalks, and plants, the Botanical Frog. The Botanical Frog appears to have been patterned on Leptodactylus pentadactylus. It is shown copulating with felines. Fine line painted vessels and ones with low relief decoration show the Botanical Frog perform...

  11. Adapting the botanical landscape of Melbourne Gardens (Royal Botanic Gardens Victoria in response to climate change

    Directory of Open Access Journals (Sweden)

    Timothy J. Entwisle

    2017-12-01

    Full Text Available Botanic gardens around the world maintain collections of living plants for science, conservation, education, beauty and more. These collections change over time – in scope and content – but the predicted impacts of climate change will require a more strategic approach to the succession of plant species and their landscapes. Royal Botanic Gardens Victoria has recently published a ‘Landscape Succession Strategy’ for its Melbourne Gardens, a spectacular botanical landscape established in 1846. The strategy recognizes that with 1.6 million visitors each year, responsibility for a heritage-listed landscape and the need to care for a collection of 8500 plant species of conservation and scientific importance, planting and planning must take into account anticipated changes to rainfall and temperature. The trees we plant today must be suitable for the climate of the twenty-second century. Specifically, the Strategy sets out the steps needed over the next twenty years to transition the botanic garden to one resilient to the climate modelled for 2090. The document includes a range of practical measures and achievable (and at times somewhat aspirational targets. Climate analogues will be used to identify places in Australia and elsewhere with conditions today similar to those predicted for Melbourne in 2090, to help select new species for the collection. Modelling of the natural and cultivated distribution of species will be used to help select suitable growth forms to replace existing species of high value or interest. Improved understanding of temperature gradients within the botanic garden, water holding capacity of soils and plant water use behaviour is already resulting in better targeted planting and irrigation. The goal is to retain a similar diversity of species but transition the collection so that by 2036 at least 75% of the species are suitable for the climate in 2090. Over the next few years we hope to provide 100% of irrigation water

  12. Preservation of Cowpea (Vigna unguiculata (L.) Walp) Grains against Cowpea Bruchids (Callosobruchus maculatus) Using Neem and Moringa Seed Oils

    OpenAIRE

    Ilesanmi, Joana O.; Gungula, Daniel T.

    2010-01-01

    This study was conducted to determine the effects of neem (Azadirachta indica A. Juss) and moringa (Moringa oleifera) seed oils on the storability of cowpea grain. Cowpea samples were treated with various concentrations (0.5, 1.0, and 1.5 mL/200 g cowpea) of pure neem and moringa oils and their mixtures in ratios of 1:1, 1:2, and 1:3. The treated cowpea samples were stored for 180 days. Data were collected every 30 days on number of eggs laid, total weevil population, and percentage of uninfe...

  13. Repellent Action Of Neem (Azadiracta India Seed Oil Against Aedes Aegypti Mosquitoes

    Directory of Open Access Journals (Sweden)

    Hati A K

    1995-01-01

    Full Text Available Neem (Azadiracta India seed oil in appropriate amount when smeared on the surface of the hand showed excellent repellent action against Aedes aegypti mosquitoes. When 1 ml of oil was spread on the hand, with an approximate area of 160 sq cm the percentage of alighting and blood fed mosquitoes in the experimental cages varied from 14 to 78 and 4 to 46 respectively. This percentage decreased to 6 to 18 and 0 to 16 respectively when the amount of oil applied was 1.5 ml. Only 0-4% of the mosquitoes alighted on the skin of which 2% only took the blood meal when 2 ml of the oil was used to cover the hand. In the control cages cent percent of the mosquitoes alighted and sucked blood. The repellent action was directly proportional to the hour of exposure to the oil. It was also observed that even after alighting on a oil- smeared skin a sizeable proportion of mosquitoes were not able to imbibe blood meal. Neem seed oil was non-toxic, non- irritating to skin.

  14. The worldwide trend of using botanical drugs and strategies for developing global drugs.

    Science.gov (United States)

    Ahn, Kyungseop

    2017-03-01

    Natural product drugs, or botanical drugs, are drugs composed of natural substances which have constituents with healthenhancing or medicinal activities. In Korea, government-led projects brought attention to botanical drugs invigorating domestic botanical drug industry. Foreign markets, as well, are growing bigger as the significance of botanical drugs stood out. To follow along with the tendency, Korea puts a lot of effort on developing botanical drugs suitable for global market. However, standards for approving drug sales vary by countries. And also, thorough standardization, certification, clinical studies and data of these will be required as well as data confirming safety and effectiveness. Meanwhile, as an international exchange in botanical drug market continues, the importance of plant resources was emphasized. Thus countries' ownership of domestic natural resources became vital. Not only establishing a systematic method to secure domestic plant resources, but also cooperation with other countries on sharing natural resources is essential to procure natural resources effectively. Korea started to show visible results with botanical drugs, and asthma/COPD treatment made out of speedwell is one example. Sufficient investment and government's active support for basic infrastructure for global botanical drugs will bring Korea to much higher level of botanical drug development. [BMB Reports 2017; 50(3): 111-116].

  15. Insecticidal and repellant activities of plants oil against stored grain pest, Tribolium castaneum (Herbst (Coleoptera:Tenebrionidae

    Directory of Open Access Journals (Sweden)

    S.R.Pugazhvendan

    2012-05-01

    Full Text Available Objective: The present investigation was aimed to assess the impact of five plants oil for their insecticidal and repellent activity against Tribolium castaneum (Herbst, a stored grain pest and they were tested in the laboratory. Method: Five plants oil Citrus autantium, Cinnamomum zeylanicum, Gaultheria fragrantissima, Lavandula officinalis, and Ocimum sanctum were evaluated for their insecticidal and repellent activities against T. castaneum by adapting the standard protocol in vitro. Results: In Tulsi oil showed powerful repellent against T. castaneum beetles at both the concentration and this property can be clearly seen from the values at 5毺 1 (-0.60 and -0.73 in 1h and 6hr respectively and 10毺 1 (-0.56 and -0.81 in 1h and 6h respectively. Tulsi oil had more repelling property than other oil tested here against T. castaneum. Maximum percentage of mortality (76 and 92% at 48h and 72 hours after treatment respectively in Tulsi oil. Wintergreen oil showed 86% mortality at 72 hours after treatment. Conclusions: The present work for botanical products to control the insect pest of stored grain T. castaneum .These results suggest the presence of actives principles in the plant oils. Further exploration of active principles and their structural elucidations are underway.

  16. Review of the use of botanicals for epilepsy in complementary medical systems--Traditional Chinese Medicine.

    Science.gov (United States)

    Xiao, Fenglai; Yan, Bo; Chen, Lei; Zhou, Dong

    2015-11-01

    In traditional Chinese medicine, botanical remedies have been used for centuries to treat seizures. This review aimed to summarize the botanicals that have been used in traditional Chinese medicine to treat epilepsy. We searched Chinese online databases to determine the botanicals used for epilepsy in traditional Chinese medicine and identified articles using a preset search syntax and inclusion criteria of each botanical in the PubMed database to explore their potential mechanisms. Twenty-three botanicals were identified to treat epilepsy in traditional Chinese medicine. The pharmacological mechanisms of each botanical related to antiepileptic activity, which were mainly examined in animal models, were reviewed. We discuss the use and current trends of botanical treatments in China and highlight the limitations of botanical epilepsy treatments. A substantial number of these types of botanicals would be good candidates for the development of novel AEDs. More rigorous clinical trials of botanicals in traditional Chinese medicine for epilepsy treatment are encouraged in the future. This article is part of a Special Issue entitled "Botanicals for Epilepsy". Copyright © 2015 Elsevier Inc. All rights reserved.

  17. Botanical and phytochemical therapy of acne: a systematic review.

    Science.gov (United States)

    Fisk, Whitney A; Lev-Tov, Hadar A; Sivamani, Raja K

    2014-08-01

    Acne is prevalent among adolescents and adults with significant psychological effects. Standard oral and topical therapies can have significant side effects including skin irritation, gastrointestinal upset, and the development of drug-resistant bacteria. The use of botanicals and phytochemicals in dermatological products is increasingly popular, and many patients are turning to these alternative therapies for treatment of acne. This study aimed to systematically review clinical studies that have investigated the use of botanical agents in the treatment of acne. PubMed and Embase databases were searched in March 2013 for trials assessing botanical therapies in the treatment of acne vulgaris. Data from these trials are presented, and methodology of each study is assessed. Twenty-three trials met inclusion criteria. Interventions included plant extracts, herbal formulations, and phytochemicals. All studies reported favorable results, and several showed equal or superior treatment to standard therapies. No serious adverse events were reported. Few studies were methodologically rigorous. Each botanical was studied in only one or two trials. Botanicals are promising therapies for acne vulgaris although further research is warranted, especially with regard to severe acne and acne resistant to conventional therapy. There is a need for standardized methods for grading acne and assessing therapeutic effects. Copyright © 2014 John Wiley & Sons, Ltd.

  18. Peterburis pakutakse valgeid öid täis muusikat ning Neeme Järvit / Piret Tali

    Index Scriptorium Estoniae

    Tali, Piret, 1972-

    2005-01-01

    Peterburis toimuvast 7 nädalat kestvast süvamuusikafestivalist "Valgete ööde tähed/Stars of the White Nights", kontsertidel esinejatest. 25. juunil toimuvast Neeme, Paavo ja Kristjan Järvi ühiskontserdist

  19. The Evolving Role of Botanical Gardens and Natural Areas: A Floristic Case Study from Royal Botanical Gardens, Canada

    Institute of Scientific and Technical Information of China (English)

    David A. GALBRAITH; Natalie E. IWANYCKI; Brechann V. McGOEY; Jamie McGREGOR; James S. PRINGLE; Carl J. ROTHFELS; Tyler W. SMITH

    2011-01-01

    As leaders calling for the conservation of the world's plants, botanical gardens protect plants within living collections. Many also study, manage and restore plants in natural habitats. Royal Botanical Gardens (Ontario,Canada) has integrated both horticultural and natural heritage in its mission for decades. Envisioned by municipal leaders in the 1920s as a combination of nature sanctuaries and civic gardens, RBG now includes forests, wetlands and other habitats, gardens and built spaces. Today RBG is Canada's largest botanical garden on the basis of area.In the 1950s RBG began to inventory plant diversity. The checklist of spontaneous vascular plants now exceeds 1 170 species, of which 752 are native. This is 37% of Ontario's native vascular plants and 19% of the native vascular flora of Canada. The RBG nature sanctuaries are among the richest locations in Canada for species-level diversity.We examine the history of fioristic exploration within RBG and compare plant species-area relationships among protected natural areas in Ontario. This comparison supports the contention that the nature sanctuaries, and in particular Cootes Paradise, could be considered an important area for plants in Canada, and relative to the nation's flora, a biodiversity hotspot. The fact that a candidate vascular plant hotspot for Canada lies within a major botanical garden presents opportunities for raising public awareness of the importance of plant diversity, as well as focusing attention on the scientific and conservation biology needs of communities and individual species in this area.

  20. Untitled

    African Journals Online (AJOL)

    Perry, were tested for the control of major insect pests of cowpea using split plot fitted into a randomised complete block ... for minimal use of synthetic insecticides in control- ling pests, the ..... The use of neem in controlling cowpea pests.

  1. The anti-tick properties of the root extracts of Senna italica subsp ...

    African Journals Online (AJOL)

    SERVER

    2007-11-15

    Nov 15, 2007 ... extract of S. italica subsp. arachoides in 24 h was 8.66% (w/v) while in 48 h was 3.59% ..... extract of neem seed oil (Azadirachta indica) on egg, immature and ... insecticides on diamondbuck moth (Lepidoptera: Plutellidae).

  2. Original Researc Original Research

    African Journals Online (AJOL)

    RAGHAVENDRA

    2015-03-15

    Mar 15, 2015 ... powder were evaluated against the maize weevil in n laid out in a randomized complete ..... diatomaceous earth with plant extracts, insecticides and ... commercial neem product Azal-T/S (1 gm kg-1) resulted in higher mortality ...

  3. The effect of different concentrations of water soluble azadirachtin (neem metabolite on Streptococcus mutans compared with chlorhexidine

    Directory of Open Access Journals (Sweden)

    Amit R Kankariya

    2016-01-01

    Full Text Available Despite advances in the development of anticaries chemotherapy, the newer agents are unable to control the initiation of dental caries. Research and development of natural antibacterial agents that are safe for the host as well as specific for oral pathogens is awaited. Neem tree extracts have been used for thousands of years for maintaining overall well-being. Chewing neem sticks in the morning is the most common indigenous method of cleaning the mouth in rural population. This has generated the interest of the dentists for the use of neem for controlling dental diseases. Aims: This study aims to evaluate the quantitative and qualitative effect of different concentrations of water soluble azadirachtin (neem metabolite on Streptococcus mutans (S. mutans against chlorhexidine. Materials and Methods: Plaque was collected from 30 children aged 8-12 years reporting to the Department of Pediatric and Preventive Dentistry, Bharti Vidyapeeth Dental College, Pune and transported to the laboratory. After incubation of the plates the inhibitory zones were noted and the diameter of the zone of inhibition was measured and recorded to check the inhibition of growth of S. mutans. For testing the bacterial survival, the biofilms were prepared and colony forming units (CFU was enumerated using a digital colony counter. Statistical Analysis Used: Two-way analysis of variance (ANOVA and Tukey′s test. Results: The results show that there was no statistically significant difference in the inhibition of S. mutans between 40% concentration of water soluble azadirachtin and chlorhexidine. Conclusions: This study concluded that 40% water soluble azadirachtin is as effective as 0.2% chlorhexidine mouthrinse in reducing the S. mutans count in dental plaque. Hence, a water soluble formulation of azadirachtin may provide the maximum benefit to mankind to prevent dental caries.

  4. EFFECTS OF AZADIRACHTIN ON THE SUNN PEST, EURYGASTER INTEGRICEPS PUT. (HETEROPTERA, SCUTELLERIDAE IN THE LABORATORY

    Directory of Open Access Journals (Sweden)

    Müjgan KIVAN

    2006-02-01

    Full Text Available To investigate the effect of azadirachtin on different stages of the sunn pest, Eurygaster integriceps Put. (Het., Scutelleridae in the laboratory, a commercial neem insecticide (NeemAzal T/S was applied at dose of 0.5 % by dipping insects. No effect was observed for 1. instar nymphs at 1 day after application, although adults had slightly effect (20 %. Adults and nymphs were infl uenced 7 days after the treatment and mortality rates for adults and nymphs were recorded 44.0 and 51.9 %, respectively. The hatching of treated eggs was reduced than control. These results indicate that NeemAzal T/S may be used in integrated sunn pest management, but should be evaluated for fi eld efficacy.

  5. Charles Darwin's Botanical Investigations

    Science.gov (United States)

    Harley, Suzanne M.

    2010-01-01

    Charles Darwin's botanical studies provide a way to expose students to his work that followed the publication of "On the Origin of Species." We can use stories from his plant investigations to illustrate key concepts in the life sciences and model how questions are asked and answered in science.

  6. Botanical Dietary Supplements: Background Information

    Science.gov (United States)

    ... use a Latin name made up of the genus and species of the plant. Under this system ... form of a botanical preparation also play important roles in its safety. Teas, tinctures, and extracts have ...

  7. EPA Helps Botanic Garden Blossom

    Science.gov (United States)

    One of the keys to the continued transformation of abandoned mine lands into a world-class botanic garden near Pittsburgh is an innovative rainwater system financed by EPA’s Clean Water State Revolving Fund.

  8. Bioactivity-Guided Identification of Botanical Inhibitors of Ketohexokinase.

    Science.gov (United States)

    Le, MyPhuong T; Lanaspa, Miguel A; Cicerchi, Christina M; Rana, Jatinder; Scholten, Jeffrey D; Hunter, Brandi L; Rivard, Christopher J; Randolph, R Keith; Johnson, Richard J

    2016-01-01

    In developed countries with westernized diets, the excessive consumption of added sugar in beverages and highly refined and processed foods is associated with increased risk for obesity, diabetes, and cardiovascular diseases. As a major constituent of added sugars, fructose has been shown to cause a variety of adverse metabolic effects, such as impaired insulin sensitivity, hypertriglyceridemia, and oxidative stress. Recent studies have shown that ketohexokinase isoform C is the key enzyme responsible in fructose metabolism that drive's fructose's adverse effects. The objective of this study was to identify botanical ingredients with potential for inhibitory activity against ketohexokinase-C and fructose-induced metabolic effects by using a series of in vitro model systems. Extracts from 406 botanicals and 1200 purified phytochemicals were screened (initial concentration of 50 μg/mL and 50 μM, respectively) for their inhibitory activity using a cell free, recombinant human ketohexokinase-C assay. Dose response evaluations were conducted on botanical extracts and phytochemicals that inhibited ketohexokinase-C by > 30% and > 40%, respectively. Two different extract lots of the top botanical candidates were further evaluated in lysates of HepG2 cells overexpressing ketohexokinase-C for inhibition of fructose-induced ATP depletion. In addition, extracts were evaluated in intact Hep G2 cells for inhibition of fructose-induced elevation of triglyceride and uric acid production. Among the botanical extracts, phloretin (Malus domestica) extracts were the most potent (IC50: 8.9-9.2 μg/mL) followed by extracts of Angelica archangelica (IC50: 22.6 μg/mL-57.3 μg/mL). Among the purified phytochemicals, methoxy-isobavachalcone (Psoralea corylifolia, IC50 = 0.2 μM) exhibited the highest potency against ketohexokinase isoform C activity followed by osthole (Angelica archangelica, IC50 = 0.7 μM), cratoxyarborenone E (Cratoxylum prunifolium, IC50 = 1.0 μM), and

  9. Bioactivity-Guided Identification of Botanical Inhibitors of Ketohexokinase

    Science.gov (United States)

    Scholten, Jeffrey D.; Hunter, Brandi L.; Rivard, Christopher J.; Randolph, R. Keith

    2016-01-01

    Objective In developed countries with westernized diets, the excessive consumption of added sugar in beverages and highly refined and processed foods is associated with increased risk for obesity, diabetes, and cardiovascular diseases. As a major constituent of added sugars, fructose has been shown to cause a variety of adverse metabolic effects, such as impaired insulin sensitivity, hypertriglyceridemia, and oxidative stress. Recent studies have shown that ketohexokinase isoform C is the key enzyme responsible in fructose metabolism that drive’s fructose's adverse effects. The objective of this study was to identify botanical ingredients with potential for inhibitory activity against ketohexokinase-C and fructose-induced metabolic effects by using a series of in vitro model systems. Methods Extracts from 406 botanicals and 1200 purified phytochemicals were screened (initial concentration of 50 μg/mL and 50 μM, respectively) for their inhibitory activity using a cell free, recombinant human ketohexokinase-C assay. Dose response evaluations were conducted on botanical extracts and phytochemicals that inhibited ketohexokinase-C by > 30% and > 40%, respectively. Two different extract lots of the top botanical candidates were further evaluated in lysates of HepG2 cells overexpressing ketohexokinase-C for inhibition of fructose-induced ATP depletion. In addition, extracts were evaluated in intact Hep G2 cells for inhibition of fructose-induced elevation of triglyceride and uric acid production. Results Among the botanical extracts, phloretin (Malus domestica) extracts were the most potent (IC50: 8.9–9.2 μg/mL) followed by extracts of Angelica archangelica (IC50: 22.6 μg/mL—57.3 μg/mL). Among the purified phytochemicals, methoxy-isobavachalcone (Psoralea corylifolia, IC50 = 0.2 μM) exhibited the highest potency against ketohexokinase isoform C activity followed by osthole (Angelica archangelica, IC50 = 0.7 μM), cratoxyarborenone E (Cratoxylum prunifolium, IC

  10. Novel botanical ingredients for beverages.

    Science.gov (United States)

    Gruenwald, Joerg

    2009-01-01

    Natural substances are generally preferred over chemical ones and are generally seen as healthy. The increasing demand for natural ingredients, improving health and appearance, is also attracting beverages as the fastest growing segment on the functional food market. Functional beverages are launched as fortified water, tea, diary or juices claiming overall nutrition, energy, anti-aging or relaxing effects. The substitution of so called superfruits, such as berries, grapes, or pomegranate delivers an effective range of beneficial compounds, including vitamins, fatty acids, minerals, and anti-oxidants. In this context, new exotic and African fruits could be useful sources in the near future. Teas and green botanicals, such as algae or aloe vera are also rich in effective bioactives and have been used traditionally. The botanical kingdom offers endless possibilities.

  11. Botanical medicines for the urinary tract.

    Science.gov (United States)

    Yarnell, Eric

    2002-11-01

    Four important categories of urologic herbs, their history, and modern scientific investigations regarding them are reviewed. Botanical diuretics are discussed with a focus on Solidago spp (goldenrod) herb, Levisticum officinale (lovage) root, Petroselinum crispus (parsley) fruit, and Urtica dioica (stinging nettle) herb. Urinary antiseptic and anti-adhesion herbs, particularly Arctostaphylos uva-ursi (uva-uri) leaf, Juniperus spp (juniper) leaf, and Vaccinium macrocarpon (cranberry) fruit are reviewed. The antinephrotoxic botanicals Rheum palmatum (Chinese rhubarb) root and Lespedeza capitata (round-head lespedeza) herb are surveyed, followed by herbs for symptoms of benign prostatic hyperplasia, most notably Serenoa repens (saw palmetto) fruit, Urtica dioica root, and Prunus africana (pygeum) bark.

  12. In chemico skin sensitization risk assessment of botanical ingredients.

    Science.gov (United States)

    Avonto, Cristina; Chittiboyina, Amar G; Sadrieh, Nakissa; Vukmanovic, Stanislav; Khan, Ikhlas A

    2018-03-24

    Skin sensitization risk assessment of botanical ingredients is necessary for consumers' protection and occupational hazard identification. There are currently very few available alternative methods that can assist in the evaluation of complex mixtures. Chemical methods can provide essential information in a timely manner and thus help to reduce the need for in vivo testing, and they can complement and facilitate targeted in vitro assays. In the present work, the applicability of the high-throughput screening with dansyl cysteamine (DCYA) method for the systematic evaluation of skin sensitization of complex botanicals was explored. Botanical ingredients of four unrelated plant species were obtained and tested with the high-throughput fluorescence method at three concentrations. To illustrate the minimal matrix effects of the tested extracts on the developed method, the least DCYA-reactive extract (Rosa canina) was spiked with known sensitizers at different concentrations. The data obtained from the four plant extracts and the spiking experiments with known sensitizers, suggest that the high-throughput screening-DCYA method can be successfully applied for estimating the skin sensitization potential of complex botanical matrices. This is the first report of an attempt to develop a versatile in chemico method for the rapid detection of reactive skin sensitizers in complex botanical extracts, which could complement the battery of existing validated, non-animal methods. Copyright © 2018 John Wiley & Sons, Ltd.

  13. Technologies and experimental approaches in the NIH Botanical Research Centers

    Science.gov (United States)

    Barnes, Stephen; Birt, Diane F; Cassileth, Barrie R; Cefalu, William T; Chilton, Floyd H; Farnsworth, Norman R; Raskin, Ilya; van Breemen, Richard B; Weaver, Connie M

    2009-01-01

    There are many similarities between research on combinatorial chemistry and natural products and research on dietary supplements and botanicals in the NIH Botanical Research Centers. The technologies in the centers are similar to those used by other NIH-sponsored investigators. All centers rigorously examine the authenticity of botanical dietary supplements and determine the composition and concentrations of the phytochemicals therein, most often by liquid chromatography–mass spectrometry. Several of the centers specialize in fractionation and high-throughput evaluation to identify the individual bioactive agent or a combination of agents. Some centers are using DNA microarray analyses to determine the effects of botanicals on gene transcription with the goal of uncovering the important biochemical pathways they regulate. Other centers focus on bioavailability and uptake, distribution, metabolism, and excretion of the phytochemicals as for all xenobiotics. Because phytochemicals are often complex molecules, synthesis of isotopically labeled forms is carried out by plant cells in culture, followed by careful fractionation. These labeled phytochemicals allow the use of accelerator mass spectrometry to trace the tissue distribution of 14C-labeled proanthocyanidins in animal models of disease. State-of-the-art proteomics and mass spectrometry are also used to identify proteins in selected tissues whose expression and posttranslational modification are influenced by botanicals and dietary supplements. In summary, the skills needed to carry out botanical centers’ research are extensive and may exceed those practiced by most NIH investigators. PMID:18258642

  14. The changing role of botanic gardens and the experience from ...

    African Journals Online (AJOL)

    An attempt is here made to review the origin, role and status of botanic gardens ... The published literature on gardens is enormous and begins with what are known ... Key words/phrases: Botanic Garden, Ethiopia, Gullele, History, Importance, ...

  15. Is oxidative stress involved in the loss of neem (Azadirachta indica) seed viability?

    NARCIS (Netherlands)

    Sacandé, M.; Hoekstra, F.A.; Aelst, van A.C.; Vos, de C.H.R.

    2000-01-01

    Neem (Azadirachta indica) is a valuable multipurpose tree of tropical arid and semi-arid regions. The use of its seeds is hindered by their short storage longevity. The possible causes of rapid loss of viability were investigated on different seed lots during exposure to 32% and 75% RH at 20°C.

  16. Insecticidal Activity of Extracts of Aglaia spp. (Meliaceae Against Cabbage Cluster Caterpillar Crocidolomia binotalis Zeller (Lepidoptera: Pyralidae

    Directory of Open Access Journals (Sweden)

    Djoko Prijono

    2001-12-01

    Full Text Available Insecticidal potential of eleven species of Aglaia (Meliaceae was evaluated in the laboratory against the cabbage cluster caterpillar, Crocidolomia binotalis. The feeding treatment of second-instar larvae C. binotalis for 48 hours with ethanol twig extract of A. odorata at 0.5% caused 98.7% larval mortality; leaf and twig extracts of A. elaeagnoidea caused 17.3% and 6.7% mortality, respectively; twig extracts of A. argentea, A. formosana, and A. latifolia caused only 1.3% mortality each; whereas extracts of the other six Aglaia species were inactive (0% mortality. Further tests with A. odorata showed that twigs gave the most active extract compared to other plant parts (leaves, flowers, and roots, and air-drying of plant materials for 2 weeks markedly decreased the activity of the derived extracts. The active extracts also delayed the development of surviving larvae in similar degree to the level of their lethal effect. LC50 of ethyl acetate fraction of A. odorata twig extract and its main active compound, rocaglamide, against C. binotalis larvae were 310.2 and 31.4 ppm, respectively. This active compound was about 8.7 times less potent than azadirachtin (LC50 3.6 ppm. Key words: Aglaia, botanical insecticides, Crocidolomia binotalis

  17. The study of penetration of energetic ions in botanic samples with transmission measurements

    International Nuclear Information System (INIS)

    Wang, Y.G.; Chen, Q.Z.; Xue, J.M.; Du, G.H.; Qin, H.L; Zhang, W.M.; Yan, S.; Zhao, W.J.

    2006-01-01

    Botanic samples (onion endocuticles, kidney bean slices) were exposed to energetic ions. By recording transmission spectra, we studied the energy loss in such samples. Individual protrusion-like damage produced in highly oriented pyrolytic graphite (HOPG) substrate allowed us to analyze the mass density of the samples by scanning tunneling microscope (STM). The experimental results showed that the botanic sample is inhomogeneous in mass density, some incident ions lose only a small part of their energy after being stopped by a layer of botanic sample. Additionally, about 10 -7 of the incident ions with energy of tens of keV can penetrate through the botanic slice with a thickness of 50 μm. The dynamic change of the transmission spectrum of MeV heavy ions through a layer of botanic slice showed that the penetration ability of the incident ions increases with increasing ion fluence. These experimental results indicate that the inhomogeneousity of mass density of botanic samples and irradiation damage are the main reasons of the ultra-depth penetration of low-energy ions in such kind of botanic samples

  18. EFFICACY OF VEGETABLE OILS AGAINST DRY BEAN BEETLES ...

    African Journals Online (AJOL)

    ACSS

    highest dose (9 ml kg-1) with castor oil and cottonseed oil, respectively. The lowest LC50 value of ... restrictions on use of insecticides, awareness of environmental pollution, the .... more plant materials such as neem oil for use in insect pest ...

  19. Insecticidal Properties of Essential Oils and Some of Their Constituents on the Turkestan Cockroach (Blattodea: Blattidae).

    Science.gov (United States)

    Gaire, Sudip; O'Connell, Mary; Holguin, Francisco O; Amatya, Anup; Bundy, Scott; Romero, Alvaro

    2017-04-01

    The Turkestan cockroach, Blatta lateralis (Walker), has become the most important peridomestic species in urban areas of the Southwestern United States. The aim of this study was to evaluate the use of botanical compounds to control this urban pest. We tested the acute toxicity and repellency of six botanical constituents and three essential oils on Turkestan cockroach nymphs. Chemical composition of the essential oils was also determined. Topical and fumigant assays with nymphs showed that thymol was the most toxic essential oil constituent, with a LD50 of 0.34 mg/nymph and a LC50 of 27.6 mg/liter air, respectively. Contact toxicity was also observed in assays with trans-Cinnamaldehyde, eugenol, geraniol, methyl eugenol, and p-Cymene. Methyl eugenol and geraniol had limited fumigant toxicity. The essential oils from red thyme, clove bud, and Java citronella exhibited toxicity against nymphs. Cockroaches avoided fresh dry residues of thymol and essential oils. Chemical analysis of the essential oils confirmed high contents of effective essential oil constituents. Our results demonstrated that essential oils and some of their constituents have potential as eco-friendly insecticides for the management of Turkestan cockroaches. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  20. Biological Reactive Intermediates (BRIs) Formed from Botanical Dietary Supplements

    Science.gov (United States)

    Dietz, Birgit M.; Bolton, Judy L.

    2013-01-01

    The use of botanical dietary supplements is increasingly popular, due to their natural origin and the perceived assumption that they are safer than prescription drugs. While most botanical dietary supplements can be considered safe, a few contain compounds, which can be converted to reactive biological reactive intermediates (BRIs) causing toxicity. For example, sassafras oil contains safrole, which can be converted to a reactive carbocation forming genotoxic DNA adducts. Alternatively, some botanical dietary supplements contain stable BRIs such as simple Michael acceptors that react with chemosensor proteins such as Keap1 resulting in induction of protective detoxification enzymes. Examples include curcumin from turmeric, xanthohumol from hops, and Z-ligustilide from dang gui. Quinones (sassafras, kava, black cohosh), quinone methides (sassafras), and epoxides (pennyroyal oil) represent BRIs of intermediate reactivity, which could generate both genotoxic and/or chemopreventive effects. The biological targets of BRIs formed from botanical dietary supplements and their resulting toxic and/or chemopreventive effects are closely linked to the reactivity of BRIs as well as dose and time of exposure. PMID:20970412

  1. Miscellaneous botanical Notes X

    NARCIS (Netherlands)

    Steenis, van C.G.G.J.

    1960-01-01

    Through the kind assistance of Prof. Dr D. K. Zerov large photographs were obtained of type specimens of two dozen Verbenaceae which have been described by Turczaninow and are preserved in his Herbarium of the Botanical Institute of the Academy of Science of the Ukrainian S.S.R. at Kiew. These have

  2. Ethno-botanical studies from northern Pakistan

    International Nuclear Information System (INIS)

    Afzal, S.; Afzal, N.

    2009-01-01

    In this research paper efforts have been made to document the ethno-botanical knowledge of important plant species found in Northern Pakistan. It includes Thandiani, Galiat, Kaghan, Swat, Buner, Dir, Chitral and Northern Areas of Pakistan. The area has many climatic and vegetation zones or biomes. Locals residing in mountainous areas belonging to various ethnic groups are traditionally utilizing plants over many generations; these ethnic groups have their distinct life style, belief, traditions and cultural heritage. Plant collection and data regarding traditional uses in various areas of Northern Pakistan has been done periodically in different flowering /fruiting seasons. Locals of old age belonging to various ethnic groups were personally interviewed for establishing uses of plants. Photography is done for easy identification and habitat recognition. Collected plant specimens and seeds were preserved. Plant species were dried, mounted, identified and authenticated. Seventy six species were known to have traditional and ethno botanical uses. Plants have been utilized for many generations. Ethnic groups have distinct life style and have different economic uses for these plants. Due to unsustainable exploitation of natural habitats scarcity of drug plants has occurred. As consequence some species are depleting and may become extinct in near future, e. g. Morchella esculenta, Colchicum lueteum and Viola serpens are just a few of these. Although some sporadic information is available about the flora of this region but very little documented record of the ethno-botanically important plants has been established. It is expected that this research paper will be beneficial for students, researchers, farmers, foresters and general public. On the basis of data obtained it is concluded that ethno-botanical Flora of Northern Pakistan is quite rich and is diverse, due to the difference in altitude, climate and other topographic conditions. (author)

  3. Symptoms of nutritional deficiencies in neem plants cultivated in nutrient solution

    Directory of Open Access Journals (Sweden)

    Ronnky Chaell Braga da Silva

    2011-03-01

    Full Text Available The planting of forest species is an activity that, besides introducing new exotic types of plants, can lessen the environmental impacts resulting from extractivism. Nevertheless, such success depends, upon other factors, on the knowledge of the nutritional needs of the species to be used. This study intended to check the typical symptoms of nutritional deficiency of macronutrients in the culture of Neem, through the visual observation of the plants. The experiment was carried out in a greenhouse at the College of Agronomy and Veterinary Medicine (FAMEV of the Federal University of Mato Grosso (UFMT in Cuiabá/MT, and it was set up in randomized blocks, with seven treatments and three repetitions. Each experimental unit was represented by a plastic vase, two liters capacity. The treatments used were: complete nutritive solution and solution with the omission of the following nutrients: -N, -P, -K, -Ca, -Mg and -S. It was ascertained that the visual symptoms of nutrient deficiency were, as a general rule, of easy characterization except for the treatment with omission of sulphur. Therefore, the omission of macronutrients decreases the production of total dry matter of the Neem plants, except for the omission of the S nutrient.

  4. Experimental investigation on a diesel engine using neem oil and its methyl ester

    Directory of Open Access Journals (Sweden)

    Sivalakshmi S.

    2011-01-01

    Full Text Available Fuel crisis and environmental concerns have led to look for alternative fuels of bio-origin sources such as vegetable oils, which can be produced from forests, vegetable oil crops and oil bearing biomass materials. Vegetable oils have energy content comparable to diesel fuel. The effect of neem oil (NeO and its methyl ester (NOME on a direct injected four stroke, single cylinder diesel engine combustion, performance and emission is investigated in this paper. The results show that at full load, peak cylinder pressure is higher for NOME; peak heat release rate during the premixed combustion phase is lower for neat NeO and NOME. Ignition delay is lower for neat NeO and NOME when compared with diesel at full load. The brake thermal efficiency is slightly lower for NeO at all engine loads, but in the case of NOME slightly higher at full load. It has been observed that there is a reduction in NOx emission for neem oil and its methyl ester along with an increase in CO, HC and smoke emissions.

  5. Insecticidal activity of compounds from ailanthus altissima against spodoptera littoralis larvae

    International Nuclear Information System (INIS)

    Pavela, R.; Zabka, M.; Tylova, T.; Kresinova, Z

    2014-01-01

    We determined the efficacy of Ailanthus altissima extracts, obtained using solvents of various polarity, in terms of acute and chronic toxicity, antifeedant efficacy and larval growth inhibition of Spodoptera littoralis. Different efficacy was found for individual fractions, in terms of both acute and chronic toxicity, as well as antifeedant efficacy and growth inhibition of S. littoralis larvae. Fractions 1 and 2, obtained at the beginning of the separation period, were the only ones to cause significant chronic toxicity accompanied by larval growth inhibition. A major proportion of tocopherol isomers were detected in these fractions. On the contrary, fractions 5 and 6 caused acute toxicity, associated with significant antifeedant efficacy and related strong growth inhibition of S. littoralis larvae. Five major quassinoids (Ailanthone, Chaparrinone, Glaucarubinone, 13(18)-Dehydroglaucarubinone and hinjulactone H) were detected in fraction 5, which showed the greatest efficacy in terms of acute toxicity and feed intake inhibition of S. littoralis. Methanol extracts or active substances obtained from A. altissima leaves can be recommended for the development of new botanical insecticides targeted against some phytophagous larval species of butterfly pests. (author)

  6. The neem limonoids azadirachtin and nimbolide inhibit cell proliferation and induce apoptosis in an animal model of oral oncogenesis.

    Science.gov (United States)

    Harish Kumar, G; Vidya Priyadarsini, R; Vinothini, G; Vidjaya Letchoumy, P; Nagini, S

    2010-08-01

    Limonoids from the neem tree (Azadirachta indica) have attracted considerable research attention for their cytotoxicity against human cancer cell lines. However, the antiproliferative and apoptosis inducing effects of neem limonoids have not been tested in animal tumour models. The present study was therefore designed to evaluate the relative chemopreventive potential of the neem limonoids azadirachtin and nimbolide in the hamster buccal pouch (HBP) carcinogenesis model by analyzing the expression of proliferating cell nuclear antigen (PCNA), p21(waf1), cyclin D1, glutathione S-transferase pi (GST-P), NF-kappaB, inhibitor of kappaB (IkappaB), p53, Fas, Bcl-2, Bax, Bid, Apaf-1, cytochrome C, survivin, caspases-3, -6, -8 and -9, and poly(ADP-ribose) polymerase (PARP) by RT-PCR, immunohistochemical, and Western blot analyses. The results provide compelling evidence that azadirachtin and nimbolide mediate their antiproliferative effects by downregulating proteins involved in cell cycle progression and transduce apoptosis by both the intrinsic and extrinsic pathways. On a comparative basis, nimbolide was found to be a more potent antiproliferative and apoptosis inducing agent and offers promise as a candidate agent in multitargeted prevention and treatment of cancer.

  7. Regulation of inflammatory gene expression in PBMCs by immunostimulatory botanicals.

    Directory of Open Access Journals (Sweden)

    Karen L Denzler

    Full Text Available Many hundreds of botanicals are used in complementary and alternative medicine for therapeutic use as antimicrobials and immune stimulators. While there exists many centuries of anecdotal evidence and few clinical studies on the activity and efficacy of these botanicals, limited scientific evidence exists on the ability of these botanicals to modulate the immune and inflammatory responses. Using botanogenomics (or herbogenomics, this study provides novel insight into inflammatory genes which are induced in peripheral blood mononuclear cells following treatment with immunomodulatory botanical extracts. These results may suggest putative genes involved in the physiological responses thought to occur following administration of these botanical extracts. Using extracts from immunostimulatory herbs (Astragalus membranaceus, Sambucus cerulea, Andrographis paniculata and an immunosuppressive herb (Urtica dioica, the data presented supports previous cytokine studies on these herbs as well as identifying additional genes which may be involved in immune cell activation and migration and various inflammatory responses, including wound healing, angiogenesis, and blood pressure modulation. Additionally, we report the presence of lipopolysaccharide in medicinally prepared extracts of these herbs which is theorized to be a natural and active component of the immunostimulatory herbal extracts. The data presented provides a more extensive picture on how these herbs may be mediating their biological effects on the immune and inflammatory responses.

  8. Kontserthuset Göteborg. Göteborgs Symfoniker, chefdirigent: Neeme Järvi. Dirigent: Neeme Järvi. Solist: Paata Burchuladze, bas. Kontsertmästare: Per Enoksson, Christer Thorvaldsson. Onsdag 12. mars 1997 Stora salen (brun serie)

    Index Scriptorium Estoniae

    1997-01-01

    Kontserdi kavas juttu: Eduard Tubin. Süit balletist "Kratt", Modest Mussorgski "Surma laulud ja tantsud" ja Jean Sibeliuse sümfoonia N 1, e-moll op. 39 Lk. 2-4: Kruckenberg, Sven: Tubin - Svit ur Kratt. Lk. 8 lühidalt Neeme Järvi edaspidisest tööst

  9. L'huile des graines de neem, un fongicide alternatif à l'oxyde de ...

    African Journals Online (AJOL)

    SARAH

    27 févr. 2013 ... d'huile et de tourteau. Thèse en vue de l'obtention du Doctorat de l'Université de. Toulouse délivré par l'Institut Polytechnique de. Toulouse (INP Toulouse). 267 pages. Osman M Z and Port GR, 1990. Systemic action of neem seed substances against Pieris brassicae. Entomologia Experimentalis et.

  10. Community based vector control in Malindi, Kenya | Kibe | African ...

    African Journals Online (AJOL)

    Results: Nineteen of 34 community groups (56%) registered at social services reported intended malaria vector control activities such as treating ditches, making and selling insecticide-treated mosquito nets, draining stagnant water, organizing clean-ups, making and selling neem soap, and the organization of campaigns ...

  11. C:\\Users\\AISA\\Desktop\\SORO S..xps

    African Journals Online (AJOL)

    AISA

    Propriétés insecticides et fertilisantes de l'engrais organique liquide «Ergofito Defense». ETUDE DE ... results were analyzed using the SAS software version 8.2. At 75 days after ... Par exemple, l'efficacité d'extraits de feuilles de neem.

  12. Fertilization of Southern Tall Grassveld of Natal: effects on botanical ...

    African Journals Online (AJOL)

    The long-term effects of nitrogen, phosphate and lime on change in botanical composition and utilisation under grazing of Southern Tall Grassveld of Natal are presented. Nitrogen, phosphate, lime and type of nitrogen affected botanical composition significantly. Generally, fertilisation had the same effect on species ...

  13. Effect of dietary supplement of sugar beet, neem leaf, linseed and coriander on growth performance and carcass trait of Vanaraja chicken

    Directory of Open Access Journals (Sweden)

    Punita Kumari

    2014-09-01

    Full Text Available Aim: This study was planned to investigate the effect of sugar beet, neem leaf, linseed and coriander on growth parameters such as feed intake, body weight gain, feed conversion ratio (FCR, performance index (PI, and carcass characteristics in broiler birds. Materials and Methods: The experiment was conducted for a period of 42 days on Vanaraja strain of broiler birds. Different dietary supplement such as sugar beet meal, neem leaf meal, linseed meal and coriander seed meal were used in the basal diet. All day-old 150 male chicks were individually weighed and distributed into five groups having 30 birds in each. Each group was further sub-divided into triplicates having 10 birds in each. Group T1served as control and rest groups T2, T3, T4 and T5 as treatment groups. Birds in T1 group were fed basal ration only, however, T2 , T3, T4 and T5 groups were fed basal ration mixed with 2.5% sugar beet meal, neem leaf meal, linseed meal, and coriander seed meal individually, respectively. Results: Broilers supplemented with herbs/spices showed improvement in growth attributes and carcass characteristics. Broilers fed with herbs at the rate of 2.5% had higher feed intake except sugar beet and coriander seed meal fed group. The body weight and weight gain was also significantly (p0.05 affected. Average giblet percentage of all supplemented groups were significantly (p<0.05 higher than control and was found to be highest in neem leaf meal fed group. Average by-product percentage was found to be highest in linseed fed group. Conclusion: Various herbs such as sugar beet, neem leaf, linseed and coriander seed meals affected the growth performance, and carcass trait showed positive inclination toward supplemented groups in broilers. The exact mode of action of these herbs/spices is still not clear, however, one or more numbers of active compounds present in these supplements may be responsible.

  14. 36 CFR 223.278 - Sale of forest botanical products and collection of fees.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Sale of forest botanical..., DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Forest Botanical Products § 223.278 Sale of forest botanical products and collection of fees. The responsible Forest Officer shall...

  15. Insecticidal factors from the seeds of Erythrina indica Lam against Hyblaea puera, the most serious defoliator pest of teak

    Directory of Open Access Journals (Sweden)

    B. Deepa

    2017-07-01

    Full Text Available The organic solvent extracts from the seeds of Erythrina indica were tested for their insecticidal action against Hyblaea puera, the most important defoliator pest of teak. The larvicidal activity of the petroleum ether, chloroform, methanol, ethyl alcohol, ethyl acetate, acetone and water extracts from the seeds of E. indica on the 3rd instar larvae of H. puera showed 100% mortality even with least concentration (0.25%. The ovicidal activity was exhibited by chloroform and ethyl acetate extract. Both the extracts exhibited highest egg hatch inhibition (56% at highest concentration (2%. The least LC50 (1.15% shows that ethyl acetate extract is better than chloroform extract (1.78. Two compounds were isolated from the ethyl acetate extract of the seeds of Erythrina indica by column chromatography. The compounds were identified using HPLC, GC MS, and NMR. Compound 1 was a mixture of linoleic acid and oleic acid. Compound 2 was a mixture of linoleic acid and oleic acid ester with a glycerol unit attached to it. Compounds 1 and 2 were biologically active and exhibited potent insecticidal activity against the 3rd instar larvae of H. puera. The result showed that Compound 2 isolated from E. indica exhibited highest mortality (72% at concentration (0.125%. At highest concentration (0.5% highest mortality (92% was exhibited by Compound 2 which on comparison is on par with the Neemark (Azadirachtin exhibiting highest mortality (100%. The study is complementary with earliar works and proves that the seeds of E. indica has immense potential to be utilized as botanical insecticide.

  16. Workshops with expedition trips organized by the Central Botanical Gardens of NAS of Belarus - an effective instrument of international cooperation between botanical gardens

    Directory of Open Access Journals (Sweden)

    Spiridovich Elena Vladimirovna

    2016-12-01

    Full Text Available NASB Central Botanical Garden (CBG in 2013-2016 made by the lead agency, the organizer of four international scientific workshops with with expedition trips "Strategies and methods of botanical gardens for the conservation and sustainable use of biological diversity of the natural flora" (Minsk, protected nature areas (PNAs of the Republic of Belarus, which was attended by representatives of leading botanical gardens of the US, Russian Federation, Kazakhstan, Poland and Lithuania. During the scientific seminars discussions and expeditions at 2013-2015 the overall goal of joint work - addressing the conservation of biodiversity of flora and strengthening the role of scientific support for optimal implementation of the Global Strategy Plant Conservation (GSPC were defined, as well as specific joint projects are elaborated.

  17. Concordance between botanical groups and genetic diversity in peanut

    Directory of Open Access Journals (Sweden)

    Ingrid Pinheiro Machado

    Full Text Available ABSTRACT The aims of this study were to characterize peanut accessions of germplasm collection of the CCA/UFC and check consistency between the pre-existing botanical groups to estimates of genetic diversity. For this were conducted a trial with 43 accessions of peanut in a randomized block design with three replications. To characterization were used 21 morphological descriptors, where revealed large genetic variation. The mass hundred grains trait showed the main discriminating factors, with relative percentage of 22.1%. The cluster obtained with the linkage complete method, it was possible to view the dendrogram the formation of seven groups based on the Mahalanobis distance. By principal components analysis was identified phenotypic diversity among genotypes. The first three components explained 81% of the total variation. Subsequently, built a three-dimensional scatter chart for access of visualization, eight groups being formed. There was medium magnitude of agreement between the botanical groups and genetic diversity, both by the dendrogram and graphic dispersion proving the dissimilarity between genotypes of different botanic groups. Therefore, crossings between group access botanical Spanish or Valencia with those belonging to the Virginia group should generate segregating populations with high genetic potential.

  18. Updates on chemical and biological research on botanical ingredients in dietary supplements.

    Science.gov (United States)

    Pawar, Rahul S; Tamta, Hemlata; Ma, Jun; Krynitsky, Alexander J; Grundel, Erich; Wamer, Wayne G; Rader, Jeanne I

    2013-05-01

    Increased use of dietary supplements is a phenomenon observed worldwide. In the USA, more than 40% of the population recently reported using complementary and alternative medicines, including botanical dietary supplements. Perceptions that such dietary supplements are natural and safe, may prevent disease, may replace prescription medicines, or may make up for a poor diet, play important roles in their increased use. Toxicity of botanical dietary supplements may result from the presence of naturally occurring toxic constituents or from contamination or adulteration with pharmaceutical agents, heavy metals, mycotoxins, pesticides, or bacteria, misidentification of a plant species in a product, formation of electrophilic metabolites, organ-specific reactions, or botanical-drug interactions. The topics discussed in this review illustrate several issues in recent research on botanical ingredients in dietary supplements. These include (1) whether 1,3-dimethylamylamine is a natural constituent of rose geranium (Pelargonium graveolens), (2) how analysis of the components of dietary supplements containing bitter melon (Momordica charantia) is essential to understanding their potential biological effects, and (3) how evolving methods for in vitro studies on botanical ingredients can contribute to safety evaluations. The virtual explosion in the use of botanical ingredients in hundreds of products presents a considerable challenge to the analytical community, and the need for appropriate methods cannot be overstated. We review recent developments and use of newer and increasingly sensitive methods that can contribute to increasing the safety and quality of botanical ingredients in dietary supplements.

  19. Mechanism of long-range penetration of low-energy ions in botanic samples

    International Nuclear Information System (INIS)

    Liu Feng; Wang Yugang; Xue Jianming; Wang Sixue; Du Guanghua; Yan Sha; Zhao Weijiang

    2002-01-01

    The authors present experimental evidence to reveal the mechanism of long-range penetration of low-energy ions in botanic samples. In the 100 keV Ar + ion transmission measurement, the result confirmed that low-energy ions could penetrate at least 60 μm thick kidney bean slices with the probability of about 1.0 x 10 -5 . The energy spectrum of 1 MeV He + ions penetrating botanic samples has shown that there is a peak of the count of ions with little energy loss. The probability of the low-energy ions penetrating the botanic sample is almost the same as that of the high-energy ions penetrating the same samples with little energy loss. The results indicate that there are some micro-regions with mass thickness less than the projectile range of low-energy ions in the botanic samples and they result in the long-range penetration of low-energy ions in botanic samples

  20. Botanical Gardens and Collecting of Plants in the Light of the Metamorphosis of Botanical

    Directory of Open Access Journals (Sweden)

    Ines Unetič

    2015-12-01

    Full Text Available In the late 18th and early 19th century, the collecting of exotic plants became a fashion that took hold of European courts, and was followed by many noblemen, intellectuals, gardeners and others. It was not only popular to grow new plants in gardens, collecting them in herbaria or illustrating and enumerating them in catalogues, but was also important to develop botanical knowledge to enable the owners of the plants to use and present them. In Carniola we can observe this interest in botany in the cases of Baron Joseph Erberg, Barons Žiga and Karl Zois, Jesuit Gabriel Gruber as well as many others. Baron Erberg's activity is recorded in archives which include lively correspondence concerning plant collecting, the exchange and purchase of plants and other botanical matters. So we can see that among plant lovers in Carniola foreign plants such as pelargonium, agave and hydrangea were popular and that they had a special role in gardens devoted especially to exotic plants. The collecting of exotic plants is not just a phenomenon of the eighteenth and nineteenth centuries but can be traced back to early civilisations such the Assyrians and ancient Chinese and was also notable in a the 16th and 17th centuries with their cabinets of curiosities. But studying the botanical collection of exotic and new (or newly defined plants gardens of the late 18th and early 19th centuries shows us that although we can recognize some of the old “habits” in the process of collecting (collecting of rare, fascinating plants or collecting plants to demonstrate imperial power the social changes in the 18th century left their trace also in this aspect of human activity. Thus we can understand plant collecting of this time as a decline and metamorphosis of the former natural cabinets of curiosities. In botanical gardens of the late 18th and early 19th century we see the development of science of botany, the rise of the amateur botanist, a different perception of nature

  1. Efficacy of dietary supplementation with botanicals on carbohydrate metabolism in humans.

    Science.gov (United States)

    Cefalu, William T; Ye, Jianping; Wang, Zhong Q

    2008-06-01

    Botanical products are widely used in nutritional supplementation for promotion of health or prevention of diseases. With the high prevalence of obesity and type 2 diabetes, abnormalities in carbohydrate metabolism are common in the general population and obtaining glycemic control is important in reducing the complications of diabetes. If shown to be effective, botanical products have a unique position in potentially aiding the general public in regard to obesity and diabetes. They can be obtained "over-the-counter" and may have less side effects compared to many synthetic drugs. Although most of the popular botanicals have a long history in folk medicine, there is paucity of data regarding their efficacy and safety, particularly as it relates to human studies. In this review, we discuss the data that was available in the literature for nine botanicals that are frequently promoted to help manage blood glucose. They are Bitter Melon (Momordica charantia), Fenugreek (trigonella foenum graecum), Gymnema Sylvestre, Ivy Gourd (Coccinia indica), Nopal or Prickly Pear Cactus (Opuntia streptacantha), Ginseng, Aloe Vera, Russian Tarragon (Artemisia dracunculus), and Garlic (Allium sativum). The discussion is emphasized on the clinical aspect of these botanicals. Due to the lack of sufficient evidence from clinical studies for any of the botanicals reviewed, it is premature to actively recommend use of any particular herb to treat either glucose or other risk factors. Thus, well defined randomized clinical trials are warranted in this area.

  2. Adverse effects of plant food supplements and botanical preparations

    DEFF Research Database (Denmark)

    Di Lorenzo, Chiara; Ceschi, Alessandro; Kupferschmidt, Hugo

    2015-01-01

    The objective of this review was to collect available data on the following: (i) adverse effects observed in humans from the intake of plant food supplements or botanical preparations; (ii) the misidentification of poisonous plants; and (iii) interactions between plant food supplements...... evaluated according to the World Health Organization Guidelines for causality assessment. Data were obtained for 66 plants that are common ingredients of plant food supplements; of the 492 papers selected, 402 (81.7%) dealt with adverse effects directly associated with the botanical and 89 (18.1%) concerned......) the number of severe clinical reactions was very limited, but some fatal cases have been described. Data presented in this review were assessed for quality in order to make the results maximally useful for clinicians in identifying or excluding deleterious effects of botanicals....

  3. Biological and chemical standardization of a hop (Humulus lupulus) botanical dietary supplement.

    Science.gov (United States)

    Krause, Elizabeth; Yuan, Yang; Hajirahimkhan, Atieh; Dong, Huali; Dietz, Birgit M; Nikolic, Dejan; Pauli, Guido F; Bolton, Judy L; van Breemen, Richard B

    2014-06-01

    Concerned about the safety of conventional estrogen replacement therapy, women are using botanical dietary supplements as alternatives for the management of menopausal symptoms such as hot flashes. Before botanical dietary supplements can be evaluated clinically for safety and efficacy, botanically authenticated and standardized forms are required. To address the demand for a standardized, estrogenic botanical dietary supplement, an extract of hops (Humulus lupulus L.) was developed. Although valued in the brewing of beer, hop extracts are used as anxiolytics and hypnotics and have well-established estrogenic constituents. Starting with a hop cultivar used in the brewing industry, spent hops (the residue remaining after extraction of bitter acids) were formulated into a botanical dietary supplement that was then chemically and biologically standardized. Biological standardization utilized the estrogen-dependent induction of alkaline phosphatase in the Ishikawa cell line. Chemical standardization was based on the prenylated phenols in hops that included estrogenic 8-prenylnaringenin, its isomer 6-prenylnaringenin, and pro-estrogenic isoxanthohumol and its isomeric chalcone xanthohumol, all of which were measured using high-performance liquid chromatography-tandem mass spectrometry. The product of this process was a reproducible botanical extract suitable for subsequent investigations of safety and efficacy. Copyright © 2014 John Wiley & Sons, Ltd.

  4. Insecticide-induced hormesis and arthropod pest management.

    Science.gov (United States)

    Guedes, Raul Narciso C; Cutler, G Christopher

    2014-05-01

    Ecological backlashes such as insecticide resistance, resurgence and secondary pest outbreaks are frequent problems associated with insecticide use against arthropod pest species. The last two have been particularly important in sparking interest in the phenomenon of insecticide-induced hormesis within entomology and acarology. Hormesis describes a biphasic dose-response relationship that is characterized by a reversal of response between low and high doses of a stressor (e.g. insecticides). Although the concept of insecticide-induced hormesis often does not receive sufficient attention, or has been subject to semantic confusion, it has been reported in many arthropod pest species and natural enemies, and has been linked to pest outbreaks and potential problems with insecticide resistance. The study of hormesis remains largely neglected in entomology and acarology. Here, we examined the concept of insecticide-induced hormesis in arthropods, its functional basis and potential fitness consequences, and its importance in arthropod pest management and other areas. © 2013 Society of Chemical Industry.

  5. Expanding the role of botanical gardens in the future of food

    Science.gov (United States)

    Collectively, the world’s more than 3,000 botanical gardens cultivate approximately one-third of known plant species in living collections, and contribute valuable information on plant identification, geographic distributions, morphology, reproduction, and traditional uses. Further, each year botan...

  6. Repellent Effect and Insecticidal Activities of Bridelia ferruginea, Blighia sapida, and Khaya senegalensis Leaves Powders and Extracts against Dinoderus porcellus in Infested Dried Yam Chips

    Directory of Open Access Journals (Sweden)

    Laura Yêyinou Loko

    2017-01-01

    Full Text Available Dinoderus porcellus is considered as the most important pest of stored yam chips and compounds extracted from plants can be used for its control. The present study aimed to test the insecticidal and repellent activities of powders and extracts of leaves of Bridelia ferruginea, Blighia sapida, and Khaya senegalensis against D. porcellus. The efficacy of plant powders was compared with the synthetic pesticide Antouka (Permethrin 3 g/kg + pirimiphos 16 g/kg. The results of the experiment revealed that all plant powders were effective as repellents. Antouka was more effective as insecticidal than the plant powders and minimal weight loss was observed with B. sapida at 2%. Among treatments, propanol extract of K. senegalensis at 5% was found to elicit the highest repellent effect on D. porcellus. The LC50 results revealed that the acetone extract of K. senegalensis is the most toxic (0.29 μL/insect to the pest, while the propanol extract of B. ferruginea at 5% exhibited strong fumigant toxicity against D. porcellus, with 88.89% of pest mortality at 160 μL/L air. The findings from the current work proved that plant powders and extracts of the three plants are sources of botanical insecticides which may be used in the integrated management of D. porcellus.

  7. Investigation on structural properties of M-type strontium hexaferrite synthesized in presence of neem and aloe-vera plant leaves extract

    Science.gov (United States)

    Solanki, Neha; Jotania, Rajshree B.

    2017-05-01

    M-type strontium hexaferrite powder samples were synthesized using a green synthesis route with and without presence of Aloe vera and Neem leaves extract. The dry brownish precursors of strontium hexaferrite were recovered from a mixed solution of metal salts and leaves extract, heated at 100 °C. The obtained precursors were pre-heated at 500 °C for 4 hrs. followed by final heating at 950 °C for 4 hrs. in a muffle furnace to obtain SrFe12O19 hexaferrite powder. The obtained SrFe12O19 hexaferrite powder samples characterized at room temperature in order to check phase purity and structural properties. XRD analysis confirms that samples prepared without and with Aloe vera leaves extract (heated at 950 °C for 4 hrs.) show formation of α-Fe2O3 and M-phase; while the sample prepared in presence of Neem leaves extract (heated at 950 °C for 4 hrs.) show formation of mono phase of strontium hexaferrite. Lattice parameter (a) and cell volume (V) are found to increase in the samples prepared in presence of Aloe vera and Neem leaves extract.

  8. Weevil x Insecticide: Does 'Personality' Matter?

    Science.gov (United States)

    Morales, Juliana A; Cardoso, Danúbia G; Della Lucia, Terezinha Maria C; Guedes, Raul Narciso C

    2013-01-01

    An insect's behavior is the expression of its integrated physiology in response to external and internal stimuli, turning insect behavior into a potential determinant of insecticide exposure. Behavioral traits may therefore influence insecticide efficacy against insects, compromising the validity of standard bioassays of insecticide activity, which are fundamentally based on lethality alone. By extension, insect 'personality' (i.e., an individual's integrated set of behavioral tendencies that is inferred from multiple empirical measures) may also be an important determinant of insecticide exposure and activity. This has yet to be considered because the behavioral studies involving insects and insecticides focus on populations rather than on individuals. Even among studies of animal 'personality', the relative contributions of individual and population variation are usually neglected. Here, we assessed behavioral traits (within the categories: activity, boldness/shyness, and exploration/avoidance) of individuals from 15 populations of the maize weevil (Sitophilus zeamais), an important stored-grain pest with serious problems of insecticide resistance, and correlated the behavioral responses with the activity of the insecticide deltamethrin. This analysis was performed at both the population and individual levels. There was significant variation in weevil 'personality' among individuals and populations, but variation among individuals within populations accounted for most of the observed variation (92.57%). This result emphasizes the importance of individual variation in behavioral and 'personality' studies. When the behavioral traits assessed were correlated with median lethal time (LT50) at the population level and with the survival time under insecticide exposure, activity traits, particularly the distance walked, significantly increased survival time. Therefore, behavioral traits are important components of insecticide efficacy, and individual variation should be

  9. Compatibility of the insect pathogenic fungus Beauveria bassiana with neem against sweetpotato whitefly, Bemisia tabaci, on eggplant

    Science.gov (United States)

    A study on the compatibility of the entomopathogenic fungus Beauveria bassiana (Balsamo) Vuillemin (Ascomycota: Hypocreales) with neem was conducted against sweetpotato whitefly, Bemisia tabaci (Gennadius) (Hemiptera: Aleyrodidae), on eggplant. Initially, three concentrations of B. bassiana (106, 1...

  10. Research and development for botanical products in medicinals and food supplements market.

    Science.gov (United States)

    Miroddi, Marco; Mannucci, Carmen; Mancari, Ferdinando; Navarra, Michele; Calapai, Gioacchino

    2013-01-01

    Botanical products sold in the health area are generally intended as drugs, medicinal products, food supplements or substances for therapeutic use. Use of botanicals for improving or to care human health has evolved independently in different countries worldwide. Regulatory issues regarding botanical products designed for the food supplements or medicinal market and their influence on research and development are discussed. European Union (EU) and United States (US) policies regulating these products are focused with comments on the legislations delivered during the last ten years and differences existing in rules between these countries are emphasized. Research and development on botanical products nowdays strongly influenced by the product destination in the market. Addressed and differentiated research for either food supplements or medicinal markets is necessary to purchase data really useful for assessment of safe and effective use for both the categories. The main objective is to catalyze interest of academic and companies' researchers on crucial aspects to be taken into account in the research for the development of botanical products.

  11. Research and Development for Botanical Products in Medicinals and Food Supplements Market

    Directory of Open Access Journals (Sweden)

    Marco Miroddi

    2013-01-01

    Full Text Available Botanical products sold in the health area are generally intended as drugs, medicinal products, food supplements or substances for therapeutic use. Use of botanicals for improving or to care human health has evolved independently in different countries worldwide. Regulatory issues regarding botanical products designed for the food supplements or medicinal market and their influence on research and development are discussed. European Union (EU and United States (US policies regulating these products are focused with comments on the legislations delivered during the last ten years and differences existing in rules between these countries are emphasized. Research and development on botanical products nowdays strongly influenced by the product destination in the market. Addressed and differentiated research for either food supplements or medicinal markets is necessary to purchase data really useful for assessment of safe and effective use for both the categories. The main objective is to catalyze interest of academic and companies' researchers on crucial aspects to be taken into account in the research for the development of botanical products.

  12. Phytotherapeutics: The Emerging Role of Intestinal and Hepatocellular Transporters in Drug Interactions with Botanical Supplements.

    Science.gov (United States)

    Murtaza, Ghulam; Ullah, Naveed; Mukhtar, Farah; Nawazish, Shamyla; Muneer, Saiqa

    2017-10-21

    In herbalism, botanical supplements are commonly believed to be safe remedies, however, botanical supplements and dietary ingredients interact with transport and metabolic processes, affecting drug disposition. Although a large number of studies have described that botanical supplements interfere with drug metabolism, the mode of their interaction with drug transport processes is not well described. Such interactions may result in serious undesired effects and changed drug efficacy, therefore, some studies on interaction between botanical supplement ingredients and drug transporters such as P-gp and OATPs are described here, suggesting that the interaction between botanical supplements and the drug transporters is clinically significant.

  13. Impact of applying edible oils to silk channels on ear pests of sweet corn

    Science.gov (United States)

    The impact of applying vegetable oils to corn silks on ear-feeding insects in sweet corn production was evaluated in 2006 and 2007. Six vegetable oils used in this experiment were canola, corn, olive, peanut, sesame, and soybean. Water and two commercial insecticidal oils (Neemix' neem oil and Sun...

  14. Morphometric Analysis of the Developmental Stages and Insecticidal Efficacy of Three Botanical Oils Against Adult Callosobruchus analis

    Directory of Open Access Journals (Sweden)

    Olufemi-Salami Folasade Kemisola

    2017-12-01

    Full Text Available The developmental stages of Callosobruchus analis were observed under laboratory conditions at 28 ± 2 °C and 72 ± 5% relative humidity. The results showed that female C. analis began to lay eggs within 24 hours and have an oviposition period of 8.50 ± 0.70 days and an average of 13.00 ± 0.50 eggs were laid by individual C. analis throughout their lifetime. The mean developmental periods from egg to larva and larva to pupa were observed to be 8.50 ± 0.79 and 4.50 ± 0.70 days, respectively. The unmated bruchids were observed to have lived longer than the mated bruchids as the unmated bruchids lifespan was on average 10.50 ± 0.81 days, as opposed to 2.50 ± 0.75 days for mated females. Adult male C. analis have an average antenna length of 2.96 ± 0.08 mm which is slightly longer than 2.42 ± 0.12 mm on average for female bruchids. The three botanical oil extracts from Capsicum frutescens, Anacardium occidentale and Xylopia aethiopica used at 10.0% concentration were not effective, as none of them resulted in a mortality rate of 50% when recorded 3 days after treatment.

  15. Malaria Vector Control Still Matters despite Insecticide Resistance.

    Science.gov (United States)

    Alout, Haoues; Labbé, Pierrick; Chandre, Fabrice; Cohuet, Anna

    2017-08-01

    Mosquito vectors' resistance to insecticides is usually considered a major threat to the recent progresses in malaria control. However, studies measuring the impact of interventions and insecticide resistance reveal inconsistencies when using entomological versus epidemiological indices. First, evaluation tests that do not reflect the susceptibility of mosquitoes when they are infectious may underestimate insecticide efficacy. Moreover, interactions between insecticide resistance and vectorial capacity reveal nonintuitive outcomes of interventions. Therefore, considering ecological interactions between vector, parasite, and environment highlights that the impact of insecticide resistance on the malaria burden is not straightforward and we suggest that vector control still matters despite insecticide resistance. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. Comparison of the effectiveness of 0.5% tea, 2% neem and 0.2% chlorhexidine mouthwashes on oral health: A randomized control trial

    Directory of Open Access Journals (Sweden)

    Aswini Y Balappanavar

    2013-01-01

    Full Text Available Background: The aim of this study was to evaluate and compare the effectiveness of 0.5% tea, 2% neem, and 0.2% chlorhexidine mouthwashes on oral health. Materials and Methods: A randomized blinded controlled trial with 30 healthy human volunteers of age group 18-25 years was carried out. The subjects were randomly assigned to 3 groups i.e., group A - 0.2% chlorhexidine gluconate (bench mark control, Group B - 2% neem, and group C - 0.5% tea of 10 subjects per group. Plaque accumulation and gingival condition were recorded using plaque index and gingival index. Oral hygiene was assessed by simplified oral hygiene index (OHIS. Salivary pH was assessed by indikrom pH strips. Plaque, gingival, and simplified OHI scores as well as salivary pH were recorded at baseline, immediately after 1 st rinse, after 1 week, 2 nd week, and 3 rd week. The 3 rd week was skipped for group A. Results: Mean plaque and gingival scores were reduced over the 3 week trial period for experimental and control groups. Anti-plaque effectiveness was observed in all groups and the highest being in group C (P < 0.05. Neem and tea showed comparative effectiveness on gingiva better than chlorhexidine (P < 0.05. The salivary pH rise was sustained and significant in Group B and C compared to Group A. Oral hygiene improvement was better appreciated in Group B and Group C. Conclusion: The effectiveness of 0.5% tea was more compared to 2% neem and 0.2% chlorhexidine mouth rinse.

  17. Modeling global distribution of agricultural insecticides in surface waters

    International Nuclear Information System (INIS)

    Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J.; Schäfer, Ralf B.; Fornaroli, Riccardo; Liess, Matthias

    2015-01-01

    Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. - Highlights: • First global map on insecticide runoff through modelling. • Model predicts upper limit of insecticide exposure when compared to field data. • Water bodies in 40% of global land surface may be at risk of adverse effects. • Insecticide application rate, terrain slope and rainfall main drivers of exposure. - We provide the first global map on insecticide runoff to surface water predicting that water bodies in 40% of global land surface may be at risk of adverse effects

  18. Research Notes Use of the dry-weight-rank method of botanical ...

    African Journals Online (AJOL)

    When used in combination with the double sampling (or comparative yield) method of yield estimation, the dry-weight-rank method of botanical analysis provides a rapid non-destructive means of estimating botanical composition. The composition is expressed in terms of the contribution of individual species to total herbage ...

  19. Space botanic research

    International Nuclear Information System (INIS)

    Sitnik, K.M.; Kordyum, Se.L.

    1980-01-01

    The basic results of investigations in the field of space botanics are considered, starting with the effect of cosmic radiation on quiet spores and seeds and ending with the modern stage of complex study of lower plants, growing and developing within various periods of time under conditions of a real space flight in special chambers and growing systems. The possibility of using different investigation methods such as luminooptic, electronomicroscopic, biochemical, biophysical, physiological and others to estimate the effect of factors of an orbital flight on plants, are discussed [ru

  20. Effect of Biofertilizers and Neem Oil on the Entomopathogenic Fungi Beauveria bassiana (Bals. Vuill. and Metarhizium anisopliae (Metsch. Sorok

    Directory of Open Access Journals (Sweden)

    Hirose Edson

    2001-01-01

    Full Text Available The in vitro fungitoxic effect of three biofertilizers, E.M.-4, Multibion Ô and Supermagro used in organic agriculture and the neem oil (Azadirachta indica A. Juss on the entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana was studied. These products were mixed in a medium where the two fungi were inoculated, and germination, vegetative growth and conidiogenesis were assessed. The biofertilizers Supermagro and E.M.- 4 showed to be less toxic for the two fungi whereas MultibionÔ caused major inhibition on M. anisopliae, with reductions in germination (-37.74%, colony diameter (-30.26% and conidiogenesis (-42.62%. Neem oil promoted a larger negative effect on B. bassiana, inhibiting germination (-45.27%, colony diameter (-36.62% and conidiogenesis (-84.93%.

  1. Photostabilization of the botanical insecticide azadirachtin in the presence of lecithin as UV protectant

    International Nuclear Information System (INIS)

    Sundaram, K.M.S.; Curry, J.

    1996-01-01

    The phytochemical insecticide, azadirachtin (AZ), undergoes UV‐induced photodegradation. Using the isomer AZ‐A as a standard, its photochemical stability was studied with and without adding lecithin surfactant as a UV protectant. Standard solutions of pure AZ‐A and Margosan‐O ® were prepared in methanol‐hexane with (AZ‐A:lecithin, 1:2 by weight) and without lecithin, applied separately onto glass plates and maple (Acer L.) foliage and exposed to radiant energy under controlled conditions. Noticeable photostabilization of AZ‐A was achieved in the samples containing lecithin compared to AZ‐A samples without the lecithin additive. First‐order kinetic evaluation of the data showed that the DTy 50 (half‐life) and C (rate constant) values for AZ‐A with and without lecithin on glass plates were 5.68 d and 0.122, and 5.42 d and 0.128, respectively. The corresponding values for the Margosan‐0 formulation were 7.37 d and 0.094, and 6.24 d and 0.111. The DT 50 and C values for the pure AZ‐A on maple foliage with and without lecithin were 8.77 d and 0.079, and 6.54 d and 0.106, respectively. The corresponding values for the Margosan‐0 formulation on foliage were 8.35 d and 0.083, and 7.45 d and 0.093. The kinetic data gave quantitative information regarding the photostabilization of AZ‐A in the presence of lecithin. Good UV protection can only be achieved if the additive has the matching X max of AZ‐A. The mechanism of photostabilization of AZ‐A in the presence of lecithin was due to either energy transfer from the excited AZ‐A to lecithin and/or competitive absorption of UV photons by the latter

  2. Development and Verification of Behavior of Tritium Analytic Code (BOTANIC)

    International Nuclear Information System (INIS)

    Park, Min Young; Kim, Eung Soo

    2014-01-01

    VHTR, one of the Generation IV reactor concepts, has a relatively high operation temperature and is usually suggested as a heat source for many industrial processes, including hydrogen production process. Thus, it is vital to trace tritium behavior in the VHTR system and the potential permeation rate to the industrial process. In other words, tritium is a crucial issue in terms of safety in the fission reactor system. Therefore, it is necessary to understand the behavior of tritium and the development of the tool to enable this is vital.. In this study, a Behavior of Tritium Analytic Code (BOTANIC) an analytic tool which is capable of analyzing tritium behavior is developed using a chemical process code called gPROMS. BOTANIC was then further verified using the analytic solutions and benchmark codes such as Tritium Permeation Analysis Code (TPAC) and COMSOL. In this study, the Behavior of Tritium Analytic Code, BOTANIC, has been developed using a chemical process code called gPROMS. The code has several distinctive features including non-diluted assumption, flexible applications and adoption of distributed permeation model. Due to these features, BOTANIC has the capability to analyze a wide range of tritium level systems and has a higher accuracy as it has the capacity to solve distributed models. BOTANIC was successfully developed and verified using analytical solution and the benchmark code calculation result. The results showed very good agreement with the analytical solutions and the calculation results of TPAC and COMSOL. Future work will be focused on the total system verification

  3. Modeling global distribution of agricultural insecticides in surface waters.

    Science.gov (United States)

    Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J; Schäfer, Ralf B; Fornaroli, Riccardo; Liess, Matthias

    2015-03-01

    Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. Copyright © 2014 Elsevier Ltd. All rights reserved.

  4. Identifying deformation mechanisms in the NEEM ice core using EBSD measurements

    Science.gov (United States)

    Kuiper, Ernst-Jan; Weikusat, Ilka; Drury, Martyn R.; Pennock, Gill M.; de Winter, Matthijs D. A.

    2015-04-01

    Deformation of ice in continental sized ice sheets determines the flow behavior of ice towards the sea. Basal dislocation glide is assumed to be the dominant deformation mechanism in the creep deformation of natural ice, but non-basal glide is active as well. Knowledge of what types of deformation mechanisms are active in polar ice is critical in predicting the response of ice sheets in future warmer climates and its contribution to sea level rise, because the activity of deformation mechanisms depends critically on deformation conditions (such as temperature) as well as on the material properties (such as grain size). One of the methods to study the deformation mechanisms in natural materials is Electron Backscattered Diffraction (EBSD). We obtained ca. 50 EBSD maps of five different depths from a Greenlandic ice core (NEEM). The step size varied between 8 and 25 micron depending on the size of the deformation features. The size of the maps varied from 2000 to 10000 grid point. Indexing rates were up to 95%, partially by saving and reanalyzing the EBSP patterns. With this method we can characterize subgrain boundaries and determine the lattice rotation configurations of each individual subgrain. Combining these observations with arrangement/geometry of subgrain boundaries the dislocation types can be determined, which form these boundaries. Three main types of subgrain boundaries have been recognized in Antarctic (EDML) ice core¹². Here, we present the first results obtained from EBSD measurements performed on the NEEM ice core samples from the last glacial period, focusing on the relevance of dislocation activity of the possible slip systems. Preliminary results show that all three subgrain types, recognized in the EDML core, occur in the NEEM samples. In addition to the classical boundaries made up of basal dislocations, subgrain boundaries made of non-basal dislocations are also common. ¹Weikusat, I.; de Winter, D. A. M.; Pennock, G. M.; Hayles, M

  5. A novel botanical formula prevents diabetes by improving insulin resistance.

    Science.gov (United States)

    Kan, Juntao; Velliquette, Rodney A; Grann, Kerry; Burns, Charlie R; Scholten, Jeff; Tian, Feng; Zhang, Qi; Gui, Min

    2017-07-05

    Type 2 diabetes mellitus (T2DM) is a major risk factor for cardiovascular disease, and the prevalence has increased significantly in recent decades to epidemic proportions in China. Individually, fenugreek (Trigonella foenum graecum) seed, mulberry (Morus alba L.) leaf and American ginseng (Panax quinquefolius) root can improve glycemia in various animal models and humans with impaired glucose metabolism and T2DM. The aim of this study was to design an optimized botanical formula containing these herbal extracts as a nutritional strategy for the prevention of insulin resistance and T2DM. Cell-free α-amylase and α-glucosidase enzyme assays were used to determine inhibitory potential of extracts. Glucose uptake was examined in differentiated human adipocytes using radiolabeled 2-deoxyglucose. Male Sprague Dawley rats were divided and glycemia balanced into 5 groups: two controls (naïve and model) and three doses of the botanical test formula containing standardized fenugreek seed, mulberry leaf and American ginseng extracts (42.33, 84.66 and 169.33 mg/kg BW). Insulin resistance and T2DM was induced by feeding animals a high fat diet and with an alloxan injection. Glucose tolerance was examined by measuring serum glucose levels following an oral glucose load. Fenugreek seed and mulberry leaf dose dependently inhibited α-amylase (IC50 = 73.2 μg/mL) and α-glucosidase (IC50 = 111.8 ng/mL), respectively. All three botanical extracts improved insulin sensitivity and glucose uptake in human adipocytes, which lead to the design of an optimized botanical test formula. In a rat model of insulin resistance and T2DM, the optimized botanical test formula improved fasting serum glucose levels, fasting insulin resistance and the development of impaired glucose tolerance. The reduction in epididymal adipose tissue GLUT4 and PDK1 expression induced by high fat diet and alloxan was blunted by the botanical test formula. A novel botanical formula containing standardized

  6. Development of Botanical Composition in Maribaya Pasture, Brebes, Central Java

    Science.gov (United States)

    Umami, N.; Ngadiyono, N.; Panjono; Agus, F. N.; Shirothul, H. M.; Budisatria, I. G. S.; Hendrawati, Y.; Subroto, I.

    2018-02-01

    The research was aimed to observe the development of botanical composition in Maribaya pastures. The sampling method was cluster random sampling. The observed variables were the type of forages and the botanical composition in the pasture. Botanical composition was measured by using Line Intercept method and the production was measured by the estimation of botany production for each square meter using its dry matter measurement. The botani sampling was performed using square with size of 1×1 m2. The observation was performed before the pasture made (at 2015) and after the pasture made (at 2017). Based on the research result, it was found that there was significant difference between the forage type in the pasture at 2015 and at 2017. It happens due to the adjustment for the Jabres cattle feed.

  7. Polyphenols as Possible Markers of Botanical Origin of Honey.

    Science.gov (United States)

    Gašić, Uroš M; Milojković-Opsenica, Dušanka M; Tešić, Živoslav Lj

    2017-07-01

    In recent years, the botanical and geographical origin of food has become an important topic in the context of food quality and safety, as well as consumer protection, in accordance with international standards. Finding chemical markers, especially phytochemicals, characteristic for some kind of food is the subject of interest of a significant number of researchers in the world. This paper is focused on the use of polyphenols as potential markers for the determination of botanical origin of honey. It includes a review of the polyphenols present in various honey samples and the methods for their separation and identification. Special emphasis in this paper is placed on the identification of honey polyphenols using advanced LC-MS techniques in order to find specific markers of botanical origin of honey. In this regard, this study gives an overview of the literature that describes the use of LC-MS techniques for the isolation and determination of honey polyphenols. This review focuses on the research performed in the past two decades.

  8. Process Philosophy and the Text-Image Interface: A Study of Three Western Australian Botanical Illustrators

    Directory of Open Access Journals (Sweden)

    John Charles Ryan

    2012-12-01

    Full Text Available Botanical illustration combines scientific knowledge and artistic technique. However, whereas illustrated botanical images record static visual qualities, such as form and color, written botanical narratives supply crucial sensory, ecological, historical, and cultural contexts that complement visual representation. Understanding the text-image interface—where images and words intersect—contributes to humanities-based analyses of botanical illustration and illustrators. More specifically, a process philosophy perspective reveals the extent to which botanical representations engage the temporality, cyclicality, and contextuality of the living plants being illustrated. This article takes up these themes through a comparative theoretical study of three female Western Australian botanical illustrators, Georgiana Leake (1812–1869, Emily Pelloe (1877–1941, and Philippa Nikulinsky (born 1942, whose lives together span the 183 year history of the Swan River Colony and the state of Western Australia. I apply a processist framework to examine the text-image interface of their works. All three illustrators use some form of textuality: marginalia, annotations, written accompaniments, introductory statements, and other narrative materials. In examining their written commentaries and traces, I identify the emergence of a process mode of botanical illustration that represents plants as ecological, historical, cultural, and temporal organisms.

  9. The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation

    Science.gov (United States)

    de Almeida, Luis Gustavo; de Moraes, Luiz Alberto Beraldo; Trigo, José Roberto; Omoto, Celso

    2017-01-01

    The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects. PMID:28358907

  10. The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation.

    Directory of Open Access Journals (Sweden)

    Luis Gustavo de Almeida

    Full Text Available The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects.

  11. Anticholinesterase insecticide retrospective.

    Science.gov (United States)

    Casida, John E; Durkin, Kathleen A

    2013-03-25

    The anticholinesterase (antiChE) organophosphorus (OP) and methylcarbamate (MC) insecticides have been used very effectively as contact and systemic plant protectants for seven decades. About 90 of these compounds are still in use - the largest number for any insecticide chemotype or mode of action. In both insects and mammals, AChE inhibition and acetylcholine accumulation leads to excitation and death. The cholinergic system of insects is located centrally (where it is protected from ionized OPs and MCs) but not at the neuromuscular junction. Structural differences between insect and mammalian AChE are also evident in their genomics, amino acid sequences and active site conformations. Species selectivity is determined in part by inhibitor and target site specificity. Pest population selection with OPs and MCs has resulted in a multitude of modified AChEs of altered inhibitor specificity some conferring insecticide resistance and others enhancing sensitivity. Much of the success of antiChE insecticides results from a suitable balance of bioactivation and detoxification by families of CYP450 oxidases, hydrolases, glutathione S-transferases and others. Known inhibitors for these enzymes block detoxification and enhance potency which is particularly important in resistant strains. The current market for OPs and MCs of 19% of worldwide insecticide sales is only half of that of 10 years ago for several reasons: there have been no major new compounds for 30 years; resistance has eroded their effectiveness; human toxicity problems are still encountered; the patents have expired reducing the incentive to update registration packages; alternative chemotypes or control methods have been developed. Despite this decline, they still play a major role in pest control and the increasing knowledge on their target sites and metabolism may make it possible to redesign the inhibitors for insensitive AChEs and to target new sites in the cholinergic system. The OPs and MCs are down

  12. Neem (Azadirachta indica A. Juss) Oil: A Natural Preservative to Control Meat Spoilage

    Science.gov (United States)

    Del Serrone, Paola; Toniolo, Chiara; Nicoletti, Marcello

    2015-01-01

    Plant-derived extracts (PDEs) are a source of biologically-active substances having antimicrobial properties. The aim of this study was to evaluate the potential of neem oil (NO) as a preservative of fresh retail meat. The antibacterial activity of NO against Carnobacterium maltaromaticum, Brochothrix thermosphacta, Escherichia coli, Pseudomonas fluorescens, Lactobacillus curvatus and L. sakei was assessed in a broth model system. The bacterial growth inhibition zone (mm) ranged from 18.83 ± 1.18 to 30.00 ± 1.00, as was found by a disc diffusion test with 100 µL NO. The bacterial percent growth reduction ranged from 30.81 ± 2.08 to 99.70 ± 1.53 in the broth microdilution method at different NO concentrations (1:10 to 1:100,000). Viable bacterial cells were detected in experimentally-contaminated meat up to the second day after NO treatment (100 µL NO per 10 g meat), except for C. maltaromaticum, which was detected up to the sixth day by PCR and nested PCR with propidium monoazide (PMA™) dye. In comparison to the previously published results, C. maltaromaticum, E. coli, L. curvatus and L. sakei appeared more susceptible to NO compared to neem cake extract (NCE) by using a broth model system. PMID:28231186

  13. Neem (Azadirachta indica A. Juss Oil: A Natural Preservative to Control Meat Spoilage

    Directory of Open Access Journals (Sweden)

    Paola Del Serrone

    2015-01-01

    Full Text Available Plant-derived extracts (PDEs are a source of biologically-active substances having antimicrobial properties. The aim of this study was to evaluate the potential of neem oil (NO as a preservative of fresh retail meat. The antibacterial activity of NO against Carnobacterium maltaromaticum, Brochothrix thermosphacta, Escherichia coli, Pseudomonas fluorescens, Lactobacillus curvatus and L. sakei was assessed in a broth model system. The bacterial growth inhibition zone (mm ranged from 18.83 ± 1.18 to 30.00 ± 1.00, as was found by a disc diffusion test with 100 µL NO. The bacterial percent growth reduction ranged from 30.81 ± 2.08 to 99.70 ± 1.53 in the broth microdilution method at different NO concentrations (1:10 to 1:100,000. Viable bacterial cells were detected in experimentally-contaminated meat up to the second day after NO treatment (100 µL NO per 10 g meat, except for C. maltaromaticum, which was detected up to the sixth day by PCR and nested PCR with propidium monoazide (PMA™ dye. In comparison to the previously published results, C. maltaromaticum, E. coli, L. curvatus and L. sakei appeared more susceptible to NO compared to neem cake extract (NCE by using a broth model system.

  14. ENVIRONMENTAL CONTAMINANTS AND POTENTIAL HUMAN RISK ASSOCIATED WITH SELECTED BOTANICAL DIETARY SUPPLEMENTS

    Science.gov (United States)

    Botanical dietary supplements have a long history of use in Europe and China and they are becoming increasingly popular in the United States. However, little data is available regarding environmental contaminants in botanical dietary supplements and the risk posed to those ingest...

  15. A comparative estimation of C.I. engine fuelled with methyl esters of punnai, neem and waste cooking oil

    Energy Technology Data Exchange (ETDEWEB)

    Subramaniam, D.; Avinash, A. [Department of Mechanical Engineering - K.S.Rangasamy College of Technology –Tiruchengode, 637215 Tamil Nadu (India); Murugesan, A. [Department of Mechatronics Engineering - K.S.Rangasamy College of Technology – Tiruchengode, 637215 Tamil Nadu (India)

    2013-07-01

    In this experimental study, performance, emission, and combustion characteristics of methyl esters of Punnai, Neem, Waste Cooking Oil and their diesel blends in a C.I. engine was experimentally examined. For the study, Punnai oil methyl esters (POME), neem oil methyl esters (NOME), and Waste Cooking Oil Methyl Esters (WCOME) were prepared by tranesterification process. The Bio diesel-diesel blends were prepared by mixing 10%, 30%, 50%, and 70% of bio diesel with diesel. The effects of three methyl esters and their diesel blends on engine performance, combustion, and exhaust emissions were examined at different engine loads. Experimental results concluded that up to 30% of methyl esters did not affect the performance, combustion, and emissions characteristics. On the other hand, above B30 (30% Bio diesel with 70% diesel) a reduction in performance, combustion, and emission characteristics were clear from the study.

  16. Photoprotective effect of botanicals and vitamins: A systematic review of clinical trials.

    Science.gov (United States)

    Tuong, William; Kuo, Sandy; Sivamani, Raja K

    2015-01-01

    Overexposure to solar radiation is a major contributor to skin cancer development and premature skin aging. Botanical extracts and vitamins may represent novel photoprotective agents. We sought to systemically review clinical evidence for the use of botanically derived agents and vitamins as photoprotective agents. We systematically searched Embase and PubMed databases. Two independent reviewers reviewed abstracts for inclusion. Additional relevant studies were identified by a manual review of reference lists. Data from eligible studies were extracted independently and discrepancies were resolved by consensus. A total of 51 studies met inclusion criteria. Limited available evidence indicates that several botanical agents and vitamins in topical or oral forms may have promising photoprotective effects. However, generalizability of results is limited by small sample sizes. Botanical extracts and vitamins may add to the armamentarium of sun-protective agents. Additional high-quality trials are needed to strengthen support for their use.

  17. Diagnostic Doses of Insecticides for Adult Aedes aegypti to Assess Insecticide Resistance in Cuba.

    Science.gov (United States)

    Rodríguez, María Magdalena; Crespo, Ariel; Hurtado, Daymi; Fuentes, Ilario; Rey, Jorge; Bisset, Juan Andrés

    2017-06-01

    The objective of this study was to determine diagnostic doses (DDs) of 5 insecticides for the Rockefeller susceptible strain of Aedes aegypti , using the Centers for Disease Control and Prevention (CDC) bottle bioassay as a tool for monitoring insecticide resistance in the Cuban vector control program. The 30-min DD values determined in this study were 13.5 μg/ml, 6.5 μg/ml, 6 μg/ml, 90.0 μg/ml, and 15.0 μg/ml for cypermethrin, deltamethrin, lambda-cyhalothrin, chlorpyrifos, and propoxur, respectively. To compare the reliability of CDC bottle bioassay with the World Health Organization susceptible test, 3 insecticide-resistant strains were evaluated for deltamethrin and lambda-cyhalothrin. Results showed that the bottles can be used effectively from 21 to 25 days after treatment and reused up to 4 times, depending on the storage time. The CDC bottle bioassay is an effective tool to assess insecticide resistance in field populations of Ae. aegypti in Cuba and can be incorporated into vector management programs using the diagnostic doses determined in this study.

  18. Level of use and safety of botanical products for itching vulvar dermatoses. Are patch tests useful?

    Science.gov (United States)

    Corazza, Monica; Virgili, Annarosa; Toni, Giulia; Minghetti, Sara; Tiengo, Silvia; Borghi, Alessandro

    2016-05-01

    Topical remedies based on botanical ingredients are popular. To assess: (i) the usage of botanical substances in subjects affected with itching and chronic vulvar complaints; (ii) the incidence of side-effects associated with their use and the frequency of contact allergy; (iii) the diagnostic usefulness of patch testing. Sixty-six patients were provided with a questionnaire to assess the prevalence and type of topical botanical preparations used and the occurrence of adverse reactions. Patients were patch tested with (i) the Italian baseline series, (ii) a topical medicament series, and (iii) a botanical series. Forty-two patients (63.6%) reported the use of natural topical products on the vulva. Seven (16.7%) noted adverse reactions; 27 showed positive reactions with the baseline series; 14 (21.2%) had at least one relevant reaction, mainly to allergens in topical products and cosmetics; and 2 (3%) showed positive reactions to the botanical series. Of the 7 patients complaining of adverse effects of botanical products, 3 (42.8%) showed relevant sensitization. The use of natural topical products is widespread among women affected with itching vulvar diseases. Contact dermatitis is a possible adverse effect. Botanical series are of questionable usefulness, owing to the wide variety of botanical ingredients. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  19. Visiting motivation and satisfaction of visitors to Chinese botanical gardens

    OpenAIRE

    He He; Jin Chen

    2011-01-01

    Botanical gardens (BGs) have attracted millions of visitors worldwide; therefore, BGs have become important sites for displaying and education for biodiversity. Understanding garden visitors’ motivations and their traveling satisfactory degree is crucial for BG management and its role in public education. In this study, we conducted survey in five Chinese BGs, i.e., Xiamen BG, Wuhan BG of Chinese Academy of Sciences (CAS), Beijing BG, Kunming BG of CAS and Xishuangbanna Tropical Botanical Gar...

  20. The effects of a novel botanical agent on lipopolysaccharide-induced alveolar bone loss in rats.

    Science.gov (United States)

    Lee, Bo-Ah; Lee, Hwa-Sun; Jung, Young-Suk; Kim, Se-Won; Lee, Yong-Wook; Chang, Sun-Hwa; Chung, Hyun-Ju; Kim, Ok-Su; Kim, Young-Joon

    2013-08-01

    The development of host-modulatory agents with low risk of adverse effects has been needed to treat periodontitis, a chronic inflammatory disease. A botanical mixture of extracts from two natural substances, Panax notoginseng and Rehmannia glutinosa Libosch, was developed as a novel botanical agent synthesized with anti-inflammatory effect. The aim of this study is to evaluate the effects of the botanical mixture on the release of inflammatory cytokines and its inhibitory effect on lipopolysaccharide (LPS)-induced alveolar bone loss (ABL) in a rat model. Cytotoxicity was assessed by 3-(4,5-dimethylthiazol-2yl)-5(3-carboxymethoxyphenol)-2-(4-sulfophenyl)-2H-tetrazolium assay using human gingival fibroblast (hGF) and human periodontal ligament (hPDL) cells. Human acute monocytic leukemia cell line and hGF cells were cultured to assay tumor necrosis factor (TNF)-α and interleukin (IL)-6, respectively. Microcomputed tomography analysis and immunofluoresence analysis were performed to evaluate the efficacy of the botanical mixture to inhibit the destruction of alveolar bone and connective tissue in a rat model. The botanical mixture is cytotoxic at concentrations exceeding 2.5 mg/mL (P botanical mixture to be used in all subsequent in vitro and in vivo experiments. The botanical mixture reduced the release of TNF-α and IL-6 from human monocytic cells and hGF cells in a dose-dependent manner (P botanical mixture significantly reduced the alveolar bone loss in a rat model (P botanical mixture, matrix metalloproteinase (MMP)-9 was detected along the alveolar bone crest (ABC), but not around the gingival connective tissue, while in the group with LPS-induced ABL, pronounced expression of MMP-9 around the ABC, periodontal ligament, and gingival connective tissue was found. The botanical mixture showed a potential adjunctive effect in the treatment of periodontitis. However, the present findings are obtained in vitro and in a rat model, so further clinical study is needed

  1. The Botanical Expedition to New Spain, 1786-1803: Mexico City's Botanical Garden and Pro­fessorship in Botany

    Directory of Open Access Journals (Sweden)

    J. Luis Maldonado Polo

    2000-07-01

    Full Text Available Thís work is about a  scientific enterprise carried out by  the Spanish Crown during the illustrated period, as a part of the ex­peditionary project to the overseas  territories. It describes the details and circumstances in which the Botanical Expedition be­gan, considering the prevailing intellectual environment at the time and the people who took a Ieading role in the cultural life of  the  incipient but  vigorous New Spain scientific community. After describing this background, the  author considers one of the Expedition's main results: the creation of  Mexico City's Botanical Garden and  Professorship in Botany,  which was the first of its kind in the American continent and contributed toes­ establish the study of Botany and related sciences in New Spain.

  2. Sublethal effect of neem extract on mediterranean fruit fly adults

    Directory of Open Access Journals (Sweden)

    Márcio Alves Silva

    2013-03-01

    Full Text Available The sublethal effect of extracts of Azadirachta indica on Ceratitis capitata was evaluated. Two pairs of flies were treated in plastic tubes with cotton placed in plastic cages. An artificial diet (hydrolyzed protein + sugar was provided ad libitum. The extracts affected significantly the longevity of C. capitata. The pre-oviposition period were not significantly affected by the extracts. The A. indica branches extracted with dichloromethane (888 ppm affected significantly the fecundity and fertility, reducing the number of eggs laid to approximately 80 % and the egg hatching by 30 % at the 8th day. Therefore, the neem branches extracted with dichloromethane affected the reproduction of C. capitata.

  3. Rice Production without Insecticide in Smallholder Farmer's Field

    Directory of Open Access Journals (Sweden)

    M. P. Ali

    2017-05-01

    Full Text Available Highlights:Use of perching, sweeping, and need based insecticide (IPM technique useage produce at par yields compared to prophylactic insecticide useage in rice fields.There exists a technique that can reduce 75% of insecticide useage in rice field.The results were obtained in cooperation between smallholder rice farmers and researchers of Bangladesh.Currently rice protection from insect pests solely depends on chemical pesticides which have tremendous impact on biodiversity, environment, animal, and human health. To reduce their impact from our society we need to cut pesticide use from agricultural practices. To address this issue, we did an experiment to identify realistic solutions that could help farmers build sustainable crop protection systems and minimize useage of insecticides and thus reduce the impact of pesticides in the environment. Innovations developed jointly by farmers and researchers and evaluated for their potential to be adopted by more farmers. In this paper we tested four management practices jointly with smallholder farmer fields in order to select the best one. Four management practices were used namely, T1 = Prophylactic use of insecticide where insecticide was applied in rice field at every 15 days interval without judging the infestation level; T2 = Perching (that is, placing roosting (perching sites for insectivorous birds within the rice field and concurrent sweep net samples along with need-based insecticide application; T3 = Perching only; and T4 = Farmer's own practices. The results revealed that routine application of insecticides for crop protection is not mandatory which is commonly found at use in rice farmers. In our experiment, where prophylactic method or farmers used 3–4 times insecticides without judging the insect pests infestation level, the similar pest population was found when compared to the field where insecticide was not applied. Our management system reduced by 75% the use of insecticides even

  4. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Detailed Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  5. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Simple Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  6. Botanical drugs in Ayurveda and Traditional Chinese Medicine.

    Science.gov (United States)

    Jaiswal, Yogini; Liang, Zhitao; Zhao, Zhongzhen

    2016-12-24

    China and India have a long history in the therapeutic application of botanical drugs in traditional medicine. Traditional Chinese Medicine (TCM) and Ayurveda are considered as two of the most ancient systems of medicine, with history of more than two millennia. Medicinal plants are the principal medicinal materials used in both these systems. This review discusses about the histories of Ayurveda and TCM, the common medicinal plants species, the drug processing strategies used, and the current statuses of these traditional systems of medicine (TSM). Through the views presented in this article, we aim to provide a new perspective to herbal drug researchers for expanding and improving the utilization of botanical drugs and their therapeutic applications. A bibliographic investigation of Chinese and Indian pharmacopoeias, monographs and official websites was performed. Furthermore, information was obtained from scientific databases on ethnobotany and ethno medicines. The review of Ayurveda and TCM ethno medicine indicates that both these systems have many medicinal materials in common. The studies carried out by the authors for comparison of plants from same genus from both these TSM's have been discussed to further bring focus to the utilization of "qualitatively" similar species which can be utilized and substituted for endangered or economically valued species. The overview of ancient literature and scientific findings for drugs in both these systems suggests that, the botanical drugs used in common and their processing methods can be explored further for extensive utilization in traditional medicine. This review describes the histories, common medicinal plant species, their processing methods and therapeutic applications in Ayurveda and TCM. The insights provided through this article may be used by herbal drug researchers and pharmacologists for further exploration of botanical drugs from these two traditional systems of medicine. Copyright © 2016. Published by

  7. Top 10 botanical ingredients in 2010 anti-aging creams.

    Science.gov (United States)

    Cronin, Hyland; Draelos, Zoe Diana

    2010-09-01

    New developments in the realm of skin rejuvenation such as phytotherapy are at an astounding increasing pace in the cosmeceutical market. Yet, many of these products that are classified as cosmeceuticals are tested less vigorously and do not have to be approved by the Food and Drug Administration to establish efficacy and safety. Thus, as clinicians, we must ask the question, "Is there science-based evidence to validate the mechanism of these new treatments?" We assessed the top anti-aging creams currently on the market specifically evaluating their botanical ingredients. Some of the most common botanicals that are hot off the market are: Rosmarinus officinalis, Vitis vinifera (grape seed extract), Citronellol, Limonene, Oenothera biennis (evening primrose), Glycyrrhiza glabra (licorice extract), Aframomum angustifolium seed extract, Diosgenin (wild yam), N6 furfuryladenine (kinetin), and Ergothioneine. Through researching each of these botanical ingredients, we have concluded that randomized controlled trials are still needed in this area, but there is promise in some of these ingredients and science to validate them. © 2010 Wiley Periodicals, Inc.

  8. An Operational Framework for Insecticide Resistance Management Planning.

    Science.gov (United States)

    Chanda, Emmanuel; Thomsen, Edward K; Musapa, Mulenga; Kamuliwo, Mulakwa; Brogdon, William G; Norris, Douglas E; Masaninga, Freddie; Wirtz, Robert; Sikaala, Chadwick H; Muleba, Mbanga; Craig, Allen; Govere, John M; Ranson, Hilary; Hemingway, Janet; Seyoum, Aklilu; Macdonald, Michael B; Coleman, Michael

    2016-05-01

    Arthropod vectors transmit organisms that cause many emerging and reemerging diseases, and their control is reliant mainly on the use of chemical insecticides. Only a few classes of insecticides are available for public health use, and the increased spread of insecticide resistance is a major threat to sustainable disease control. The primary strategy for mitigating the detrimental effects of insecticide resistance is the development of an insecticide resistance management plan. However, few examples exist to show how to implement such plans programmatically. We describe the formulation and implementation of a resistance management plan for mosquito vectors of human disease in Zambia. We also discuss challenges, steps taken to address the challenges, and directions for the future.

  9. Insecticide susceptibility status of human biting mosquitoes in ...

    African Journals Online (AJOL)

    Background: There has been a rapid emergence in insecticide resistance among mosquito population to commonly used public health insecticides. This situation presents a challenge to chemicals that are currently used to control mosquitoes in sub-Saharan African. Furthermore, there is limited information on insecticide ...

  10. [Study on botanical pesticides and its application in production of traditional Chinese medicine].

    Science.gov (United States)

    Zhang, Peng; Li, Xi-Wen; Dong, Lin-Lin; Chen, Shi-Lin

    2016-10-01

    The issues including excessive pesticide residues and heavy metal contamination have become the bottle-neck in the development of Chinese herbal medicines. Compared with traditional chemical pesticides, biological pesticides, especially botanical pesticides, are more safe and environment-friendly, which were beneficial to the quality improvement Chinese medicinal materials. Though there exists a weak basic research and it is hard for promotion and regulation, the policy of good and the desire for botanical pesticides will accelerate its development, and replace traditional chemical pesticides gradually. This paper reviews the current situation of botanical pesticides, and gives some pertinence suggestions according to the existing problems and challenges. Research on botanical pesticides will become the key point to solve the problem of excessive pesticides residues and heavy metal contamination, and promote the healthy development of Chinese materia medica. Copyright© by the Chinese Pharmaceutical Association.

  11. Fractional characterisation of jatropha, neem, moringa, trisperma, castor and candlenut seeds as potential feedstocks for biodiesel production in Cuba

    Energy Technology Data Exchange (ETDEWEB)

    Martin, Carlos [Bioresource Technology group, Department of Chemistry and Chemical Engineering, University of Matanzas, Autopista a Varadero, km 3, Matanzas 44740 (Cuba); Department of Chemical Engineering, University of Vigo (Campus Ourense), Polytechnical Building, As Lagoas, 32004 Ourense (Spain); Moure, Andres; Dominguez, Herminia; Parajo, Juan C. [Department of Chemical Engineering, University of Vigo (Campus Ourense), Polytechnical Building, As Lagoas, 32004 Ourense (Spain); Martin, Giraldo [Experimental Station of Pastures and Forages ' ' Indio Hatuey' ' , Central Espana Republicana, CP 44280, Matanzas (Cuba); Carrillo, Eugenio [Biomass Energy Department, National Renewable Energy Centre (CENER), Ciudad de la Innovacion 4, Sarriguren, 31621 Pamplona (Spain)

    2010-04-15

    A preliminary investigation on the suitability of various non-edible oil seeds for the integral utilisation of their fractions for production of biodiesel and other products was carried out. The oil seeds considered were jatropha (Jatropha curcas), neem (Azadirachta indica), moringa (Moringa oleifera), trisperma (Aleurites trisperma), castor beans (Ricinus communis) and candlenut (Aleurites moluccana). The highest oil content (62.0% (w/w)) was found in trisperma seeds, but the use of that oil for biodiesel production is restricted by its high content of polyunsaturated fatty acids. The oils of castor beans and moringa contained 86.0% of ricinoleic acid and 70.6% of oleic acid, respectively, while in the oils from the other seeds no predominance of any acid was observed. According to the oil yield and to the fatty acid composition of the oil, jatropha was identified as the most promising oil seed for biodiesel production in Cuba. All the press cakes were rich in protein, the highest content (68.6%) being detected in moringa cake. The investigation revealed that the husks of neem and moringa can be considered potential substrates for ethanol production due to their high cellulose content (approximately 30%). A high concentration (4.3%) of acetyl groups was found in neem husks, what is favourable for the hydrolytic conversion of polysaccharides to simple sugars. A high protein content (15.2%) was detected in moringa husks, which is a positive feature for lowering the cost of nutrient supplementation in ethanolic fermentation. (author)

  12. Interactive wood combustion for botanical tree models

    KAUST Repository

    Pirk, Sö ren; Jarząbek, Michał; Hadrich, Torsten; Michels, Dominik L.; Palubicki, Wojciech

    2017-01-01

    We present a novel method for the combustion of botanical tree models. Tree models are represented as connected particles for the branching structure and a polygonal surface mesh for the combustion. Each particle stores biological and physical

  13. Improvement of sperm density in neem-oil induced infertile male albino rats by Ipomoea digitata Linn.

    Directory of Open Access Journals (Sweden)

    Ghanashyam Keshav Mahajan

    2015-06-01

    Full Text Available Aim: Investigation has been carried out to validate folkloric claim of the potential of ID based on reproductive health status in experimentally induced male albino rats. Materials and Methods: Emulsified neem oil (ENO fed albino rats were orally administered root powder of ID suspended in water for the doses of 250 and 500 mg/kg body weight for 40 days. Change in organ weight, sperm density and motility, serum hormonal levels and histomorphological changes were evaluated. Results: Significant increase in the sperm density and the sperm motility (P< 0.01 along with increase in the testis, and epididymes weight in neem-oil induced infertile rats treated with ID at both dose levels. This effect is vis- and agrave;-vis to serum hormonal levels. Presence of beta-sitosterol in the root of ID likely to enhance the process of spermatogenesis as it is evident from histomorphological studies. Conclusion: Results of the present investigation reveal that ID is a good candidate for the management of male infertility. [J Intercult Ethnopharmacol 2015; 4(2.000: 125-128

  14. Insecticide Resistance and Metabolic Mechanisms Involved in Larval and Adult Stages of Aedes aegypti Insecticide-Resistant Reference Strains from Cuba.

    Science.gov (United States)

    Bisset, Juan Andrés; Rodríguez, María Magdalena; French, Leydis; Severson, David W; Gutiérrez, Gladys; Hurtado, Daymi; Fuentes, Ilario

    2014-12-01

    Studies were conducted to compare levels of insecticide resistance and to determine the metabolic resistance mechanisms in larval and adult stages of Aedes aegypti from Cuba. Three insecticide-resistant reference strains of Ae. aegypti from Cuba were examined. These strains were derived from a Santiago de Cuba strain isolated in 1997; it was previously subjected to a strong selection for resistance to temephos (SAN-F6), deltamethrin (SAN-F12), and propoxur (SAN-F13) and routinely maintained in the laboratory under selection pressure up to the present time, when the study was carried out. In addition, an insecticide-susceptible strain was used for comparison. The insecticide resistance in larvae and adults was determined using standard World Health Organization methodologies. Insecticide resistance mechanisms were determined by biochemical assays. The esterases (α EST and β EST) and mixed function oxidase (MFO) activities were significantly higher in adults than in the larvae of the three resistant strains studied. The association of resistance level with the biochemical mechanism for each insecticide was established for each stage. The observed differences between larval and adult stages of Ae. aegypti in their levels of insecticide resistance and the biochemical mechanisms involved should be included as part of monitoring and surveillance activities in Ae. aegypti vector control programs.

  15. Is Apis mellifera more sensitive to insecticides than other insects?

    Science.gov (United States)

    Hardstone, Melissa C; Scott, Jeffrey G

    2010-11-01

    Honey bees (Apis mellifera L.) are among the most important pollinators in natural and agricultural settings. They commonly encounter insecticides, and the effects of insecticides on honey bees have been frequently noted. It has been suggested that honey bees may be (as a species) uniquely sensitive to insecticides, although no comparative toxicology study has been undertaken to examine this claim. An extensive literature review was conducted, using data in which adult insects were topically treated with insecticides. The goal of this review was to summarize insecticide toxicity data between A. mellifera and other insects to determine the relative sensitivity of honey bees to insecticides. It was found that, in general, honey bees were no more sensitive than other insect species across the 62 insecticides examined. In addition, honey bees were not more sensitive to any of the six classes of insecticides (carbamates, nicotinoids, organochlorines, organophosphates, pyrethroids and miscellaneous) examined. While honey bees can be sensitive to individual insecticides, they are not a highly sensitive species to insecticides overall, or even to specific classes of insecticides. However, all pesticides should be used in a way that minimizes honey bee exposure, so as to minimize possible declines in the number of bees and/or honey contamination. Copyright © 2010 Society of Chemical Industry.

  16. Experimental investigation on emission reduction in neem oil biodiesel using selective catalytic reduction and catalytic converter techniques.

    Science.gov (United States)

    Viswanathan, Karthickeyan

    2018-05-01

    In the present study, non-edible seed oil namely raw neem oil was converted into biodiesel using transesterification process. In the experimentation, two biodiesel blends were prepared namely B25 (25% neem oil methyl ester with 75% of diesel) and B50 (50% neem oil methyl ester with 50% diesel). Urea-based selective catalytic reduction (SCR) technique with catalytic converter (CC) was fixed in the exhaust tail pipe of the engine for the reduction of engine exhaust emissions. Initially, the engine was operated with diesel as a working fluid and followed by refilling of biodiesel blends B25 and B50 to obtain the baseline readings without SCR and CC. Then, the same procedure was repeated with SCR and CC technique for emission reduction measurement in diesel, B25 and B50 sample. The experimental results revealed that the B25 blend showed higher break thermal efficiency (BTE) and exhaust gas temperature (EGT) with lower break-specific fuel consumption (BSFC) than B50 blend at all loads. On comparing with biodiesel blends, diesel experiences increased BTE of 31.9% with reduced BSFC of 0.29 kg/kWh at full load. A notable emission reduction was noticed for all test fuels in SCR and CC setup. At full load, B25 showed lower carbon monoxide (CO) of 0.09% volume, hydrocarbon (HC) of 24 ppm, and smoke of 14 HSU and oxides of nitrogen (NOx) of 735 ppm than diesel and B50 in SCR and CC setup. On the whole, the engine with SCR and CC setup showed better performance and emission characteristics than standard engine operation.

  17. THE MOCHE BOTANICAL FROG (La rana botánica mochica

    Directory of Open Access Journals (Sweden)

    Donna McClelland †

    2011-06-01

    Full Text Available Plants and animals with features which identify them as supernaturals characterize the art of the Precolumbian Moche culture of northern Peru. Among these animals is a frog with feline attributes and a consistent association with manioc tubers, stalks, and plants, the Botanical Frog. The Botanical Frog appears to have been patterned on Leptodactylus pentadactylus. It is shown copulating with felines. Fine line painted vessels and ones with low relief decoration show the Botanical Frog performing as part of a ritual involving other animals and cultivated crops, suggesting that the Botanical Frog was associated with agriculture. ESPAÑOL: El arte de la cultura mochica de la costa norte del Perú presenta plantas y animales mostrando rasgos sobrenaturales. Uno de los animales es una rana con elementos felinos y asociada con tubérculos, ramas y plantas de yuca. La Rana Botánica probablemente tiene su origen en Leptodactylus pentadactylus, una rana carnívora de la selva amazónica. La Rana Botánica copula con felinos y, en vasijas pintadas con líneas finas o con escenarios representados en bajorrelieve, toma parte en ceremonias involucrando a otros animales y cosechas domésticas. Parece ser que la Rana Botánica era un ser sobrenatural asociado con la agricultura.

  18. Botanical modulation of menopausal symptoms: Mechanisms of action?

    Science.gov (United States)

    Hajirahimkhan, Atieh; Dietz, Birgit M.; Bolton, Judy L.

    2013-01-01

    Menopausal women suffer from a variety of symptoms, including hot flashes and night sweats which can affect quality of life. Although hormone therapy (HT) has been the treatment of choice for relieving these symptoms, HT has been associated with increased breast cancer risk leading many women to search for natural, efficacious, and safe alternatives such as botanical supplements. Data from clinical trials suggesting that botanicals have efficacy for menopausal symptom relief, have been controversial and several mechanisms of action have been proposed including estrogenic, progestogenic, and serotonergic pathways. Plant extracts with potential estrogenic activities include soy, red clover, kudzu, hops, licorice, rhubarb, yam, and chasteberry. Botanicals with reported progestogenic activities are red clover, hops, yam, and chasteberry. Serotonergic mechanisms have also been proposed since women taking antidepressants often report reduction in hot flashes and night sweats. Black cohosh, kudzu, kava, licorice, and dong quai all either have reported 5-HT7 ligands or inhibit serotonin re-uptake, therefore have potential serotonergic activities. Understanding the mechanisms of action of these natural remedies used for women’s health, could lead to more efficacious formulations and to the isolation of active components which have the potential of becoming effective medications in the future. PMID:23408273

  19. Insecticide Mixtures Could Enhance the Toxicity of Insecticides in a Resistant Dairy Population of Musca domestica L

    Science.gov (United States)

    Khan, Hafiz Azhar Ali; Akram, Waseem; Shad, Sarfraz Ali; Lee, Jong-Jin

    2013-01-01

    House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-“A” and LC50: LC50-“B”) significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies. PMID:23613758

  20. Representativeness and seasonality of major ion records derived from NEEM firn cores

    Directory of Open Access Journals (Sweden)

    G. Gfeller

    2014-10-01

    Full Text Available The seasonal and annual representativeness of ionic aerosol proxies (among others, calcium, sodium, ammonium and nitrate in various firn cores in the vicinity of the NEEM drill site in northwest Greenland have been assessed. Seasonal representativeness is very high as one core explains more than 60% of the variability within the area. The inter-annual representativeness, however, can be substantially lower (depending on the species making replicate coring indispensable to derive the atmospheric variability of aerosol species. A single core at the NEEM site records only 30% of the inter-annual atmospheric variability in some species, while five replicate cores are already needed to cover approximately 70% of the inter-annual atmospheric variability in all species. The spatial representativeness is very high within 60 cm, rapidly decorrelates within 10 m but does not diminish further within 3 km. We attribute this to wind reworking of the snow pack leading to sastrugi formation. Due to the high resolution and seasonal representativeness of the records we can derive accurate seasonalities of the measured species for modern (AD 1990–2010 times as well as for pre-industrial (AD 1623–1750 times. Sodium and calcium show similar seasonality (peaking in February and March respectively for modern and pre-industrial times, whereas ammonium and nitrate are influenced by anthropogenic activities. Nitrate and ammonium both peak in May during modern times, whereas during pre-industrial times ammonium peaked during July–August and nitrate during June–July.

  1. Recent Trends in Studies on Botanical Fungicides in Agriculture

    Directory of Open Access Journals (Sweden)

    Mi-Young Yoon

    2013-03-01

    Full Text Available Plants are attacked by various phytopathogenic fungi. For many years, synthetic fungicides have been used to control plant diseases. Although synthetic fungicides are highly effective, their repeated use has led to problems such as environmental pollution, development of resistance, and residual toxicity. This has prompted intensive research on the development of biopesticides, including botanical fungicides. To date, relatively few botanical fungicides have been registered and commercialized. However, many scientists have reported isolation and characterization of a variety of antifungal plant derivatives. Here, we present a survey of a wide range of reported plant-derived antifungal metabolites.

  2. Development and evaluation of thin-layer chromatography-digital image-based analysis for the quantitation of the botanical pesticide azadirachtin in agricultural matrixes and commercial formulations: comparison with ELISA.

    Science.gov (United States)

    Tanuja, Penmatsa; Venugopal, Namburi; Sashidhar, Rao Beedu

    2007-01-01

    A simple thin-layer chromatography-digital image-based analytical method has been developed for the quantitation of the botanical pesticide, azadirachtin. The method was validated by analyzing azadirachtin in the spiked food matrixes and processed commercial pesticide formulations, using acidified vanillin reagent as a postchromatographic derivatizing agent. The separated azadirachtin was clearly identified as a green spot. The Rf value was found to be 0.55, which was similar to that of a reference standard. A standard calibration plot was established using a reference standard, based on the linear regression analysis [r2 = 0.996; y = 371.43 + (634.82)x]. The sensitivity of the method was found to be 0.875 microg azadirachtin. Spiking studies conducted at the 1 ppm (microg/g) level in various agricultural matrixes, such as brinjal, tomato, coffee, and cotton seeds, revealed the recoveries of azadirachtin in the range of 67-92%. Azadirachtin content of commercial neem formulations analyzed by the method was in the range of 190-1825 ppm (microg/mL). Further, the present method was compared with an immunoanalytical method enzyme-linked immonosorbent assay developed earlier in our laboratory. Statistical comparison of the 2 methods, using Fischer's F-test, indicated no significant difference in variance, suggesting that both methods are comparable.

  3. Dr. Auzoux's botanical teaching models and medical education at the universities of Glasgow and Aberdeen.

    Science.gov (United States)

    Olszewski, Margaret Maria

    2011-09-01

    In the 1860s, Dr. Louis Thomas Jérôme Auzoux introduced a set of papier-mâché teaching models intended for use in the botanical classroom. These botanical models quickly made their way into the educational curricula of institutions around the world. Within these institutions, Auzoux's models were principally used to fulfil educational goals, but their incorporation into diverse curricula also suggests they were used to implement agendas beyond botanical instruction. This essay examines the various uses and meanings of Dr. Auzoux's botanical teaching models at the universities of Glasgow and Aberdeen in the nineteenth century. The two main conclusions of this analysis are: (1) investing in prestigious scientific collections was a way for these universities to attract fee-paying students so that better medical accommodation could be provided and (2) models were used to transmit different kinds of botanical knowledge at both universities. The style of botany at the University of Glasgow was offensive and the department there actively embraced and incorporated ideas of the emerging new botany. At Aberdeen, the style of botany was defensive and there was some hesitancy when confronting new botanical ideas. Copyright © 2011 Elsevier Ltd. All rights reserved.

  4. Chemometric analysis for identification of botanical raw materials for pharmaceutical use: a case study using Panax notoginseng.

    Science.gov (United States)

    Zhu, Jieqiang; Fan, Xiaohui; Cheng, Yiyu; Agarwal, Rajiv; Moore, Christine M V; Chen, Shaw T; Tong, Weida

    2014-01-01

    The overall control of the quality of botanical drugs starts from the botanical raw material, continues through preparation of the botanical drug substance and culminates with the botanical drug product. Chromatographic and spectroscopic fingerprinting has been widely used as a tool for the quality control of herbal/botanical medicines. However, discussions are still on-going on whether a single technique provides adequate information to control the quality of botanical drugs. In this study, high performance liquid chromatography (HPLC), ultra performance liquid chromatography (UPLC), capillary electrophoresis (CE) and near infrared spectroscopy (NIR) were used to generate fingerprints of different plant parts of Panax notoginseng. The power of these chromatographic and spectroscopic techniques to evaluate the identity of botanical raw materials were further compared and investigated in light of the capability to distinguishing different parts of Panax notoginseng. Principal component analysis (PCA) and clustering results showed that samples were classified better when UPLC- and HPLC-based fingerprints were employed, which suggested that UPLC- and HPLC-based fingerprinting are superior to CE- and NIR-based fingerprinting. The UPLC- and HPLC- based fingerprinting with PCA were able to correctly distinguish between samples sourced from rhizomes and main root. Using chemometrics and its ability to distinguish between different plant parts could be a powerful tool to help assure the identity and quality of the botanical raw materials and to support the safety and efficacy of the botanical drug products.

  5. Chemometric analysis for identification of botanical raw materials for pharmaceutical use: a case study using Panax notoginseng.

    Directory of Open Access Journals (Sweden)

    Jieqiang Zhu

    Full Text Available The overall control of the quality of botanical drugs starts from the botanical raw material, continues through preparation of the botanical drug substance and culminates with the botanical drug product. Chromatographic and spectroscopic fingerprinting has been widely used as a tool for the quality control of herbal/botanical medicines. However, discussions are still on-going on whether a single technique provides adequate information to control the quality of botanical drugs. In this study, high performance liquid chromatography (HPLC, ultra performance liquid chromatography (UPLC, capillary electrophoresis (CE and near infrared spectroscopy (NIR were used to generate fingerprints of different plant parts of Panax notoginseng. The power of these chromatographic and spectroscopic techniques to evaluate the identity of botanical raw materials were further compared and investigated in light of the capability to distinguishing different parts of Panax notoginseng. Principal component analysis (PCA and clustering results showed that samples were classified better when UPLC- and HPLC-based fingerprints were employed, which suggested that UPLC- and HPLC-based fingerprinting are superior to CE- and NIR-based fingerprinting. The UPLC- and HPLC- based fingerprinting with PCA were able to correctly distinguish between samples sourced from rhizomes and main root. Using chemometrics and its ability to distinguish between different plant parts could be a powerful tool to help assure the identity and quality of the botanical raw materials and to support the safety and efficacy of the botanical drug products.

  6. A Content Analysis of U.S. Botanical and Horticultural Library Web Sites.

    Science.gov (United States)

    Meyers, Michele M.

    The purpose of this study was to provide an introductory analysis of the content of the Web sites of botanical and horticultural libraries in the United States to determine what types of resources and information is included, whether or not information is organized and accessible, and to what extent botanical and horticultural libraries are using…

  7. Use of the dry-weight-rank method of botanical analysis in the ...

    African Journals Online (AJOL)

    The dry-weight-rank method of botanical analysis was tested in the highveld of the Eastern Transvaal and was found to be an efficient and accurate means of determining the botanical composition of veld herbage. Accuracy was increased by weighting ranks on the basis of quadrat yield, and by allocation of equal ranks to ...

  8. Ethanolic Neem (Azadirachta indica Leaf Extract Prevents Growth of MCF-7 and HeLa Cells and Potentiates the Therapeutic Index of Cisplatin

    Directory of Open Access Journals (Sweden)

    Chhavi Sharma

    2014-01-01

    Full Text Available The present study was designed to gain insight into the antiproliferative activity of ethanolic neem leaves extract (ENLE alone or in combination with cisplatin by cell viability assay on human breast (MCF-7 and cervical (HeLa cancer cells. Nuclear morphological examination and cell cycle analysis were performed to determine the mode of cell death. Further, to identify its molecular targets, the expression of genes involved in apoptosis, cell cycle progression, and drug metabolism was analyzed by RT-PCR. Treatment of MCF-7, HeLa, and normal cells with ENLE differentially suppressed the growth of cancer cells in a dose- and time-dependent manner through apoptosis. Additionally, lower dose combinations of ENLE with cisplatin resulted in synergistic growth inhibition of these cells compared to the individual drugs (combination index <1. ENLE significantly modulated the expression of bax, cyclin D1, and cytochrome P450 monooxygenases (CYP 1A1 and CYP 1A2 in a time-dependent manner in these cells. Conclusively, these results emphasize the chemopreventive ability of neem alone or in combination with chemotherapeutic treatment to reduce the cytotoxic effects on normal cells, while potentiating their efficacy at lower doses. Thus, neem may be a prospective therapeutic agent to combat gynecological cancers.

  9. Fungal profiles in various milk thistle botanicals from US retail.

    Science.gov (United States)

    Tournas, V H; Rivera Calo, J; Sapp, C

    2013-06-03

    Milk thistle (MT) dietary supplements are widely consumed due to their possible beneficial effect on liver health. As botanicals, they can be contaminated with a variety of fungi and their secondary metabolites, mycotoxins. This study was conducted in an effort to determine the mycological quality of various MT botanical supplements from the US market. Conventional plating methods were used for the isolation and enumeration of fungi, while conventional microscopy as well as molecular methods were employed for the speciation of the isolated strains. Results showed that a high percentage of the MT samples tested were contaminated with fungi. Total counts ranged between Aspergillus sections Flavi and Nigri as well as Eurotium, Penicillium, Fusarium and Alternaria species were isolated from MT supplements. The predominant molds were Eurotia (E. repens, E. amstelodami and E. rubrum), A. flavus, A. tubingensis, A. niger and A. candidus. To our knowledge, this is the first study reporting on fungal contamination profiles of MT botanicals. Published by Elsevier B.V.

  10. Insecticidal and Repellant Activities of Four indigenous medicinal Plants Against Stored Grain Pest, Tribolium castaneum (Herbst (Coleoptera:Tenebrionidae

    Directory of Open Access Journals (Sweden)

    S.R.Pugazhvendan

    2012-05-01

    Full Text Available Objective: The present investigation was aimed to assess the impact of four indigenous plants for their insecticidal and repellent activity against Tribolium castaneum (Herbst, a stored grain pest and they were tested in the laboratory. Methods: Four widely distributed plants (Artemisia vulgaris, Sphaeranthus indicus, Tephrosia purpurea, and Prosopis juliflora were sequentially extracted with increasing polarity of organic solvents such as, hexane, chloroform and ethyl acetate were evaluated for their insecticidal and repellent activities against Tribolium castaneum by adapting the standard protocol in in vitro. Results: Data pertaining to the present investigation clearly revealed that the percentage of mortality was maximum in(72 hr 58% hexane extract of A. vulgaris, chloroform extract (72 hr 34% of S. indicus, and ethyl acetate extract (72 hr 52% of T. purpurea. Repellant activities of plant extracts were tested against T. castaneum, repellent activity was maximum in hexane extract of P. fuliflora, ( EPI value for P. fuliflora in 2.5% was – 0.11 and – 0.33 at 1hr and 6 hr respectively chloroform extract of T. purpurea (2.5% was -0.17 at 6 hr and ethyl acetate extract of S. indicus (2.5% was -0.65 at 6 hr against T. castaneum. Conclusions: The present work for botanical products to control the insect pest of stored grain Tribolium castaneum (Herbst.These results suggest the presence of actives toxic substances acting after consumption or topical application.

  11. Mixture for Controlling Insecticide-Resistant Malaria Vectors

    OpenAIRE

    Pennetier, Cédric; Costantini, Carlo; Corbel, Vincent; Licciardi, Séverine; Dabire, R. K.; Lapied, B.; Chandre, Fabrice; Hougard, Jean-Marc

    2008-01-01

    The spread of resistance to pyrethroids in the major Afrotropical malaria vectors Anopheles gambiae s.s. necessitates the development of new strategies to control resistant mosquito populations. To test the efficacy of nets treated with repellent and insecticide against susceptible and insecticide-resistant An. gambiae mosquito populations, we impregnated mosquito bed nets with an insect repellent mixed with a low dose of organophosphorous insecticide and tested them in a rice-growing area ne...

  12. Radioligand Recognition of Insecticide Targets.

    Science.gov (United States)

    Casida, John E

    2018-04-04

    Insecticide radioligands allow the direct recognition and analysis of the targets and mechanisms of toxic action critical to effective and safe pest control. These radioligands are either the insecticides themselves or analogs that bind at the same or coupled sites. Preferred radioligands and their targets, often in both insects and mammals, are trioxabicyclooctanes for the γ-aminobutyric acid (GABA) receptor, avermectin for the glutamate receptor, imidacloprid for the nicotinic receptor, ryanodine and chlorantraniliprole for the ryanodine receptor, and rotenone or pyridaben for NADH + ubiquinone oxidoreductase. Pyrethroids and other Na + channel modulator insecticides are generally poor radioligands due to lipophilicity and high nonspecific binding. For target site validation, the structure-activity relationships competing with the radioligand in the binding assays should be the same as that for insecticidal activity or toxicity except for rapidly detoxified or proinsecticide analogs. Once the radioligand assay is validated for relevance, it will often help define target site modifications on selection of resistant pest strains, selectivity between insects and mammals, and interaction with antidotes and other chemicals at modulator sites. Binding assays also serve for receptor isolation and photoaffinity labeling to characterize the interactions involved.

  13. Zein Nanoparticles as Eco-Friendly Carrier Systems for Botanical Repellents Aiming Sustainable Agriculture.

    Science.gov (United States)

    Oliveira, Jhones L de; Campos, Estefânia V R; Pereira, Anderson E S; Pasquoto, Tatiane; Lima, Renata; Grillo, Renato; Andrade, Daniel Junior de; Santos, Fabiano Aparecido Dos; Fraceto, Leonardo Fernandes

    2018-02-14

    Botanical repellents represent one of the main ways of reducing the use of synthetic pesticides and the contamination of soil and hydric resources. However, the poor stability and rapid degradation of these compounds in the environment hinder their effective application in the field. Zein nanoparticles can be used as eco-friendly carrier systems to protect these substances against premature degradation, provide desirable release characteristics, and reduce toxicity in the environment and to humans. In this study, we describe the preparation and characterization of zein nanoparticles loaded with the main constituents of the essential oil of citronella (geraniol and R-citronellal). The phytotoxicity, cytotoxicity, and insect activity of the nanoparticles toward target and nontarget organisms were also evaluated. The botanical formulations showed high encapsulation efficiency (>90%) in the nanoparticles, good physicochemical stability, and effective protection of the repellents against UV degradation. Cytotoxicity and phytotoxicity assays showed that encapsulation of the botanical repellents decreased their toxicity. Repellent activity tests showed that nanoparticles containing the botanical repellents were highly repellent against the Tetranychus urticae Koch mite. This nanotechnological formulation offers a new option for the effective use of botanical repellents in agriculture, reducing toxicity, protecting against premature degradation, and providing effective pest control.

  14. Integrating Biodiversity Data into Botanic Collections.

    Science.gov (United States)

    Horn, Thomas

    2016-01-01

    Today's species names are entry points into a web of publicly available knowledge and are integral parts of legislation concerning biological conservation and consumer safety. Species information usually is fragmented, can be misleading due to the existence of different names and might even be biased because of an identical name that is used for a different species. Safely navigating through the name space is one of the most challenging tasks when associating names with data and when decisions are made which name to include in legislation. Integrating publicly available dynamic data to characterise plant genetic resources of botanic gardens and other facilities will significantly increase the efficiency of recovering relevant information for research projects, identifying potentially invasive taxa, constructing priority lists and developing DNA-based specimen authentication. To demonstrate information availability and discuss integration into botanic collections, scientific names derived from botanic gardens were evaluated using the Encyclopedia of Life, The Catalogue of Life and The Plant List. 98.5% of the names could be verified by the combined use of these providers. Comparing taxonomic status information 13 % of the cases were in disagreement. About 7 % of the verified names were found to be included in the International Union for Conservation of Nature Red List, including one extinct taxon and three taxa with the status "extinct in the wild". As second most important factor for biodiversity loss, potential invasiveness was determined. Approximately 4 % of the verified names were detected using the Global Invasive Species Information Network, including 208 invasive taxa. According to Delivering Alien Invasive Species Inventories for Europe around 20 % of the verified names are European alien taxa including 15 of the worst European invasive taxa. Considering alternative names in the data recovery process, success increased up to 18 %.

  15. Modern systematics, a further botanical note

    NARCIS (Netherlands)

    Holttum, R.E.

    1948-01-01

    As noted in Dr L.G.M. Baas Becking’s Postscript to Mr van Bemmel’s article in Chronica Naturae Vol. 104, part 4, the new systematics has not been entirely neglected by botanists. I would like to put a further botanical vieuwpoint on this subject. Firstly, I suggest that there is no sharp distinction

  16. Degradation of Insecticides in Poultry Manure: Determining the Insecticidal Treatment Interval for Managing House Fly (Diptera: Muscidae) Populations in Poultry Farms.

    Science.gov (United States)

    Ong, Song-Quan; Ab Majid, Abdul Hafiz; Ahmad, Hamdan

    2016-04-01

    It is crucial to understand the degradation pattern of insecticides when designing a sustainable control program for the house fly, Musca domestica (L.), on poultry farms. The aim of this study was to determine the half-life and degradation rates of cyromazine, chlorpyrifos, and cypermethrin by spiking these insecticides into poultry manure, and then quantitatively analyzing the insecticide residue using ultra-performance liquid chromatography. The insecticides were later tested in the field in order to study the appropriate insecticidal treatment intervals. Bio-assays on manure samples were later tested at 3, 7, 10, and 15 d for bio-efficacy on susceptible house fly larvae. Degradation analysis demonstrated that cyromazine has the shortest half-life (3.01 d) compared with chlorpyrifos (4.36 d) and cypermethrin (3.75 d). Cyromazine also had a significantly greater degradation rate compared with chlorpyrifos and cypermethrin. For the field insecticidal treatment interval study, 10 d was the interval that had been determined for cyromazine due to its significantly lower residue; for ChCy (a mixture of chlorpyrifos and cypermethrin), the suggested interval was 7 d. Future work should focus on the effects of insecticide metabolites on targeted pests and the poultry manure environment.

  17. Insecticidal effect of plant extracts on Phlebotomus argentipes (Diptera: Psychodidae) in Bihar, India.

    Science.gov (United States)

    Dinesh, Diwakar Singh; Kumari, Seema; Pandit, Vibhishan; Kumar, Jainendra; Kumari, Nisha; Kumar, Prahlad; Hassan, Faizan; Kumar, Vijay; Das, Pradeep

    2015-12-01

    Phlebotomus argentipes (Diptera: Psychodidae), the established vector for kala-azar is presently being controlled by indoor residual spray of DDT in kala-azar endemic areas in India. Search for non-hazardous and non-toxic biodegradable active molecules from botanicals may provide cost-effective and eco-friendly alternatives to synthetic insecticides. The present study was aimed at evaluating various plant extracts from endemic and non-endemic areas of Bihar for their insecticidal activity against sandfly to identify the most effective plant extract. Bio-assay test was conducted with larvae and adult of P. argentipes with different plant extracts collected in distilled water, hexane, ethyl acetate, acetone and methanol. Thin layer chromatography (TLC), column chromatography and high performance liquid chromatography (HPLC) were conducted for detection of active molecules. Adults and larvae of sandflies exposed to the aqueous extract of Nicotiana tabacum resulted in 100 per cent mortality. The hexane extract of Clerodendrum infortunatum was found to kill 77 per cent adults but was ineffective against larvae. Bio-assay test of the ninth fraction (hexane extract-methanol phase) separated by column chromatography was found to be 63 per cent effective. The purple spot on the TLC of this fraction indicated the presence of a diterpenoid. HPLC of this fraction detected nine compounds with two peaks covering 20.44 and 56.52 per cent areas with retention time of 2.439 and 5.182 min, respectively supporting the TLC results. The column separated 9 [th] fraction of C. infortunatum extract was found to be effective in killing 63 per cent of adult P. argentipes. Compounds of this fraction need to be evaluated further for identification and characterization of the active molecule by conducting individual bio-assay tests followed by further fractionation and HPLC. Once the structure of the active molecule is identified and validated, it may be synthesized and formulated as a product.

  18. Identification of differentially expressed genes in Monochamus alternatus digested with azadirachtin.

    Science.gov (United States)

    Lin, Tong; Liu, Qisi; Chen, Jingxiang

    2016-09-15

    The pine sawyer beetle Monochamus alternatus Hope, a major forest insect pest, is the primary vector of the destructive forest pest pine wood nematode, Bursaphelenchus xylophilus. Azadirachtin, an active compound of neem, is biologically interesting because it represents a group of important, successful botanical pesticides. We provide insight into the molecular effects of azadirachtin on M. alternatus at the transcriptional level to provide clues about possible molecular-level targets and to establish a link between azadirachtin and insect global responses. We found that 920 and 9894 unique genes were significantly up- and down-regulated, respectively. We obtained expression patterns of the differentially expressed genes (DEGs), identifying 4247, 3488 and 7613 sequences that involved cellular components, molecular functions and biological processes, respectively, and showed that the DEGs were distributed among 50 Gene Ontology categories. The Encyclopedia of Genes and Genomes pathway enrichment analysis indicated that the DEGs were enriched in 50 pathways. Detailed gene profile knowledge of the interaction of azadirachtin with M. alternatus should facilitate the development of more effective azadirachtin-based products against M. alternatus and other target Coleoptera. These results further enhance the value of azadirachtin as a potential insecticide of biological origin, as well as for other biological applications.

  19. Verifying the botanical authenticity of commercial tannins through sugars and simple phenols profiles.

    Science.gov (United States)

    Malacarne, Mario; Nardin, Tiziana; Bertoldi, Daniela; Nicolini, Giorgio; Larcher, Roberto

    2016-09-01

    Commercial tannins from several botanical sources and with different chemical and technological characteristics are used in the food and winemaking industries. Different ways to check their botanical authenticity have been studied in the last few years, through investigation of different analytical parameters. This work proposes a new, effective approach based on the quantification of 6 carbohydrates, 7 polyalcohols, and 55 phenols. 87 tannins from 12 different botanical sources were analysed following a very simple sample preparation procedure. Using Forward Stepwise Discriminant Analysis, 3 statistical models were created based on sugars content, phenols concentration and combination of the two classes of compounds for the 8 most abundant categories (i.e. oak, grape seed, grape skin, gall, chestnut, quebracho, tea and acacia). The last approach provided good results in attributing tannins to the correct botanical origin. Validation, repeated 3 times on subsets of 10% of samples, confirmed the reliability of this model. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. Metabolite Profiling and Classification of DNA-Authenticated Licorice Botanicals

    Science.gov (United States)

    Simmler, Charlotte; Anderson, Jeffrey R.; Gauthier, Laura; Lankin, David C.; McAlpine, James B.; Chen, Shao-Nong; Pauli, Guido F.

    2015-01-01

    Raw licorice roots represent heterogeneous materials obtained from mainly three Glycyrrhiza species. G. glabra, G. uralensis, and G. inflata exhibit marked metabolite differences in terms of flavanones (Fs), chalcones (Cs), and other phenolic constituents. The principal objective of this work was to develop complementary chemometric models for the metabolite profiling, classification, and quality control of authenticated licorice. A total of 51 commercial and macroscopically verified samples were DNA authenticated. Principal component analysis and canonical discriminant analysis were performed on 1H NMR spectra and area under the curve values obtained from UHPLC-UV chromatograms, respectively. The developed chemometric models enable the identification and classification of Glycyrrhiza species according to their composition in major Fs, Cs, and species specific phenolic compounds. Further key outcomes demonstrated that DNA authentication combined with chemometric analyses enabled the characterization of mixtures, hybrids, and species outliers. This study provides a new foundation for the botanical and chemical authentication, classification, and metabolomic characterization of crude licorice botanicals and derived materials. Collectively, the proposed methods offer a comprehensive approach for the quality control of licorice as one of the most widely used botanical dietary supplements. PMID:26244884

  1. Insecticide mixtures could enhance the toxicity of insecticides in a resistant dairy population of Musca domestica L [corrected].

    Directory of Open Access Journals (Sweden)

    Hafiz Azhar Ali Khan

    Full Text Available House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-"A" and LC50: LC50-"B" significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies.

  2. Transesterification of jojoba oil, sunflower oil, neem oil, rocket seed oil and linseed oil by tin catalysts

    International Nuclear Information System (INIS)

    Shah, Mazloom; Tariq, Muhammad; Ali, Saqib; Guo, Qing-Xiang; Fu, Yao

    2014-01-01

    The methanolysis of jojoba oil has been studied in the presence of tin powder, dibutyltin diacetate (C 4 H 9 ) 2 Sn(OOCCH 3 ) 2 , dioctyltin diacetate (C 8 H 17 ) 2 Sn(OOCCH 3 ) 2 , dibutyltin oxide (C 4 H 9 ) 2 SnO, dioctyltin oxide (C 8 H 17 ) 2 SnO, diphenyltin oxide (C 6 H 5 ) 2 SnO, dibutyltin chloride dihydroxide (C 4 H 9 ) 2 Sn(OH) 2 Cl, butyltinhydroxide hydrate (C 4 H 9 )Sn(=O)OH.xH 2 O, Ni nanoparticles and Pd nanoparticles act as catalysts. Among these, 1 weight % of dibutyltin diacetate shows the maximum conversion. Then, methanolysis of sunflower oil, neem oil, rocket seed oil and linseed oil into methyl esters studied in the presence of 1% dibutyltin diacetate as a catalyst and was compared their percentage conversions. The experimental yield for the conversion of jojoba oil, sunflower oil, neem oil, rocket seed oil and linseed oil into biodiesel was found to be 71%, 51%, 50.78%, 40.90% and 39.66%, respectively. The experimental yield of the conversion of jojoba oil into methyl esters was found to be increased up to 96% by increasing reaction time, without emulsion formation. The synthesis of jojoba seed oil biodiesel (JSOB), soybean oil biodiesel (SOB), neem oil biodiesel (NOB), rocket seed oil biodiesel (RSOB) and linseed oil biodiesel (LSOB) was confirmed by NMR ( 1 H and 13 C) and FT-IR analyses of biodiesel. - Highlights: • Transesterification of jojoba oil into biodiesel by tin and nano catalysts. • 1 weight % dibutyltin diacetate showed highest yield at 60 °C. • Catalytic conversion comparison of five oils using dibutyltin diacetate • The experimental yield of the conversion of jojoba oil increased with time. • FT-IR and NMR ( 1 H and 13 C) characterization

  3. Application of neem (Azadirachta indica) as biological pesticides in cocoa seed (Theobroma cacao) storage using various local adsorbent media

    Science.gov (United States)

    Mardiyani, S. A.; Sunawan; Pawestri, A. E.

    2018-03-01

    Cocoa seeds are recalcitrant (the water content is more than 40%) that require special handling. The use of adsorbent media to reduce the decrease in the quality of cocoa seeds and extend their shelf life in this storage has not been widely done. Local adsorbent media such as sawdust, sand and ash have the potential to maintain the viability of cocoa seeds. The objective of this research was to determine the interaction of the application of neem (Azadirachta indica) as biological pesticides and the use of various natural adsorbent media in the storage of cocoa seeds (Theobroma cacao). It was an experimental study with a factorial design composed of three factors. The first factor was the medium adsorbent type for the storage of cocoa seed, which consists of three levels (river sand, ash, and sawdust). The second factor was the concentration of neem leaves for pre-storage treatment with three levels (10, 20, and 30%). The third factor was the storage time (10 and 20 days). The results of the study indicated that the combination of the three factors showed a significant interaction in the height of the plant and the diameter of the stem of the seedling at 28 days after sowing. The fresh weight of the seedlings of the seeds that were stored in ash media gave a better result than the seedlings of seeds that had been stored in the river sand and the sawdust as adsorbent media. The application of 20% extract of neem leaves gave the best influence for the seeds that were stored for 20 days.

  4. Use of biorational for the vegetable pest control in the north of Sinaloa

    Directory of Open Access Journals (Sweden)

    María Berenice González Maldonado

    2012-09-01

    Full Text Available In Sinaloa the vegetable and cucurbits production are important agricultural activities, so each year a high volume of chemicalinsecticides are applied to pest control that attack these crops. This paper present the main pests insects in the region, as wellas an analysis about effects of biorational insecticides on these pests. Was found that for control of Bemisia argentifolii Bellows & Perring (Hemiptera: Aleyrodidae is used Neem oil 0.2%., for kill nymphs of Bactericera cockerelli Sulc. (Homoptera: Psyllidae soursop Annona muricata L. (Annonales: Annonaceae at doses of 2500-5000 mg/L., for Liriomyza trifolii Burgess (Diptera: Agromyzidae neem seeds 2%., to Myzus persicae Sulzer (Hemiptera: Aphididae rapeseed oil at doses 920 g/L (2% v/v., to Frankliniella occidentalis Pergande (Thysanoptera: Thripidae spinosad (Conserve® 48-60 mg/L., and for Phthorimaea operculella Zeller (Lepidoptera: Gelechiidae granular viruses (105 OBs/mL combined with neem (DalNeem TM emulsifiable oil and NeemAzal TM -T/S at doses of 8 mg/L, everyone. The use of these products and the dose depends on the type of pest and crop. In general these products cause insect mortality greater than 95%, besides having low toxicity on natural enemies, so that these can be used individually or in combination in integrated pest control schemes against vegetable pests, and also for disease vectors insects in the northern of Sinaloa.

  5. Process optimization and kinetics of biodiesel production from neem oil using copper doped zinc oxide heterogeneous nanocatalyst.

    Science.gov (United States)

    Gurunathan, Baskar; Ravi, Aiswarya

    2015-08-01

    Heterogeneous nanocatalyst has become the choice of researchers for better transesterification of vegetable oils to biodiesel. In the present study, transesterification reaction was optimized and kinetics was studied for biodiesel production from neem oil using CZO nanocatalyst. The highly porous and non-uniform surface of the CZO nanocatalyst was confirmed by AFM analysis, which leads to the aggregation of CZO nanoparticles in the form of multi layered nanostructures. The 97.18% biodiesel yield was obtained in 60min reaction time at 55°C using 10% (w/w) CZO nanocatalyst and 1:10 (v:v) oil:methanol ratio. Biodiesel yield of 73.95% was obtained using recycled nanocatalyst in sixth cycle. The obtained biodiesel was confirmed using GC-MS and (1)H NMR analysis. Reaction kinetic models were tested on biodiesel production, first order kinetic model was found fit with experimental data (R(2)=0.9452). The activation energy of 233.88kJ/mol was required for transesterification of neem oil into biodiesel using CZO nanocatalyst. Copyright © 2015 Elsevier Ltd. All rights reserved.

  6. Efficacy of Nigeria-Derived Diatomaceous Earth, Botanicals and ...

    African Journals Online (AJOL)

    , Bularafa diatomaceous earth (DE), Riverbed Sand, and combinations of the two botanicals with Bularafa DE and Riverbed Sand were evaluated as protectants of wheat seed against Sitophilus oryzae (L.) and Rhyzopertha dominica (F.).

  7. Use of physiologically based kinetic modelling facilitated read-across in risk assessment of botanical food-borne alkenylbenzenes

    NARCIS (Netherlands)

    Al-Malahmeh, Amer

    2017-01-01

    Botanicals and botanical preparations have become widely available on the market in the form of food supplements and other food preparations. In Europe the safety of botanicals and derived food products placed on the market has to comply with the general requirements set out in regulation (EC) No

  8. Schmidt. Sinfonie Nr. 1 E-Dur; Strauss. Vier sinfonische Zwischenspiele aus Intermezzo. Detroit Symphony Orchestra, Neeme Järvi / Helge Grünewald

    Index Scriptorium Estoniae

    Grünewald, Helge

    1996-01-01

    Uuest heliplaadist "Schmidt. Sinfonie Nr. 1 E-Dur; Strauss. Vier sinfonische Zwischenspiele aus Intermezzo. Detroit Symphony Orchestra, Neeme Järvi. Chandos/Koch CD 9357 (WD: 68'20") DDD (WD:114'36")

  9. Microbes as interesting source of novel insecticides: A review ...

    African Journals Online (AJOL)

    ... strains with good insecticidal properties can be identified, evaluated and utilized for pest control. This paper reviews the insecticidal properties of microbes and their potential utility in pest management. Keywords: Microbes, insecticides, metabolites, pest management. African Journal of Biotechnology, Vol 13(26) 2582- ...

  10. Mechanistic modeling of insecticide risks to breeding birds in ...

    Science.gov (United States)

    Insecticide usage in the United States is ubiquitous in urban, suburban, and rural environments. In evaluating data for an insecticide registration application and for registration review, scientists at the United States Environmental Protection Agency (USEPA) assess the fate of the insecticide and the risk the insecticide poses to the environment and non-target wildlife. At the present time, current USEPA risk assessments do not include population-level endpoints. In this paper, we present a new mechanistic model, which allows risk assessors to estimate the effects of insecticide exposure on the survival and seasonal productivity of birds known to use agricultural fields during their breeding season. The new model was created from two existing USEPA avian risk assessment models, the Terrestrial Investigation Model (TIM v.3.0) and the Markov Chain Nest Productivity model (MCnest). The integrated TIM/MCnest model has been applied to assess the relative risk of 12 insecticides used to control corn pests on a suite of 31 avian species known to use cornfields in midwestern agroecosystems. The 12 insecticides that were assessed in this study are all used to treat major pests of corn (corn root worm borer, cutworm, and armyworm). After running the integrated TIM/MCnest model, we found extensive differences in risk to birds among insecticides, with chlorpyrifos and malathion (organophosphates) generally posing the greatest risk, and bifenthrin and ë-cyhalothrin (

  11. Ecdysone Agonist: New Insecticides with Novel Mode of Action

    Directory of Open Access Journals (Sweden)

    Y. Andi Trisyono

    2002-12-01

    Full Text Available Development of insect resistance to insecticide has been the major driving force for the development of new insecticides. Awareness and demand from public for more environmentally friendly insecticides have contributed in shifting the trend from using broad spectrum to selective insecticides. As a result, scientists have looked for new target sites beyond the nervous system. Insect growth regulators (IGRs are more selective insecticides than conventional insecticides, and ecdysone agonists are the newest IGRs being commercialized, e.g. tebufenozide, methoxyfenozide, and halofenozide. Ecdysone agonists bind to the ecdysteroid receptors, and they act similarly to the molting hormone 20-hydroxyecdysone. The binding provides larvae or nymphs with a signal to enter a premature and lethal molting cycle. In addition, the ecdysone agonists cause a reduction in the number of eggs laid by female insects. The ecdysone agonists are being developed as selective biorational insecticides. Tebufenozide and methoxyfenozide are used to control lepidopteran insect pests, whereas halofenozide is being used to control coleopteran insect pests. Their selectivity is due to differences in the binding affinity between these compounds to the receptors in insects from different orders. The selectivity of these compounds makes them candidates to be used in combinations with other control strategies to develop integrated pest management programs in agricultural ecosystems. Key words: new insecticides, selectivity, ecdysone agonists

  12. Effect of feeding Neem (Azadirachta indica) and Acacia (Acacia senegal) tree foliage on nutritional and carcass parameters in short-eared Somali goats.

    Science.gov (United States)

    Hailemariam, Samson; Urge, Mengistu; Menkir, Sissay

    2016-02-01

    The study was conducted to determine the effects of dried foliage of Acacia senegal and Neem (Azadirachta indica) tree supplementations on feed intake, nutrient digestibility, growth, and carcass parameters in short-eared Somali goats. Twenty male intact short-eared Somali goat yearlings with an average live weight of 16.2 ± 1.08 (Mean ± SD) were assigned to four treatment groups, which comprised a basal diet of hay alone (T1) and supplementation with the tree foliages. Supplements consisted Neem tree (T2), A. senegal (T3) and the mixture of the two (1:1 ratio; T4) dried foliages. The crude protein (CP) content of Neem tree foliage, A. senegal, and their mixture were 16.92, 17.5 and 17.01 % of dry matter (DM), respectively. Total DM intake and digestibility of DM and organic matter were significantly (P senegal (67 %). The final body weights were higher (P Senegal. An average daily body weight (BW) gain was higher (P senegal (8.3 kg) among the supplemented groups, all of which are higher than the control (4.9 kg). It is concluded that the supplementation with tree foliage, especially with A. senegal tree foliage, on grass hay encouraged a better utilization of nutrients and animal performance as compared to goats fed on a basal diet of grass hay only.

  13. Insecticide Resistance Reducing Effectiveness of Malaria Control

    Centers for Disease Control (CDC) Podcasts

    Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.

  14. Experimental analysis on thermally coated diesel engine with neem oil methyl ester and its blends

    Science.gov (United States)

    Karthickeyan, V.

    2018-01-01

    Depletion of fossil fuel has created a threat to the nation's energy policy, which in turn led to the development of new source renewable of energy. Biodiesel was considered as the most promising alternative to the traditional fossil fuel. In the present study, raw neem oil was considered as a principle source for the production of biodiesel and converted into Neem Oil Methyl Ester (NOME) using two stage transesterification process. The chemical compositions of NOME was analysed using Fourier Transform Infra-Red Spectroscopy (FTIR) and Gas Chromatography- Mass Spectrometry (GC-MS). Baseline readings were recorded with diesel, 25NOME (25% NOME with 75% diesel) and 50NOME (50% NOME with 50% diesel) in a direct injection, four stroke, water cooled diesel engine. Thermal Barrier Coating (TBC) was considered as a better technique for emission reduction in direct injection diesel engine. In the present study, Partially Stabilized Zirconia (PSZ) was used as a TBC material to coat the combustion chamber components like cylinder head, piston head and intake and exhaust valves. In coated engine, 25NOME showed better brake thermal efficiency and declined brake specific fuel consumption than 50NOME. Decreased exhaust emissions like CO, HC and smoke were observed with 25NOME in coated engine except NOx. [Figure not available: see fulltext.

  15. Chromatographic evaluation and antimicrobial activity of Neem (Azadirachta indica A. Juss., Meliaceae leaves hydroalcoholic extracts

    Directory of Open Access Journals (Sweden)

    Priscila D. Alves

    Full Text Available Neem (Azadirachta indica is an Indian tree well known for its several pharmacological activities, including antimicrobial activity. More than 300 composites have already been isolated and azadirachtin (AZA is its main active component. In the present work, Neem leaves hydroalcoholic extracts were prepared by percolation in 96% ethanol different concentrations (50%, 60%, 70%, 80% and 90% (v/v. The presence of AZA was tested by TLC by eluting the extracts and a standard solution of AZA through a chromatographic plate developed with anisaldehyde/sulfuric acid solution followed by heating. By HPLC, extracts elution took place on a C18 column, water:acetonitrile (60:40 as mobile phase, 1.0 mL/min flow rate and detection at λ217 nm. The extracts did not display AZA spots or peaks, however, they were tested against Gram-positive and Gram-negative bacteria, yeasts and a mold fungus. The extracts were tested in different increasing concentrations, in order to detect a dose-dependent relationship of the activity. Despite the absence of AZA, the 70% and 80% (v/v ethanol extracts showed activity against Staphylococcus aureus. However, this activity was not dose-dependent according to Tukey's test (q0,05;3;7.

  16. Prokofieff: Krieg und Frieden (Sinfonische Suite), Die Verlobung im Kloster (Sommernacht-Suite), Russische Overtüre. Philharmonia Orchestra, Neeme Järvi / G. W.

    Index Scriptorium Estoniae

    G. W.

    1993-01-01

    Uuest heliplaadist "Prokofieff: Krieg und Frieden (Sinfonische Suite), Die Verlobung im Kloster (Sommernacht-Suite), Russische Overtüre. Philharmonia Orchestra, Neeme Järvi. (AD: 1991). Chandos/Koch CD 9096

  17. The botanical activities of George Edward Post (1838-1909).

    Science.gov (United States)

    Musselman, Lytton John

    2006-01-01

    George Edward Post wrote the first flora of the Middle East in English. His other botanical activities are less familiar. In addition to the flora, this paper discusses his teaching, fieldwork, contribution to Bible dictionaries, relations with the Boissier Herbarium in Geneva, establishment of the herbarium, and letters. Those letters are used here for the first time. Post corresponded with botanical luminaries of his day including Autran, Baker, Balfour, Barbey, Boissier, Bornmüller, Carruthers, Denslow, Haussknecht, Hooker, Schweinfurth, Thistleton-Dyer, Torrey, and Winkler. His long-term relationship with the herbarium at Geneva is highlighted. In addition, some of the lesser understood aspects of his life including chaplaincy during the American Civil War, and missionary to Syria are discussed.

  18. Jan Gehli teose "Linnad inimestele" ilmumine = Publication of an Estonian-language Edition of Jan Gehl's Cities for People / Yoko Alender, Liina Teder, Neeme Lopp

    Index Scriptorium Estoniae

    Alender, Yoko, 1979-

    2016-01-01

    Taani arhitektist Jan Gehlist ja tema raamatust "Linnad inimestele". Eestikeelse väljaande toimkond: Yoko Alender, Neeme Lopp, Liina Teder, Eneli Rohtla. Maastikuarhitektuuri aastapreemia nominent 2016

  19. Role of cytochrome P450s in insecticide resistance: impact on the control of mosquito-borne diseases and use of insecticides on Earth.

    Science.gov (United States)

    David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham

    2013-02-19

    The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementation of control interventions and reduce their environmental impact on Earth. Recent technological advances are helping us to build a functional profile of the P450 determinants of insecticide metabolic resistance in mosquitoes. Alongside, the cross-responses of mosquito P450s to insecticides and pollutants are also being investigated. Such research will provide the means to produce diagnostic tools for early detection of P450s linked to resistance. It will also enable the design of new insecticides with optimized efficacy in different environments.

  20. Fawrou SEYE, Raymond Demba NDIONE et Mady NDIAYE.

    African Journals Online (AJOL)

    AKA Boko Mathieu

    Afrique SCIENCE 02(2) (2006) 212 - 225 microtome sont colorées par la méthode du trichome de Masson. Les observations sont faites au microscope photonique Motic relié à un micro-ordinateur où les photos sont enregistrées sous format JPEG. 3. Résultats. 3-1. Effets insecticides des produits de neem sur les larves de ...

  1. Botanical environmental monitors for zinc pollution resulting from vehicular traffic

    International Nuclear Information System (INIS)

    Altaf, W.J.

    2007-01-01

    Botanical samples were used as monitors for zinc pollution resulting from vehicular traffic. Euphorbia terracina and Calotropis procera were the botanical monitors used in this work. Zinc concentrations were reported alongside a motorway stretch of 50 km. Variations in concentration with respect to the perpendicular distance from the roadside were also reported. The effect of wind turbulence and the wind direction on the concentrations is discussed. In addition, differences between open areas and confined areas with respect to the elemental uptake were also discussed. INAA, using reactor neutrons, was employed for the determination of Zn concentrations in the samples. (author)

  2. Azadirachta indica (Neem) leaf powder as a biosorbent for removal of Cd(II) from aqueous medium

    Energy Technology Data Exchange (ETDEWEB)

    Sharma, Arunima [Department of chemistry, Gauhati University, Guwahati 781014, Assam (India); Bhattacharyya, Krishna G. [Department of chemistry, Gauhati University, Guwahati 781014, Assam (India)]. E-mail: krishna2604@sify.com

    2005-10-17

    A biosorbent, Neem leaf powder (NLP), was prepared from the mature leaves of the Azadirachta indica (Neem) tree by initial cleaning, drying, grinding, washing to remove pigments and redrying. The powder was characterized with respect to specific surface area (21.45 m{sup 2} g{sup -1}), surface topography and surface functional groups and the material was used as an adsorbent in a batch process to remove Cd(II) from aqueous medium under conditions of different concentrations, NLP loadings, pH, agitation time and temperature. Adsorption increased from 8.8% at pH 4.0 to 70.0% at pH 7.0 and 93.6% at pH 9.5, the higher values in alkaline medium being due to removal by precipitation. The adsorption was very fast initially and maximum adsorption was observed within 300 min of agitation. The kinetics of the interactions was tested with pseudo first order Lagergren equation (mean k {sub 1} = 1.2 x 10{sup -2} min{sup -1}), simple second order kinetics (mean k {sub 2} = 1.34 x 10{sup -3} g mg{sup -1} min{sup -1}), Elovich equation, liquid film diffusion model (mean k = 1.39 x 10{sup -2} min{sup -1}) and intra-particle diffusion mechanism. The adsorption data gave good fits with Langmuir and Freundlich isotherms and yielded Langmuir monolayer capacity of 158 mg g{sup -1} for the NLP and Freundlich adsorption capacity of 18.7 L g{sup -1}. A 2.0 g of NLP could remove 86% of Cd(II) at 293 K from a solution containing 158.8 mg Cd(II) per litre. The mean values of the thermodynamic parameters, {delta}H, {delta}S and {delta}G, at 293 K were -73.7 kJ mol{sup -1}, -0.24 J mol{sup -1} K{sup -1} and -3.63 kJ mol{sup -1}, respectively, showing the adsorption process to be thermodynamically favourable. The results have established good potentiality for the Neem leaf powder to be used as a biosorbent for Cd(II)

  3. Cyclic polyalcohols: fingerprints to identify the botanical origin of natural woods used in wine aging.

    Science.gov (United States)

    Alañón, M Elena; Díaz-Maroto, M Consuelo; Díaz-Maroto, Ignacio J; Vila-Lameiro, Pablo; Pérez-Coello, M Soledad

    2011-02-23

    Cyclic polyalcohol composition of 80 natural wood samples from different botanical species, with the majority of them used in the oenology industry for aging purposes, has been studied by gas chromatography-mass spectrometry (GC-MS) after its conversion into their trimethylsilyloxime derivatives. Each botanical species showed a different and specific cyclic polyalcohol profile. Oak wood samples were characterized by the richness in deoxyinositols, especially proto-quercitol. Meanwhile, other botanical species showed a very low content of cyclic polyalcohols. The qualitative and quantitative study of cyclic polyalcohols was a useful tool to characterize and differentiate woods of different botanical origin to guarantee the authenticity of chips used in the wine-aging process. Monosaccharide composition was also analyzed, showing some quantitative differences among species, but cyclic polyalcohols were the compounds that revealed the main differentiation power.

  4. Effect of selected insecticides on SF9 insect cell line

    International Nuclear Information System (INIS)

    Saleh, M.; Rahmo, A.; Hajjar, J.

    2013-01-01

    The toxic effect of three insecticides: dimethoate (organophosphate insecticide), acetamiprid (neonicotinoid insecticide) and deltamethrin (pyrethroid insecticide) were evaluated in vitro on cultured Sf9 cell line. Cell growth inhibition was measured by the 3- (4,5- dimethylthiazol - 2-yl) - 2,5 - diphenyl tetrazolium bromide (MTT) assay. Regression Analysis was used to estimate the 20% inhibition of cells growth (IC 20). The IC 20 values obtained for deltamethrin, acetamipridand dimethoate were: 46.8, 61.6 and 68.9 μM, respectively. The proportion of phagocytic cells was positively correlated with the applied concentrations of the insecticides. (author)

  5. XVII International Botanical Congress. 100 years after the II IBC in Vienna 1905. Abstracts

    International Nuclear Information System (INIS)

    Popp, M.; Hesse, M.; Stuessy, T.; Greimler, J.; Bohar-Nodenkampf, H.

    2005-01-01

    Full text: The program of XVII IBC 2005 includes all aspects of basic and applied botanical research. Progress in the different sub-disciplines is revealed through plenary talks, general lectures, symposia, and poster sessions. This conference emphasizes the newest developments in the botanical sciences worldwide. (botek)

  6. Sibelius: Pohjola's Daughter; Night Ride and Sunrise; Four Legends from Kalevala (Lemminkäinen Suite). Gothenburg Symphony Orchestra, Neeme Järvi / Brian Hunt

    Index Scriptorium Estoniae

    Hunt, Brian

    1997-01-01

    Uuest heliplaadist "Sibelius: Pohjola's Daughter; Night Ride and Sunrise; Four Legends from Kalevala (Lemminkäinen Suite). Gothenburg Symphony Orchestra / Neeme Järvi. Deutsche Grammophon 453 426-2; 70:37 DDD

  7. Modulation of Estrogen Chemical Carcinogenesis by Botanical Supplements used for Postmenopausal Women’s Health

    Science.gov (United States)

    Snelten, Courtney S.; Dietz, Birgit; Bolton, Judy L.

    2012-01-01

    Breast cancer risk has been associated with long-term estrogen exposure including traditional hormone therapy (HT, formally hormone replacement therapy). To avoid traditional HT and associated risks, women have been turning to botanical supplements such as black cohosh, red clover, licorice, hops, dong gui, and ginger to relieve menopausal symptoms despite a lack of efficacy evidence. The mechanisms of estrogen carcinogenesis involve both hormonal and chemical pathways. Botanical supplements could protect women from estrogen carcinogenesis by modulating key enzymatic steps [aromatase, P4501B1, P4501A1, catechol-O-methyltransferase (COMT), NAD(P)H quinone oxidoreductase 1 (NQO1), and reactive oxygen species (ROS) scavenging] in estradiol metabolism leading to estrogen carcinogenesis as outlined in Figure 1. This review summarizes the influence of popular botanical supplements used for women’s health on these key steps in the estrogen chemical carcinogenesis pathway, and suggests that botanical supplements may have added chemopreventive benefits by modulating estrogen metabolism. PMID:24223609

  8. Botanical drugs, synergy, and network pharmacology: forth and back to intelligent mixtures.

    Science.gov (United States)

    Gertsch, Jürg

    2011-07-01

    For centuries the science of pharmacognosy has dominated rational drug development until it was gradually substituted by target-based drug discovery in the last fifty years. Pharmacognosy stems from the different systems of traditional herbal medicine and its "reverse pharmacology" approach has led to the discovery of numerous pharmacologically active molecules and drug leads for humankind. But do botanical drugs also provide effective mixtures? Nature has evolved distinct strategies to modulate biological processes, either by selectively targeting biological macromolecules or by creating molecular promiscuity or polypharmacology (one molecule binds to different targets). Widely claimed to be superior over monosubstances, mixtures of bioactive compounds in botanical drugs allegedly exert synergistic therapeutic effects. Despite evolutionary clues to molecular synergism in nature, sound experimental data are still widely lacking to support this assumption. In this short review, the emerging concept of network pharmacology is highlighted, and the importance of studying ligand-target networks for botanical drugs is emphasized. Furthermore, problems associated with studying mixtures of molecules with distinctly different pharmacodynamic properties are addressed. It is concluded that a better understanding of the polypharmacology and potential network pharmacology of botanical drugs is fundamental in the ongoing rationalization of phytotherapy. © Georg Thieme Verlag KG Stuttgart · New York.

  9. The Regulatory Framework Across International Jurisdictions for Risks Associated with Consumption of Botanical Food Supplements

    NARCIS (Netherlands)

    Low, Teng Yong; Wong, Kwok Onn; Yap, Adelene L.L.; Haan, De Laura H.J.; Rietjens, Ivonne M.C.M.

    2017-01-01

    Dietary supplements, including those containing botanical ingredients and botanical-derived compounds, have been marketed to consumers globally for many decades. However, the legislative framework for such products remains inconsistent across jurisdictions internationally. This study aims to

  10. Trifluoromethylphenyl amides as novel insecticides and fungicides

    Science.gov (United States)

    Because of increased resistance to insecticides in arthropods, it is necessary to identify new chemicals that may have novel modes of action. Following an extensive literature search for compounds with insecticidal and mosquito repellent activity, we have designed and synthesized a set of 20 trifluo...

  11. 36 CFR 223.277 - Forest botanical products definition.

    Science.gov (United States)

    2010-07-01

    ..., boughs, bryophytes, bulbs, burls, cones, ferns, fungi (including mushrooms), forbs, grasses, mosses, nuts, pine straw, roots, sedges, seeds, shrubs, transplants, tree sap, and wildflowers. Forest botanical products are not animals, animal parts, Christmas trees, fence material, firewood, insects, mine props...

  12. Botanical Criterions of Quchan Baharkish pastureland in Khorasan ...

    African Journals Online (AJOL)

    ADOWIE PERE

    Botanical Criterions of Quchan Baharkish pastureland in Khorasan Razavi Province,. Iran. *1SAEED, JAHEDI POUR 2ALIREZA, KOOCHEKI 3MEHDI, NASSIRI. MAHALLATI 4PARVIZ REZVANI MOGHADDAM. 1Department of Agroecology and Plant Breeding, Ferdowsi. University of Mashhad International Campus, ...

  13. The severity of toxic reactions to ephedra: comparisons to other botanical products and national trends from 1993-2002.

    Science.gov (United States)

    Woolf, Alan D; Watson, William A; Smolinske, Susan; Litovitz, Toby

    2005-01-01

    Ephedra is a botanical product widely used to enhance alertness, as a weight loss aide, and as a decongestant. Its reported adverse effects led the Food and Drug Administration (FDA) to ban ephedra-containing products in the United States in 2004. This study's purpose was to compare toxicity from botanical products containing ephedra to nonephedra products. The Toxic Exposure Surveillance System (TESS), a national poison center database, was utilized to determine the number and outcomes of cases involving botanical products reported from 1993-2002. Cases listing both a botanical product and any other drugs or chemicals were excluded a priori. Ten-year hazard rates (moderate outcomes + major outcomes + deaths per 1000 exposures) were used to compare botanical product categories. There were 21,533 toxic exposures with definitive medical outcomes reported over the 10 yrs where a botanical product was the only substance involved. Of these, 4306 (19.9%) had moderate or major medical outcomes and there were two deaths, for an overall hazard score of 200 per 1000 exposures. The number of ephedra reports to poison centers increased 150-fold over the 10-yr period. The hazard rate for products that contained only ephedra was 250 per 1000 exposures and 267 per 1000 exposures for products that contained ephedra and additional ingredients; whereas the hazard score for only nonephedra botanical products was 96 per 1000 exposures. The rate ratios for multibotanical products with ephedra (RR 1.33; 95% C.I. 1.27-1.40) and for single-ingredient ephedra products (RR 1.25; 95% C.I. 1.11-1.40) were both two to six times higher than those of other common botanical products. Yohimbe-containing products had the highest hazard score (417) and rate ratio (2.08; 95% C.I. 1.59-2.80). Ephedra-containing botanical products accounted for a significant number of toxic exposures with severe medical outcomes reported to poison centers. Hazard rate analysis suggests poison center-reported events

  14. Multitarget botanical pharmacotherapy in major depression: a toxic brain hypothesis.

    Science.gov (United States)

    Tang, Siu W; Tang, Wayne H; Leonard, Brain E

    2017-11-01

    A significant number of patients with major depression do not respond optimally to current antidepressant drugs. As depression is likely to be a heterogeneous disorder, it is possible that existing neurotransmitter-based antidepressant drugs do not fully address other pathologies that may exist in certain cases. Biological pathologies related to depression that have been proposed and studied extensively include inflammation and immunology, hypercortisolemia, oxidative stress, and impaired angiogenesis. Such pathologies may induce neurodegeneration, which in turn causes cognitive impairment, a symptom increasingly being recognized in depression. A neurotoxic brain hypothesis unifying all these factors may explain the heterogeneity of depression as well as cognitive decline and antidepressant drug resistance in some patients. Compared with neurotransmitter-based antidepressant drugs, many botanical compounds in traditional medicine used for the treatment of depression and its related symptoms have been discovered to be anti-inflammatory, immunoregulatory, anti-infection, antioxidative, and proangiogenic. Some botanical compounds also exert actions on neurotransmission. This multitarget nature of botanical medicine may act through the amelioration of the neurotoxic brain environment in some patients resistant to neurotransmitter-based antidepressant drugs. A multitarget multidimensional approach may be a reasonable solution for patients resistant to neurotransmitter-based antidepressant drugs.

  15. An insecticidal toxin from Nephila clavata spider venom.

    Science.gov (United States)

    Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong

    2017-07-01

    Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on Na V and K V channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.

  16. Sensitivity of Bemisia Tabaci (Hemiptera: Aleyrodidae) to Several New Insecticides in China: Effects of Insecticide Type and Whitefly Species, Strain, and Stage

    Science.gov (United States)

    Xie, Wen; Liu, Yang; Wang, Shaoli; Wu, Qingjun; Pan, Huipeng; Yang, Xin; Guo, Litao; Zhang, Youjun

    2014-01-01

    Abstract Whitefly biotypes B and Q are the two most damaging members of the Bemisia tabaci (Hemiptera: Aleyrodidae) species complex. Control of B. tabaci (and especially of Q) has been impaired by resistance to commonly used insecticides. To find new insecticides for B. tabaci management in China, we investigated the sensitivity of eggs, larvae, and adults of laboratory strains of B and Q (named Lab-B and Lab-Q) and field strains of Q to several insecticides. For eggs, larvae, and adults of B. tabaci and for six insecticides (cyantraniliprole, chlorantraniliprole, pyriproxyfen, buprofezin, acetamiprid, and thiamethoxam), LC 50 values were higher for Lab-Q than for Lab-B; avermectin LC 50 values, however, were low for adults of both Lab-Q and Lab-B. Based on the laboratory results, insecticides were selected to test against eggs, larvae, and adults of four field strains of B. tabaci Q. Although the field strains differed in their sensitivity to the insecticides, the eggs and larvae of all strains were highly sensitive to cyantraniliprole, and the adults of all strains were highly sensitive to avermectin. The eggs, larvae, and adults of B. tabaci Q were generally more resistant than those of B. tabaci B to the tested insecticides. B. tabaci Q eggs and larvae were sensitive to cyantraniliprole and pyriproxyfen, whereas B. tabaci Q adults were sensitive to avermectin. Field trials should be conducted with cyantraniliprole, pyriproxyfen, and avermectin for control of B. tabaci Q and B in China. PMID:25434040

  17. Botanical and molecular evidences of landraces from the ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-10-19

    Oct 19, 2009 ... Botanical descriptors, total seed proteins, isozymes and RAPD markers were applied to identify landraces from indigenous lentil germplasm exclusively collected from the province of Baluchistan,. Pakistan. The Germplasm revealed the prevalence of landraces, especially on the basis of isozymes.

  18. Insecticides suppress natural enemies and increase pest damage in cabbage.

    Science.gov (United States)

    Bommarco, Riccardo; Miranda, Freddy; Bylund, Helena; Björkman, Christer

    2011-06-01

    Intensive use of pesticides is common and increasing despite a growing and historically well documented awareness of the costs and hazards. The benefits from pesticides of increased yields from sufficient pest control may be outweighed by developed resistance in pests and killing of beneficial natural enemies. Other negative effects are human health problems and lower prices because of consumers' desire to buy organic products. Few studies have examined these trade-offs in the field. Here, we demonstrate that Nicaraguan cabbage (Brassica spp.) farmers may suffer economically by using insecticides as they get more damage by the main pest diamondback moth, Plutella xylostella (L.) (Lepidoptera: Plutellidae), at the same time as they spend economic resources on insecticides. Replicated similarly sized cabbage fields cultivated in a standardized manner were either treated with insecticides according common practice or not treated with insecticides over two seasons. Fields treated with insecticides suffered, compared with nontreated fields, equal or, at least in some periods of the seasons, higher diamondback moth pest attacks. These fields also had increased leaf damage on the harvested cabbage heads. Weight and size of the heads were not affected. The farmers received the same price on the local market irrespective of insecticide use. Rates of parasitized diamondback moth were consistently lower in the treated fields. Negative effects of using insecticides against diamondback moth were found for the density of parasitoids and generalist predatory wasps, and tended to affect spiders negatively. The observed increased leaf damages in insecticide-treated fields may be a combined consequence of insecticide resistance in the pest, and of lower predation and parasitization rates from naturally occurring predators that are suppressed by the insecticide applications. The results indicate biological control as a viable and economic alternative pest management strategy

  19. Organisation of the Botanical Survey of India

    NARCIS (Netherlands)

    Steenis, van C.G.G.J.

    1963-01-01

    From the new (quarto 2-column) journal ”Bulletin of the Botanical Survey of India”, initiated to supplement the ’Records’ and ’Annual Reports’ and to e cited as Bull. Bot. Surv. India, we are now informed about the shape of the studies of the Indian flora, since the reorganisation in 1954-55. Three

  20. A hybridized membrane-botanical biofilter for improving air quality in occupied spaces

    Science.gov (United States)

    Llewellyn, David; Darlington, Alan; van Ras, Niels; Kraakman, Bart; Dixon, Mike

    Botanical biofilters have been shown to be effective in improving indoor air quality through the removal of complex mixtures of gaseous contaminants typically found in human-occupied environments. Traditional, botanical biofilters have been comprised of plants rooted into a thin and highly porous synthetic medium that is hung on vertical surfaces. Water flows from the top of the biofilter and air is drawn horizontally through the rooting medium. These botanical biofilters have been successfully marketed in office and institutional settings. They operate efficiently, with adequate contaminant removal and little maintenance for many years. Depending on climate and outdoor air quality, botanical biofiltration can substantially reduce costs associated with ventilation of stale indoor air. However, there are several limitations that continue to inhibit widespread acceptance: 1. Current designs are architecturally limiting and inefficient at capturing ambient light 2. These biofilters can add significant amounts of humidity to an indoor space. This water loss also leads to a rapid accumulation of dissolved salts; reducing biofilter health and performance 3. There is the perception of potentially actively introducing harmful bioaerosols into the air stream 4. Design and practical limitations inhibit the entrance of this technology into the lucrative residential marketplace This paper describes the hybridization of membrane and botanical biofiltration technologies by incorporating a membrane array into the rootzone of a conventional interior planting. This technology has the potential for addressing all of the above limitations, expanding the range of indoor settings where botanical biofiltration can be applied. This technology was developed as the CSA-funded Canadian component an ESA-MAP project entitled: "Biological airfilter for air quality control of life support systems in manned space craft and other closed environments", A0-99-LSS-019. While the project addressed a