WorldWideScience

Sample records for bos taurus indicus

  1. Genetic effects on beef tenderness in Bos indicus composite and Bos taurus cattle.

    Science.gov (United States)

    O'Connor, S F; Tatum, J D; Wulf, D M; Green, R D; Smith, G C

    1997-07-01

    Bos indicus composite and Bos taurus cattle, originating from diverse production environments, were used to quantify genetic variation in marbling, 24-h calpastatin activity, and beef tenderness and to identify strategies for prevention of beef tenderness problems in Bos indicus composite cattle. Comparisons among 3/8 Bos indicus breeds (Braford, Red Brangus, Simbrah) revealed significant differences in marbling and 24-h calpastatin activity, but not in tenderness. Compared with Bos taurus cattle, 3/ 8 Bos indicus cattle had similar marbling scores but higher 24-h calpastatin activities. Also, beef from 3/8 Bos indicus composites aged more slowly from 1 to 7 d and was less tender at 4, 7, 14, 21, and 35 d postmortem than beef from Bos taurus cattle. However, beef from 3/8 Bos indicus cattle was relatively tender if it was aged for a sufficient period of time (21 d). The delayed response to aging and greater toughness of beef from 3/8 Bos indicus cattle was associated with Brahman breed effects and was not related to the Bos taurus germplasm source. Marbling was moderately heritable (.52 +/- .21) but exhibited positive genetic correlations with shear force at d 1 through 14 of aging, suggesting that, in these cattle, selection for increased marbling would have an unfavorable effect on beef tenderness. A low heritability estimate for 24-h calpastatin activity (.15 +/- .15), coupled with low genetic correlations between calpastatin activity and shear force at 7, 14, and 35 d, suggested that selection for low calpastatin activity would have little effect on aged beef tenderness. Panel tenderness and shear force at 7, 14, and 21 d were moderately heritable (.27 to .47), indicating that aged beef tenderness could be improved by direct selection (via progeny testing). Comparisons among Simbrah, Senegus x Simbrah, and Red Angus x Simmental steers showed that inclusion of a tropically adapted Bos taurus breed (Senepol) could be an effective strategy for preventing beef

  2. Genetic effects on beef tenderness in Bos indicus composite and Bos taurus cattle.

    Science.gov (United States)

    O'Connor, S F; Tatum, J D; Wulf, D M; Green, R D; Smith, G C

    1997-07-01

    Bos indicus composite and Bos taurus cattle, originating from diverse production environments, were used to quantify genetic variation in marbling, 24-h calpastatin activity, and beef tenderness and to identify strategies for prevention of beef tenderness problems in Bos indicus composite cattle. Comparisons among 3/8 Bos indicus breeds (Braford, Red Brangus, Simbrah) revealed significant differences in marbling and 24-h calpastatin activity, but not in tenderness. Compared with Bos taurus cattle, 3/ 8 Bos indicus cattle had similar marbling scores but higher 24-h calpastatin activities. Also, beef from 3/8 Bos indicus composites aged more slowly from 1 to 7 d and was less tender at 4, 7, 14, 21, and 35 d postmortem than beef from Bos taurus cattle. However, beef from 3/8 Bos indicus cattle was relatively tender if it was aged for a sufficient period of time (21 d). The delayed response to aging and greater toughness of beef from 3/8 Bos indicus cattle was associated with Brahman breed effects and was not related to the Bos taurus germplasm source. Marbling was moderately heritable (.52 +/- .21) but exhibited positive genetic correlations with shear force at d 1 through 14 of aging, suggesting that, in these cattle, selection for increased marbling would have an unfavorable effect on beef tenderness. A low heritability estimate for 24-h calpastatin activity (.15 +/- .15), coupled with low genetic correlations between calpastatin activity and shear force at 7, 14, and 35 d, suggested that selection for low calpastatin activity would have little effect on aged beef tenderness. Panel tenderness and shear force at 7, 14, and 21 d were moderately heritable (.27 to .47), indicating that aged beef tenderness could be improved by direct selection (via progeny testing). Comparisons among Simbrah, Senegus x Simbrah, and Red Angus x Simmental steers showed that inclusion of a tropically adapted Bos taurus breed (Senepol) could be an effective strategy for preventing beef

  3. Evaluation of carcass characteristics and meat chemical composition of Bos indicus and Bos indicus x Bos taurus crossbred steers finished in pasture systems

    OpenAIRE

    Moreira Fernanda Barros; Souza Nilson Evelázio de; Matsushita Makoto; Prado Ivanor Nunes do; Nascimento Willian Gonçalves do

    2003-01-01

    The objective of this study was to evaluate the carcass characteristics (carcass weight, carcass yield, fat thickness, loin area, marbling and colour) and chemical composition of the Longissimus dorsi muscle (moisture, ash, crude protein, fat and cholesterol) of cuts with or without fat thickness, of Bos indicus and Bos indicus x Bos taurus crossbred steers finished in millet (Pennisetum americanum L.) or star grass (Cynodon plectostachyus Pilger) pasture systems, with mineral or mineral prot...

  4. Superovulation and embryo production in tropical adapted Bos taurus (Caracu and Bos indicus (Nelore cows

    Directory of Open Access Journals (Sweden)

    Rafael Herrera Alvarez

    2011-01-01

    Full Text Available The aim of this study was to compare ovarian response and embryo production of superovulated Bos indicus and Bos taurus cows adapted to the environmental conditions from São Paulo State, Brazil. Ninety non-lactating cows from Caracu ( Bos taurus, n=40 and Nelore (Bos indicus, n=50 were treated with an intravaginal device containing progesterone (1.38 mg; CIDRB ®, Pfizer Animal Health, Montreal, Québec, Canada and 2.5 mg, intramuscularly (IM, of estradiol benzoate (Estrogin®, Farmavet, São Paulo, Brazil. Four days later, all animals were treated with multiple IM injections of 400 IU of FSH (Pluset®, Calier, Spain in decreasing doses (75–75; 75–50; 50–25, and 25–25 IU at 12-h intervals over 4 days. On the seventh day, CIDR-B device was removed and cows received, IM, 150 ìg of cloprostenol (Veteglan®, Calier, Spain. Cows were then inseminated 48 and 62 h after cloprostenol treatment and embryos were recovered non-surgically seven days after first insemination. Differences in the number of corpora lutea (CL number, total number of structures (ova/embryos, and number of transferable embryos were analyzed by Student t test. There was no difference (P > 0.05 in the average number of CL, total ova/embryos and transferable embryos of Caracu (11.4 ± 3.3; 8.6 ± 2.6 e 6.0 ± 2.4 and Nelore (12.0 ± 4.1; 9.0 ± 4.3 e 5.1 ± 2.9 cows, respectively. These results suggest that Caracu and Nelore cows superovulated in tropical climate had similar ovarian responses and embryo production.

  5. Ganancia diaria y peso al destete en terneros de cruces Bos taurus con Bos indicus en trópico húmedo

    OpenAIRE

    Córdova, Alejandro; Rodriguez, Gustavo; Córdova, Mary; Córdova, Cristian; Pérez., José

    2005-01-01

    El objetivo del trabajo fue evaluar la ganancia diaria de peso desde el nacimiento hasta el destete a los cuatro meses de edad de terneros de la cruza Bos taurus con Bos indicus, manejados en pastoreo convencional, para lo cual se utilizaron los registros de 302 terneros. Las razas Bos taurus utilizadas para las cruzas fueron Belgian blue, Charolais, Limousine y Beef master; las Bos indicus, fueron Brahman, Nelore, Indobrasil y Simbrah. Los resultados se analizaron mediante estadística descri...

  6. Ganancia diaria y peso al destete en becerros de cruzas Bos taurus con Bos indicus en trópico húmedo.

    OpenAIRE

    Alejandro Córdova; Gustavo Rodríguez; Mary Córdova; Cristian Córdova; José Pérez

    2005-01-01

    El objetivo del trabajo fue evaluar la ganancia diaria de peso desde el nacimiento hasta el destete a los cuatromeses de edad de terneros de la cruza Bos taurus con Bos indicus, manejados en pastoreo convencional, para locual se utilizaron los registros de 302 terneros. Las razas Bos taurus utilizadas para las cruzas fueron Belgianblue, Charolais, Limousine y Beef master; las Bos indicus, fueron Brahman, Nelore, Indobrasil y Simbrah. Losresultados se analizaron mediante estadística descriptiv...

  7. Genome wide scan for quantitative trait loci affecting tick resistance in cattle (Bos taurus × Bos indicus)

    OpenAIRE

    Machado, Marco Antonio; S Azevedo, Ana Luisa; Teodoro, Roberto L; Pires, Maria A; CD Peixoto, Maria Gabriela; de Freitas, Célio; Prata, Márcia Cristina A; Furlong, John; da Silva, Marcos Vinicius GB; Guimarães, Simone EF; Regitano, Luciana CA; Coutinho, Luiz L.; Gasparin, Gustavo; Verneque, Rui S

    2010-01-01

    Background In tropical countries, losses caused by bovine tick Rhipicephalus (Boophilus) microplus infestation have a tremendous economic impact on cattle production systems. Genetic variation between Bos taurus and Bos indicus to tick resistance and molecular biology tools might allow for the identification of molecular markers linked to resistance traits that could be used as an auxiliary tool in selection programs. The objective of this work was to identify QTL associated with tick resista...

  8. Immunological Profiles of Bos taurus and Bos indicus Cattle Infested with the Cattle Tick, Rhipicephalus (Boophilus) microplus▿ †

    OpenAIRE

    Piper, Emily K.; Jonsson, Nicholas N.; Gondro, Cedric; Lew-Tabor, Ala E.; Moolhuijzen, Paula; Vance, Megan E.; Jackson, Louise A.

    2009-01-01

    The cattle tick, Rhipicephalus (Boophilus) microplus, is a major threat to the improvement of cattle production in tropical and subtropical countries worldwide. Bos indicus cattle are naturally more resistant to infestation with the cattle tick than are Bos taurus breeds, although considerable variation in resistance occurs within and between breeds. It is not known which genes contribute to the resistant phenotype, nor have immune parameters involved in resistance to R. microplus been fully ...

  9. Evaluation of carcass characteristics and meat chemical composition of Bos indicus and Bos indicus x Bos taurus crossbred steers finished in pasture systems

    Directory of Open Access Journals (Sweden)

    Fernanda Barros Moreira

    2003-12-01

    Full Text Available The objective of this study was to evaluate the carcass characteristics (carcass weight, carcass yield, fat thickness, loin area, marbling and colour and chemical composition of the Longissimus dorsi muscle (moisture, ash, crude protein, fat and cholesterol of cuts with or without fat thickness, of Bos indicus and Bos indicus x Bos taurus crossbred steers finished in millet (Pennisetum americanum L. or star grass (Cynodon plectostachyus Pilger pasture systems, with mineral or mineral protein supplementation. Animals were slaughtered with an average body weight of 450 kg (Bos indicus or 470 kg (Bos indicus x Bos taurus crossbreed. There was no treatments effect on carcass characteristics and meat chemical composition of cut without fat thickness. The cuts with fat thickness of steers fed millet presented the highest fat deposition. Bos indicus steers presented higher carcass yield (57.23% and fat thickness (4.88 mm compared with crossbreed (53.40% and 3.05 mm. There was no breed effect on chemical composition of meat. The mean levels of cholesterol concentration were 31.41 mg/100 and 37.55 mg/100g of meat with and without fat thickness.O objetivo deste trabalho foi avaliar as características de carcaça (peso de carcaça, rendimento de carcaça, espessura de gordura de cobertura, área de olho de lombo, marmoreio e coloração e composição química do músculo Longissimus dorsi (umidade, cinzas, proteína bruta, gordura e colesterol de cortes, com ou sem gordura de cobertura, de novilhos Bos indicus e mestiços Bos indicus x Bos taurus terminados em sistemas em pastagem de milheto (Pennisetum americanum L. ou grama estrela (Cynodon plectostachyus Pilger, com suplementação mineral ou protéica e mineral. Os animais foram abatidos com peso médio de 450 kg (Bos indicus ou 470 kg (mestiços. Não houve efeito de tratamento sobre as características de carcaça e composição da carne com ou sem gordura de cobertura. Os cortes com gordura de

  10. MADURACIÓN DEL SOLOMO (Biceps femoris EN VACAS DE DESCARTE Bos indicus Y Bos taurus

    Directory of Open Access Journals (Sweden)

    Roger Alonso Cubero-Rojas

    2013-01-01

    Full Text Available El objetivo de este trabajo fue evaluar el efecto de la maduración sobre la terneza del músculo Biceps femoris en vacas de descarte Bos indicus y Bos taurus. En la planta procesadora de Montecillos R.L., ubicada en Alajuela, se realizó la escogencia y sacrificio de los animales, la maduración y empaque al vacío de la carne. La cocción, determinación de la terneza y evaluación sensorial se llevó a cabo a los 0, 14 y 28 días de maduración, en el Laboratorio de Análisis Sensorial del Centro de Investigaciones en Tecnología de Alimentos de la Universidad de Costa Rica, ubicado en San Pedro de Montes de Oca, San José, en julio del año 2011. De acuerdo con la evaluación instrumental, la especie y la cronometría dental no fueron factores significativos en la determinación de la terneza de la carne, mientras que el tiempo de maduración sí mostró cambios altamente significativos (p>0,001 sobre el mismo parámetro. Los mejores resultados se obtuvieron a los 28 días, donde B. indicus mostró 3,78 kg de fuerza al corte, mientras que para B. taurus se obtuvo 3,88 kg. En la evaluación sensorial, los animales B. indicus se calificaron como más jugosos (p=0,016 y con mejor sabor (p<0,001. Se determinó una relación inversa entre sabor y tiempo de maduración, lo cual indicó que a mayor tiempo de maduración el sabor de la carne se volvió menos agradable al paladar.

  11. Identification of genes involved with tick infestation in Bos taurus and Bos indicus.

    Science.gov (United States)

    Kongsuwan, K; Piper, E K; Bagnall, N H; Ryan, K; Moolhuijzen, P; Bellgard, M; Lew, A; Jackson, L; Jonsson, N N

    2008-01-01

    Tick resistant cattle could provide a potentially sustainable and environmentally sound method of controlling cattle ticks. Advances in genomics and the availability of the bovine genome sequence open up opportunities to identify useful and selectable genes controlling cattle tick resistance. Using quantitative real-time PCR and theAffymetrix bovine array platform, differences in gene expression of skin biopsies from tick resistant Bos indicus (Brahman) and tick susceptible Bos taurus (Holstein-Friesian) cattle following tick challenge were examined. We identified 138 significant differentially-expressed genes, including several immunologicallhost defence genes, extracellularmatrix proteins, and transcription factors as well as genes involved in lipid metabolism. Three key pathways, represented by genes differentially expressed in resistant Brahmans, were identified; the development of the cell-mediated immune response, structural integrity of the dermis and intracellular Ca2+ levels. Ca2+, which is implicated in host responses to microbial stimuli, may be required for the enhancement or fine-tuning of transcriptional activation of Ca2+ -dependant host defence signalling pathways. PMID:18817288

  12. The polled locus maps to BTA1 in a Bos indicus x Bos taurus cross.

    Science.gov (United States)

    Brenneman, R A; Davis, S K; Sanders, J O; Burns, B M; Wheeler, T C; Turner, J W; Taylor, J F

    1996-01-01

    Two hundred and nine reciprocal backcross and F2 progeny produced by embryo transfer from Angus (Bos taurus) and Brahman (Bos indicus) parents and their 60 parents and grandparents were utilized to localize the locus (POLL) responsible for the polled phenotype in a genetic map of bovine chromosome 1. Progeny were scored for polled, scurred, and horned phenotypes at 1 year of age and again following skull disection at slaughter at 20 months of age. Phenotype frequencies were independent of gender. One hundred and forty-two informative meioses for POLL and 13 microsatellite loci with an average of 267 informative meioses per locus contributed to a genetic map spanning 124.6 cM with an average interval of 9.6 cM. POLL mapped proximal to the centromere and 4.9 cM from TGLA49 supporting a previous study that employed two anonymous microsatellites. Difficulties in discriminating between scurred and horned phenotypes indicate that bracketing markers will be essential for refining the model for inheritance of the horned, scurred, and polled phenotypes and for effective marker assisted selection (MAS) for polled. PMID:8830095

  13. In vivo comparison of susceptibility between Bos indicus and Bos taurus cattle types to Theileria parva infection

    Directory of Open Access Journals (Sweden)

    S.G. Ndungu

    2005-09-01

    Full Text Available The objective of this study was to determine whether Bos taurus cattle differ form Bos indicus in their susceptibility to infection with the Muguga stabilate of Theileria parva and in their resistance to the resultant disease. Ten Friesians (B. taurus, ten improved Borans (B. indicus, ten unimproved Borans (B. indicus and ten Zebus (B. indicus born to dams from an East Coast fever (ECF endemic area were inoculated with an infective dose50 dilution of T. parva Muguga stabilate 147. All the animals except one Friesian and one Zebu developed schizont parasitosis. All the improved Borans, nine of the Friesians, eight of the unimproved Borans and six of the Zebus developed a febrile response. Four of the improved Borans, four of the Friesians and three of the unimproved Borans died of theileriosis. No significant difference (P > 0.05 in the prepatent period occurred between the groups, but the Zebus had a significantly shorter duration of schizont parasitosis (P > 0.05 and took a significantly shorter time to recover (P > 0.05 than the other three groups. There was no significant difference in the two parameters between the other three groups. The study showed that three B. indicus breds and a B. taurus breed are equally susceptible to T. parva infection. However, Zebus born to dams from an ECF endemic area showed a better ability to control the course of disease than cattle from ECF free areas.

  14. Membrane proteins associated with sperm-oocyte interaction: A proteomic comparison between Kedah Kelantan (Bos indicus) and Mafriwal (Bos taurus × Bos indicus) sperm

    Science.gov (United States)

    Ashrafzadeh, Ali; Nathan, Sheila; Othman, Iekhsan; Yee, Tee Ting; Karsani, Saiful Anuar

    2013-11-01

    Production performance of European cattle breeds has significantly improved through various breeding programs. However, European breeds are more susceptible to heat stress compared to zebu cattle (Bos indicus) as their conception rate can range between 20 to 30% in hot seasons compared to winter. To identify cattle sperm proteins associated with zebu cattle higher fertility and heat tolerance in tropical environments, we utilised a proteomics-based approach to compare sperm from the highly fertile Malaysian indigenous breed, Kedah Kelantan (Bos indicus), with sperm from the sub-fertile crossbreed, Mafriwal (Bos taurus × Bos indicus). Frozen semen of three high performance bulls from each breed was processed to obtain live and pure sperm. Proteins were separated and gel bands were processed by in-gel tryptic digestion. For each breed, mass spectrometry data was acquired over 11 replicates. The analyzed data identified peptides with different expression levels (99% confidence level) and protein identification was determined by targeted MS/MS. Among the identified proteins associated with sperm-oocyte interaction, two proteins were up-regulated in Kedah Kelantan sperm and 7 proteins were up-regulated in or specific to Mafriwal. Our results suggest that the higher fertility of zebu cattle in tropical areas may not be related to more efficient sperm-oocyte interaction. Further analysis of the other regulated proteins in these two breeds may contribute further knowledge on the physiological reason/s for higher fertility and heat tolerance of Zebu cattle in tropical areas.

  15. Life-cycle biological efficiency of Bos indicus x Bos taurus and Bos taurus crossbred cow-calf production to weaning.

    Science.gov (United States)

    Green, R D; Cundiff, L V; Dickerson, G E

    1991-09-01

    A deterministic model was developed that accounted for all biological inputs and outputs for a theoretical herd of F1 females at age equilibrium mated to produce three-way terminal-cross calves and for the required proportion of straightbred cows needed to produce replacements. Two Bos indicus x Bos taurus vs two Bos taurus x Bos taurus types of crossbred cows were compared in the production environment of south-central Nebraska. The four types of F1 females were from Hereford (H) or Angus (A) dams and by H or A (HA), Pinzgauer (Pz), Brahman (Bm), or Sahiwal (Sw) sires. The crossbred females were assumed mated to Red Poll (R) sires for their first calving and to Simmental (S) sires thereafter. Two evaluations of efficiency for each of the four breeding systems were total cow and calf feed energy input 1) per unit of only weaned calf weight output (CALFEFF, Mcal/kg) and 2) per unit of weaned calf plus .55 x cull cow weight output (TVALEFF, Mcal/kg). Results for a terminal age of 7 yr in systems using HA, Pz, Bm, and Sw crossbred cows, respectively, were 64.9, 64.5, 60.9, and 59.3 Mcal/kg for CALFEFF and 45.7, 46.4, 44.1, and 43.7 Mcal/kg for TVALEFF. Changing terminal age to 11 yr reduced CALFEFF about 6% but increased TVALEFF about 7%, because total inputs increased more than output value (10 vs 3%) from 7 to 11 yr terminal ages. These results suggest differences in efficiency among these breed crosses favoring the Bos indicus crossbred cows by over 4% in this particular environment. PMID:1938641

  16. Life-cycle biological efficiency of Bos indicus x Bos taurus and Bos taurus crossbred cow-calf production to weaning.

    Science.gov (United States)

    Green, R D; Cundiff, L V; Dickerson, G E

    1991-09-01

    A deterministic model was developed that accounted for all biological inputs and outputs for a theoretical herd of F1 females at age equilibrium mated to produce three-way terminal-cross calves and for the required proportion of straightbred cows needed to produce replacements. Two Bos indicus x Bos taurus vs two Bos taurus x Bos taurus types of crossbred cows were compared in the production environment of south-central Nebraska. The four types of F1 females were from Hereford (H) or Angus (A) dams and by H or A (HA), Pinzgauer (Pz), Brahman (Bm), or Sahiwal (Sw) sires. The crossbred females were assumed mated to Red Poll (R) sires for their first calving and to Simmental (S) sires thereafter. Two evaluations of efficiency for each of the four breeding systems were total cow and calf feed energy input 1) per unit of only weaned calf weight output (CALFEFF, Mcal/kg) and 2) per unit of weaned calf plus .55 x cull cow weight output (TVALEFF, Mcal/kg). Results for a terminal age of 7 yr in systems using HA, Pz, Bm, and Sw crossbred cows, respectively, were 64.9, 64.5, 60.9, and 59.3 Mcal/kg for CALFEFF and 45.7, 46.4, 44.1, and 43.7 Mcal/kg for TVALEFF. Changing terminal age to 11 yr reduced CALFEFF about 6% but increased TVALEFF about 7%, because total inputs increased more than output value (10 vs 3%) from 7 to 11 yr terminal ages. These results suggest differences in efficiency among these breed crosses favoring the Bos indicus crossbred cows by over 4% in this particular environment.

  17. INTROGRESIÓN GENÉTICA DE Bos indicus (BOVIDAE EN BOVINOS CRIOLLOS COLOMBIANOS DE ORIGEN Bos taurus Genetic Introgression of Bos indicus (Bovidae in Colombian Creole Cattle Bos taurus

    Directory of Open Access Journals (Sweden)

    CARLOS ARTURO SÁNCHEZ ISAZA

    Full Text Available El presente trabajo evidencia desde el punto de vista citogenético la introgresión genética, de origen paterno, de Bos indicus en ganado criollo colombiano descendiente de Bos taurus. Para este estudio se realizó el análisis cariológico de la morfología del cromosoma Y a partir de muestras de sangre heparinizada de 67 bovinos machos pertenecientes a siete razas criollas colombianas. Se reporta la presencia de cuatro ejemplares pertenecientes a la raza Romosinuano (40% y 10 toros de la raza Casanareña (100% con cromosoma Y de tipo acrocéntrico característico de Bos indicus, lo cual estaría evidenciando un alto grado de introgresión genética, en estas dos razas, posiblemente originada por la intensiva introducción de sementales de la raza Cebú en la ganadería criolla colombiana. En las otras cinco razas (Blanco Orejinegro (BON, Chino santandereano, Costeño con cuernos, Hartón del valle y Sanmartinero, los toros presentaron el cromosoma Y submetacéntrico, característico de Bos taurus.This work evidenced, using a cytogenetics approach, that Bos indicus exerted a genetic introgression of paternal origin on Creole Colombian cattle descendent from Bos taurus. Analysis of chromosome Y morphology was carried out in heparinized blood samples of 67 bulls belonging to seven Colombian breeds. We report 4 sires belonging to the Romosinuano breed (40% and 10 bulls of the Casanareño breed (100% with acrocentric Y chromosome which is characteristic of Bos taurus. This finding indicates a high degree of genetic introgression in these two breeds probably caused by the continuous input of zebu stallions in the Colombian Creole breeds. In other five Creole breeds (Blanco Orejinegro -BON-, Chino Santandereano, Costeño con Cuernos, Hartón del Valle and Sanmartinero, the bulls had a submetacentric Y chromosome characteristic of Bos taurus.

  18. Screening of biotechnical parameters for production of bovine inter-subspecies embryonic chimeras by the aggregation of tetraploid Bos indicus and diploid crossbred Bos taurus embryos.

    Science.gov (United States)

    Razza, Eduardo M; Satrapa, Rafael A; Emanuelli, Isabele P; Barros, Ciro M; Nogueira, Marcelo F G

    2016-03-01

    The aggregation of a tetraploid zebu embryo (Bos indicus, a thermotolerant breed) with a diploid taurine embryo (Bos taurus, a thermosensitive breed) should create a complete taurine fetus, whose extra-embryonic components, e.g., the chorion, is derived mainly from the zebu embryo. These zebu-derived extra-embryonic components may interact positively with the taurine embryo/fetus during pregnancy in a tropical environment. We tested different parameters for the production of tetraploid Nelore (Bos indicus) embryos to be combined via aggregation with crossbred Bos taurus (diploid) embryos in order to produce viable chimeric blastocysts. Bovine (Bos indicus or crossbred Bos taurus) embryos were produced in vitro according to standard procedures. Two-cell Bos indicus embryos were submitted to electrofusion with varying numbers of pulses (1 or 2), voltages (0.4, 0.5, 0.75, 1.0, 1.4 and 5.0 kV/cm) and time (20, 25, 50 and 60 μs) to produce tetraploid embryos. Electrofused embryos were cultured with crossbred non-fused embryos to form chimeras that developed until the blastocyst stage. The best fusion parameter was 0.75 kV/cm for 60 μs. Four chimeric blastocysts (tetraploid Nelore with diploid crossbred Holstein) were formed after 31 attempts in 4 replicates (13%). We established an optimal procedure for the production of tetraploid Bos indicus (4n) embryos and embryonic chimeras by aggregation of crossbred Bos taurus (2n) with Bos indicus (4n) embryos. This technique would be valid in applied research, by producing exclusively taurine calves, but with placental elements from the Bos indicus breed, following transfer of these chimeras into recipient cows.

  19. Genome wide scan for quantitative trait loci affecting tick resistance in cattle (Bos taurus × Bos indicus

    Directory of Open Access Journals (Sweden)

    Guimarães Simone EF

    2010-04-01

    Full Text Available Abstract Background In tropical countries, losses caused by bovine tick Rhipicephalus (Boophilus microplus infestation have a tremendous economic impact on cattle production systems. Genetic variation between Bos taurus and Bos indicus to tick resistance and molecular biology tools might allow for the identification of molecular markers linked to resistance traits that could be used as an auxiliary tool in selection programs. The objective of this work was to identify QTL associated with tick resistance/susceptibility in a bovine F2 population derived from the Gyr (Bos indicus × Holstein (Bos taurus cross. Results Through a whole genome scan with microsatellite markers, we were able to map six genomic regions associated with bovine tick resistance. For most QTL, we have found that depending on the tick evaluation season (dry and rainy different sets of genes could be involved in the resistance mechanism. We identified dry season specific QTL on BTA 2 and 10, rainy season specific QTL on BTA 5, 11 and 27. We also found a highly significant genome wide QTL for both dry and rainy seasons in the central region of BTA 23. Conclusions The experimental F2 population derived from Gyr × Holstein cross successfully allowed the identification of six highly significant QTL associated with tick resistance in cattle. QTL located on BTA 23 might be related with the bovine histocompatibility complex. Further investigation of these QTL will help to isolate candidate genes involved with tick resistance in cattle.

  20. INTROGRESIÓN GENÉTICA DE Bos indicus (BOVIDAE EN BOVINOS CRIOLLOS COLOMBIANOS DE ORIGEN Bos taurus

    Directory of Open Access Journals (Sweden)

    JIMÉNEZ ROBAYO LIGIA MERCEDES

    2008-04-01

    Full Text Available

    El presente trabajo evidencia desde el punto de vista citogenético la introgresión genética, de origen paterno, de Bos indicus en ganado criollo colombiano descendiente de Bos taurus. Para este estudio se realizó el análisis cariológico de la morfología del cromosoma Y a partir de muestras de sangre heparinizada de 67 bovinos machos pertenecientes a siete razas criollas colombianas. Se reporta la presencia de cuatro ejemplares pertenecientes a la raza Romosinuano (40% y 10 toros de la raza Casanareña (100% con cromosoma Y de tipo acrocéntrico característico de Bos indicus, lo cual estaría evidenciando un alto grado de introgresión genética, en estas dos razas, posiblemente originada por la intensiva introducción de sementales de la raza Cebú en la ganadería criolla colombiana. En las otras cinco razas (Blanco Orejinegro (BON, Chino santandereano, Costeño con cuernos, Hartón del valle y Sanmartinero, los toros presentaron el cromosoma Y submetacéntrico, característico de Bos taurus.

  1. High environmental temperature and humidity decrease oocyte quality in Bos taurus but not in Bos indicus cows.

    Science.gov (United States)

    Rocha, A; Randel, R D; Broussard, J R; Lim, J M; Blair, R M; Roussel, J D; Godke, R A; Hansel, W

    1998-02-01

    Two experiments were conducted to assess the effects of environmental temperature and humidity on the quality and developmental capabilities of bovine oocytes. In Experiment 1, Bos taurus (Holstein and crossbred Angus) cows were subjected to 5 weekly sessions of ultrasound-guided follicle aspiration from February 16 through March 23 (cool season) and 5 sessions from May 22 through June 20 (hot season). In Experiment 2, Bos taurus (Holstein) and Bos indicus (Brahman) cows were superstimulated (Super-Ov) during the months of August (hot season) or January (cool season), and each cow was subjected to a single oocyte aspiration session. In each experiment, oocytes were classified as normal or abnormal based on ooplasm morphology and cumulus cell layers. In Experiment 1, oocytes classified as normal were in vitro matured and fertilized (IVM/IVF), and the resulting embryos cultured for 8 d. All oocytes recovered from superstimulated cows in Experiment 2 were matured and fertilized in vitro and the subsequent embryos cultured for 8 d, regardless of their morphological appearance. In Experiment 1, Bos taurus cows produced a higher (P = 0.02) percentage of normal oocytes during the cool season (75.9 +/- 8.0) than during the hot season (41.0 +/- 9.5). The percentage of fertilized oocytes developing to the 2-cell (82.4), 8-cell (65.4) and morula (46.6) stages were also greater (P Holstein) had a lower (P = 0.01) percentage of normal oocytes in the hot season (24.5 vs 80.0) and a lower (P or = 0.57) in the percentage of normal oocytes or in embryo development was detected between seasons in Bos indicus (Brahman) cows. In conclusion, high environmental temperature and humidity resulted in a marked decline in the quality of oocytes retrieved from Bos taurus cows and markedly decreased their in vitro developmental capabilities. In contrast, a high percentage of oocytes retrieved from Bos indicus cows exhibited normal morphology and yielded a high proportion of blastocysts

  2. A disintegrin and metalloprotease-12 is type I myofiber specific in Bos taurus and Bos indicus cattle.

    Science.gov (United States)

    Coles, C A; Wadeson, J; Knight, M I; Cafe, L M; Johns, W H; White, J D; Greenwood, P L; McDonagh, M B

    2014-04-01

    A disintegrin and metalloproteinase-12 (ADAM12) is involved in the regulation of myogenesis and adipogenesis and is of interest as a potential target to manipulate skeletal muscle development and intramuscular fat (IMF) deposition in cattle to increase beef yield and improve meat quality. The longissimus thoracis muscle (LM) and semitendinosus muscle (STM) from 5 Bos taurus (Angus) and 5 Bos indicus (Brahman) cattle were collected for histological and ADAM12 gene and protein expression analysis. Myofiber typing was used to determine if ADAM12 expression patterns related to differences in muscling and IMF deposition, which are influenced by proportions of the different myofiber types. The STM was found to contain a higher proportion of glycolytic myofibers than the LM, which contained a greater proportion of oxidative myofibers (myofiber ratio of glycolytic to more oxidative types in LM and STM of 1.1 and 3.5, respectively; P < 0.05). ADAM12 gene expression, fluorescent immunohistochemical staining for ADAM12, and image analysis found ADAM12 to be greater in the LM (P < 0.05). Regression analysis found a strong, positive relationship for the distribution of ADAM12 against the proportion of type I myofibers (P < 0.05, r(2) = 0.86). These findings suggest ADAM12 is upregulated in muscles with more slow-oxidative myofibres, such as the LM, and is linked to type I myofibers in cattle. ADAM12 may be important in the regulation and maintenance slow myofibers in the LM muscle. PMID:24663211

  3. Gene expression in the skin of Bos taurus and Bos indicus cattle infested with the cattle tick, Rhipicephalus (Boophilus) microplus.

    Science.gov (United States)

    Piper, Emily K; Jackson, Louise A; Bagnall, Neil H; Kongsuwan, Kritaya K; Lew, Ala E; Jonsson, Nicholas N

    2008-11-15

    The cattle tick Rhipicephalus microplus (formerly Boophilus microplus) is responsible for severe production losses to the cattle industry worldwide. It has long been known that different breeds of cattle can resist tick infestation to varying degrees; however, the mechanisms by which resistant cattle prevent heavy infestation are largely unknown. The aim of this study was to determine whether gene expression varied significantly between skin sampling sites (neck, chest and tail region), and whether changes in gene expression could be detected in samples taken at tick attachment sites (tick attached to skin sample) compared with samples taken from non-attachment sites (no tick attachment). We present here the results of an experiment examining the expression of a panel of forty-four genes in skin sections taken from Bos indicus (Brahman) cattle of known high resistance, and Bos taurus (Holstein-Friesian) cattle of known low resistance to the cattle tick. The forty-four genes chosen for this study included genes known to be involved in several immune processes, some structural genes, and some genes previously suggested to be of importance in tick resistance by other researchers. The expression of fifteen gene transcripts increased significantly in Holstein-Friesian skin samples at tick attachment sites. The higher expression of many genes involved in innate inflammatory processes in the Holstein-Friesian animals at tick attachment sites suggests this breed is exhibiting a non-directed pathological response to infestation. Of the forty-four genes analysed, no transcripts were detected in higher abundance at tick attachment sites in the Brahman cattle compared with similar samples from the Holstein-Friesian group, nor difference between attachment site and non-attachment site samples within the Brahman group. The results presented here suggest that the means by which these two cattle breeds respond to tick infestation differ and warrant further investigation. PMID

  4. Tick-susceptible Bos taurus cattle display an increased cellular response at the site of larval Rhipicephalus (Boophilus) microplus attachment, compared with tick-resistant Bos indicus cattle.

    Science.gov (United States)

    Piper, Emily K; Jackson, Louise A; Bielefeldt-Ohmann, Helle; Gondro, Cedric; Lew-Tabor, Ala E; Jonsson, Nicholas N

    2010-03-15

    Cattle demonstrate divergent and heritable phenotypes of resistance and susceptibility to infestation with the cattle tick Rhipicephalus (Boophilus) microplus. Bos indicus cattle are generally more resistant to tick infestation than Bos taurus breeds although large variations in resistance can occur within subspecies and within breed. Increased tick resistance has been previously associated with an intense hypersensitivity response in B. taurus breeds; however, the mechanism by which highly resistant B. indicus cattle acquire and sustain high levels of tick resistance remains to be elucidated. Using the commercially available Affymetrix microarray gene expression platform, together with histological examination of the larval attachment site, this study aimed to describe those processes responsible for high levels of tick resistance in Brahman (B. indicus) cattle that differ from those in low-resistance Holstein-Friesian (B. taurus) cattle. We found that genes involved in inflammatory processes and immune responsiveness to infestation by ticks, although up-regulated in tick-infested Holstein-Friesian cattle, were not up-regulated in Brahman cattle. In contrast, genes encoding constituents of the extracellular matrix were up-regulated in Brahmans. Furthermore, the susceptible Holstein-Friesian animals displayed a much greater cellular inflammatory response at the site of larval R. microplus attachment compared with the tick-resistant Brahman cattle. PMID:19852965

  5. Pregnancy rate and birth rate of calves from a large-scale IVF program using reverse-sorted semen in Bos indicus, Bos indicus-taurus, and Bos taurus cattle.

    Science.gov (United States)

    Morotti, F; Sanches, B V; Pontes, J H F; Basso, A C; Siqueira, E R; Lisboa, L A; Seneda, M M

    2014-03-15

    Obtaining sexed sperm from previously frozen doses (reverse-sorted semen [RSS]) provides an important advantage because of the possibility of using the semen of bulls with desired genetic attributes that have died or have become infertile but from whom frozen semen is available. We report the efficiency of RSS on the pregnancy rate and birth rate of calves in a large-scale program using ovum pick-up and in vitro embryo production (IVEP) from Bos indicus, Bos indicus-taurus, and Bos taurus cattle. From 645 ovum pick-up procedures (Holstein, Gir, and Nelore), 9438 viable oocytes were recovered. A dose of frozen semen (Holstein, Nelore, Brahman, Gir, and Braford) was thawed, and the sperm were sex-sorted and cooled for use in IVF. Additionally, IVF with sperm from three Holstein bulls with freeze-thawed, sex-sorted (RSS) or sex-sorted, freeze-thawed (control) was tested. A total of 2729 embryos were produced, exhibiting a mean blastocyst rate of 29%. Heifers and cows selected for adequate body condition, estrus, and health received 2404 embryos, and 60 days later, a 41% average pregnancy rate was observed. A total of 966 calves were born, and 910 were of a predetermined sex, with an average of 94% accuracy in determining the sex. Despite the lower blastocyst rate with freeze-thawed, sex-sorted semen compared with sex-sorted semen, (P 0.05) and sex-sorted efficiency (bull I, 93% vs. 98%; II, 96% vs. 94%; and III, 96% vs. 97% for RSS and control, respectively; P > 0.05) were similar for each of the three bulls regardless of the sperm type used in the IVF. The sexing of previously frozen semen, associated with IVEP, produces viable embryos with a pregnancy rate of up to 40%, and calves of the desired sex are born even if the paternal bull has acquired some infertility, died, or is located a long distance from the sexing laboratory. Furthermore, these data show the feasibility of the process even when used in a large-scale IVEP program. PMID:24412681

  6. Imputation of Microsatellite Alleles from Dense SNP Genotypes for Parentage Verification Across Multiple Bos taurus and Bos indicus breeds

    Directory of Open Access Journals (Sweden)

    Matthew Charles Mcclure

    2013-09-01

    Full Text Available To assist cattle producers transition from microsatellite (MS to single nucleotide polymorphism (SNP genotyping for parental verification we previously devised an effective and inexpensive method to impute MS alleles from SNP haplotypes. While the reported method was verified with only a limited data set (N=479 from Brown Swiss, Guernsey, Holstein, and Jersey cattle, some of the MS-SNP haplotype associations were concordant across these phylogenetically diverse breeds. This implied that some haplotypes predate modern breed formation and remain in strong linkage disequilibrium. To expand the utility of MS allele imputation across breeds, MS and SNP data from more than 8,000 animals representing 39 breeds (Bos taurus and B. indicus were used to predict 9,410 SNP haplotypes, incorporating an average of 73 SNPs per haplotype, for which alleles for 12 MS markers could be accurately be imputed. Approximately 25% of the MS-SNP haplotypes were present in multiple breeds (N=2 to 36 breeds. These shared haplotypes allowed for MS imputation in breeds that were not represented in the reference population with only a small increase in Mendelian inheritance inconsistancies. Our reported reference haplotypes can be used for any cattle breed and the reported methods can be applied to any species to aid the transition from MS to SNP genetic markers. While ~91% of the animals with imputed alleles for 12 MS markers had <1 Mendelian inheritance conflicts with their parents’ reported MS genotypes, this figure was 96% for our reference animals, indicating potential errors in the reported MS genotypes. The workflow we suggest autocorrects for genotyping errors and rare haplotypes, by MS genotyping animals whose imputed MS alleles fail parentage verification, and then incorporating those animals into the reference dataset.

  7. Comparative microarray analysis of Rhipicephalus (Boophilus microplus expression profiles of larvae pre-attachment and feeding adult female stages on Bos indicus and Bos taurus cattle

    Directory of Open Access Journals (Sweden)

    Gondro Cedric

    2010-07-01

    Full Text Available Abstract Background Rhipicephalus (Boophilus microplus is an obligate blood feeder which is host specific to cattle. Existing knowledge pertaining to the host or host breed effects on tick transcript expression profiles during the tick - host interaction is poor. Results Global analysis of gene expression changes in whole R. microplus ticks during larval, pre-attachment and early adult stages feeding on Bos indicus and Bos taurus cattle were compared using gene expression microarray analysis. Among the 13,601 R. microplus transcripts from BmiGI Version 2 we identified 297 high and 17 low expressed transcripts that were significantly differentially expressed between R. microplus feeding on tick resistant cattle [Bos indicus (Brahman] compared to R. microplus feeding on tick susceptible cattle [Bos taurus (Holstein-Friesian] (p ≤ 0.001. These include genes encoding enzymes involved in primary metabolism, and genes related to stress, defence, cell wall modification, cellular signaling, receptor, and cuticle formation. Microarrays were validated by qRT-PCR analysis of selected transcripts using three housekeeping genes as normalization controls. Conclusion The analysis of all tick stages under survey suggested a coordinated regulation of defence proteins, proteases and protease inhibitors to achieve successful attachment and survival of R. microplus on different host breeds, particularly Bos indicus cattle. R. microplus ticks demonstrate different transcript expression patterns when they encounter tick resistant and susceptible breeds of cattle. In this study we provide the first transcriptome evidence demonstrating the influence of tick resistant and susceptible cattle breeds on transcript expression patterns and the molecular physiology of ticks during host attachment and feeding. The microarray data used in this analysis have been submitted to NCBI GEO database under accession number GSE20605 http://www.ncbi

  8. Influence of calf genotype on colostral immunoglobulins in Bos taurus and Bos indicus cows and serum immunoglobulins in their calves.

    Science.gov (United States)

    Vann, R C; Holloway, J W; Carstens, G E; Boyd, M E; Randel, R D

    1995-10-01

    Purebred Bos indicus calves are documented to have lower survival rates than Bos taurus calves. Thus, this study was designed to investigate the possibility that this decreased survival rate may be attributed to dam colostral immunoglobulin (Ig) concentrations and subsequent calf serum Ig concentrations. The specific objective was to determine the effect of breed type of calf on colostrum production, immunoglobulin concentrations in colostrum and calf serum, and availability and absorption efficiency of Ig. Brahman (B) and Angus (A) cattle were reciprocally mated to produce calves of the following types: A x A (n = 8), A x B (n = 9), B x B (n = 11), and B x A (n = 11). At birth, calves were separated from their dams and a blood sample was collected before feeding pooled colostrum (30 mL/kg birth weight) at 1 and 6 h of age. From 6 to 12 h of age, each calf was placed in a box that allowed interaction with the dam but prevented suckling. At 12 h of age, each calf was fed its dam's colostrum and placed with the dam. Additional blood samples were collected at 12, 24, and 48 h after birth. Serum and colostrum samples were analyzed for IgG, IgG1, IgG2, IgM, and IgA using single radial immunodiffusion (RID) assay techniques. The cows were hand-milked after induction of milk letdown with oxytocin at 1 and 12 h after calving. Colostrum volume was recorded, and samples were collected. Brahman cows produced more (P x B and A x B breed types of calf. Brahman cows had more Ig available at 1 and 12 h than A cows due to increased production of colostrum. Breed type influenced colostral Ig in cattle. Serum concentrations of total Ig, IgG, IgG1, IgG2, IgM, and IgA in the calf and efficiency of absorption at 6 and 12 h were not affected by breed type, sex of calf, or any interaction. PMID:8617676

  9. A new single nucleotide polymorphism in CAPN1 extends the current tenderness marker test to include cattle of Bos indicus, Bos taurus, and crossbred descent.

    Science.gov (United States)

    White, S N; Casas, E; Wheeler, T L; Shackelford, S D; Koohmaraie, M; Riley, D G; Chase, C C; Johnson, D D; Keele, J W; Smith, T P L

    2005-09-01

    The three objectives of this study were to 1) test for the existence of beef tenderness markers in the CAPN1 gene segregating in Brahman cattle; 2) test existing CAPN1 tenderness markers in indicus-influenced crossbred cattle; and 3) produce a revised marker system for use in cattle of all subspecies backgrounds. Previously, two SNP in the CAPN1 gene have been described that could be used to guide selection in Bos taurus cattle (designated Markers 316 and 530), but neither marker segregates at high frequency in Brahman cattle. In this study, we examined three additional SNP in CAPN1 to determine whether variation in this gene could be associated with tenderness in a large, multisire American Brahman population. One marker (termed 4751) was associated with shear force on postmortem d 7 (P Brangus, Beefmaster, Bonsmara, Romosinuano, Hereford, and Angus referred to as the GPE Cycle 8 population). The highly significant association of Marker 4751 with shear force in this population (P < 0.001) confirms the usefulness of Marker 4751 in cattle of all subspecies backgrounds, including Bos taurus, Bos indicus, and crossbred descent. This wide applicability adds substantial value over previously released Markers 316 and 530. However, Marker 316, which had previously been shown to be associated with tenderness in the GPE Cycle 7 population, also was highly associated with shear force in the GPE Cycle 8 animals (P < 0.001). Thus, Marker 316 may continue to be useful in a variety of populations with a high percentage of Bos taurus backgrounds. An optimal marker strategy for CAPN1 in many cases will be to use both Markers 316 and 4751. PMID:16100054

  10. Sequenciamento e análise dos genes das subunidades alfa e beta do hormônio folículo estimulante de bovino (Bos taurus indicus Sequencing and analysis of subunits alpha and beta of the follicle stimulating hormone from bovine (Bos taurus indicus

    Directory of Open Access Journals (Sweden)

    Luci Sayori Murata

    2008-07-01

    Full Text Available

    Este trabalho relata uma clonagem e seqüenciamento das subunidades alfa e beta do hormônio folículo estimulante de Bos taurus indicus. Também apresenta os resultados de comparação realizada das seqüências gênicas dessas cadeias com as seqüências das cadeias alfa e beta do FSH de suínos e da cadeia beta de bovinos Bos taurus taurus já presentes no GenBank. Na comparação das seqüências de nucleotídeos e de aminoácidos predita da cadeia αFSH de Bos taurus indicus com as cadeias αFSH de outras espécies como suínos e búfalo (Bubalis bubalis, observou-se que as seqüências são bastante similares. A comparação da seqüência da subunidade αFSH de Bos taurus indicus com a de suíno demonstrou diferenças em três resíduos de aminoácidos. Na comparação com ßFSH, registrou-se modificação na primeira base do codon que levou à alteração no resíduo do aminóacido 83, que, em Bos taurus indicus, é uma glicina, ao invés da serina presente em Bos taurus taurus. Confirmaram-se essa modificação e todas as outras identificadas na seqüência dos cDNA das cadeias αFSH e βFSH em outra clonagem. A modificação Ser para Gly na posição 83 foi a única que alterou a identidade do resíduo de aminoácido na comparação entre as subunidades beta do FSH de Bos taurus indicus e Bos taurus taurus. Contudo, ela não deve alterar significativamente as propriedades fisiológicas do FSH, uma vez que o resíduo de glicina encontrado nessa posição também é encontrado na cadeia βFSH suína. Trata-se, portanto, de uma modificação particular que distingue as cadeias βFSH de B. taurus taurus e B. taurus indicus.

     

    PALAVRAS-CHAVES: Bovino, clonagem, FSH, hormônio.

    The aim this work was to promove the cloning and analysis sequencing

  11. Growth traits and composition of two- and three-way-cross intact male progeny of Bos taurus and Bos indicus X Bos taurus dams.

    Science.gov (United States)

    Van Ornum, K M; Bailey, C M; Ringkob, T P; Koh, Y O

    1987-07-01

    Feedlot traits, carcass traits and distribution of commercial cuts of crossbred intact male progeny (n = 556) from young and mature Hereford, Red Poll, Hereford X Red Poll, Red Poll X Hereford, Angus X Hereford, Angus X Charolais, Brahman X Hereford and Brahman X Angus dams were evaluated. First-calf heifers were bred to Red Angus bulls; Santa Gertrudis sires were used for each cow's second and third breeding seasons. Calves from these young dams were slaughtered at 13 mo. Calves of mature dams were all sired by Limousin bulls and slaughtered at 12 mo. Dam breed was a major source of variation in most bull traits. Progeny of Brahman-cross dams were inferior (P less than .01) in daily gain, final weight, carcass weight and in edible cuts/day of age compared with progeny from Bos taurus dams. Intact male progeny of Angus X Charolais dams ranked highest in longissimus area, cutability, and edible cuts/day of age. The range of dam breed means in percentage of steak, roast, bone-in cuts (chuck short ribs and back ribs), short plate and thin cuts, and lean trim was just over 1%. Greater variation among dam breeds existed in fat measurements. Analyses in which Hereford-Red Poll diallel data for young dams and mature dams were combined showed positive maternal heterosis for dressing percentage (P less than .05), carcass weight (P less than .05), carcass weight/day of age (P less than .05), estimated carcass fat (P less than .05), fat thickness (P less than .01) and marbling score (P less than .01). Reciprocal effects were inconsequential. Results illustrate the importance of dam breed-type effects in formulating breeding strategies for commercial beef herds.

  12. Growth traits and composition of two- and three-way-cross intact male progeny of Bos taurus and Bos indicus X Bos taurus dams.

    Science.gov (United States)

    Van Ornum, K M; Bailey, C M; Ringkob, T P; Koh, Y O

    1987-07-01

    Feedlot traits, carcass traits and distribution of commercial cuts of crossbred intact male progeny (n = 556) from young and mature Hereford, Red Poll, Hereford X Red Poll, Red Poll X Hereford, Angus X Hereford, Angus X Charolais, Brahman X Hereford and Brahman X Angus dams were evaluated. First-calf heifers were bred to Red Angus bulls; Santa Gertrudis sires were used for each cow's second and third breeding seasons. Calves from these young dams were slaughtered at 13 mo. Calves of mature dams were all sired by Limousin bulls and slaughtered at 12 mo. Dam breed was a major source of variation in most bull traits. Progeny of Brahman-cross dams were inferior (P less than .01) in daily gain, final weight, carcass weight and in edible cuts/day of age compared with progeny from Bos taurus dams. Intact male progeny of Angus X Charolais dams ranked highest in longissimus area, cutability, and edible cuts/day of age. The range of dam breed means in percentage of steak, roast, bone-in cuts (chuck short ribs and back ribs), short plate and thin cuts, and lean trim was just over 1%. Greater variation among dam breeds existed in fat measurements. Analyses in which Hereford-Red Poll diallel data for young dams and mature dams were combined showed positive maternal heterosis for dressing percentage (P less than .05), carcass weight (P less than .05), carcass weight/day of age (P less than .05), estimated carcass fat (P less than .05), fat thickness (P less than .01) and marbling score (P less than .01). Reciprocal effects were inconsequential. Results illustrate the importance of dam breed-type effects in formulating breeding strategies for commercial beef herds. PMID:3610866

  13. Urinary excretion of purine derivatives as an index of microbial protein supply in cross-bred (Bos indicus x Bos taurus) cattle in tropical environment

    International Nuclear Information System (INIS)

    Four experiments were carried out to establish a response model between urinary excretion of purine derivatives (PD) and microbial production in Bos indicus x Bos taurus cross-bred cattle: LZ, MZ and HZ (3/8, 1/2 and 5/8 Bos indicus, respectively). The fasting PD excretion was considered as endogenous excretion and amounted to 268 (± 85.1), 294 (± 128.1) and 269 (± 68.4) μmol/kg W0.75 for LZ, MZ and HZ, respectively. Urinary recovery of absorbed purine bases (PB) was calculated as the urinary recovery of a single dose of intrajugular infused uric acid (1,3-15N). In HZ crossbred cattle 83% (± 20.3) of infused uric acid was recovered in the urinary PD. The relationship between duodenal purine absorption (X, mmol/d) and urinary PD excretion (Y, mmol/d) was defined in HZ crossbred cattle as Y = 0.83 X + 0.269W0.75 (± 85.1), assuming that the endogenous contribution was constant and independent of the exogenous PB supply. The activity of xanthine oxidase (EC 1.2.3.2.) was determined in HZ and MZ and was found to be higher in the liver (0.62 and 0.66 units/g, respectively) than in intestinal mucosa (0.09 and 0.03 units/g, respectively), whereas xanthine oxidase activity was practically absent in plasma of both cross breeds. The ratio PB:total N was determined in microbial extracts taken from rumen fluid of cows fed Bermuda grass (Cynodon dactylon) as the sole diet or supplemented (ratio of 80:20, grass: supplement) with gluten feed, soybean hulls or Gliricidia species and were found to range from 1.52-1.62 μmol PB/mg N. (author)

  14. Effect of single nucleotide polymorphisms of CAPN1 and CAST genes on meat traits in Nellore beef cattle (Bos indicus) and in their crosses with Bos taurus.

    Science.gov (United States)

    Curi, R A; Chardulo, L A L; Mason, M C; Arrigoni, M D B; Silveira, A C; de Oliveira, H N

    2009-08-01

    The objectives of this work were to study the segregation of single nucleotide polymorphisms of the calpain 1, large subunit (CAPN1) and calpastatin (CAST) genes in Nellore (Bos indicus) and Nellore xBos taurus beef cattle, as well as to evaluate their effects on meat traits. For this, 300 animals, including 114 Nellore, 67 Angus x Nellore, 44 Rubia Gallega x Nellore, 41 Canchim, 19 Brangus three-way crosses and 15 Braunvieh three-way crosses, were genotyped for the CAPN4751 [AF_248054.2:g.6545C>T (GenBank accession AF248054.2)] and CAST/DdeI [AF_159246.1:g.2959A>G (GenBank accession AF159246.1)] polymorphisms and phenotyped for Ribeye Area, Backfat Thickness, Intramuscular Fat, Shear Force (SF) and Myofibrillar Fragmentation Index (MFI). In relation to the CAPN4751 polymorphism, a frequency of 10.5% was observed for the C allele in the Nellore breed. In the total sample of studied animals, a significant association was found between genotypes and meat tenderness, assessed by SF (P = 0.005) and MFI (P = 0.008), with genotype CT being more favourable than TT. For the CAST/DdeI polymorphism, a frequency of 55.7% was found for the A allele in the Nellore breed. In the total sample, a significant association was observed between genotypes and meat tenderness - SF (P = 0.004) and MFI (P = 0.006), with genotype AA being more favourable than AG. The relationship between genotypes and aged meat tenderness in confluence with the distribution of favourable alleles shows great potential for application of the CAPN4751 and CAST/DdeI polymorphisms in the genetic improvement of the Nellore breed, whilst contributing to the validation, in this breed and in its crosses with B. taurus, of the association results previously described in the literature.

  15. Effect of single nucleotide polymorphisms of CAPN1 and CAST genes on meat traits in Nellore beef cattle (Bos indicus) and in their crosses with Bos taurus.

    Science.gov (United States)

    Curi, R A; Chardulo, L A L; Mason, M C; Arrigoni, M D B; Silveira, A C; de Oliveira, H N

    2009-08-01

    The objectives of this work were to study the segregation of single nucleotide polymorphisms of the calpain 1, large subunit (CAPN1) and calpastatin (CAST) genes in Nellore (Bos indicus) and Nellore xBos taurus beef cattle, as well as to evaluate their effects on meat traits. For this, 300 animals, including 114 Nellore, 67 Angus x Nellore, 44 Rubia Gallega x Nellore, 41 Canchim, 19 Brangus three-way crosses and 15 Braunvieh three-way crosses, were genotyped for the CAPN4751 [AF_248054.2:g.6545C>T (GenBank accession AF248054.2)] and CAST/DdeI [AF_159246.1:g.2959A>G (GenBank accession AF159246.1)] polymorphisms and phenotyped for Ribeye Area, Backfat Thickness, Intramuscular Fat, Shear Force (SF) and Myofibrillar Fragmentation Index (MFI). In relation to the CAPN4751 polymorphism, a frequency of 10.5% was observed for the C allele in the Nellore breed. In the total sample of studied animals, a significant association was found between genotypes and meat tenderness, assessed by SF (P = 0.005) and MFI (P = 0.008), with genotype CT being more favourable than TT. For the CAST/DdeI polymorphism, a frequency of 55.7% was found for the A allele in the Nellore breed. In the total sample, a significant association was observed between genotypes and meat tenderness - SF (P = 0.004) and MFI (P = 0.006), with genotype AA being more favourable than AG. The relationship between genotypes and aged meat tenderness in confluence with the distribution of favourable alleles shows great potential for application of the CAPN4751 and CAST/DdeI polymorphisms in the genetic improvement of the Nellore breed, whilst contributing to the validation, in this breed and in its crosses with B. taurus, of the association results previously described in the literature. PMID:19392828

  16. Evaluation of reciprocal differences in Bos indicus x Bos taurus backcross calves produced through embryo transfer: I. Birth and weaning traits.

    Science.gov (United States)

    Amen, T S; Herring, A D; Sanders, J O; Gill, C A

    2007-02-01

    Angus (A) and Bos indicus (B; Brahman or Nellore) reciprocal backcross, embryo transfer calves, belonging to 28 full-sib families, were evaluated for differences in birth weight, gestation length, and weaning weight. Two methods were investigated; method I made no distinction between how the F(1) parents were produced, whereas method II distinguished between the 2 types of F(1) parents (AB vs. BA corresponding to A x B vs. B x A, respectively). Bos indicus backcross calves had a 4.3 d longer (P x F(1) calves had a 5.2 d longer (P = 0.01) gestation length than F(1) x B calves (290.5 vs. 285.3, respectively). Under method II analysis, there was a consistent trend for gestation length, in which BA F(1) parents produced calves that ranked greater than calves from AB F(1) parents, as sires and dams. Crosses with a greater proportion of B in the sire in relation to the amount in the dam had a heavier (P x A and B x F(1); 38.1 and 38.4 kg, respectively) than their respective reciprocal crosses (A x F(1) and F(1) x B; 34.3 and 33.5 kg, respectively). The F(1) x A and B x F(1) crosses showed a large difference in birth weight between males and females (5.3 and 4.1 kg, respectively), whereas A x F(1) and F(1) x B crosses showed a small difference (P > 0.10) in birth weight between males and females (1.5 and 1.1 kg, respectively). Further examination within each sex showed a difference between male reciprocals that was generally much larger than that between female reciprocals. Calves with a greater percentage of B in the sire compared with the proportion in the dam ranked heavier for weaning weight as for birth weight, though these differences were not significant. In breeding systems involving B x Bos taurus crosses, even when using embryo transfer, not only does the breed composition of the calves affect their preweaning performance, but the particular cross that produces the calves also should be considered in making breeding decisions. PMID:17235021

  17. Clínica e hematologia de Bos indicus, Bos taurus e Bubalus bubalis inoculados com oocistos de Toxoplasma gondii (Apicomplexa: Toxoplasmatinae

    Directory of Open Access Journals (Sweden)

    Oliveira Francisco Carlos Rodrigues de

    2001-01-01

    Full Text Available Três animais de cada espécie (Bos indicus, Bos taurus e Bubalus bubalis foram inoculados, via oral, com 2,0 x 10(5 oocistos de Toxoplasma gondii. Seis outros animais, dois de cada espécie, foram mantidos como testemunhas. As alterações clínicas surgidas a partir do 3º dia após inoculação (DAI foram: hipertermia, taquicardia, taquipnéia, anorexia, prostração, corrimento nasal e lacrimejamento. Estes sinais foram mais evidentes nos taurinos, espécie que apresentou, ainda, diarréia, fotofobia e conjuntivite. Foi possível isolar T. gondii da corrente sangüínea em todas as espécies. Nos taurinos, a partir do 5º DAI até o final do experimento, o parasito foi isolado de todas as amostras de sangue colhidas semanalmente, com exceção do 14º, 35º e 63º DAI. Os bubalinos apresentaram parasitemia no 7º, 14º, 35º e 70º DAI e os zebuínos apenas no 7º e 28º DAI, correspondendo aos picos de temperatura, em todas as espécies, sendo mais evidente em taurinos. Os parâmetros clínico-laboratoriais demonstraram que os taurinos foram mais sensíveis ao T. gondii do que os zebuínos e estes não diferiram significativamente dos bubalinos, que tiveram aparente normalidade clínico-laboratorial.

  18. Is the American Zebu really Bos indicus?

    Directory of Open Access Journals (Sweden)

    Meirelles Flávio V.

    1999-01-01

    Full Text Available The American continent was colonized in the 16th century by Europeans who first introduced cattle of Bos taurus origin. Accounts register introduction of Bos indicus cattle into South America in the 19th and continuing through the 20th century, and most reported imports were males derived from the Indian subcontinent. In the present study we show, by using mitochondrial DNA (mtDNA polymorphism, major participation of matrilineages of taurus origin in the American Zebu purebred origin, i.e., 79, 73 and 100% for the Nellore, Gyr and Brahman breeds, respectively. Moreover, we have created a restriction map identifying polymorphism among B. taurus and B. indicus mtDNA using three restriction enzymes. Results are discussed concerning American Zebu origins and potential use of this information for investigating the contribution of cytoplasmic genes in cattle production traits.

  19. Variation in meat quality characteristics between Sanga (Bos taurus africanus) and Sanga-derived cattle breeds and between Sanga and Brahman (Bos indicus).

    Science.gov (United States)

    Strydom, P E; Frylinck, L; Smith, M F

    2011-03-01

    Cattle breeds indigenous to Africa (Sanga) compare favourably to Bos indicus breeds with regard to adaptation to harsh environments. This study compared the meat quality of three Sanga breeds (Nguni, Tuli and Drakensberger), a Sanga-related breed (Bonsmara) and a B. indicus breed (Brahman) and supported these results with biochemical and histological measurements on the M. longissimus lumborum. Twelve young grain-fed steers of each breed were slaughtered and carcasses were electrically stimulated. All Sanga (and related) breeds, with the exception of the Tuli, had lower Warner-Bratzler shear force (SF) values at 2 and 21 days post mortem compared with the BR (P meat than BR, mainly due to favourable calpain-to-calpastatin ratios. Small differences in colour, drip loss and cooking properties were found among breeds (P < 0.05). PMID:22445415

  20. Effects of beta agonists in the diagnosis of fasciolosis in Bos indicus x Bos taurus in the state of Puebla, Mexico

    International Nuclear Information System (INIS)

    currently in Mexico about 30 million cattle of which about 15000.000 million are in areas at high risk of infestation and about 5,000,000 million fascioliosis animals are with, if we estimate the economic losses per year gives us an approximate price of 4,500,000,000 pesos are lost annually, on the other hand, the lack of good pasture especially in times of drought in the state are helping farmers are feeding their animals with food additives in this case the betaagonist (clenbuterol and the like ), At present there are several municipal traces at the state level are discarding the livers of cattle producing very large economic losses. been conducted on prevailing level of municipal trail Atlixco (zone endemic to the disease) in the year 2001-02 with a prevalence of 32-33 % While that in 2007 set a precedence of 7% over the same track municipal; this parasitic disease that affects the liver parenchyma and pipelines, affects the metabolic activity of the liver, this organ is one of the most important thing, because it participates in many metabolic pathways, as in the production and secretion of bile, regulates the metabolism of carbohydrates, lipids and proteins among others. This parasitic disease affects the production of meat and milk in ruminant animals in this very particular case Bos taurus x Bos indicus, the affected animals, these activities are depleted in previous studies have found that animals are fed with food additives such as beta -adrenergic-agonist, whose effect is to produce lipolysis, lipogenesis, are glucoliticos, and glycogen, affecting body composition, favouring neoformation tissue by the redistribution of power, also increasing the release of fatty acids into the blood, facilitating the synthesis of protein and retains the nitrogen fed into skeletal muscle, these components used as food additives are prohibited by federal law nationals (SAGARPA NOM-015-ZOO-2002), as the consumption of meat produced visceral primarily of clinical cases as tachycardia

  1. Evaluation of reciprocal differences in Bos indicus x Bos taurus backcross calves produced through embryo transfer: II. Postweaning, carcass, and meat traits.

    Science.gov (United States)

    Amen, T S; Herring, A D; Sanders, J O; Gill, C A

    2007-02-01

    Angus (A) x Bos indicus (B; Brahman or Nellore) reciprocal backcross, embryo transfer calves belonging to 28 full-sib families were evaluated for differences in feedyard initial BW, feedyard final BW, carcass weight, LM area, adjusted fat thickness, intramuscular fat, and Warner-Bratzler shear force. Two methods of analysis were investigated; method I made no distinction between how the F(1) parents were produced, whereas method II distinguished the 2 types of F(1) parents (AB vs. BA, corresponding to A x B vs. B x A, respectively). No significant reciprocal differences for these weight and carcass traits were detected under method I analyses, although the same trend existed for subsequent BW rankings as for birth weight and weaning weight. For each weight phase, the cross that involved a larger proportion of B in the sire in relation to the amount in the dam (F(1) x A and B x F(1)) ranked heavier than the respective reciprocal cross (A x F(1) and F(1) x B). As a whole, A backcross calves had larger (P carcass (P < 0.001), and had larger LM area (P < 0.05) with less adjusted fat (P < 0.001). No difference existed between the sexes for Warner-Bratzler shear force or marbling. No interactions involving sex, sire type, and dam type were observed for any of these traits. The results were similar under methods I and II analyses, with the exception that a significant sire type x dam type interaction was observed for initial feedyard BW. Results from this study suggest that for weight-related traits, both the breed constitution of the embryo transfer calf and the cross that produces the calf play an important role in its ultimate performance for B crossbred calves. For body composition and meat-related traits, it appears that the breed makeup of the embryo transfer calf itself is more important to animal performance than the specific cross used to produce the calf.

  2. Evaluation of reciprocal differences in Bos indicus x Bos taurus backcross calves produced through embryo transfer: II. Postweaning, carcass, and meat traits.

    Science.gov (United States)

    Amen, T S; Herring, A D; Sanders, J O; Gill, C A

    2007-02-01

    Angus (A) x Bos indicus (B; Brahman or Nellore) reciprocal backcross, embryo transfer calves belonging to 28 full-sib families were evaluated for differences in feedyard initial BW, feedyard final BW, carcass weight, LM area, adjusted fat thickness, intramuscular fat, and Warner-Bratzler shear force. Two methods of analysis were investigated; method I made no distinction between how the F(1) parents were produced, whereas method II distinguished the 2 types of F(1) parents (AB vs. BA, corresponding to A x B vs. B x A, respectively). No significant reciprocal differences for these weight and carcass traits were detected under method I analyses, although the same trend existed for subsequent BW rankings as for birth weight and weaning weight. For each weight phase, the cross that involved a larger proportion of B in the sire in relation to the amount in the dam (F(1) x A and B x F(1)) ranked heavier than the respective reciprocal cross (A x F(1) and F(1) x B). As a whole, A backcross calves had larger (P x dam type interaction was observed for initial feedyard BW. Results from this study suggest that for weight-related traits, both the breed constitution of the embryo transfer calf and the cross that produces the calf play an important role in its ultimate performance for B crossbred calves. For body composition and meat-related traits, it appears that the breed makeup of the embryo transfer calf itself is more important to animal performance than the specific cross used to produce the calf. PMID:17235022

  3. Accuracy of prediction of genomic breeding values for residual feed intake and carcass and meat quality traits in Bos taurus, Bos indicus, and composite beef cattle.

    Science.gov (United States)

    Bolormaa, S; Pryce, J E; Kemper, K; Savin, K; Hayes, B J; Barendse, W; Zhang, Y; Reich, C M; Mason, B A; Bunch, R J; Harrison, B E; Reverter, A; Herd, R M; Tier, B; Graser, H-U; Goddard, M E

    2013-07-01

    The aim of this study was to assess the accuracy of genomic predictions for 19 traits including feed efficiency, growth, and carcass and meat quality traits in beef cattle. The 10,181 cattle in our study had real or imputed genotypes for 729,068 SNP although not all cattle were measured for all traits. Animals included Bos taurus, Brahman, composite, and crossbred animals. Genomic EBV (GEBV) were calculated using 2 methods of genomic prediction [BayesR and genomic BLUP (GBLUP)] either using a common training dataset for all breeds or using a training dataset comprising only animals of the same breed. Accuracies of GEBV were assessed using 5-fold cross-validation. The accuracy of genomic prediction varied by trait and by method. Traits with a large number of recorded and genotyped animals and with high heritability gave the greatest accuracy of GEBV. Using GBLUP, the average accuracy was 0.27 across traits and breeds, but the accuracies between breeds and between traits varied widely. When the training population was restricted to animals from the same breed as the validation population, GBLUP accuracies declined by an average of 0.04. The greatest decline in accuracy was found for the 4 composite breeds. The BayesR accuracies were greater by an average of 0.03 than GBLUP accuracies, particularly for traits with known genes of moderate to large effect mutations segregating. The accuracies of 0.43 to 0.48 for IGF-I traits were among the greatest in the study. Although accuracies are low compared with those observed in dairy cattle, genomic selection would still be beneficial for traits that are hard to improve by conventional selection, such as tenderness and residual feed intake. BayesR identified many of the same quantitative trait loci as a genomewide association study but appeared to map them more precisely. All traits appear to be highly polygenic with thousands of SNP independently associated with each trait. PMID:23658330

  4. Accuracy of prediction of genomic breeding values for residual feed intake and carcass and meat quality traits in Bos taurus, Bos indicus, and composite beef cattle.

    Science.gov (United States)

    Bolormaa, S; Pryce, J E; Kemper, K; Savin, K; Hayes, B J; Barendse, W; Zhang, Y; Reich, C M; Mason, B A; Bunch, R J; Harrison, B E; Reverter, A; Herd, R M; Tier, B; Graser, H-U; Goddard, M E

    2013-07-01

    The aim of this study was to assess the accuracy of genomic predictions for 19 traits including feed efficiency, growth, and carcass and meat quality traits in beef cattle. The 10,181 cattle in our study had real or imputed genotypes for 729,068 SNP although not all cattle were measured for all traits. Animals included Bos taurus, Brahman, composite, and crossbred animals. Genomic EBV (GEBV) were calculated using 2 methods of genomic prediction [BayesR and genomic BLUP (GBLUP)] either using a common training dataset for all breeds or using a training dataset comprising only animals of the same breed. Accuracies of GEBV were assessed using 5-fold cross-validation. The accuracy of genomic prediction varied by trait and by method. Traits with a large number of recorded and genotyped animals and with high heritability gave the greatest accuracy of GEBV. Using GBLUP, the average accuracy was 0.27 across traits and breeds, but the accuracies between breeds and between traits varied widely. When the training population was restricted to animals from the same breed as the validation population, GBLUP accuracies declined by an average of 0.04. The greatest decline in accuracy was found for the 4 composite breeds. The BayesR accuracies were greater by an average of 0.03 than GBLUP accuracies, particularly for traits with known genes of moderate to large effect mutations segregating. The accuracies of 0.43 to 0.48 for IGF-I traits were among the greatest in the study. Although accuracies are low compared with those observed in dairy cattle, genomic selection would still be beneficial for traits that are hard to improve by conventional selection, such as tenderness and residual feed intake. BayesR identified many of the same quantitative trait loci as a genomewide association study but appeared to map them more precisely. All traits appear to be highly polygenic with thousands of SNP independently associated with each trait.

  5. Impact of a trace element supplementation programme on health and performance of cross-breed (Bos indicus x Bos taurus) dairy cattle under tropical farming conditions: a double-blinded randomized field trial.

    Science.gov (United States)

    Dermauw, V; Dierenfeld, E; Du Laing, G; Buyse, J; Brochier, B; Van Gucht, S; Duchateau, L; Janssens, G P J

    2015-06-01

    Small-scale urban dairy farms (n = 16) in and around Jimma, Ethiopia with cross-bred (Bos indicus × Bos taurus) cows were enrolled in a double-blinded intervention study to investigate the effect of a trace element supplementation programme on trace element status and milk concentrations as well as performance [body condition score (BCS), milk yield, leptin], milk composition, antioxidant status (ferric-reducing ability of plasma (FRAP), thiobarbituric acid-reactive substances (TBARS)], blood biochemistry, serum proteins and immune response (antibody titre upon rabies vaccination). The farms were allocated to a (1) placebo or (2) Cu, Zn, Se, Co and I supplementation treatment for 150 d. On days 0 and 120, four lactating cows per farm were sampled for milk and plasma, and on day 150 for serum, following primo-vaccination. Cu deficiency was present in 17% and marginal Se deficiency in 30% of initially sampled cows, while no Zn shortage was detected. Over 120 days, trace element supplementation caused a bigger increase in plasma Se and Cu concentrations, but also a larger decrease of plasma Fe concentrations. A larger increase in milk Se concentrations was observed in the supplemented group, whereas none of the other elements were affected. BCS decreased more over time in the supplemented group. None of the other parameters of performance and antioxidant status nor milk composition or blood biochemistry was affected by treatment. Antibody response to rabies vaccination did not differ between groups, whereas α1-globulins tended to be lower and β-globulins tended to be higher in the supplemented group. In conclusion, despite improved Cu and Se status and Se concentrations in milk, cows on tropical urban dairy farms did not seem to benefit from trace element supplementation, with respect to the parameters investigated.

  6. Impact of a trace element supplementation programme on health and performance of cross-breed (Bos indicus x Bos taurus) dairy cattle under tropical farming conditions: a double-blinded randomized field trial.

    Science.gov (United States)

    Dermauw, V; Dierenfeld, E; Du Laing, G; Buyse, J; Brochier, B; Van Gucht, S; Duchateau, L; Janssens, G P J

    2015-06-01

    Small-scale urban dairy farms (n = 16) in and around Jimma, Ethiopia with cross-bred (Bos indicus × Bos taurus) cows were enrolled in a double-blinded intervention study to investigate the effect of a trace element supplementation programme on trace element status and milk concentrations as well as performance [body condition score (BCS), milk yield, leptin], milk composition, antioxidant status (ferric-reducing ability of plasma (FRAP), thiobarbituric acid-reactive substances (TBARS)], blood biochemistry, serum proteins and immune response (antibody titre upon rabies vaccination). The farms were allocated to a (1) placebo or (2) Cu, Zn, Se, Co and I supplementation treatment for 150 d. On days 0 and 120, four lactating cows per farm were sampled for milk and plasma, and on day 150 for serum, following primo-vaccination. Cu deficiency was present in 17% and marginal Se deficiency in 30% of initially sampled cows, while no Zn shortage was detected. Over 120 days, trace element supplementation caused a bigger increase in plasma Se and Cu concentrations, but also a larger decrease of plasma Fe concentrations. A larger increase in milk Se concentrations was observed in the supplemented group, whereas none of the other elements were affected. BCS decreased more over time in the supplemented group. None of the other parameters of performance and antioxidant status nor milk composition or blood biochemistry was affected by treatment. Antibody response to rabies vaccination did not differ between groups, whereas α1-globulins tended to be lower and β-globulins tended to be higher in the supplemented group. In conclusion, despite improved Cu and Se status and Se concentrations in milk, cows on tropical urban dairy farms did not seem to benefit from trace element supplementation, with respect to the parameters investigated. PMID:24990384

  7. ALGUNOS FACTORES RELACIONADOS CON LA DINÁMICA FOLICULAR EN BOS INDICUS SOME FACTORS RELATED TO FOLLICULAR DYNAMICS IN BOS INDICUS

    Directory of Open Access Journals (Sweden)

    Guillermo Henao Restrepo

    2010-12-01

    Full Text Available El desarrollo folicular bovino durante un ciclo estral normal, se caracteriza por un crecimiento en forma de ondas con presencia de dos a cinco cohortes foliculares por ciclo, de las cuales solo un folículo se torna ovulatorio. El crecimiento folicular en forma de ondas también se produce durante el período prepuberal, puberal, primer tercio de la gestación y período de anestro posparto. Aunque existe mucha similitud en el patrón fundamental del desarrollo de ondas foliculares entre Bos taurus y Bos indicus, se han encontrado diferencias en la dinámica folicular que pueden afectar el comportamiento reproductivo y la aplicación de biotecnologías reproductivas. La dinámica folicular puede variar por efectos ambientales y estados fisiológicos de hembras Bos indicus que impiden establecer un patrón específico de dinámica folicular para cada raza y etapa fisiológica. El propósito de esta revisión es analizar la función reproductiva teniendo en cuenta las diferencias de la dinámica folicular entre estados fisiológicos y condiciones ambientales de hembras bovinas con énfasis en B. indicus.The bovine follicular development during a normal estrous cycle, is characterized by a growth in wave form with presence of two to five follicular cohorts by cycle, of which only one follicle ovulate. The follicular growth in wave form also occurs during the prepubertal and pubertal periods, first quarter of the gestation, and in the postpartum anestrous period. Although there is great similarity in the fundamental pattern of the development of follicular waves between Bos taurus and Bos indicus, differences of follicular dynamics has been detected, that can affect the reproductive behavior and the application of reproductive biotechnologies. Follicular dynamics can change by environmental effects and physiological states of Bos indicus females that impede to establish a specific pattern of follicular dynamics for each breed and physiological

  8. Estimulação hormonal, punção folicular transvaginal e avaliação ovocitária em bezerras pré-púberes da raça Nelore (Bos taurus indicus Hormonal stimulation and ultrasound guided transvaginal follicle aspiration and oocyte recovery in Nelore (Bos taurus indicus prepubertal calves

    Directory of Open Access Journals (Sweden)

    Marilia Viviane Snel-Oliveira

    2003-02-01

    Full Text Available O uso de bezerras pré-púberes como doadoras de ovócitos oferece um considerável potencial para acelerar o ganho genético através da diminuição do intervalo de gerações, além de incrementar o aproveitamento de fêmeas bovinas de alto valor genético. Os objetivos deste estudo foram analisar o efeito da idade e do tratamento estimulatório com gonadotrofinas sobre a resposta folicular, a taxa de recuperação, a produção e a avaliação morfológica de ovócitos colhidos em bezerras da raça nelore (B. t. indicus a partir de 10 meses de idade. As bezerras foram distribuídas aleatoriamente em três grupos (n=4 e receberam tratamentos hormonais distintos, repetidos nos mesmos animais nos três períodos, aos 10, 11 e 12 meses de idade. No dia zero (D0, todas as bezerras receberam um implante intravaginal de progesterona e, em D1, 2 mg de benzoato de estradiol intramuscular (im. Em D6, deu-se início à diferenciação dos tratamentos (T: T1- 120 UI de FSH, divididos em quatro aplicações im a cada 12 horas; T2 - 120 UI de FSH, em uma única aplicação subcutânea (sc, mais 300 UI de eCG sc, T3 - sem tratamento estimulatório. No D8, o implante de progesterona foi retirado e a punção folicular transvaginal, guiada por ultra-som (PFTV, foi realizada no D9. Dos 402 ovócitos coletados, 53 foram desnudados e medidos, incluindo a zona pelúcida, encontrando-se um diâmetro médio de 153,38 (8,06 mm. Não houve diferença significativa entre os tratamentos e entre as idades para quantidade de folículos > 3 mm, de ovócitos recuperados e de ovócitos viáveis. A média de ovócitos recuperados e ovócitos viáveis para cada tratamento foi: T1- 11,08 (6,20 e 59,58% (25,80, T2- 12,75 (8,04 e 66,02% (36,71, T3 - 9,66 (8,15 e 51,51% (30,69, respectivamente. O valor médio da taxa de recuperação foi de 78,70%. O uso de FSH e FSH + eCG não aumentou significantemente a quantidade de folículos > 3 mm no momento da PFTV, assim como dos ov

  9. Accuracy of genomic predictions in Bos indicus (Nellore) cattle

    OpenAIRE

    Neves, Haroldo HR; Carvalheiro, Roberto; O’Brien, Ana M Pérez; Utsunomiya, Yuri T; do Carmo, Adriana S; Schenkel, Flávio S; Sölkner, Johann; McEwan, John C; Van Tassell, Curtis P.; Cole, John B; da Silva, Marcos VGB; Queiroz, Sandra A; Tad S. Sonstegard; Garcia, José Fernando

    2014-01-01

    Background Nellore cattle play an important role in beef production in tropical systems and there is great interest in determining if genomic selection can contribute to accelerate genetic improvement of production and fertility in this breed. We present the first results of the implementation of genomic prediction in a Bos indicus (Nellore) population. Methods Influential bulls were genotyped with the Illumina Bovine HD chip in order to assess genomic predictive ability for weight and carcas...

  10. Seminal plasma proteome of electroejaculated Bos indicus bulls.

    Science.gov (United States)

    Rego, J P A; Crisp, J M; Moura, A A; Nouwens, A S; Li, Y; Venus, B; Corbet, N J; Corbet, D H; Burns, B M; Boe-Hansen, G B; McGowan, M R

    2014-07-01

    The present study describes the seminal plasma proteome of Bos indicus bulls. Fifty-six, 24-month old Australian Brahman sires were evaluated and subjected to electroejaculation. Seminal plasma proteins were separated by 2-D SDS-PAGE and identified by mass spectrometry. The percentage of progressively motile and morphologically normal sperm of the bulls were 70.4 ± 2.3 and 64 ± 3.2%, respectively. A total of 108 spots were identified in the 2-D maps, corresponding to 46 proteins. Binder of sperm proteins accounted for 55.8% of all spots detected in the maps and spermadhesins comprised the second most abundant constituents. Other proteins of the Bos indicus seminal plasma include clusterin, albumin, transferrin, metalloproteinase inhibitor 2, osteopontin, epididymal secretory protein E1, apolipoprotein A-1, heat shock 70 kDa protein, glutathione peroxidase 3, cathelicidins, alpha-enolase, tripeptidyl-peptidase 1, zinc-alpha-2-glycoprotein, plasma serine protease inhibitor, beta 2-microglobulin, proteasome subunit beta type-4, actin, cathepsins, nucleobinding-1, protein S100-A9, hemoglobin subunit alpha, cadherin-1, angiogenin-1, fibrinogen alpha and beta chain, ephirin-A1, protein DJ-1, serpin A3-7, alpha-2-macroglobulin, annexin A1, complement factor B, polymeric immunoglobulin receptor, seminal ribonuclease, ribonuclease-4, prostaglandin-H2 d-isomerase, platelet-activating factor acetylhydrolase, and phosphoglycerate kinase 1. In conclusion, this work uniquely portrays the Bos indicus seminal fluid proteome, based on samples from a large set of animals representing the Brahman cattle of the tropical Northern Australia. Based on putative biochemical attributes, seminal proteins act during sperm maturation, protection, capacitation and fertilization. PMID:24889044

  11. Assessment of single nucleotide polymorphisms in genes residing on chromosomes 14 and 29 for association with carcass composition traits in Bos indicus cattle.

    Science.gov (United States)

    Casas, E; White, S N; Riley, D G; Smith, T P L; Brenneman, R A; Olson, T A; Johnson, D D; Coleman, S W; Bennett, G L; Chase, C C

    2005-01-01

    Objective of this study was to assess the association of SNP in the diacylglycerol O-acyltransferase 1 (DGAT1), thyroglobulin (TG), and micromolar calcium-activated neutral protease (CAPN1) genes with carcass composition and meat quality traits in Bos indicus cattle. A population of Brahman calves (n = 479) was developed in central Florida from 1996 to 2000. Traits analyzed were ADG, hip height, slaughter weight, fat thickness, HCW, marbling score, LM area, estimated KPH fat, yield grade, retail yield, sensory panel tenderness score, carcass hump height, and cooked meat tenderness measured as Warner-Bratzler shear force at 7, 14, and 21 d postmortem. Single nucleotide polymorphisms previously reported in the TG and DGAT1 genes were used as markers on chromosome 14. Two previously reported and two new SNP in the CAPN1 gene were used as markers on chromosome 29. One SNP in CAPN1 was uninformative, and another one was associated with tenderness score (P Brahman population than in reported allele frequencies in Bos taurus populations. The results suggest that the use of molecular marker information developed in Bos taurus populations to Bos indicus populations may require development of appropriate additional markers. PMID:15583037

  12. Assessment of single nucleotide polymorphisms in genes residing on chromosomes 14 and 29 for association with carcass composition traits in Bos indicus cattle.

    Science.gov (United States)

    Casas, E; White, S N; Riley, D G; Smith, T P L; Brenneman, R A; Olson, T A; Johnson, D D; Coleman, S W; Bennett, G L; Chase, C C

    2005-01-01

    Objective of this study was to assess the association of SNP in the diacylglycerol O-acyltransferase 1 (DGAT1), thyroglobulin (TG), and micromolar calcium-activated neutral protease (CAPN1) genes with carcass composition and meat quality traits in Bos indicus cattle. A population of Brahman calves (n = 479) was developed in central Florida from 1996 to 2000. Traits analyzed were ADG, hip height, slaughter weight, fat thickness, HCW, marbling score, LM area, estimated KPH fat, yield grade, retail yield, sensory panel tenderness score, carcass hump height, and cooked meat tenderness measured as Warner-Bratzler shear force at 7, 14, and 21 d postmortem. Single nucleotide polymorphisms previously reported in the TG and DGAT1 genes were used as markers on chromosome 14. Two previously reported and two new SNP in the CAPN1 gene were used as markers on chromosome 29. One SNP in CAPN1 was uninformative, and another one was associated with tenderness score (P Brahman population than in reported allele frequencies in Bos taurus populations. The results suggest that the use of molecular marker information developed in Bos taurus populations to Bos indicus populations may require development of appropriate additional markers.

  13. Época de nascimento, genótipo e sexo de terneiros cruzas taurinos e zebuínos sobre o peso ao nascer, à desmama e eficiência individual de primíparas Hereford Calving season, genotype and sex of crossbred taurus and indicus calves on the birth and weaning weight and individual efficiency of primiparous Hereford

    Directory of Open Access Journals (Sweden)

    Gilson de Mendonça

    2003-12-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito da época de nascimento, genótipo e sexo do terneiro sobre a eficiência individual das vacas à desmama (relação percentual entre o peso do terneiro à desmama e o peso da vaca, peso ao nascer e peso à desmama dos terneiros. Foram utilizadas 48 vacas da raça Hereford (Bos taurus, com idade de três anos, manejadas sobre campo natural, 16 inseminadas com um touro da raça Red Angus (Bos taurus e 32 com Nelore (Bos indicus. Os fatores estudados foram genótipo do terneiro (GENOT - Bos taurus x Bos taurus e Bos taurus x Bos indicus, época de nascimento (EPOCN subdividida em três períodos - 1S (setembro, 2O (outubro e 3N (novembro e sexo do terneiro (SEXO. A produção de leite (PL foi incluída como co-variável. Foram realizadas dez medidas de produção de leite pelo método indireto pesagem - mamada - pesagem e onze medidas de peso para vacas e terneiros, em intervalos de 21 dias. Os fatores que influenciaram significativamente o PN foram GENOT e SEXO (PThe objective of the present study was to evaluate the effect of calving season, genotype and calf sex on the cows weaning individual efficiency ( percentual relationship between cow body weight and calf weaning weight, birth and weaning weight of calves. Forty-eight primiparous Hereford cows with approximate average age of 3 years and grazing only native pastures were used. Sixteen inseminated with one Red Angus bull (Bos taurus and 32 with Nelore (Bos indicus. Effects studied were calf genotype (GENOT, Bos taurus x Bos taurus and Bos taurus x Bos indicus, calving season (EPOCN concentrated in the Spring and subdivided into three periods: 1S (September, 2O (October and 3N (November and December and calf sex (SEXO. Milk production (PL was included as co-variable. Ten measurements of milk production obtained by the indirect method, weighing the calf before and after suckling, and eleven measurements of cow and calf weights, were made at 21

  14. Bioanalytical methods for the metalloproteomics study of bovine longissimus thoracis muscle tissue with different grades of meat tenderness in the Nellore breed (Bos indicus).

    Science.gov (United States)

    Baldassini, Welder Angelo; Braga, Camila Pereira; Chardulo, Luis Artur Loyola; Vasconcelos Silva, Josineudson Augusto; Malheiros, Jessica Moraes; de Albuquerque, Lúcia Galvão; Fernandes, Talita Tanaka; Padilha, Pedro de Magalhães

    2015-02-15

    The work describes a metalloproteomics study of bovine muscle tissue with different grades of meat tenderness from animals of the Nellore breed (Bos indicus) based on protein separation by two-dimensional gel electrophoresis, the identification of calcium ions in protein spots by X-ray fluorescence (SR-XRF) and the characterisation of proteins by electrospray ionisation mass spectrometry. Forty (40) specimens were selected and divided into two experimental groups: animals with tough meat (TO) and animals with tender meat (TE). A third group (P) of Piedmontese breed animals (Bos taurus) was included to serve as a comparative model for the level of meat tenderness. The procedures were efficient and preserved the metal-protein structure, enabling calcium detection in protein spots by SR-XRF at a given molecular weight range of 14-97kDa. Two proteins (pyruvate kinase and albumin) were inferred to be related to the phenotypical differences in animals from the different groups.

  15. Physiological responses of newborn Bos indicus and Bos indicus x Bos taurus calves after exposure to cold.

    Science.gov (United States)

    Godfrey, R W; Smith, S D; Guthrie, M J; Stanko, R L; Neuendorff, D A; Randel, R D

    1991-01-01

    Brahman (n = 9) and 1/2 Simmental x 1/4 Brahman x 1/4 Hereford (n = 11) calves were utilized to determine the influence of exposure to cold on the physiology of the neonate. All calves were removed from their dams within 20 min of birth and prior to suckling. Calves were assigned randomly within breed to either a warm (W; 31 degrees C) or cold (C; 4 degrees C) environmental treatment group. Jugular blood samples were collected via indwelling catheters at 20-min intervals for 180 min. At 100 to 120 min of sampling, all calves were given 1.2 liters of colostrum from their dams via stomach tube. At 120 min, C calves were placed in the W environment. Calf vigor score (CVS) and rectal temperature were determined at each time blood was collected. Serum or plasma was analyzed for glucose (GLU), lactate (LAC), blood urea nitrogen (BUN), hemoglobin (HEM), triglyceride (TRG), triiodothyronine (T3), thyroxine (T4), insulin (INS), cortisol (CORT) and nonesterified fatty acid (NEFA) concentration. Rectal temperature was lower (P less than .01) in C Brahman than in W Brahman and C or W crossbred calves. Crossbred calves had higher (P less than .01) CVS than Brahman calves. Calves in W had lower (P less than .01) GLU than C calves. Brahman calves had higher GLU, LAC, BUN, TRG, T3, T4 and CORT (P less than .05) than crossbred calves. The C Brahman calves had the highest (P less than .05) TRG, CORT, T3 and T4 of all groups. Concentration of NEFA were higher (P less than .01) in C than in W calves.(ABSTRACT TRUNCATED AT 250 WORDS) PMID:2005021

  16. Physiological responses of newborn Bos indicus and Bos indicus x Bos taurus calves after exposure to cold.

    Science.gov (United States)

    Godfrey, R W; Smith, S D; Guthrie, M J; Stanko, R L; Neuendorff, D A; Randel, R D

    1991-01-01

    Brahman (n = 9) and 1/2 Simmental x 1/4 Brahman x 1/4 Hereford (n = 11) calves were utilized to determine the influence of exposure to cold on the physiology of the neonate. All calves were removed from their dams within 20 min of birth and prior to suckling. Calves were assigned randomly within breed to either a warm (W; 31 degrees C) or cold (C; 4 degrees C) environmental treatment group. Jugular blood samples were collected via indwelling catheters at 20-min intervals for 180 min. At 100 to 120 min of sampling, all calves were given 1.2 liters of colostrum from their dams via stomach tube. At 120 min, C calves were placed in the W environment. Calf vigor score (CVS) and rectal temperature were determined at each time blood was collected. Serum or plasma was analyzed for glucose (GLU), lactate (LAC), blood urea nitrogen (BUN), hemoglobin (HEM), triglyceride (TRG), triiodothyronine (T3), thyroxine (T4), insulin (INS), cortisol (CORT) and nonesterified fatty acid (NEFA) concentration. Rectal temperature was lower (P less than .01) in C Brahman than in W Brahman and C or W crossbred calves. Crossbred calves had higher (P less than .01) CVS than Brahman calves. Calves in W had lower (P less than .01) GLU than C calves. Brahman calves had higher GLU, LAC, BUN, TRG, T3, T4 and CORT (P less than .05) than crossbred calves. The C Brahman calves had the highest (P less than .05) TRG, CORT, T3 and T4 of all groups. Concentration of NEFA were higher (P less than .01) in C than in W calves.(ABSTRACT TRUNCATED AT 250 WORDS)

  17. Toxoplasma gondii in experimentally infected Bos taurus and Bos indicus semen and tissues Toxoplasma gondii em semen e tecidos de Bos taurus and Bos indicus experimentalmente infectados

    Directory of Open Access Journals (Sweden)

    Leslie Scarpelli

    2009-01-01

    Full Text Available Eighteen young steers were inoculated with Toxoplasma gondii and randomly distributed into three groups of six animals each: GI, 2.5x10(5 "P" strain oocysts, GII, 5.0x10(6 "RH" strain tachyzoites, and GIII (Control. Clinical, serological and parasitemia exams were realized. Parasite investigation by bioassay and PCR was realized on semen and fragments of skeletal musculature, lymph nodes, brain, retina, spleen, liver, lung, testicle, epididymis and seminal vesicle. Blood and semen samples were collected on days -2, -1, 1, 3, 5, 7, 14 and weekly thereafter, up to postinfection day (PID 84. The inoculated steers (GI and GII presented hyperthermia from PID 3 to 16. Antibodies against T. gondii were detected through the indirect fluorescence antibody test (IFAT on PID 5 (1:16 in both inoculated groups (oocysts and tachyzoites, reaching peaks of 1:4096 on PID 7. Parasitemia outbursts occurred in all infected bovines, principally from PID 7 to 28, independent of the strain and inoculate used. Bioassays revealed the presence of parasites in semen samples of animals infected with oocysts (GI and tachyzoites (GII on several experimental days between PID 7 and 84. Tissue parasitism by T. gondii was diagnosed by bioassay and the PCR technique in several organ and tissue fragments. These findings suggest the possibility of sexual transmission of T. gondii in the bovine species.Dezoito bovinos foram inoculados com Toxoplasma gondii e distribuídos aleatoriamente em três grupos de seis bovinos cada: GI (2,5x10(5 oocistos da cepa "P", GII (5,0x10(6 taquizoítos da cepa "RH" e GIII (controle. Exames clínicos, sorológicos e parasitêmicos foram realizados. Pesquisas do parasito, por meio da bioprova e pela técnica de Reação em Cadeia pela Polimerase (PCR, foram realizadas no sêmen e em fragmentos de musculatura esquelética, linfonodos, cérebro, retina, baço, fígado, pulmão, testículo, epidídimo e vesícula seminal. Amostras de sangue e sêmen foram colhidas nos dias -2, -1, 1, 3, 5, 7, 14 e, semanalmente, até o 84º dia pós-infecção (DPI. Os bovinos inoculados (GI e GII apresentaram hipertermia do 3º ao 16º DPI. Anticorpos contra T. gondii foram detectados (IFI no 5º DPI (1:16, em ambos grupos inoculados (oocistos e taquizoítos, atingindo picos de 1:4096 no 7º DPI. Surtos parasitêmicos ocorreram em todos os bovinos infectados, principalmente do 7º ao 28º DPI, independente da cepa e inóculo utilizados. O bioensaio revelou a presença do parasito em amostras seminais dos bovinos infectados com oocistos (GI e taquizoítos (GII, em diversas datas experimentais, entre o 7º e 84º DPI. Parasitismo tissular por T. gondii foi diagnosticado por meio da bioprova e pela técnica da PCR, em vários fragmentos de tecidos e/ou órgãos. Os achados sugerem a possibilidade da ocorrência da transmissão sexual do T. gondii na espécie bovina.

  18. Sarcocystis heydorni, n. sp. (Apicomplexa: Protozoa) with cattle (Bos taurus) and human (Homo sapiens) cycle

    Science.gov (United States)

    Cattle (Bos taurus) are intermediate hosts for four species of Sarcocystis, S. cruzi, S. hirsuta, S. hominis, and S. rommeli. Of these four species, mature sarcocysts of S. cruzi are thin-walled (< 1µm) whereas S. hirsuta, S. hominis, and S. rommeli have thick walls (4 µm or more). Here we describe ...

  19. A whole-genome assembly of the domestic cow, Bos taurus

    Science.gov (United States)

    Background: The genome of the domestic cow, Bos taurus, was sequenced using a mixture of hierarchical and whole-genome shotgun sequencing methods. Results: We have assembled the 35 million sequence reads and applied a variety of assembly improvement techniques, creating an assembly of 2.86 billion b...

  20. History and economic importance of cattle (Bos taurus L.) in Switzerland from neolithic to early middle ages

    OpenAIRE

    Schibler, J.; Schlumbaum, A.

    2007-01-01

    In Switzerland domestic cattle (Bos primigenius f. taurus resp. Bos taurus L.) first appear with the earliest Neolithic settlements (similar to 5000 BC). With the gradual deforestation of the landscape caused by human exploitation of the environment, cattle were used more intensive and in many ways. There is evidence that cattle were used as draught animal since ca. 3400 BC, probably even earlier milk was regularly used. The size of domestic cattle gradually decreased from Early Neolithic unt...

  1. Genome-Wide Detection and Characterization of Endogenous Retroviruses in Bos taurus

    OpenAIRE

    Garcia-Etxebarria, Koldo; Jugo, Begoña Marina

    2010-01-01

    Endogenous retroviruses (ERVs) are the proviral phase of exogenous retroviruses that become integrated into a host germ line. They can play an important role in the host genome. Bioinformatic tools have been used to detect ERVs in several vertebrates, primarily primates and rodents. Less information is available regarding ERVs in other mammalian groups, and the source of this information is basically experimental. We analyzed the genome of the cow (Bos taurus) using three different methods. A...

  2. Candidate SNPs for carcass and meat traits in Nelore animals and in their crosses with Bos taurus

    Directory of Open Access Journals (Sweden)

    Rogério Abdallah Curi

    2012-02-01

    Full Text Available The objective of this work was to evaluate the effects of single-nucleotide polymorphisms (SNPs in the genes IGF1 (AF_017143.1:g.198C>T, MSTN (AF_320998.1:g.433C>A, MYOD1 (NC_007313:g.1274A>G and MYF5 (NC_007303:g.1911A>G on carcass and meat traits in Nelore (Bos indicus and Nelore x B. taurus. A total of 300 animals were genotyped and phenotyped for rib eye area (REA, backfat thickness (BT, intramuscular fat (IF, shear force (SF and myofibrillar fragmentation index (MFI. The effects of allele substitution for each SNP were estimated by regression of the evaluated phenotypes on the number of copies of a particular allele using the general linear model. The polymorphism at IGF1 was non-informative in Nelore animals. In crossbred animals, the IGF1 C allele was associated with greater REA. However, this relation was not significant after Bonferroni correction for multiple testing. The A allele of the MSTN polymorphism was absent in Nelore cattle and was only found in two crossbred animals. The polymorphisms of MYOD1 and MYF5 were little informative in Nelore animals with G allele frequency of 0.097 and A allele frequency of 0.031, respectively. These markers show no association with the analyzed traits in the total sample of evaluated animals.

  3. Kappa-casein gene study in Iranian Sistani cattle breed (Bos indicus) using PCR-RFLP.

    Science.gov (United States)

    Rohallah, Alinaghizadeh; Mohammadreza, Mohammad Abadi; Shahin, Moradnasab Badrabadi

    2007-12-01

    In cattle, caseins are subdivided into four main groups: alphaS1-, alphaaS2-, beta- and kappa-caseins. kappa-caseins (CSN2) considerably differ from other caseins in structure and other properties. Testing the A and B alleles is of practical importance, because the milk of cows that carry the B allele of CSN3 has a better thermal resistance and shorter coagulation time, better curdles and contains micelles of different sizes. Iranian Sistani cattle (Bos indicus) are a heavy built breed and used as dual-purpose cattle breed in Eastern Iran. This breed is a genetic resource that shows special features of adaptation to rustic environments. One of the most distinctive features of Sistani cattle is its great capability to resist diseases which makes it a potential reservoir of germplasm useful for future crosses. Our main goal was to study DNA-polymorphism of the CSN3 gene in the Iranian Sistani native cattle (Bos indicus) and analyze the information value of CSN3 gene polymorphism as a genetic marker. We genotyped and analyzed 65 animals of this breed using PCR-RFLP. The frequencies of A and B alleles were 0.6385 and 0.3615 and those of AA, AB and BB genotypes were 0.4000, 0.4769 and 0.1231, respectively. In the Sistani Zebu breed, frequency of B allele is higher than other Zebu breeds, indicating that intensive selection for dairy production have been done and indirectly influenced CSN3 allele frequencies.

  4. Heat tolerance in two tropically adapted Bos taurus breeds, Senepol and Romosinuano, compared with Brahman, Angus, and Hereford cattle in Florida.

    Science.gov (United States)

    Hammond, A C; Olson, T A; Chase, C C; Bowers, E J; Randel, R D; Murphy, C N; Vogt, D W; Tewolde, A

    1996-02-01

    Two trials were conducted with heifers to determine heat tolerance among temperate Bos taurus (Angus, Hereford), Bos indicus (Brahman), tropical Bos taurus (Senepol, Romosinuano), and the reciprocal crosses of Hereford and Senepol. Differences among breeds in temperament score, circulating concentrations of cortisol, and blood packed cell volume were also investigated. Trial 1 used 43 Angus, 28 Brahman, 12 Hereford, 23 Romosinuano, 16 Senepol, 5 Hereford x Senepol (H x S), and 5 Senepol x Hereford (S x H) heifers. Trial 2 used 36 Angus, 31 Brahman, 9 Hereford, 14 Senepol, 19 H x S, and 10 S x H heifers. On the hottest summer date in Trial 1, rectal temperature of Angus was greater (P Brahman, Senepol, or Romosinuano. Rectal temperature and plasma cortisol were significantly less in Senepol than in Brahman, suggesting that the differences in rectal temperature between these breeds may be due to differences in stress response possibly related to differences in temperament. Reciprocal crosses of Hereford and Senepol had rectal temperatures nearly as low as that of Senepol and displayed substantial heterosis (-9.4%, P Brahman, Romosinuano, or Senepol heifers, and Brahman had significantly slower respiration rates than Romosinuano or Senepol. On the hottest summer date in Trial 2, rectal temperature in Angus heifers was greater (P Brahman or Senepol had rectal temperatures similar to that of Senepol, or heterosis for log10 rectal temperature was similar to that in Trial 1 (-9.8%, P Brahman always had the slowest respiration rate and greatest packed cell volume. Brahman had significantly greater temperament scores and plasma cortisol concentrations than Angus or Senepol, except that plasma cortisol was not different between Brahman and Senepol on the hottest summer date. On this date, rectal temperature did not differ between Brahman and Senepol, which supports the hypothesis that there is a relationship between response to stress and rectal temperature that helps

  5. The Effect of Myogenic Factor 5 Polymorphism on the Meat Quality in Chinese Bos Taurus

    Directory of Open Access Journals (Sweden)

    J. A. Ujan

    2011-12-01

    Full Text Available In the present study, we evaluated polymorphism of myogenic factor 5, involved in growth and meat quality traits. Based on PCR-SSCP technology, a novel missense substitution SNP (single-nucleotide polymorphism g.1142 A > G was identified in the intron1 region of the MyF-5 gene, it causes an amino acid substitution (1142Glutamine/ Glycine1142. Allele frequencies, gene heterozygosity, effective allele number and polymorphism information content of the bovine MyF-5 SNP in three population breeds were determined and evaluated by the χ2 test. Results showed that the polymorphism distribution was not similar in all of the three Bos taurus breeds, the genotype distributions of two cattle breeds Jia xian red and Nanyang did not agree with Hardy–Weinberg equilibrium (P 0.05. The A/G allelic frequencies in these breeds were 0.797/0.202, 0.770/0.229, 0.863/0.136 respectively. The genotype frequencies in Jia xian red and Nanyang cattle breeds showed moderate diversity (0.25< polymorphism information content <0.5. Furthermore, least squares analysis revealed significant effects of genotype on intramuscular fat, rib area and water holding capacity in 510 individuals (P < 0.05. Our result suggests that A1142G SNP can be used as an efficacious genetic marker for meat quality traits in native Chinese cattle breeds (Bos taurus but a much large number of animals are required for Marker assisted selection.

  6. Hormonal induction of estrous cycles in anestrous Bos taurus beef cows.

    Science.gov (United States)

    Day, M L

    2004-07-01

    A significant proportion of postpartum beef cows are anestrus at the onset of the breeding season. Much progress has been made in understanding anestrus and the changes that lead to spontaneous resumption of reproductive function. Likewise, knowledge regarding the impact of hormonal interventions on the endocrine and ovarian changes normally associated with spontaneous resumption of estrous cycles continue to accumulate. A wide range of hormonal treatment programs designed to induce estrous cycles in anestrous cows to coincide with the start of the breeding season have been developed. Programs structured to provide for increased progesterone, estradiol and LH concentrations at the appropriate times during the period leading to the first ovulation, and an induced preovulatory gonadotropin surge when the dominant ovarian follicle is of appropriate maturity have been demonstrated to induce estrous cycles of normal duration and acceptable fertility in a majority of anestrous, Bos taurus beef cows.

  7. DGAT1 and ABCG2 polymorphism in Indian cattle (Bos indicus and buffalo (Bubalus bubalis breeds

    Directory of Open Access Journals (Sweden)

    Mishra Bina

    2006-11-01

    Full Text Available Abstract Background Indian cattle (Bos indicus and riverine buffalo (Bubalus bubalis give a poor yield of milk but it has a high fat and protein percentage compared to taurine cattle. The identification of QTLs (Quantitative Trait Loci on BTA14 and BTA6 and its subsequent fine mapping has led to identification of two non conservative mutations affecting milk production and composition. Our objective was to estimate the frequency of K232A (DGAT1 – diacylglycerol – acyltransferase 1 and Y581S (ABCG2 – ATP binding cassette sub family G member 2 polymorphisms in diverse cattle and buffalo breeds of India having large variation in terms of milk production. Results We screened the reported missense mutations in six cattle and five buffalo breeds. The DGAT1K and ABCG2Y alleles were found to be fixed in Indian cattle and buffalo breeds studied. Conclusion This study provides an indirect evidence that all the Indian cattle and buffalo breeds have fixed alleles with respect to DGAT1 and ABCG2 genes reported to be responsible for higher milk fat yield, higher fat and protein percent.

  8. Pleiotropic Genes Affecting Carcass Traits in Bos indicus (Nellore) Cattle Are Modulators of Growth

    Science.gov (United States)

    Milanesi, Marco; Torrecilha, Rafaela B. P.; Carmo, Adriana S.; Neves, Haroldo H. R.; Carvalheiro, Roberto; Ajmone-Marsan, Paolo; Sonstegard, Tad S.; Sölkner, Johann; Contreras-Castillo, Carmen J.; Garcia, José F.

    2016-01-01

    Two complementary methods, namely Multi-Trait Meta-Analysis and Versatile Gene-Based Test for Genome-wide Association Studies (VEGAS), were used to identify putative pleiotropic genes affecting carcass traits in Bos indicus (Nellore) cattle. The genotypic data comprised over 777,000 single-nucleotide polymorphism markers scored in 995 bulls, and the phenotypic data included deregressed breeding values (dEBV) for weight measurements at birth, weaning and yearling, as well visual scores taken at weaning and yearling for carcass finishing precocity, conformation and muscling. Both analyses pointed to the pleomorphic adenoma gene 1 (PLAG1) as a major pleiotropic gene. VEGAS analysis revealed 224 additional candidates. From these, 57 participated, together with PLAG1, in a network involved in the modulation of the function and expression of IGF1 (insulin like growth factor 1), IGF2 (insulin like growth factor 2), GH1 (growth hormone 1), IGF1R (insulin like growth factor 1 receptor) and GHR (growth hormone receptor), suggesting that those pleiotropic genes operate as satellite regulators of the growth pathway. PMID:27410030

  9. Pleiotropic Genes Affecting Carcass Traits in Bos indicus (Nellore Cattle Are Modulators of Growth.

    Directory of Open Access Journals (Sweden)

    Anirene G T Pereira

    Full Text Available Two complementary methods, namely Multi-Trait Meta-Analysis and Versatile Gene-Based Test for Genome-wide Association Studies (VEGAS, were used to identify putative pleiotropic genes affecting carcass traits in Bos indicus (Nellore cattle. The genotypic data comprised over 777,000 single-nucleotide polymorphism markers scored in 995 bulls, and the phenotypic data included deregressed breeding values (dEBV for weight measurements at birth, weaning and yearling, as well visual scores taken at weaning and yearling for carcass finishing precocity, conformation and muscling. Both analyses pointed to the pleomorphic adenoma gene 1 (PLAG1 as a major pleiotropic gene. VEGAS analysis revealed 224 additional candidates. From these, 57 participated, together with PLAG1, in a network involved in the modulation of the function and expression of IGF1 (insulin like growth factor 1, IGF2 (insulin like growth factor 2, GH1 (growth hormone 1, IGF1R (insulin like growth factor 1 receptor and GHR (growth hormone receptor, suggesting that those pleiotropic genes operate as satellite regulators of the growth pathway.

  10. Comportamento de vacas da raça Gir (Bos taurus indicus em estro Estrus behaviour in Gir cows (Bos taurus indicus

    Directory of Open Access Journals (Sweden)

    M.F. Ávila Pires

    2003-04-01

    Full Text Available O comportamento de vacas da raça Gir em estro e a concentração plasmática de progesterona foram avaliadas durante um estro induzido e o natural subseqüente, em 35 animais da raça Gir, no inverno e no verão de dois anos consecutivos. Observou-se efeito de interação entre estação e ano do experimento sobre a duração do ciclo estral. O proestro foi maior no verão (51,82± 4,77h do que no inverno (33,43± 4,82h e no estro natural (64,41± 4,95h do que no induzido (20,85± 4,64h. Observou-se menor duração da atividade sexual total no estro induzido do que no natural (41,62± 4,81 vs 94,83± 4,56h no inverno, e 64,00± 4,14 vs 127,44± 4,04h no verão. A duração do estro foi similar no inverno (12,33± 0,74h e no verão (11,82± 0,74h, e maior nas vacas sincronizadas (13,24± 0,70 vs 10,91± 0,78h. O número de montas recebidas durante o estro foi similar no inverno (28,16± 2,61 e no verão (22,98± 2,58 e maior nos animais sincronizados (29,97± 2,48 vs 21,17± 2,17. Observou-se efeito de interação entre estação e tipo de luteólise sobre o número de montas recebidas por hora em estro. O inverno não se constituiu em fator limitante à manifestação do estro, cuja duração e intensidade foram suficientes para permitir sua detecção; contudo, a sincronização dos estros interferiu com a manifestação do comportamento sexual.The estrus behaviour and the plasma progesterone concentration were monitored during an induced and a natural subsequent estrus, in 35 Gir cows, during the winter and summer seasons of two consecutives years. The length of estrous cycle was influenced by the interaction between season and experimental year. The proestrus period was longer in the summer (51.82± 4.77h compared to the one in the winter (33.43± 4.82h season as far as in the natural (64.41± 4.95h vs in the induced estrus (20.85± 4.64h. The total sexual activity was shorter in the induced than in the natural estrus (41.62± 4.81 vs 94.83± 4.56h in the winter, and 64.00± 4.14 vs 127.44± 4.04h in the summer. The length of estrus was similar between winter (12.33± 0.74h and summer (11.82± 0.74h, and longer in the synchronized cows (13.24± 0.70 vs 10.91± 0.78h. The number of mounts accepted during the estrus was similar between winter (28.16± 2.61 and summer (22.98± 2.58, and greater in the synchronized animals (29.97± 2.48 vs 21.17± 2.17. It was observed effect of interaction between season of the year and luteolysis type on the total received mountings per hour in estrus. The winter was not a limiting factor to the estrus manifestation, once its length and intensity allowed heat detection, however, heat synchronization meddled the manifestation of sexual behaviour.

  11. The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla

    Science.gov (United States)

    Ballarin, Cristina; Povinelli, Michele; Granato, Alberto; Panin, Mattia; Corain, Livio; Peruffo, Antonella; Cozzi, Bruno

    2016-01-01

    The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ), and Cerebellar Quotient (CQ). Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla) indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes. PMID:27128674

  12. Embryonic development of the bovine pineal gland (Bos taurus) during prenatal life (30 to 135 days of gestation)

    OpenAIRE

    Regodón, S.; Roncero, V

    2005-01-01

    The ontogenesis of the pineal gland of 30 bovine embryos (Bos taurus) has been analysed from 30 until 135 days of gestation by means of optical microscopy and immunohistochemical techniques. For this study, the specimens were grouped into three stages in accordance with the most relevant histological characteristics: Stage 1 (30 to 64 days of prenatal development); Stage 2 (70 to 90 days) and Stage 3 (106 to 135 days). In the cow, it is from 30 days of gestatio...

  13. The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

    Science.gov (United States)

    Ballarin, Cristina; Povinelli, Michele; Granato, Alberto; Panin, Mattia; Corain, Livio; Peruffo, Antonella; Cozzi, Bruno

    2016-01-01

    The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ), and Cerebellar Quotient (CQ). Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla) indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes. PMID:27128674

  14. Mutagenic Potential ofBos taurus Papillomavirus Type 1 E6 Recombinant Protein: First Description

    Directory of Open Access Journals (Sweden)

    Rodrigo Pinheiro Araldi

    2015-01-01

    Full Text Available Bovine papillomavirus (BPV is considered a useful model to study HPV oncogenic process. BPV interacts with the host chromatin, resulting in DNA damage, which is attributed to E5, E6, and E7 viral oncoproteins activity. However, the oncogenic mechanisms of BPV E6 oncoprotein per se remain unknown. This study aimed to evaluate the mutagenic potential of Bos taurus papillomavirus type 1 (BPV-1 E6 recombinant oncoprotein by the cytokinesis-block micronucleus assay (CBMNA and comet assay (CA. Peripheral blood samples of five calves were collected. Samples were subjected to molecular diagnosis, which did not reveal presence of BPV sequences. Samples were treated with 1 μg/mL of BPV-1 E6 oncoprotein and 50 μg/mL of cyclophosphamide (positive control. Negative controls were not submitted to any treatment. The samples were submitted to the CBMNA and CA. The results showed that BPV E6 oncoprotein induces clastogenesis per se, which is indicative of genomic instability. These results allowed better understanding the mechanism of cancer promotion associated with the BPV E6 oncoprotein and revealed that this oncoprotein can induce carcinogenesis per se. E6 recombinant oncoprotein has been suggested as a possible vaccine candidate. Results pointed out that BPV E6 recombinant oncoprotein modifications are required to use it as vaccine.

  15. Genome-wide detection and characterization of endogenous retroviruses in Bos taurus.

    Science.gov (United States)

    Garcia-Etxebarria, Koldo; Jugo, Begoña Marina

    2010-10-01

    Endogenous retroviruses (ERVs) are the proviral phase of exogenous retroviruses that become integrated into a host germ line. They can play an important role in the host genome. Bioinformatic tools have been used to detect ERVs in several vertebrates, primarily primates and rodents. Less information is available regarding ERVs in other mammalian groups, and the source of this information is basically experimental. We analyzed the genome of the cow (Bos taurus) using three different methods. A BLAST-based method detected 928 possible ERVs, LTR_STRUC detected 4,487 elements flanked by long terminal repeats (LTRs), and Retrotector detected 9,698 ERVs. The ERVs were not homogeneously distributed across chromosomes; the number of ERVs was positively correlated with chromosomal size and negatively correlated with chromosomal GC content. The bovine ERVs (BoERVs) were classified into 24 putative families, with 20 of them not previously described. One of these new families, BoERV1, was the most abundant family and appeared to be specific to ruminants. An analysis of representatives of ERV families from rodents, primates, and ruminants showed a phylogenetic relationship following their hosts' relationships. This study demonstrates the importance of using multiple methods when trying to identify new ERVs and shows that the number of bovine ERV families is not as limited as previously thought. PMID:20686017

  16. Bovine Genome Database: new tools for gleaning function from the Bos taurus genome.

    Science.gov (United States)

    Elsik, Christine G; Unni, Deepak R; Diesh, Colin M; Tayal, Aditi; Emery, Marianne L; Nguyen, Hung N; Hagen, Darren E

    2016-01-01

    We report an update of the Bovine Genome Database (BGD) (http://BovineGenome.org). The goal of BGD is to support bovine genomics research by providing genome annotation and data mining tools. We have developed new genome and annotation browsers using JBrowse and WebApollo for two Bos taurus genome assemblies, the reference genome assembly (UMD3.1.1) and the alternate genome assembly (Btau_4.6.1). Annotation tools have been customized to highlight priority genes for annotation, and to aid annotators in selecting gene evidence tracks from 91 tissue specific RNAseq datasets. We have also developed BovineMine, based on the InterMine data warehousing system, to integrate the bovine genome, annotation, QTL, SNP and expression data with external sources of orthology, gene ontology, gene interaction and pathway information. BovineMine provides powerful query building tools, as well as customized query templates, and allows users to analyze and download genome-wide datasets. With BovineMine, bovine researchers can use orthology to leverage the curated gene pathways of model organisms, such as human, mouse and rat. BovineMine will be especially useful for gene ontology and pathway analyses in conjunction with GWAS and QTL studies.

  17. Effects of temperament and acclimation to handling on reproductive performance of Bos taurus beef females.

    Science.gov (United States)

    Cooke, R F; Bohnert, D W; Cappellozza, B I; Mueller, C J; Delcurto, T

    2012-10-01

    Two experiments evaluated the effects of temperament and acclimation to handling on reproductive performance of Bos taurus beef females. In Exp. 1, 433 multiparous, lactating Angus × Hereford cows were sampled for blood and evaluated for temperament before the breeding season. Cow temperament was assessed by chute score and exit velocity. Chute score was assessed on a 5-point scale according to behavioral responses during chute restraining. Exit score was calculated by dividing exit velocity into quintiles and assigning cows with a score from 1 to 5 (1 = slowest, 5 = fastest cows). Temperament score was calculated by averaging chute and exit scores. Cows were classified for temperament type according to temperament score (≤ 3 = adequate, > 3 = aggressive). Plasma cortisol concentrations were greater (P temperament. Cows with aggressive temperament had reduced (P ≤ 0.05) pregnancy and calving rate and tended to have reduced (P = 0.09) weaning rate compared with cows with adequate temperament. Hence, kilogram of calf born per cow was reduced (P = 0.05) and kilogram of calf weaned per cow tended to be reduced (P = 0.08) in aggressive cows. In Exp. 2, 88 Angus × Hereford heifers (initial age = 206 ± 2 d) were weighed (d 0 and 10) and evaluated for temperament score (d 10). On d 11, heifers were ranked by these variables and assigned to receive or not (control) an acclimation treatment. Acclimated heifers were processed through a handling facility 3 times weekly for 4 wk (d 11 to 39; Mondays, Wednesdays, and Fridays), whereas control heifers remained undisturbed on pasture. Heifer puberty status, evaluated via plasma progesterone concentrations, was assessed on d 0 and 10, d 40 and 50, 70 and 80, 100 and 110, 130 and 140, 160 and 170, and 190 and 200. Blood samples collected on d 10 and 40 were also analyzed for plasma concentrations of cortisol and haptoglobin. Temperament score was assessed again on d 40 and d 200. Acclimated heifers had reduced (P = 0

  18. Comparison of proximate chemical composition and texture of cupim, Rhomboideus m. and lombo, Longissimus dorsi m. of Nelore (Bos indicus

    Directory of Open Access Journals (Sweden)

    Mayka Reghiany Pedrão

    2009-06-01

    Full Text Available The proximate chemical composition of hump, known in Brazil as cupim, Rhomboideus m. (RB, of Nelore (Bos indicus aged 24 months revealed it to be a unique beef muscle. It presents a lipid fraction 14-fold as high as that of Longissimus dorsi m. (LD taken from the same animal (pA composição química percentual aproximada do cupim m. Rhomboideus (RB derivado de Nelore (Bos indicus de 24 meses de idade mostrou ser um músculo diferenciado. Há uma maior fração de material lipídico em RB chegando a ser 14 vezes proporcionalmente maior em comparação ao m. Longissimus dorsi (LD (p<0,05 a maior quantidade de gordura relatada em amostras de carne em literatura científica. Esse fato foi também observado pela avaliação histológica. Há proporcionalmente maior concentração da fração protéica e menor quantidade de umidade em RB. O teor de colágeno foi de 22,9% mais concentrado em RB enquanto que a quantidade da sua ligação cruzada, hidroxilisilpiridinolina (HP foi 14 vezes maior indicando que cupim seria mais rígido. Contrariando essa expectativa, a maciez da carne crua avaliada pelo texturômetro mostrou valores de 8.05 e 5.81 kg/F para LD e RB, respectivamente (p<0.05. Tais resultados mostram que em músculo contendo abundante gordura esta funciona como lubrificante para a lamina penetrar sem muita resistência através do cupim a despeito dar quantidade e qualidade das fibras de colágeno.

  19. A novel application of ecological analyses to assess transposable element distributions in the genome of the domestic cow, Bos taurus.

    Science.gov (United States)

    Saylor, Brent; Elliott, Tyler A; Linquist, Stefan; Kremer, Stefan C; Gregory, T Ryan; Cottenie, Karl

    2013-09-01

    Transposable elements (TEs) are among the most abundant components of many eukaryotic genomes. Efforts to explain TE abundance, as well as TE diversity among genomes, have led some researchers to draw an analogy between genomic and ecological processes. Adopting this perspective, we conducted an analysis of the cow (Bos taurus) genome using techniques developed by community ecologists to determine whether environmental factors influence community composition. Specifically, each chromosome within the Bos taurus genome was treated as a "linear transect", and a multivariate redundancy analysis (RDA) was used to identify large-scale spatial patterns in TE communities associated with 10 TE families. The position of each TE community on the chromosome accounted for ∼50% of the variation along the chromosome "transect". Multivariate analysis further revealed an effect of gene density on TE communities that is influenced by several other factors in the (genomic) environment, including chromosome length and TE density. The results of this analysis demonstrate that ecological methods can be applied successfully to help answer genomic questions.

  20. Different true-protein sources do not modify the metabolism of crossbred Bos taurus × Bos indicus growing heifers

    Directory of Open Access Journals (Sweden)

    Diego Azevedo Mota

    2015-02-01

    Full Text Available The present study was conducted to investigate the effect of alternative true-protein sources to soybean meal, with different ruminal degradability, using a sugarcane-based diet, on nutrient digestion, ruminal fermentation, efficiency of microbial protein synthesis and passage rate in prepubertal dairy heifers. Eight crossbred rumen- and duodenum-cannulated Holstein × Gyr dairy heifers (202.0±11.5 kg BW were evaluated in a 4 × 4 Latin square experimental design with four treatments and four periods in two simultaneous replicates. Dietary treatments were: soybean meal; cottonseed meal; peanut meal; and sunflower meal. When associated with diets containing sugarcane, the different protein sources did not affect intake or digestibility of dry mater, crude protein, organic matter and neutral detergent fiber. The average ruminal pH, NH3-N and concentration of total volatile fatty acids were not different among the diets supplied. The concentration of butyric acid was different among the protein sources, wherein the animals fed the diet with sunflower meal presented lower values than those fed the other sources. Diets did not affect nitrogen balance, microbial nitrogen, microbial synthesisefficiency, estimated dry matter flow, or passage rate. Alternative protein sources can be used to reduce the costs without changing the animal metabolism.

  1. Different true-protein sources do not modify the metabolism of crossbred Bos taurus × Bos indicus growing heifers

    OpenAIRE

    Diego Azevedo Mota; Juliana Duarte Messana; Roberta Carrilho Canesin; Giovani Fiorentini; Alexandre Vaz Pires; Telma Teresinha Berchielli

    2015-01-01

    The present study was conducted to investigate the effect of alternative true-protein sources to soybean meal, with different ruminal degradability, using a sugarcane-based diet, on nutrient digestion, ruminal fermentation, efficiency of microbial protein synthesis and passage rate in prepubertal dairy heifers. Eight crossbred rumen- and duodenum-cannulated Holstein × Gyr dairy heifers (202.0±11.5 kg BW) were evaluated in a 4 × 4 Latin square experimental design with four treatments and four ...

  2. Molecular characterization of Cryptosporidium spp. in calves (Bos taurus and Bos indicus in the Formiga city, Minas Gerais - Brazil

    Directory of Open Access Journals (Sweden)

    Roberto César Araujo Lima

    2014-02-01

    Full Text Available Cryptosporidiosis is a waterborne disease, has as aggravating the difficulty of preventing environmental contamination and lack of effective therapeutic measures. With marked importance to the cattle, causes inflammation and intestinal villous atrophy resulting in loss of absorptive surface. This study aimed to perform molecular characterization of Cryptosporidium spp. in calves in the city of Formiga, Minas Gerais. A total of 300 faeces samples from Holstein calves, Nelore and indefinite breed, both healthy, were evaluated by negative contrast staining technique of malachite green and through the reaction of nested PCR for amplification of DNA fragments of the 18S subunit of the RNA gene ribosomal. Occurrence of 5.33 % ( 16/300 for malachite green and 4.66 % ( 14/300 by PCR was observed, whereas no correlation was found between positive and variables studied. Through molecular characterization were identified Cryptosporidium andersoni and Cryptosporidium ryanae species. In conclusion, we observed a low incidence of infection and elimination of Cryptosporidium spp. oocysts, the absence of clinical signs in animals, strong agreement between the results obtained by the two techniques. Beyond, with the molecular characterization ( nested PCR , species of C. andersoni and C. ryanae were diagnosed in age groups not present in the literature. These two species of Cryptosporidium are described above for the first time parasitizing cattle in the state of Minas Gerais.

  3. Identity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus) and the suppression of Sarcocystis sinensis as a nomen nudum

    Science.gov (United States)

    There are uncertainties concerning the identity and host species specificity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus). Currently, in cattle three species are recognized with known endogenous stages, viz.: S. cruzi (with canine definitive host), S. hirsuta...

  4. Chemical sterilisation of Bos indicus bull calves following intratesticular injection of zinc acetate: effects on semen quality and testicular changes.

    Science.gov (United States)

    Cavalieri, J; Wang, M; Johnson, L

    2015-05-01

    The aim of this study was to determine the effects in Bos indicus bull calves of intratesticular administration of 1mL of either saline (n=9) or one of the two doses of zinc acetate (ZA1, 57.75mg, n=10 or ZA2, 71.75mg, n=10) on semen quality and testicular changes. Semen was collected by electroejaculation on Days 343, 524 and 783 and animals were slaughtered on Day 860. Treatment reduced median maximum number of progressively motile and morphologically normal sperm collected (P=0.001) and the percentage of animals in which sperm were recovered (saline: 100%, 9/9; ZA1: 44.9%, 4/9 and ZA2: 40.0%, 4/10; P=0.013). Compared to saline treated controls, treatment with ZA reduced the mean diameter of the testes after Day 34 of treatment (treatment×time, P=0.013) and total testicular weight at slaughter (treatment: mean±SEM; saline: 569.4±59.0g, ZA1: 249.3±72.9g, ZA2: 247.5±68.1g; P=0.004). Histological changes in testes of bulls treated with ZA were characterized by germ cell depletion, vacuolation of Sertoli cells, interstitial fibrosis, epididymal duct atrophy with variable remnants of testicular tissue and degeneration. We conclude that intratesticular administration of two doses of ZA in B. indicus calves is able to severely impair spermatogenesis and cause varying degrees of testicular degeneration and a reduction in testicular diameter and mass. Further investigation is required to determine ways of obtaining more consistent results from treatment. PMID:25752498

  5. Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle

    DEFF Research Database (Denmark)

    Ali, A.; O'Neill, C.J.; Thomson, P.C.;

    2012-01-01

    Background: Infectious bovine keratoconjunctivitis (IBK) or 'pinkeye' is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified...... species) eggs per gram of faeces and growth traits in Australian tropically adapted Bos taurus cattle were estimated. Methods: Animals were clinically examined for the presence of IBK infection before and after weaning when the calves were 3 to 6 months and 15 to 18 months old, respectively and were also...... counts. Conclusions: Our results suggest that genetic selection against IBK incidence in tropical cattle is feasible and that calves genetically prone to acquire IBK infection could also be genetically prone to have a slower growth. The positive genetic correlations among weight traits and between tick...

  6. Comparison of F1 Bos indicus x Hereford cows in central Texas: II. Udder, mouth, longevity, and lifetime productivity.

    Science.gov (United States)

    Riley, D G; Sanders, J O; Knutson, R E; Lunt, D K

    2001-06-01

    Postpartum udder characteristics, aged mouth condition scores, and cow survival, longevity, and productivity were evaluated for 15 yr on F1 cows in central Texas (temperate winters and subtropical summers). The cows (n = 116) were progeny of Angus, Gray Brahman, Gir, Indu-Brazil, Nellore, and Red Brahman sires and Hereford dams. Crossbred cows sired by Nellore had smaller (P Brahman crossbreds. The Nellore crossbred cows had larger (P Brahman crossbreds. As 14-yr-old cows, Angus crossbreds had lower (P < 0.05) mouth scores (indicative of one or more missing incisors) than Bos indicus crossbreds. Under actual and artificial (records were removed) culling procedures, Nellore crossbreds had the highest cow survival to age 14 and the highest longevity. Indu-Brazil crossbreds tended to be the lowest for both survival and longevity. Curves were fitted by nonlinear regression procedures to the adjusted frequencies of cows remaining at each age; scale and shape parameters were estimated and compared for the different breed groups. Breed group cow survival rates, calf crop weaned, and calf weaning weights were used 1) to construct population projection and production matrices for each breed group and 2) to generate breed group vectors containing projected age distributions and production information. Cows sired by Nellore and Gir were projected to require the fewest purebred cows to generate replacement heifers and to have the most calves and the largest total calf weight sold per year. PMID:11424680

  7. Quality characteristics of Longissimus dorsi muscle from Bos indicus animals treated with vitamin D3 Características qualitativas do músculo Longissimus dorsi de animais Bos indicus tratados com vitaminaD3

    Directory of Open Access Journals (Sweden)

    Aparecida Carla de Moura Silveira Pedreira

    2003-12-01

    Full Text Available Among several techniques to improve beef tenderness, vitamin D3, important for calcium mobilization, has recently been developed as an alternative. It acts on the intracellular calcium-dependent proteases (mu- and m-calpain. Ten days prior to slaughter, 36 Nelore steers were fed 0, 3, 6 and 9 million IU of supplemental vitamin D3 (D3 per animal per day (an-1 d-1. Animals were slaughtered and tenderness (shear force, cooking losses (1, 8 and 15 days of aging, sensory evaluation, and minerals in blood plasma and muscle (Longissimus dorsi were measured. There were no differences (P > 0.05 among treatments for blood plasma and muscle mineral concentration, evaporation losses, and sensory juiciness. For drip and total loss, the smallest losses were for the 6 × 10(6 IU an-1 d-1 treatment. The control treatment resulted in lowest shear force and aging also tended to lower resistance to shearing. The 3 × 10(6 IU an-1 d-1 treatment had a positive effect on tenderness, flavor and overall palatability. High levels of supplemental D3 did not improve the quality characteristicsof Longissimus dorsi muscle from Bos indicus animals.Muitas técnicas são empregadas para melhorar a maciez da carne de bovinos. A mais recente usa a vitamina D3, que tem importância na mobilização do cálcio e na ativação das proteases cálcio-dependentes (mi- e m-calpaína. Neste estudo, 36 machos castrados (Nelore foram suplementados por via oral com quatro níveis de vitamina D3 (0, 3, 6 e 9 milhões de UI de vitamina D3 animal-1 dia-1 durante os 10 dias que antecederam o abate. Após o abate foram medidos a força de cisalhamento e perdas por cozimento (aos dias 1, 8 e 15 de maturação, pH, concentração de minerais no plasma sangüíneo e no músculo Longissimus dorsi, além de análise sensorial de amostras. Não houve (P > 0.05 efeito da dose de vitamina D3 na concentração de minerais no plasma sangüíneo e no músculo, nas perdas por evaporação, e na sucul

  8. Mitogenomes from Egyptian Cattle Breeds: New Clues on the Origin of Haplogroup Q and the Early Spread of Bos taurus from the Near East

    OpenAIRE

    Olivieri, Anna; Gandini, Francesca; Achilli, Alessandro; Fichera, Alessandro; Rizzi, Ermanno; Bonfiglio, Silvia; Battaglia, Vincenza; Brandini, Stefania; De Gaetano, Anna; El-Beltagi, Ahmed; Lancioni, Hovirag; Agha, Saif; Semino, Ornella; Ferretti, Luca; Torroni, Antonio

    2015-01-01

    Background Genetic studies support the scenario that Bos taurus domestication occurred in the Near East during the Neolithic transition about 10 thousand years (ky) ago, with the likely exception of a minor secondary event in Italy. However, despite the proven effectiveness of whole mitochondrial genome data in providing valuable information concerning the origin of taurine cattle, until now no population surveys have been carried out at the level of mitogenomes in local breeds from the Near ...

  9. Chemical and sensory meat characteristics of Nellore cattle (Bos indicus) finished with different levels of backfat thickness in the longissimus thoracis muscle

    OpenAIRE

    Jéssica Moraes Malheiros; Welder Angelo Baldassini; Victor Augusto Domingos Dias; Josineudson Augusto II Vasconcelos da Silva; Rogério Abdalah Curi; Luiz Artur Loyola Chardulo

    2016-01-01

    The objective of this study was to evaluate the effect of backfat thickness (BFT) on the meat quality of feedlot-finished Nellore bulls (Bos indicus). Seventy-two animals were feedlot finished for about 100 days. For this study, 24 animals were sampled according to BFT in the longissimus thoracis muscle after slaughter: 12 animals with BFT up to 3.0 mm (class BFT-3) and 12 animals with BFT > 6.0 mm (class BFT-6). Chemical (myofibrillar fragmentation index, intramuscular fat content, and unsat...

  10. Superovulation, collection and transfer of embryos and demi-embryos from Boran(Bos indicus ) cows and heifers.

    Science.gov (United States)

    Jordt, T; Lorenzini, E

    1988-08-01

    Twenty-three Boran(Bos indicus ) cows and heifers were superovulated with pregnant mare serum gonadotropin (PMSG); a total of four embryos and 4.1 +/- 0.3 (mean +/- SEM) ova per ova-producing donor resulted. Follicle stimulating hormone (FSH-P) was then used to superovulate 49 Boran cows for a total of 106 superovulations, of which 63 (59.4%) produced an average of 3.7 +/- 0.4 (mean +/- SEM) embryos. The embryo production was not influenced by either the season or the number of times(one to five) the cows were superovulated. A higher pregnancy rate was obtained when the selection of Boran recipients was based on their plasma-progesterone values (overall 52.5%, single embryos 63.3%, twin demi-embryos 45.8%) than when they were selected by palpation per rectum only (overall 43.8%, single embryos 50%, twin demi-embryos 36.4%). The twinning rate of twin demiembryos was 62.5%, whereas only single calves were born after transfer of two embryos per recipient. No pregnancies were produced following transfer of twin demi-embryos without zonae pellucidae. Transferring single demi-embryos gave a low pregnancy rate (13.3%). Twelve donor Boran cows (21 superovulations) bred with their fathers resulted in a high rate of early embryonic death; additionally, only 20.9% (overall) of the recipients became pregnant. Estrus synchronization of Boran cows with a progesterone releasing intravaginal device (PRID) for a short period (7 d) combined with one injection of prostaglandin (Day 6) produced a larger number of good quality recipients (70.5%) than using double prostaglandin injections (60%). PMID:16726476

  11. The effects of intramuscular or intravenous injections of gonadotropin releasing hormone at fixed-time artificial insemination on pregnancy rates of Bos indicus beef cows

    Directory of Open Access Journals (Sweden)

    Danilo Demeterco

    2014-06-01

    Full Text Available The effect of an intramuscular versus intravenous administration of gonadotropin releasing hormone (GnRH at fixed-time AI (FTAI on the pregnancy rates of crossbred Bos indicus beef cows was evaluated. Pluriparous nursing calv cows (n=120 were synchronized as follows: d 0 cows received a 2.0 mg injection of estradiol benzoate (EB and insertion of a controlled intravaginal progesterone releasing device containing 0.558 g of progesterone, d 8 removal of the progesterone device , a 0.15 mg injection of prostaglandin F2α (PGF, a 1.0 mg injection of EB, and 400 IU injection of equine chorionic gonadotropin. Fifty-four hr after PGF, all cows were exposed to FTAI and a 0.084 mg injection of GnRH was administered either via Vena caudalis (n=60, or via Longissimus dorsi (n=60. Cows were inseminated with the same sire and by a single AI technician. Pregnancy was determined by the transrectal ultrasonography on d 40 after AI. Cows receiving the intravenous administration of GnRH had higher (P = 0.04 pregnancy rates than the cows receiving the intramuscular injection of GnRH (65 vs 46.6%, respectively. It was concluded that the intravenous administration of GnRH at the time of AI improved the pregnancy rates of crossbred Bos indicus beef cows submitted to FTAI.

  12. Amino acid profile of salivary proteins and plasmatic trace mineral response to dietary condensed tannins in free-ranging zebu cattle (Bos indicus) as a marker of habitat degradation

    NARCIS (Netherlands)

    Yisehak, K.; Becker, A.; Rothman, J.M.; Dierenfeld, E.S.; Marescau, B.; Bosch, G.; Hendriks, W.H.; Janssens, G.P.J.

    2012-01-01

    In the southern hemisphere, foraging areas of cattle are affected by overgrazing and soil erosion resulting in decreased availability of grasses and increased amounts of browse plants high in condensed tannins (CT). This study aimed to identify biomarkers in free-ranging zebu cattle (Bos indicus) fo

  13. Altas concentrações de FSH-p na maturação in vitro de oócitos Bos indicus High concentrations of FSH-p on the in vitro maturation of Bos indicus oocytes

    Directory of Open Access Journals (Sweden)

    Joana D'Arc Rocha Alves

    2001-08-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência de diferentes concentrações de um FSH-p comercial sobre a maturação nuclear de oócitos Bos indicus, clivagem e desenvolvimento in vitro de embriões até estádios de blastocisto. Após seleção e transferência para o meio TCM 199/HEPES suplementado com diferentes concentrações de FSH-p (T1 = 10mg/m ; T2 = 20mg/m ; T3 = 40mg/m, os oócitos foram incubados, durante 24 horas, a 39ºC em atmosfera úmida contendo 5% de CO2. Parte dos oócitos foram retirados para análise da maturação nuclear e os demais foram transferidos para o meio de fecundação (mDM. Após 18 horas de incubação nas mesmas condições atmosféricas mencionadas para os oócitos, os presumíveis zigotos foram distribuídos no meio de desenvolvimento embrionário (KSOM contendo monocamada de células da granulosa. As porcentagens de metáfase II, de clivagem e de blastocisto foram, respectivamente, de 81,8/62,5/17,6% (T1; 55,6/64,0/19,5% (T2 e 50,0/65,0/16,3% (T3. A análise estatística revelou que uma menor porcentagem (P £ 0,05 de oócitos tratados com 20mg/m e 40mg/m de FSH-p alcançou o estádio de metáfase II e que as taxas de clivagem e blastocisto não diferiram (P ³ 0,05 entre os tratamentos. Os resultados permitem concluir que a adição de 20mg/m e 40mg/m de FSH-p ao meio de cultura interfere no processo de maturação nuclear, mas todas as concentrações testadas podem ser utilizadas sem prejuízo aparente para a clivagem e o posterior desenvolvimento embrionário.The aim of this work was to evaluate the efficiency of different concentrations of a commercial FSH-p on the nuclear maturation of Bos indicus oocytes, cleavage and in vitro development of embryos until blastocyst stages. The oocytes were selected and transferred to the maturation medium (TCM 199/25 mM HEPES supplemented with different concentrations of FSH-p (T1 = 10mg/m ; T2 - 20mg/m ; T3 - 40mg/m and after 24 hours of incubation, at 39º

  14. Nucleotide polymorphisms in the bovine lymphotoxin A gene and their distribution among Bos indicus zebu cattle breeds.

    Science.gov (United States)

    Behl, Jyotsna Dhingra; Mishra, Priyanka; Verma, N K; Niranjan, S K; Dangi, P S; Sharma, Rekha; Behl, Rahul

    2016-03-15

    The present study was undertaken to characterize the genetic variation present in lymphoxin A gene (LTA gene) encoding for the lymphotoxin A protein also known as tumor necrosis factor beta, a cytokine produced by lymphocytes, known to be cytotoxic for a wide range of tumor cells both in vitro and in vivo, and, which is essential for normal immunological development; in 40 animals of 5 diverse Bos indicus Indian zebu cattle breeds. These breeds survive under the harsh and tough tropical climatic conditions of various parts of the Indian subcontinent. The LTA gene in the present study was observed to contain 33 SNPs and 3 small insertion/deletion polymorphisms. Four SNPs occurred in the coding regions of the gene viz. g.1327A>G and g.1400C>T in exon 2 and g.1840C>T and g.1942C>T in exon 3, of which the SNP g.1327A>G in exon 2 resulted in a non-synonymous amino acid change G38D. This amino acid change was however predicted not be affecting the protein function in any manner. The gene contained putative transcription factor binding sites for the c-Re1 and for Pax-4 transcription factors. A putative promoter region was also predicted on the reverse DNA strand from position 894 to 644. Several repeat elements and microsatellite repeats were detected to be occurring across the 3.2kb LTA gene sequence. The study showed the occurrence of 40 genotypes and 48 most probable haplotypes. The genotypes at the observed SNP positions in the LTA gene were in near Hardy-Weinberg equilibrium. A negative Tajima's D value that was not significant statistically at P>0.10 indicated that the neutral mutation hypothesis could not be excluded. The genetic variations observed in the LTA gene in the present study have not been reported earlier and these could possibly be used as molecular markers for further studies involving association of the gene variability with disease resistance/tolerance traits.

  15. Hábitos de amamantamiento del ganado bovino Chinampo (Bos taurus de México

    Directory of Open Access Journals (Sweden)

    José Espinoza V.

    2011-12-01

    Full Text Available Objetivo. Conocer los hábitos de amamantamiento de becerros Chinampos (Bos taurusen diferentes etapas de su lactancia. Materiales y métodos. Se utilizaron 20 vacas con su cría. A partir de los 30 hasta los 180 días de la lactancia los animales fueron observados durante 24 horas continuas cada mes registrando la frecuencia con la que los becerros mamaron y la duración de cada amamantamiento. Resultados. Los becerros mamaron con mayor frecuencia entre las 06:00 y las 07:00 hr, se observaron otros picos a las 10:00 y a las 19:00 hr. La frecuencia promedio de amamantamiento en 24 horas fue de 4.9±0.21utilizando un total de 66.9 ± 3.1 minutos. Los becerros de 180 días de edad mamaron menos veces comparados con los de edades inferiores a los 150 días; la duración del amamantamiento disminuyó a los 180 días de edad (p0.05. Conclusiones. La frecuencia de amamantamientos es mayor durante las primeras horas de la mañana y al final de la tarde. Hasta los 5 meses de edad la frecuencia y el tiempo de amamantamiento no variaron pero se redujeron a los180 días y las hembras mamaron con más periodicidad que los machos.

  16. Seminal plasma proteins and their relationship with percentage of morphologically normal sperm in 2-year-old Brahman (Bos indicus) bulls.

    Science.gov (United States)

    Boe-Hansen, G B; Rego, J P A; Crisp, J M; Moura, A A; Nouwens, A S; Li, Y; Venus, B; Burns, B M; McGowan, M R

    2015-11-01

    The objective was to determine the relationship between seminal plasma proteins and sperm morphology in Bos indicus bulls of the Brahman breed. Fifty-six 24-month-old Australian Brahman bulls were electroejaculated and samples were examined to determine the percentage of morphologically normal sperm (PNS24) and the seminal plasma protein composition was identified and quantified by 2-D gel electrophoresis. The total integrated optical density of 152 seminal plasma protein spots (SPPs) across all gels was determined using the PDQuest software version 8.0 (Bio Rad, USA). Using a single regression mixed model with the density of individual spots as a covariate for PNS24, 17 SPPs were significantly associated with PNS24 (pBrahman bulls and sperm morphology. PMID:26417650

  17. Expression of genes related to quality of Longissimus dorsi muscle meat in Nellore (Bos indicus) and Canchim (5/8 Bos taurus × 3/8 Bos indicus) cattle.

    Science.gov (United States)

    Giusti, Juliana; Castan, Eduardo; Dal Pai, Maeli; Arrigoni, Mário De Beni; Rodrigues Baldin, Samira; De Oliveira, Henrique Nunes

    2013-06-01

    This study was performed to compare CAPN1, CAPN2, CAST, TG, DGAT1 and LEP gene expressions and correlate them with meat quality traits in two genetic groups (Nellore and Canchim) in order to assess their expression profile and use their expression profile as genetic markers. We analyzed 30 young bulls (1year old), 15 of each genetic group. Samples of the Longissimus dorsi muscle were collected for analysis of: total lipids (TL) and meat tenderness measured as Warner-Bratzler shear force (SF) and myofibrillar fragmentation (MFI) at day of slaughter and 7days of aging. Gene expression profiles were obtained via RT-qPCR. TL and MFI showed differences between breeds, higher MFI in Canchim and higher TL in Nellore. Calpains showed no differential expression between groups, as did DGAT1, TG, and LEP. CAST was expressed more in the Nellore cattle. The only significant within-breed correlation (0.79) between gene expression and meat traits was found for DGAT1 and MFI in Canchim breed. Although the number of animals used in this study was small, the results indicate that the increased expression of CAST in Nellore may reflect tougher meat, but the lack of correlations with the meat traits indicates it is not a promising genetic marker.

  18. Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on the disease phenotypes of dairy cows with experimentally induced Escherichia coli mastitis

    DEFF Research Database (Denmark)

    Khatun, Momena; Sørensen, Peter; Jørgensen, Hanne Birgitte Hede;

    2013-01-01

    the HH group did. However, we also found interactions between the effects of haplotype and biopsy for body temperature, heart rate, and PMNL. In conclusion, when challenged with E. coli mastitis, HF cows with the specific Bos taurus autosome 9-located QTL haplotypes were associated with differences...... autosome 9. In the present study, we induced experimental E. coli mastitis in Danish HF cows to investigate the effect of 2 E. coli mastitis-associated QTL haplotypes on the cows' disease phenotypes and recovery in early lactation. Thirty-two cows were divided in 2 groups bearing haplotypes with either low...... motility; and the paraclinical parameters: bacterial counts, somatic cell count (SCC), and milk amyloid A levels in milk; and white blood cell count, polymorphonuclear neutrophilic leukocyte (PMNL) count, and serum amyloid A levels in blood were recorded at different time points post-E. coli inoculation...

  19. Effects of electrical stimulation and postmortem storage on changes in titin, nebulin, desmin, troponin-T, and muscle ultrastructure in Bos indicus crossbred cattle.

    Science.gov (United States)

    Ho, C Y; Stromer, M H; Rouse, G; Robson, R M

    1997-02-01

    The effects of electrical stimulation (ES) on degradation of titin, nebulin, desmin, and troponin-T (TN-T) and on structural changes in the longissimus muscle (LM) from Brahman x Simmental (B x S) cattle (Bos indicus cross) were determined. The left side of seven B x S beef carcasses was stimulated (200 V, 20 Hz) within 1 h of death, and the right side was the nonstimulated (NS) control. Myofibrils for SDS-PAGE and samples for transmission electron microscopy were prepared from the LM at 0, 1, 3, 7, 14, and 28 d postmortem (PM). The SDS-PAGE results showed that the T1 band of titin was absent by 7 d in two animals, by 14 d in four animals, and by 28 d in one animal in both NS and ES samples. By SDS-PAGE, intact nebulin was gone by 7 d in two animals and by 14 d in five animals, but in blots, nebulin decreased by 7 d and was absent by 14 d in both NS and ES samples. The desmin band could still be seen as a light band at 28 d in Western blots of both NS and ES samples. A decrease in TN-T and a concomitant increase in the 30-kDa polypeptide were observed in both NS and ES samples. Western blots with a monoclonal antibody to TN-T confirmed that TN-T decreased at similar rates in NS and ES samples but showed that the 30-kDa polypeptide was more heavily labeled in ES samples from 7 to 28 d. Contraction nodes were present in O-d ES samples and were still observed in 28-d ES samples. Narrow, intermediate, and wide I-band fractures were seen earlier and at a greater frequency in ES than in NS samples. Overall, ES had no detectable effect on titin, nebulin, desmin, or TN-T degradation but accelerated the appearance and enhanced the frequency of three types of I-band fractures in the LM from Bos indicus crossbred cattle. PMID:9051459

  20. Effects of electrical stimulation and postmortem storage on changes in titin, nebulin, desmin, troponin-T, and muscle ultrastructure in Bos indicus crossbred cattle.

    Science.gov (United States)

    Ho, C Y; Stromer, M H; Rouse, G; Robson, R M

    1997-02-01

    The effects of electrical stimulation (ES) on degradation of titin, nebulin, desmin, and troponin-T (TN-T) and on structural changes in the longissimus muscle (LM) from Brahman x Simmental (B x S) cattle (Bos indicus cross) were determined. The left side of seven B x S beef carcasses was stimulated (200 V, 20 Hz) within 1 h of death, and the right side was the nonstimulated (NS) control. Myofibrils for SDS-PAGE and samples for transmission electron microscopy were prepared from the LM at 0, 1, 3, 7, 14, and 28 d postmortem (PM). The SDS-PAGE results showed that the T1 band of titin was absent by 7 d in two animals, by 14 d in four animals, and by 28 d in one animal in both NS and ES samples. By SDS-PAGE, intact nebulin was gone by 7 d in two animals and by 14 d in five animals, but in blots, nebulin decreased by 7 d and was absent by 14 d in both NS and ES samples. The desmin band could still be seen as a light band at 28 d in Western blots of both NS and ES samples. A decrease in TN-T and a concomitant increase in the 30-kDa polypeptide were observed in both NS and ES samples. Western blots with a monoclonal antibody to TN-T confirmed that TN-T decreased at similar rates in NS and ES samples but showed that the 30-kDa polypeptide was more heavily labeled in ES samples from 7 to 28 d. Contraction nodes were present in O-d ES samples and were still observed in 28-d ES samples. Narrow, intermediate, and wide I-band fractures were seen earlier and at a greater frequency in ES than in NS samples. Overall, ES had no detectable effect on titin, nebulin, desmin, or TN-T degradation but accelerated the appearance and enhanced the frequency of three types of I-band fractures in the LM from Bos indicus crossbred cattle.

  1. Produtividade à Desmama de Novilhas Nelore e F1 Bos taurus x Nelore e Bos indicus x Nelore Productivity to Weaning of Nellore and F1 Guzerath x Nellore and Bos taurus x Nellore Heifers

    Directory of Open Access Journals (Sweden)

    Daniel Perotto

    2001-12-01

    Full Text Available A eficiência produtiva das vacas de corte está relacionada com o tamanho do animal, a fertilidade e a produção de leite. Este trabalho avaliou a eficiência à desmama de 289 novilhas sendo 100 Nelore (N, 47 F1 Guzerá x Nelore (GN, 67 F1 Red Angus x Nelore (RN, 37 F1 Marchigiana x Nelore (MN e 38 F1 Simental x Nelore (SN da Est. Exp. Paranavaí/IAPAR. Foram analisadas a idade ao primeiro parto (IPP, a relação entre o peso do bezerro à desmama e o peso da mãe ao parto, dividida pela idade da mãe em dias ao parto (PDPV, e a relação entre o peso do bezerro à desmama e o peso metabólico da mãe ao parto, dividida pela idade da mãe em dias ao parto (PDPM. As médias por quadrados mínimos para IPP em dias, PDPV [((kg/kg/dia x 1000] e PDPM [((kg/kg0,75/dia x 100] foram: 1416, 1340, 1053, 1187 e 1117; 0,394, 0,414, 0,422, 0,379 e 0,418; e 0,169, 0,179, 0,187, 0,169 e 0,188, respectivamente para os grupos N, GN, RN, MN e SN. Para IPP, foram significativos os contrastes N- RN (362 dias, GN -- RN (287 dias e RN -- MN (-133 dias. Para PDPV, foi significativo o contraste RN - MN [-0,04287((kg/kg/dia x 1000] e para PDPM foram significativos os contrastes N -- RN [-0,01803((kg/kg0,75/dia x 100], RN -- MN [0,01841((kg/kg0,75/dia x 100] e MN -- SN [-0,01915((kg/kg0,75/dia x 100]. Conclui-se que novilhas RN e SN foram mais eficientes à primeira desmama que novilhas MN, as quais não diferiram das zebuínas N e GN.Production efficiency of a beef cow-calf herd is determined by the ability of the cows in converting the ingested food into calf weight. This ability is related to cow size, fertility and milk production. The present study evaluated efficiency at weaning after first calving of 100 Nellore (N, 47 F1 Guzerath x Nellore (GN, 67 F1 Red Angus x Nellore (RN, 37 F1 Marchigiana x Nellore (MN and 38 F1 Simental x Nellore (SN heifers at Estação Experimental Paranavaí/IAPAR. The traits analyzed were age at first calving (IPP, the ratio of calf weaning weight to heifer weight at calving, divided by the age of the heifer at calving (PDPV and the ratio of calf weaning weight to heifer metabolic weight at calving, divided by the age of the heifer at calving (PDPM. Least squares means for IPP in days, PDPV [((kg/kg/day x 1000] and PDPM [((kg/kg0.75/day x 100] were: 1416, 1340, 1053, 1187 and 1117; 0.394, 0.414, 0.422, 0.379 and 0.418; and 0.169, 0.179, 0.187, 0.169 and 0.188, respectively for N, GN, RN, MN and SN. The contrasts N -- RN (362 days, GN -- RN (287 days and RN -- MN (-133 days were significant for IPP. For PDPV, the contrast RN -- MN [-0.04287((kg/kg/day x 1000] was significant while for PDPM the contrasts N -- RN [-0.01803((kg/kg0.75/day x 100], RN -- MN [0,01841((kg/kg0.75/day x 100] and MN -- SN [-0.01915((kg/kg0.75/day x 100] were significant. It can be concluded that RN and SN heifers had greater production efficiency at first weaning than MN heifers, which did not differ from N and GN heifers.

  2. Patterns of cell proliferation and apoptosis by topographic region in normal Bos taurus vs. Bos indicus crossbreeds bovine placentae during pregnancy

    Directory of Open Access Journals (Sweden)

    Ambrósio Carlos E

    2009-03-01

    Full Text Available Abstract Background Placental and fetal growth requires high rates of cellular turnover and differentiation, which contributes to conceptus development. The trophoblast has unique properties and a wide range of metabolic, endocrine and angiogenic functions, but the proliferative profile of the bovine placenta characterized by flow cytometry analysis and its role in fetal development are currently uncharacterized. Complete understanding of placental apoptotic and proliferative rates may be relevant to development, especially if related to the pathogenesis of pregnancy losses and placental abnormalities. Methods In this study, the proliferation activity and apoptosis in different regions of normal bovine placenta (central and boundary regions of placentomes, placentomal fusion, microplacentomes, and interplacentomal regions, from distinct gestation periods (Days 70 to 290 of pregnancy, were analyzed by flow cytometry. Results Our results indicated that microplacentomes presented a lower number of apoptotic cells throughout pregnancy, with a higher proliferative activity by the end of gestation, suggesting that such structures do not contribute significantly to normal of placental functions and conceptus development during pregnancy. The placentome edges revealed a higher number of apoptotic cells from Day 170 on, which suggests that placentome detachment may well initiate in this region. Conclusion Variations involving proliferation and apoptotic rates may influence placental maturation and detachment, compromising placental functions and leading to fetal stress, abnormalities in development and abortion, as frequently seen in bovine pregnancies from in vitro fertilization and cloning procedures. Our findings describing the pattern of cell proliferation and apoptosis in normal bovine pregnancies may be useful for unraveling some of the developmental deviations seen in nature and after in vitro embryo manipulations.

  3. Differential expression of IGF family members in heat-stressed embryos produced in vitro from OPU-derived oocytes of Nelore (Bos indicus) and Holstein (Bos taurus) cows.

    Science.gov (United States)

    Satrapa, R A; Razza, E M; Castilho, A C S; Simões, R A L; Silva, C F; Nabhan, T; Pegorer, M F; Barros, C M

    2013-12-01

    The IGF system is related to embryo quality. We aim to determine the effect of the heat stress on the mRNA expression of IGF1 and IGF2, IGFR1 and IGFR2, IGFBP2 and IGFBP4, and PAPPA in in vitro production (IVP) blastocysts from Nelore and Holstein after ovum pick up (OPU) to better understand the differences between these breeds. Oocytes from four Nelore and seven Holstein were collected in six OPU sessions. Following in vitro maturation and fertilization using six Nelore or Holstein sires, embryos were divided into control (cultured at 39°C) and heat stress (HS; exposed to 41°C for 9 h). Blastocysts were submitted to RNA extraction. The IGF1 expression was higher in blastocysts under HS in both breeds, and the expression of IGFBP2 and IGFBP4 was higher in Holstein blastocysts under HS. The high PAPPA expression and the low expression of IGFBP2 and IGFBP4 are associated with a more efficient degradation of IGFBPs, which results in greater IGF bioavailability in Nelore blastocysts and may contribute to the superior HS tolerance in Nelore, when compared to Holstein.

  4. Purebred-crossbred performance and genetic evaluation of postweaning growth and carcass traits in Bos indicus x Bos taurus crosses in Australia.

    Science.gov (United States)

    Newman, S; Reverter, A; Johnston, D J

    2002-07-01

    Growth and carcass data on 7,154 cattle from a purebred project and 1,241 cattle from a crossbred project, comprising 916 first-crosses and 325 purebred Brahman controls, were analyzed to estimate genetic parameters, including the genetic correlations between purebred and crossbred performance (rpc). The data also allowed the estimation of sire breed means for various growth and carcass traits. Crossbred calves were produced using 9 Angus, 8 Hereford, 7 Shorthorn, 14 Belmont Red, and 8 Santa Gertrudis sires bred to Brahman dams. These same sires produced 1,568 progeny in a separate purebreeding project. Cattle in both projects were managed under two finishing regimens (pasture and feedlot) to representative market live weights of 400 (domestic), 520 (Korean), and 600 kg (Japanese). The traits studied included live weight at around 400 d of age (400W), hot carcass weight (CWT), retail beef yield percentage (RBY), intramuscular fat percentage (IMF), rump fat depth (P8), and preslaughter ultrasound scanned eye muscle area (SEMA). Estimated breeding values (EBV) of sires from their BREEDPLAN genetic evaluations were used to assess their value in predicting crossbred performance. Regressions of actual crossbred calf performance on sire EBV for each of the traits differed little from their expectation of 0.5. Angus sires produced crossbred carcasses with the highest P8 and lowest RBY but highest IMF. In contrast, crossbred progeny from Belmont Red sires had the lightest 400W and CWT, lowest P8, and highest RBY. Estimates of rpc were 0.48, 0.48, 0.83, 0.95, 1.00, and 0.78 for 400W, CWT, RBY, IMF, P8, and SEMA, respectively. Commercial breeders selecting sires for crossbreeding programs with Brahman females, based on EBV computed from purebred data, might encounter some reranking of sire's performance for weight-related traits, with little expected change in carcass traits.

  5. Detection of quantitative trait loci for growth and beef carcass fatness traits in a cross between Bos taurus (Angus) and Bos indicus (Brahman) cattle.

    Science.gov (United States)

    Kim, J J; Farnir, F; Savell, J; Taylor, J F

    2003-08-01

    This study was conducted to detect quantitative trait loci (QTL) affecting growth and beef carcass fatness traits in an experimental population of Angus and Brahman crossbreds. The three-generation mapping population was generated with 602 progeny from 29 reciprocal backcross and three F2 full-sib families, and 417 genetic markers were used to produce a sex-averaged map of the 29 autosomes spanning 2,642.5 Kosambi cM. Alternative interval-mapping approaches were applied under line-cross (LC) and random infinite alleles (RA) models to detect QTL segregating between and within breeds. A total of 35 QTL (five with genomewide significant and 30 with suggestive evidence for linkage) were found on 19 chromosomes. One QTL affecting yearling weight was found with genomewide significant evidence for linkage in the interstitial region of bovine autosome (BTA) 1, and an additional 19 QTL were detected with suggestive evidence for linkage under the LC model. Many of these QTL had a dominant (complete or overdominant) mode of gene action, and only a few of the QTL were primarily additive, which reflects the fact that heterosis for growth is known to be appreciable in crosses among Brahman and British breeds. Four QTL affecting growth were detected with genomewide significant evidence for linkage under the RA model on BTA 2 and BTA 6 for birth weight, BTA 5 for yearling weight, and BTA 23 for hot carcass weight. An additional 11 QTL were detected with suggestive evidence for linkage under the RA model. None of the QTL (except for yearling weight on BTA 5) detected under the RA model were found by the LC analyses, suggesting the segregation of alternate alleles within one or both of the parental breeds. Our results reveal the utility of implementing both the LC and RA models to detect dominant QTL and also QTL with similar allele frequency distributions within parental breeds.

  6. Detection of quantitative trait loci for growth and beef carcass fatness traits in a cross between Bos taurus (Angus) and Bos indicus (Brahman) cattle.

    Science.gov (United States)

    Kim, J J; Farnir, F; Savell, J; Taylor, J F

    2003-08-01

    This study was conducted to detect quantitative trait loci (QTL) affecting growth and beef carcass fatness traits in an experimental population of Angus and Brahman crossbreds. The three-generation mapping population was generated with 602 progeny from 29 reciprocal backcross and three F2 full-sib families, and 417 genetic markers were used to produce a sex-averaged map of the 29 autosomes spanning 2,642.5 Kosambi cM. Alternative interval-mapping approaches were applied under line-cross (LC) and random infinite alleles (RA) models to detect QTL segregating between and within breeds. A total of 35 QTL (five with genomewide significant and 30 with suggestive evidence for linkage) were found on 19 chromosomes. One QTL affecting yearling weight was found with genomewide significant evidence for linkage in the interstitial region of bovine autosome (BTA) 1, and an additional 19 QTL were detected with suggestive evidence for linkage under the LC model. Many of these QTL had a dominant (complete or overdominant) mode of gene action, and only a few of the QTL were primarily additive, which reflects the fact that heterosis for growth is known to be appreciable in crosses among Brahman and British breeds. Four QTL affecting growth were detected with genomewide significant evidence for linkage under the RA model on BTA 2 and BTA 6 for birth weight, BTA 5 for yearling weight, and BTA 23 for hot carcass weight. An additional 11 QTL were detected with suggestive evidence for linkage under the RA model. None of the QTL (except for yearling weight on BTA 5) detected under the RA model were found by the LC analyses, suggesting the segregation of alternate alleles within one or both of the parental breeds. Our results reveal the utility of implementing both the LC and RA models to detect dominant QTL and also QTL with similar allele frequency distributions within parental breeds. PMID:12926775

  7. Preweaning growth of Angus- (Bos taurus), Brahman- (Bos indicus), and Tuli- (Sanga) sired calves and reproductive performance of their Brahman dams.

    Science.gov (United States)

    Browning, R; Leite-Browning, M L; Neuendorff, D A; Randel, R D

    1995-09-01

    Calves born to Angus (A), Brahman (B), or Tuli (T) bulls and B cows were evaluated to determine sire breed of calf effects on preweaning calf growth and reproductive performance of their dams. Records from 242 cow-calf pairs over 2 yr were used to assess birth weight, calf ADG, weaning weight, gestation length, and postpartum interval to estrus (PPI). The sire breed x sex of calf interaction was important (P Angus-sired F1 calves and similar to straightbred Brahman calves in preweaning growth. Crossbred calves had shorter gestations but longer postpartum intervals than purebred calves. PMID:8582844

  8. Purebred-crossbred performance and genetic evaluation of postweaning growth and carcass traits in Bos indicus x Bos taurus crosses in Australia.

    Science.gov (United States)

    Newman, S; Reverter, A; Johnston, D J

    2002-07-01

    Growth and carcass data on 7,154 cattle from a purebred project and 1,241 cattle from a crossbred project, comprising 916 first-crosses and 325 purebred Brahman controls, were analyzed to estimate genetic parameters, including the genetic correlations between purebred and crossbred performance (rpc). The data also allowed the estimation of sire breed means for various growth and carcass traits. Crossbred calves were produced using 9 Angus, 8 Hereford, 7 Shorthorn, 14 Belmont Red, and 8 Santa Gertrudis sires bred to Brahman dams. These same sires produced 1,568 progeny in a separate purebreeding project. Cattle in both projects were managed under two finishing regimens (pasture and feedlot) to representative market live weights of 400 (domestic), 520 (Korean), and 600 kg (Japanese). The traits studied included live weight at around 400 d of age (400W), hot carcass weight (CWT), retail beef yield percentage (RBY), intramuscular fat percentage (IMF), rump fat depth (P8), and preslaughter ultrasound scanned eye muscle area (SEMA). Estimated breeding values (EBV) of sires from their BREEDPLAN genetic evaluations were used to assess their value in predicting crossbred performance. Regressions of actual crossbred calf performance on sire EBV for each of the traits differed little from their expectation of 0.5. Angus sires produced crossbred carcasses with the highest P8 and lowest RBY but highest IMF. In contrast, crossbred progeny from Belmont Red sires had the lightest 400W and CWT, lowest P8, and highest RBY. Estimates of rpc were 0.48, 0.48, 0.83, 0.95, 1.00, and 0.78 for 400W, CWT, RBY, IMF, P8, and SEMA, respectively. Commercial breeders selecting sires for crossbreeding programs with Brahman females, based on EBV computed from purebred data, might encounter some reranking of sire's performance for weight-related traits, with little expected change in carcass traits. PMID:12162647

  9. Evaluation of the impacts of spaying by either the dropped ovary technique or ovariectomy via flank laparotomy on the welfare of Bos indicus beef heifers and cows.

    Science.gov (United States)

    Petherick, J C; McCosker, K; Mayer, D G; Letchford, P; McGowan, M

    2013-01-01

    The welfare outcomes for Bos indicus cattle (100 heifers and 50 cows) spayed by either the dropped ovary technique (DOT) or ovariectomy via flank laparotomy (FL) were compared with cattle subjected to physical restraint (PR), restraint by electroimmobilization in conjunction with PR (EIM), and PR and mock AI (MAI). Welfare assessment used measures of morbidity, mortality, BW change, and behavior and physiology indicative of pain and stress. One FL heifer died at d 5 from peritonitis. In the 8-h period postprocedures, plasma bound cortisol concentrations of FL, DOT, and EIM cows were not different and were greater (P0.05) between treatments in BW changes. For both heifers and cows, FL and DOT spaying caused similar levels of acute pain, but FL had longer-lasting adverse impacts on welfare. Electroimmobilization during FL contributed to the pain and stress of the procedure. We conclude that: i) FL and DOT spaying should not be conducted without measures to manage the associated pain and stress; ii) DOT spaying is preferable to FL spaying; iii) spaying heifers is preferable to spaying cows; and iv) electroimmobilization causes pain and stress and should not be routinely used as a method of restraint. PMID:23048132

  10. Infrared thermography as a tool to evaluate body surface temperature and its relationship with feed efficiency in Bos indicus cattle in tropical conditions

    Science.gov (United States)

    Martello, Luciane Silva; da Luz e Silva, Saulo; da Costa Gomes, Rodrigo; da Silva Corte, Rosana Ruegger Pereira; Leme, Paulo Roberto

    2016-01-01

    The aims of this study were to evaluate the use of infrared thermography (IRT) images as a tool for monitoring body surface temperature and to study its relationship with residual feed intake (RFI) in Nellore cattle. We also evaluated IRT as an indicator of feed efficiency in Bos indicus cattle. In this study, 144 Nellore steers were fed high-concentrate diets for 70 days to evaluate feedlot performance. We examined nine animals classified as high RFI and nine animals classified as low RFI by measuring rectal temperature (RT), respiratory frequency (RF), and IRT in the front, eye, ocular area, cheek, flank, ribs, rump, and front feet. The measurements were taken at 0700, 1200, and 1600 hours. The IRT temperatures measured at the eye, cheek, flank, ribs, rump, and front feet were positively associated with RF and RT. These results indicate that increases in the temperatures are associated with increased RF and RT. There was an effect in the RFI group in the front region where IRT correlates with RT. The front IRT for high-RFI cattle was lower ( P cattle. The higher skin temperature measured by IRT for animals in the RFI group may be related to improved efficiency of thermoregulatory mechanisms because the RT remained lower in the low-RFI group. IRT can be used in the head for studies related to RFI in beef cattle.

  11. Microsatellite DNA typing for assessment of genetic variability in Tharparkar breed of Indian zebu (Bos indicus) cattle, a major breed of Rajasthan

    Indian Academy of Sciences (India)

    M. Sodhi; M. Mukesh; B. Prakash; S. P. S. Ahlawat; R. C. Sobti

    2006-12-01

    The present study estimates genetic variability with a set of 25 microsatellite markers in a random sample of 50 animals of Tharparkar breed of Indian zebu (Bos indicus) cattle. Tharparkar is a dual-purpose breed, valued for its milk as well as draught utility, and is adapted to the inhospitable Thar desert conditions of Rajasthan typified by summer temperature hovering above 50°C, sparse rainfall and vegetation, and scarcity of even drinking water. The observed number of alleles ranged from 4 (ETH3, ILSTS030, INRA5, INRA63 and MM8) to 11 (HEL9 and ILSTS034), with allelic diversity (average number of observed alleles per locus) of 6.20. Observed and expected heterozygosity ranged from 0.25 (INRA63) to 0.77 (ETH10), and from 0.51 (HEL5 and HAUT27) to 0.88 (HEL9) respectively. Wide range of genetic variability supported the utility of these microsatellite loci in measurement of genetic diversity indices in other Indian cattle breeds too. Various average genetic variability measures, namely allele diversity (6.20), observed heterozygosity (0.57), expected heterozygosity (0.67) and mean polymorphism information content (0.60) values showed substantial within-breed genetic variability in this major breed of Rajasthan, despite accumulated inbreeding as reflected by high average inbreeding coefficient $(F_{\\text{IS}} = 0.39)$. The Tharparkar population has not experienced a bottleneck in the recent past.

  12. The effect of supplementing leaves of four tannin-rich plant species with polyethylene glycol on digestibility and zootechnical performance of zebu bulls (Bos indicus).

    Science.gov (United States)

    Yisehak, K; De Boever, J L; Janssens, G P J

    2014-06-01

    The effect of supplementing leaves of four tannin-rich plant species with polyethylene glycol 6000 (PEG) on nutrient intake and digestibility as well as on weight gain, feed conversion ratio (FCR) and N retention of zebu bulls (Bos indicus) was studied. Leaves of Albizia gummifera, Grewia ferruginea, Prunus africana and Syzygium guineense, containing, respectively, 85, 55, 76 and 172 g condensed tannins (CT) per kg dry matter (DM), were combined with natural pasture hay in a ratio of 40:60 on DM basis. The four diets were fed both without and with addition of PEG, at a dose of 40 g per kg DM, to eight zebu bulls during trials of 25 days in an 8 × 8 randomized crossover design. Supplementation with PEG increased nutrient intake, digestibility, FCR, N retention and average daily gain (p < 0.01). A diet × PEG interaction was observed for nutrient intake as well as for crude protein, neutral detergent fibre and acid detergent fibre digestibility (p < 0.05), but the effect size of PEG addition could not be attributed to the CT content as such, and also digestibility without PEG was not related to CT content of the diets. The reason why the efficacy of PEG addition did not relate to the CT content pointed the need to evaluate other factors that can help to predict the efficacy of PEG, for example, tannin type or interaction with other nutrients.

  13. AVALIAÇÕES DA PARASITEMIA, DO HEMATÓCRITO E DOS NÍVEIS BIOQUÍMICOS SÉRICOS, DE BEZERROS NELORE (Bos indicus), INOCULADOS COM ISOLADOS DE Babesia bigemina (Smith & Kilborne, 1893) DAS REGIÕES SUL, SUDESTE, CENTRO-OESTE, NORDESTE E NORTE DO BRASIL

    OpenAIRE

    Maria Aparecida Schenki; Cláudio Roberto Madruga; Aguemi Kohayagawa; Carla Lopes de Mendonça; Dirson Vieira; Raul Kessler

    2006-01-01

    Avaliaram-se a parasitemia, o hematócrito e os níveis séricos de bilirrubina total, creatinina, uréia e colesterol de bezerros Nelore (Bos indicus) inoculados com isolados de Babesia bigemina das cinco regiões fisiográficas do Brasil. Constatou-se que os diferentes isolados desenvolveram baixa parasitemia, nos animais experimentalmente inoculados, diminuição do colesterol sérico, e que não houve variações nos níveis de bilirrubina, creatinina e uréia sérica. PALAVRAS-CHAVE: Bos indicus, ...

  14. Variations in the Regulatory Region of Alpha S1-Casein Milk Protein Gene among Tropically Adapted Indian Native (Bos Indicus) Cattle

    Science.gov (United States)

    Kishore, Amit; Mukesh, Manishi; Sobti, Ranbir C.; Mishra, Bishnu P.; Sodhi, Monika

    2013-01-01

    Regulatory region of milk protein alpha S1-casein (αS1-CN) gene was sequenced, characterized, and analyzed to detect variations among 13 Indian cattle (Bos indicus) breeds. Comparative analysis of 1,587 bp region comprising promoter (1,418 bp), exon-I (53 bp), and partial intron-I (116 bp) revealed 35 nucleotide substitutions (32 within promoter region, 1 in exon-I, and 2 in partial intron-I region) and 4 Indels. Within promoter, 15 variations at positions −1399 (A > G), −1288 (G > A), −1259 (T > C), −1158 (T > C), −1016 (A > T), −941 (T > G), −778 (C > T), −610 (G > A), −536 (A > G), −521 (A > G), −330 (A > C), −214 (A > G), −205 (A > T), −206 (C > A), and −175 (A > G) were located within the potential transcription factor binding sites (TFBSs), namely, NF-κE1/c-Myc, GATA-1, GATA-1/NF-E, Oct-1/POU3F2, MEF-2/YY1, GATA-1, AP-1, POU1F1a/GR, TMF, GAL4, YY1/Oct-1, HNF-1, GRalpha/AR, GRalpha/AR, and AP-1, respectively. Seventy-four percent (26/35) of the observed SNPs were novel to Indian cattle and 11 of these novel SNPs were located within one or more TFBSs. Collectively, these might influence the binding affinity towards their respective nuclear TFs thus modulating the level of transcripts in milk and affecting overall protein composition. The study provides information on several distinct variations across indicine and taurine αS1-CN regulatory domains. PMID:25937984

  15. Chemical and sensory meat characteristics of Nellore cattle (Bos indicus finished with different levels of backfat thickness in the longissimus thoracis muscle

    Directory of Open Access Journals (Sweden)

    Jéssica Moraes Malheiros

    2016-01-01

    Full Text Available The objective of this study was to evaluate the effect of backfat thickness (BFT on the meat quality of feedlot-finished Nellore bulls (Bos indicus. Seventy-two animals were feedlot finished for about 100 days. For this study, 24 animals were sampled according to BFT in the longissimus thoracis muscle after slaughter: 12 animals with BFT up to 3.0 mm (class BFT-3 and 12 animals with BFT > 6.0 mm (class BFT-6. Chemical (myofibrillar fragmentation index, intramuscular fat content, and unsaturated and saturated fatty acids and physical (cold carcass weight, rib eye area, and marbling score characteristics of the meat were evaluated. Additionally, shear force and sensory characteristics (aroma, flavor, tenderness, chewiness, and juiciness were analyzed. Marbling score and intramuscular fat content were considered low for the two BFT classes. The mean values of the characteristics studied did not differ (P>0.05 between BFT classes, except for fatty acids, with the observation of higher unsaturated fatty acid levels in the BFT-6 class. There was no difference (P>0.05 in sensory characteristics between BFT classes. The most consistent relationship was observed between the myofibrillar fragmentation index and tenderness, measured as shear force, in animals with greater BFT (BFT-6 class compared to animals with lower BFT (BFT-3 class, suggesting possible tenderness problems in animals with a leaner carcass. The observation of a higher concentration of unsaturated fatty acids in animals with greater BFT suggests an increase in the sensory perception of meat, especially flavor.

  16. Incidence and transplacental transmission of Neospora caninum in primiparous females from Bos indicus slaughtered in Presidente Prudente, São Paulo, Brazil / Incidência e transmissão transplacentária de Neospora caninum em fêmeas primíparas da raça Bos indicus abatidos em Presidente Prudente, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Sergio do Nascimento Kronka

    2008-08-01

    Full Text Available To produce an epidemiological map of neosporosis in Brazil and identify the types of transmission of this disease, the present study evaluated the occurrence of Neospora caninum in Nelore cattle (Bos indicus in Presidente Prudent, west region of Sao Paulo state; its vertical transmission; and the early stage in which fetuses are infected. To achieve this, serum samples from 518 slaughtered pregnant heifers and their fetuses were tested by ELISA technique and fetal brain tissues subjected to PCR. One hundred and three heifers (19.88% had antibodies to N. caninum, as well as 38 (36.8% of fetuses from 4 months of gestation. The conventional PCR failed to detect N. caninum DNA. These findings show that neosporosis occurs in the area studied and that it may be transmitted the transplacental route, althought N. caninum had not detected in brain tissue from non-aborted fetuses. The use of nested PCR it would be applied to increase the sensitivy of test.Para produzir um mapa epidemiológico da neosporose no Brasil e identificar os tipos de transmissão dessa doença, o presente estudo avaliou a ocorrência de Neospora caninum em fêmea Nelore (Bos Indicus em Presidente Prudente, região oeste do Estado de São Paulo e o risco de infecção fetal nos estágios iniciais da gestação. Para a realização deste estudo, amostras de soro de 518 novilhas prenhas abatidas e seus fetos foram testadas pela técnica de ELISA e para avaliação de transmissão vertical, tecido cerebral fetal foi submetido à reação da polimerase em cadeia (PCR. Dessas novilhas, 103 (19,88% tinham anticorpos para N. caninum dos quais 38 (36,8% estavam no 4 mês de gestação. Esses achados mostram que a Neosporose ocorre na área estudada e que pode ser transmitido pela via placentária, embora o N. caninum não tenha sido detectado em tecido cerebral de fetos não abortado. O uso de nested PCR poderia ser aplicado como forma de aumentar a sensibilidade do teste.

  17. Severe diarrhea outbreak in beef calves (Bos indicus caused by G6P[11], an emergent genotype of bovine rotavirus group A

    Directory of Open Access Journals (Sweden)

    Thais N.S. Medeiros

    2014-08-01

    Full Text Available The episodes of diarrhea caused by neonatal bovine rotavirus group A (BoRVA constitute one of the major health problems in the calf rearing worldwide. The main G (VP7 and P (VP4 genotypes of BoRVA strains involved in the etiology of diarrhea in calves are G6P[1], G10P[11], G6P[5], and G8P[1]. However, less frequently, other G and P genotypes have been described in BoRVA strains identified in diarrheic fecal samples of calves. This study describes the identification and molecular characterization of an emerging genotype (G6P[11] in BoRVA strains involved in the etiology of a diarrhea outbreak in beef calves in a cattle herd of high production in extensive management system. The diarrhea outbreak, which showed high morbidity (60% and lethality (7% rates, occurred in calves (n= 384 Nelore (Bos indicus up to 30-day-old from the State of Mato Grosso do Sul, Brazil. BoRVA was identified in 80% (16/20 of the fecal samples analyzed by polyacrylamide gel electrophoresis (PAGE technique. In all PAGE-positive fecal samples were amplified products with 1,062-bp and 876-bp in the RT-PCR assays for VP7 (G type and VP4 (VP8* (P type of BoRVA, respectively. The nucleotide sequence analysis of VP7 and VP4 genes of four wild-type BoRVA strains showed G6-III P[11]-III genotype/lineage. The G6P[11] genotype has been described in RVA strains of human and animal hosts, however, in calves this genotype was only identified in some cross-sectional studies and not as a single cause of diarrhea outbreaks in calves with high morbidity and lethality rates as described in this study. The monitoring of the G and P genotypes of BoRVA strains involved in diarrhea outbreaks in calves is important for both animal and public health by allowing the identification of the most frequent genotypes, the characterization of novel genotypes and to identify reassortments with genotypes described in animal and human hosts. The results of this study show the importance of the monitoring of

  18. Comparative expression profiling of insulin-like growth factor binding protein-5 in milk of Bos indicus and Bubalus bubalis during lactation.

    Science.gov (United States)

    Mohapatra, S K; Singh, S; Kumar, S; Dang, A K; Datta, T K; Das, S K; Mohanty, T K; Kaushik, J K; Mohanty, A K

    2015-04-01

    Insulin-like growth factor binding protein-5 (IGFBP-5) is a key molecule in mammary gland development, which facilitates the removal of mammary epithelial cells (MECs) by apoptosis that takes place during remodeling of the mammary gland during involution. IGFBP-5 binds with IGFs for their bioavailability. IGFBP-5 has been reported to perform pleiotropic roles such as cellular apoptosis, proliferation and differentiation. To understand the role of IGFBP-5 during lactation and clinical mastitis, expression profiling of IGFBP-5 at the protein level was performed in both indigenous cows (Bos indicus) and buffaloes (Bubalus bubalis) belonging to two different breeds - Sahiwal cows and Murrah buffaloes. Reverse-transcriptase PCR (RT-PCR) of IGFBP-5 mRNA confirmed its expression in milk somatic cells and MECs of Sahiwal cows. ELISA was performed for quantitative measurement of IGFBP-5 concentrations in milk during different days (0, 50, 100, 150, 200, 250 and 300) of lactation, during the involution period and in animals exhibiting short lactation and clinical mastitis. The highest concentration of IGFBP-5 in milk was observed during the involution period followed by colostrum, late and early lactation, respectively, in both cattle and buffaloes. No significant difference in the concentration of IGFBP-5 was observed during the first 150 days of lactation between cows and buffaloes. However, higher concentration of IGFBP-5 was observed in cows during late lactation (200 to 300 days) in comparison with buffaloes. To validate the ELISA data, quantitative real-time PCR was performed in MECs of Sahiwal cows. The relative mRNA abundance of IGFBP-5 was found to be significantly (Pcows. Highest mRNA expression of IGFBP-5 was observed around 300 days of lactation followed by 200 and 250 days (Pmilk as compared with Sahiwal cows during lactation in ELISA. Animals having history of short lactation length (short lactating animals) showed higher levels of IGFBP-5 expression (at

  19. Comparison of the pregnancy rates and costs per calf born after fixed-time artificial insemination or artificial insemination after estrus detection in Bos indicus heifers.

    Science.gov (United States)

    Edwards, S A A; Bo, G A; Chandra, K A; Atkinson, P C; McGowan, M R

    2015-01-01

    This study compared pregnancy rates (PRs) and costs per calf born after fixed-time artificial insemination (FTAI) or AI after estrus detection (i.e., estrus detection and AI, EDAI), before and after a single PGF2α treatment in Bos indicus (Brahman-cross) heifers. On Day 0, the body weight, body condition score, and presence of a CL (46% of heifers) were determined. The heifers were then alternately allocated to one of two FTAI groups (FTAI-1, n = 139) and (FTAI-2, n = 141) and an EDAI group (n = 273). Heifers in the FTAI groups received an intravaginal progesterone-releasing device (IPRD; 0.78 g of progesterone) and 1 mg of estradiol benzoate intramuscularly (im) on Day 0. Eight days later, the IPRD was removed and heifers received 500 μg of PGF2α and 300 IU of eCG im; 24 hours later, they received 1 mg estradiol benzoate im and were submitted to FTAI 30 to 34 hours later (54 and 58 hours after IPRD removal). Heifers in the FTAI-2 group started treatment 8 days after those in the FTAI-1 group. Heifers in the EDAI group were inseminated approximately 12 hours after the detection of estrus between Days 4 and 9 at which time the heifers that had not been detected in estrus received 500 μg of PGF2α im and EDAI continued until Day 13. Heifers in the FTAI groups had a higher overall PR (proportion pregnant as per the entire group) than the EDAI group (34.6% vs. 23.2%; P = 0.003), however, conception rate (PR of heifers submitted for AI) tended to favor the estrus detection group (34.6% vs. 44.1%; P = 0.059). The cost per AI calf born was estimated to be $267.67 and $291.37 for the FTAI and EDAI groups, respectively. It was concluded that in Brahman heifers typical of those annually mated in northern Australia FTAI compared with EDAI increases the number of heifers pregnant and reduces the cost per calf born. PMID:25284281

  20. Parâmetros genéticos entre características de leite, de peso e a idade ao primeiro parto em gado mestiço leiteiro (Bos taurus x Bos indicus Genetic parameters between milk traits, weight traits and age at first calving in crossbreed dairy cattle (Bos taurus x Bos indicus

    Directory of Open Access Journals (Sweden)

    A.E. Vercesi Filho

    2007-08-01

    Full Text Available Foram estimadas as correlações genéticas entre características de produção de leite (produção de leite, gordura, proteína e duração da lactação em até 305 dias, na primeira lactação, características de peso (taxa de crescimento de novilhas entre 12-24 meses e peso médio de vacas e idade ao primeiro parto, em uma população de fêmeas Mestiço Leiteiro Brasileiro (MLB, por meio de metodologia REML, sob modelo animal. As estimativas de herdabilidade das características estudadas na ordem acima foram, respectivamente, 0,28± 0,08, 0,30±0,11, 0,28±0,09, 0,19±0,07, 0,18±0,06, 0,42±0,10 e 0,48±0,12. As correlações genéticas entre peso médio da vaca e a produção de leite, gordura e proteína foram, respectivamente, -0,22±0,22, -0,49±0,31 e -0,22±0,23 e da taxa de crescimento das novilhas com a produção de leite, gordura e proteína foram respectivamente, -0,59±0,35, -0,73±0,44 e -0,62±0,37. As correlações genéticas entre produção de leite, peso médio das vacas e taxa de crescimento das novilhas com idade ao primeiro parto foram respectivamente, 0,05±0,18, -0,05±0,18 e 0,02±0,20. A alta correlação genética (0,93±0,02 entre produção de leite e duração da lactação indicou que não se deve remover a variação na duração da lactação na seleção de gado leiteiro tropical.Genetic correlations between milk production (milk, fat, protein yield lactation length in 305-d lactation, live weight (average cow live weight, growth rate between 12-24 mo and age at first calving traits were estimated in a population of Mestiço Leiteiro Brasileiro (MLB females using REML methodology and animal model. The estimates of heritability were respectively, 0.28± 0.08, 0.30±0.11, 0.28±0.09, 0.19±0.07, 0.18±0.06, 0.42±0.10 and 0.48±0.12 for those traits. Genetic correlations between milk, fat and protein yield with cow average weight were, respectively, -0.22±0.22, -0.49±0.31, -0.22±0.23, and between milk, fat and protein yield with heifer live weight gain, -0.59±0.35, -0.73±0.44, -0.62±0.37 as well. Genetic correlations between milk yield, cow average weight and heifer live weight gain with age at first calving were, respectively, 0.05±0.18, -0.05±0.18, 0.02±0.20. The high genetic correlation between milk production and lactation length (0.93±0.02 indicated that variation of the lactation length should not be removed when selecting tropical dairy cattle.

  1. The potential for transmission of BCG from orally vaccinated white-tailed deer (Odocoileus virginianus to cattle (Bos taurus through a contaminated environment: experimental findings.

    Directory of Open Access Journals (Sweden)

    Pauline Nol

    Full Text Available White-tailed deer (Odocoileus virginianus experimentally infected with a virulent strain of Mycobacterium bovis have been shown to transmit the bacterium to other deer and cattle (Bos taurus by sharing of pen waste and feed. The risk of transmission of M. bovis bacille Calmette-Guerin (BCG vaccine from orally vaccinated white-tailed deer to other deer and cattle, however, is not well understood. In order to evaluate this risk, we orally vaccinated 14 white-tailed deer with 1×10(9 colony forming units BCG in lipid-formulated baits and housed them with nine non-vaccinated deer. Each day we exposed the same seven naïve cattle to pen space utilized by the deer to look for transmission between the two species. Before vaccination and every 60 days until the end of the study, we performed tuberculin skin testing on deer and cattle, as well as interferon-gamma testing in cattle, to detect cellular immune response to BCG exposure. At approximately 27 weeks all cattle and deer were euthanized and necropsied. None of the cattle converted on either caudal fold, comparative cervical tests, or interferon-gamma assay. None of the cattle were culture positive for BCG. Although there was immunological evidence that BCG transmission occurred from deer to deer, we were unable to detect immunological or microbiological evidence of transmission to cattle. This study suggests that the risk is likely to be low that BCG-vaccinated white-tailed deer would cause domestic cattle to react to the tuberculin skin test or interferon-gamma test through exposure to a BCG-contaminated environment.

  2. Mitogenomes from Egyptian Cattle Breeds: New Clues on the Origin of Haplogroup Q and the Early Spread of Bos taurus from the Near East.

    Directory of Open Access Journals (Sweden)

    Anna Olivieri

    Full Text Available Genetic studies support the scenario that Bos taurus domestication occurred in the Near East during the Neolithic transition about 10 thousand years (ky ago, with the likely exception of a minor secondary event in Italy. However, despite the proven effectiveness of whole mitochondrial genome data in providing valuable information concerning the origin of taurine cattle, until now no population surveys have been carried out at the level of mitogenomes in local breeds from the Near East or surrounding areas. Egypt is in close geographic and cultural proximity to the Near East, in particular the Nile Delta region, and was one of the first neighboring areas to adopt the Neolithic package. Thus, a survey of mitogenome variation of autochthonous taurine breeds from the Nile Delta region might provide new insights on the early spread of cattle rearing outside the Near East.Using Illumina high-throughput sequencing we characterized the mitogenomes from two cattle breeds, Menofi (N = 17 and Domiaty (N = 14, from the Nile Delta region. Phylogenetic and Bayesian analyses were subsequently performed.Phylogenetic analyses of the 31 mitogenomes confirmed the prevalence of haplogroup T1, similar to most African cattle breeds, but showed also high frequencies for haplogroups T2, T3 and Q1, and an extremely high haplotype diversity, while Bayesian skyline plots pointed to a main episode of population growth ~12.5 ky ago. Comparisons of Nile Delta mitogenomes with those from other geographic areas revealed that (i most Egyptian mtDNAs are probably direct local derivatives from the founder domestic herds which first arrived from the Near East and the extent of gene flow from and towards the Nile Delta region was limited after the initial founding event(s; (ii haplogroup Q1 was among these founders, thus proving that it underwent domestication in the Near East together with the founders of the T clades.

  3. An interpretive review of selective sweep studies in Bos taurus cattle populations: identification of unique and shared selection signals across breeds.

    Directory of Open Access Journals (Sweden)

    Beatriz eGutiérrez-Gil

    2015-05-01

    Full Text Available This review compiles the results of 21 genomic studies of European Bos taurus breeds and thus provides a general picture of the selection signatures in taurine cattle identified by genome-wide selection-mapping scans. By performing a comprehensive summary of the results reported in the literature, we compiled a list of 1,049 selection sweeps described across 37 cattle breeds (17 beef breeds, 14 dairy breeds and 6 dual-purpose breeds, and four different beef-vs-dairy comparisons, which we subsequently grouped into core selective sweep (CSS regions, defined as consecutive signals within 1 Mb of each other. We defined a total of 409 CSSs across the 29 bovine autosomes, 232 (57% of which were associated with a single-breed (Single-breed CSSs, 134 CSSs (33% were associated with a limited number of breeds (Two-to-four-breed CSSs and 39 CSSs (9% were associated with five or more breeds (Multi-breed CSSs. For each CSS, we performed a candidate gene survey that identified 291 genes within the CSS intervals (from the total list of 5,183 BioMart-extracted genes linked to dairy and meat production, stature and coat colour traits. A complementary functional enrichment analysis of the CSS positional candidates highlighted other genes related to pathways underlying behaviour, immune response and reproductive traits. The Single-breed CSSs revealed an over-representation of genes related to dairy and beef production, this was further supported by over-representation of production-related pathway terms in these regions based on a functional enrichment analysis. Overall, this review provides a comparative map of the selection sweeps reported in European cattle breeds and presents for the first time a characterization of the selection sweeps that are found in individual breeds. Based on their uniqueness, these breed-specific signals could be considered as divergence signals, which may be useful in characterising and protecting livestock genetic diversity.

  4. Identification of a two-marker-haplotype on Bos taurus autosome 18 associated with somatic cell score in German Holstein cattle

    Directory of Open Access Journals (Sweden)

    Reinsch Norbert

    2009-09-01

    Full Text Available Abstract Background The somatic cell score (SCS is implemented in routine sire evaluations in many countries as an indicator trait for udder health. Somatic cell score is highly correlated with clinical mastitis, and in the German Holstein population quantitative trait loci (QTL for SCS have been repeatedly mapped on Bos taurus autosome 18 (BTA18. In the present study, we report a refined analysis of previously detected QTL regions on BTA18 with the aim of identifying marker and marker haplotypes in linkage disequilibrium with SCS. A combined linkage and linkage disequilibrium approach was implemented, and association analyses of marker genotypes and maternally inherited two-marker-haplotypes were conducted to identify marker and haplotypes in linkage disequilibrium with a locus affecting SCS in the German Holstein population. Results We detected a genome-wide significant QTL within marker interval 9 (HAMP_c.366+109G>A - BMS833 in the middle to telomeric region on BTA18 and a second putative QTL in marker interval 12-13 (BB710 - PVRL2_c.392G>A. Association analyses with genotypes of markers flanking the most likely QTL positions revealed the microsatellite marker BMS833 (interval 9 to be associated with a locus affecting SCS within the families investigated. A further analysis of maternally inherited two-marker haplotypes and effects of maternally inherited two-marker-interval gametes indicated haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A to be associated with SCS in the German Holstein population. Conclusion Our results confirmed previous QTL mapping results for SCS and support the hypothesis that more than one locus presumably affects udder health in the middle to telomeric region of BTA18. However, a subsequent investigation of the reported QTL regions is necessary to verify the two-QTL hypothesis and confirm the association of two-marker-haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A with SCS. For this

  5. Tissue-specific and minor inter-individual variation in imprinting of IGF2R is a common feature of Bos taurus Concepti and not correlated with fetal weight.

    Directory of Open Access Journals (Sweden)

    Daniela Bebbere

    Full Text Available The insulin-like growth factor 2 receptor (IGF2R is essential for prenatal growth regulation and shows gene dosage effects on fetal weight that can be affected by in-vitro embryo culture. Imprinted maternal expression of murine Igf2r is well documented for all fetal tissues excluding brain, but polymorphic imprinting and biallelic expression were reported for IGF2R in human. These differences have been attributed to evolutionary changes correlated with specific reproductive strategies. However, data from species suitable for testing this hypothesis are lacking. The domestic cow (Bos taurus carries a single conceptus with a similar gestation length as human. We identified 12 heterozygous concepti informative for imprinting studies among 68 Bos taurus fetuses at Day 80 of gestation (28% term and found predominantly maternal IGF2R expression in all fetal tissues but brain, which escapes imprinting. Inter-individual variation in allelic expression bias, i.e. expression of the repressed paternal allele relative to the maternal allele, ranged from 4.6-8.9% in heart, 4.3-10.2% in kidney, 6.1-11.2% in liver, 4.6-15.8% in lung and 3.2-12.2% in skeletal muscle. Allelic bias for mesodermal tissues (heart, skeletal muscle differed significantly (P<0.05 from endodermal tissues (liver, lung. The placenta showed partial imprinting with allelic bias of 22.9-34.7% and differed significantly (P<0.001 from all other tissues. Four informative fetuses were generated by in-vitro fertilization (IVF with embryo culture and two individuals displayed fetal overgrowth. However, there was no evidence for changes in imprinting or DNA methylation after IVF, or correlations between allelic bias and fetal weight. In conclusion, imprinting of Bos taurus IGF2R is similar to mouse except in placenta, which could indicate an effect of reproductive strategy. Common minor inter-individual variation in allelic bias and absence of imprinting abnormalities in IVF fetuses suggest

  6. INFLUÊNCIA DO GENÓTIPO BOS INDICUS NA ATIVIDADE DE CALPASTATINA E NA TEXTURA DA CARNE DE NOVILHOS ABATIDOS NO SUL DO BRASIL EFFECTS OF THE BOS INDICUS GENOTYPE ON CALPASTATIN ACTIVITIY AND TEXTURE OF BEEF FROM STEERS SLAUGHTERED IN THE SOUTH OF BRAZIL

    Directory of Open Access Journals (Sweden)

    Jane M. RUBENSAM

    1998-10-01

    Full Text Available Amostras de contrafilé (músculo L. dorsi provenientes de 26 bovinos, sendo 14 Polled Hereford (HH, sete 3/4Hereford 1/4Nelore (3/4H1/4N e cinco 5/8Hereford 3/8Nelore (5/8H3/8N, machos castrados, abatidos aos dois anos de idade, foram coletadas 24 h após o abate e analisadas quanto à atividade de calpastatina e textura, tanto no 1o dia post mortem quanto após um período de maturação de 10 dias a 2o C. A atividade de calpastatina foi determinada pelo ensaio de inibição da m-calpaína e a textura através da força de cisalhamento (Warner-Bratzler. A carne de novilhos 5/8H3/8N apresentou, no 1o dia, maiores (p0,05 entre os grupos HH e 3/4H1/4N para as mesmas características. Após 10 dias, houve uma diferença na atividade de calpastatina, porém não significativa (p>0,05, entre o grupo 5/8H3/8N (1,57U/g e os demais (HH=1,23U/g; 3/4H1/4N=1,35U/g, e diferença significativa entre os grupos HH e 5/8H3/8N para força de cisalhamento (3,67 e 5,00kg, respectivamente. Conclui-se que a atividade de calpastatina determinada 24 h post mortem pode ser útil para a previsão da textura da carne, maturada ou não, em programas de melhoramento genético, e que a participação crescente do genótipo Bos indicus nos rebanhos da Região Sul, a par das conhecidas vantagens zootécnicas, poderá resultar em carne de pior textura.Boneless rib steaks (L. dorsi muscle from 26 two years old steers, 14 Polled Hereford, seven 3/4Hereford 1/4Nelore (3/4H1/4N and five 5/8Hereford 3/8Nelore (5/8H3/8N, were collected 24 hs after slaughter and analysed for calpastatin activity and texture at the 1st day post mortem and at the 10th day of aging at 2o C. Calpastatin activity was determined by m-calpain inhibition assay and texture by shear force (Warner-Bratzler. Beef from 5/8H3/8N steers showed higher (p0.05 were detected in the same traits between groups HH and 3/4H1/4N. After 10 days of aging, there was a difference in calpastatin activity, although non

  7. Morfologia e grânulos citoplasmáticos do corpo lúteo de vacas aneloradas (Bos taurus indicus) gestantes e não gestantes

    OpenAIRE

    L.R. Vargas; P.R. Xavier; C.A. Rezende; M.M. Neves; A.P. Marques Júnior

    2015-01-01

    Avaliaram-se a proporção volumétrica dos constituintes do corpo lúteo e a distribuição de células lúteas com grânulos citoplasmáticos no corpo lúteo de animais Nelore ao longo da gestação e em animais não gestantes. Foram coletados ovários com corpos lúteos de 24 animais abatidos em frigorífico. Os animais foram distribuídos em dois grupos: gestantes e não gestantes. A idade gestacional foi determinada pela medição do comprimento apicocaudal do feto. Os ovários foram distribuídos segundo o tr...

  8. Digital infrared thermography of the scrotum, semen quality, serum testosterone levels in Nellore bulls (Bos taurus indicus) and their correlation with climatic factors

    OpenAIRE

    Felipe Rydygier de Ruediger; Marcelo George Mungai Chacur; Francisco Carlos Platzeck Estrella Alves; Eunice Oba; Alcides de Amorim Ramos

    2016-01-01

    The objective was to study the relationship of climatic conditions with the temperature of the scrotum surface and sperm quality through digital infrared thermography in Nellore bulls, raised extensively. In six bulls held with scrotal thermography Flir E40® cameras, blood samples for serum testosterone and semen collection were taken by electroejaculation every 10 days, with six replications. Climatic factors: ambient temperature, relative humidity, dry globe temperature and temperature of t...

  9. Digital infrared thermography of the scrotum, semen quality, serum testosterone levels in Nellore bulls (Bos taurus indicus and their correlation with climatic factors

    Directory of Open Access Journals (Sweden)

    Felipe Rydygier de Ruediger

    2016-02-01

    Full Text Available The objective was to study the relationship of climatic conditions with the temperature of the scrotum surface and sperm quality through digital infrared thermography in Nellore bulls, raised extensively. In six bulls held with scrotal thermography Flir E40® cameras, blood samples for serum testosterone and semen collection were taken by electroejaculation every 10 days, with six replications. Climatic factors: ambient temperature, relative humidity, dry globe temperature and temperature of the wet globe were recorded using a globe thermometer (InstruTemp®, ITWTG-2000. Thermal images of the scrotum were analyzed with the Flir Tools® software for the temperatures of scrotal surface, the right and left sides of the scrotum lap thirds: dorsal, middle and ventral testicles; and tails of the epididymis. The semen data and thermograms were submitted to ANOVA and Tukey’s test at 5%. Pearson correlation was used for the surface temperatures of the scrotum, rectal temperature, quantitative and qualitative characteristics of semen and climatic factors. There was a positive correlation (P<0.05 for sperm motility x scrotal temperatures; sperm concentration x scrotal temperatures; climatic factors x rectal temperature. There was a negative correlation (P<0.05 between ambient temperature x sperm concentration. It was concluded that the temperature of the scrotum surface and climatic factors, temperature and humidity, influence the quality of semen. Thermography is recommended as a supplementary examination for reproductive evaluation of bulls.

  10. Morfologia e grânulos citoplasmáticos do corpo lúteo de vacas aneloradas (Bos taurus indicus gestantes e não gestantes

    Directory of Open Access Journals (Sweden)

    L.R. Vargas

    2015-04-01

    Full Text Available Avaliaram-se a proporção volumétrica dos constituintes do corpo lúteo e a distribuição de células lúteas com grânulos citoplasmáticos no corpo lúteo de animais Nelore ao longo da gestação e em animais não gestantes. Foram coletados ovários com corpos lúteos de 24 animais abatidos em frigorífico. Os animais foram distribuídos em dois grupos: gestantes e não gestantes. A idade gestacional foi determinada pela medição do comprimento apicocaudal do feto. Os ovários foram distribuídos segundo o trimestre gestacional: primeiro - gestação de até 90 dias; segundo - de 91 a 180 dias; e terceiro - de 181 a 270 dias. Os corpos lúteos, processados para inclusão em paraplast, foram avaliados em microscópio de luz. Na proporção volumétrica do corpo lúteo, os constituintes avaliados foram citoplasma e núcleo de células lúteas, tecido conjuntivo e fibroblastos, células endoteliais e pericitos e vasos sanguíneos. A proporção volumétrica de citoplasma de células lúteas reduziu de 46,1±2,8% para 37,9±3,5% e a de núcleo de células lúteas reduziu de 9,2±1,0% para 6,2±1,0%, do primeiro para o segundo trimestre. A proporção de tecido conjuntivo e fibroblastos aumentou de 20,9±5,4%, no primeiro trimestre, para 34,0±4,2%, no segundo trimestre. Grânulos citoplasmáticos foram evidenciados pelas técnicas histoquímicas xylidine ponceau e azul de bromofenol, que indicam sua provável composição proteica. A quantidade de células maiores com grânulos aumentou significativamente de 2,3±1,9%, no primeiro trimestre, para 25,5±20,3%, no segundo. A proporção volumétrica de citoplasma e núcleo de células lúteas diminuiu ao longo da gestação, e a de tecido conjuntivo aumentou. A quantidade de células lúteas maiores contendo grânulos também aumentou ao longo da gestação.

  11. Response to GnRH on day 6 of the estrous cycle is diminished as the percentage of Bos indicus breeding increases in Angus, Brangus, and Brahman x Angus heifers.

    Science.gov (United States)

    Portillo, Germán E; Bridges, G Allen; de Araujo, Jennifer W; Shaw, Mary-Karen V; Schrick, F Neal; Thatcher, William W; Yelich, Joel V

    2008-01-15

    Angus (n=6), Brangus (5/8 Angus x 3/8 Brahman, n=6), and Brahman x Angus (3/8 Angus x 5/8 Brahman, n=6) heifers exhibiting estrous cycles at regular intervals were used to determine if the percentage of Bos indicus breeding influenced the secretory patterns of LH in response to a GnRH treatment on Day 6 of the estrous cycle. Heifers were pre-synchronized with a two-injection PGF(2 alpha) protocol (25 mg i.m. Day -14 and 12.5 mg i.m. Day -3 and -2 of experiment). Heifers received 100 microg GnRH i.m. on Day 6 of the subsequent estrous cycle. Blood samples were collected at -60, -30, and -1 min before GnRH and 15, 30, 60, 90, 120, 150, 180, 240, 300, 360, 420, and 480 min after GnRH to determine concentrations of serum LH. Estradiol concentrations were determined at -60, -30, and -1 min before GnRH. On Day 6 and 8, ovaries were examined by ultrasonography to determine if ovulation occurred. On Day 13, heifers received 25 mg PGF(2 alpha) i.m. and blood samples were collected daily until either the expression of estrus or Day 20 for heifers not exhibiting estrus to determine progesterone concentrations. There was no effect (P>0.10) of breed on ovulation rate to GnRH as well as size of the largest follicle, mean estradiol, and mean corpus luteum volume at GnRH. Mean LH was greater (PBrangus (4.6+/-0.8 ng/mL) and Brahman x Angus (2.9+/-0.8 ng/mL), which were similar (P>0.10). Mean LH peak-height was similar (P>0.10) for Brangus (13.9+/-3.4 ng/mL) compared to Angus (21.9+/-3.4 ng/mL) and Brahman x Angus (8.0+/-3.4 ng/mL), but was greater (P0.10) between breeds. As the percentage of Bos indicus breeding increased the amount of LH released in response to GnRH on Day 6 of the estrous cycle decreased. PMID:17212980

  12. An examination of positive selection and changing effective population size in Angus and Holstein cattle populations (Bos taurus using a high density SNP genotyping platform and the contribution of ancient polymorphism to genomic diversity in Domestic cattle

    Directory of Open Access Journals (Sweden)

    Hayes Ben

    2009-04-01

    Full Text Available Abstract Background Identifying recent positive selection signatures in domesticated animals could provide information on genome response to strong directional selection from domestication and artificial selection. With the completion of the cattle genome, private companies are now providing large numbers of polymorphic markers for probing variation in domestic cattle (Bos taurus. We analysed over 7,500 polymorphic single nucleotide polymorphisms (SNP in beef (Angus and dairy (Holstein cattle and outgroup species Bison, Yak and Banteng in an indirect test of inbreeding and positive selection in Domestic cattle. Results Outgroup species: Bison, Yak and Banteng, were genotyped with high levels of success (90% and used to determine ancestral and derived allele states in domestic cattle. Frequency spectrums of the derived alleles in Angus and Holstein were examined using Fay and Wu's H test. Significant divergences from the predicted frequency spectrums expected under neutrality were identified. This appeared to be the result of combined influences of positive selection, inbreeding and ascertainment bias for moderately frequent SNP. Approximately 10% of all polymorphisms identified as segregating in B. taurus were also segregating in Bison, Yak or Banteng; highlighting a large number of polymorphisms that are ancient in origin. Conclusion These results suggest that a large effective population size (Ne of approximately 90,000 or more existed in B. taurus since they shared a common ancestor with Bison, Yak and Banteng ~1–2 million years ago (MYA. More recently Ne decreased sharply probably associated with domestication. This may partially explain the paradox of high levels of polymorphism in Domestic cattle and the relatively small recent Ne in this species. The period of inbreeding caused Fay and Wu's H statistic to depart from its expectation under neutrality mimicking the effect of selection. However, there was also evidence for selection

  13. Perfil de ácidos grasos en leche de vacas Chinampas (Bos taurus alimentadas con forraje fresco de matorral sarcocaulescente o heno de alfalfa Fatty acids profile in milk of Chinampo cows (Bos taurus fed fresh forage from sarcocaulescent shrubs or alfalfa hay

    Directory of Open Access Journals (Sweden)

    R Ortega-Pérez

    2013-01-01

    Full Text Available El objetivo del estudio fue determinar la concentración de ácidos grasos (AG en la leche de vacas Chinampas, con énfasis en los ácidos grasos conjugados (CLA. Se colectó una muestra manual de leche (10 ml de 32 vacas entre los 60 y 120 días de lactación. Un grupo (FV; n = 25 se alimentó en pastoreo con forraje verde durante la estación de lluvias de septiembre a octubre de 2009 en una zona semiárida de matorral sarcocaulescente (Municipio La Paz, B.C.S.. Otro grupo (HA; n = 7 se mantuvo en corral y se alimentó con heno de alfalfa. El análisis cromatográfico revela que la concentración de AG saturados fue menor (P The objective of the present study was to determine the concentration of fatty acids (FA in the milk of Chinampo cows (Bos taurus, with emphasis on conjugated fatty acids (CLA. A sample of 10 ml was collected from 32 cows that had been lactating at least 60 days, but not longer than 120 days. A group (FV, n = 25 was free-ranged grazed on green fresh pasture (sarcocaulescent shrub semiarid area, La Paz, B.C.S. during the wet season (September-October 2009. The second group (HA, n = 7 was penned and fed fodder of alfalfa hay. The FA analysis revealed that there were less saturated FA in the FV group (P < 0.05. This difference was basically explained by the lesser content of 14:0, 15:0, and 16:0. The concentration of total monounsaturated FA was higher in FV (P < 0.05, given by the higher concentration of 18:1 n-9 and 18:1 n-7 trans-11. The total concentration of polyunsaturated FA was similar for both groups, but there was a higher concentration of 18:2 n-6 and 18:2 n-7 cis-9 trans-11 in the FV group (P < 0.01. The proportion of omega-3 FA was similar for both groups, but the concentration of omega-6 FA was higher in FV (P < 0.01, resulting in an increased omega-6:omega-3 ratios in the FV group compared to HA. It is concluded that Chinampo cows left to free-range on fresh green pasture reduced the total saturated FA of

  14. EFEITO DE UM PROBIÓTICO NO PERÍMETRO ESCROTAL E ESPERMIOGRAMA EM TOUROS JOVENS TABAPUÃ (Bos taurus indicus) (Nota Científica) EFFECT OF ONE PROBIOTIC ON SCROTAL PERIMETER AND SPERMIOGRAM IN YOUNG TABAPUA BULLS (Bos taurus indicus)

    OpenAIRE

    Valéria da Silva Gandolfo; Gabriella Biondi de Godoy; Andrea Novoa Castillo Oliveira; Marcelo George Mungai Chacur; Sérgio do Nascimento Kronka

    2009-01-01

    Neste experimento avaliou-se o efeito do probiótico Proenzime® no perímetro escrotal e espermiograma em touros jovens Tabapuã. Duas colheitas de sêmen de 21 touros Tabapuã, com trinta meses de idade, foram realizadas nos dias zero (D0) e 120 (D120) por eletroejaculação, totalizando 42 amostras. Dividiram-se os touros em grupo-controle (GC) com dez animais e grupo tratado (GT) com onze animais. Os to...

  15. EFEITO DE UM PROBIÓTICO NO PERÍMETRO ESCROTAL E ESPERMIOGRAMA EM TOUROS JOVENS TABAPUÃ (Bos taurus indicus (Nota Científica EFFECT OF ONE PROBIOTIC ON SCROTAL PERIMETER AND SPERMIOGRAM IN YOUNG TABAPUA BULLS (Bos taurus indicus

    Directory of Open Access Journals (Sweden)

    Valéria da Silva Gandolfo

    2009-04-01

    Full Text Available

    Neste experimento avaliou-se o efeito do probiótico Proenzime® no perímetro escrotal e espermiograma em touros jovens Tabapuã. Duas colheitas de sêmen de 21 touros Tabapuã, com trinta meses de idade, foram realizadas nos dias zero (D0 e 120 (D120 por eletroejaculação, totalizando 42 amostras. Dividiram-se os touros em grupo-controle (GC com dez animais e grupo tratado (GT com onze animais. Os touros do GT receberam 4g de probiótico/animal/dia, durante 120 dias. Houve diferença (p<0,01 entre as colheitas (D0 e D120 nos grupos GC e GT para o perímetro escrotal (GC – D0: 30,50 cm e D120: 33,55 cm; GT – D0: 29,90 cm e D120: 34,30 cm. Houve diferença (p<0,05 entre colheitas (D0 e D120 nos grupos GC e GT, respectivamente, para: defeitos menores (GC – D0: 13,84 % e D120: 21,79%; GT – D0: 14,99% e D120: 20,84% e defeitos totais (GC – D0: 22,29% e D120: 29,24%; GT – D0: 25,14% e D120: 32,81%. Os resultados demonstram que, entre grupos, não houve alteração significativa das características seminais e perímetro escrotal.
       
    PALAVRAS-CHAVES: Aditivo, nutrição, sêmen, touro.

    PALAVRAS-CHAVE: Touro, sêmen, nutrição, aditivo.    The objective of this experiment was to evaluate the effect of the probiotic Proenzime® on scrotal perimeter and spermiogram in young Tabapua bulls. Two samples of semen from 21 Tabapua bulls, aging 30 months, were collected in day zero (D0 and 120 (D120 by electroejaculation, totalizing 42 samples. The bulls were divided in control group (CG with 10 animals and trated group (TG with 11 animals. The bulls of TG received 4g of probiotic/animal/day, during 120 days. There was difference (p<0.01 between collects (D0 and D120 in the groups CG and TG for scrotal perimeter (CG – D0: 30.50 cm and D120: 33.55 cm; TG – D0: 29.90 cm and D120: 34.30 cm. There was difference (p<0.05 between collects (D0 and D120 in the groups CG and TG, respectively. Minor defects (CG – D0: 13.84% and D120: 21.79%; TG – D0: 14.99% and D120: 20.84% and total defects (CG – D0: 22.29% and D120: 29.24%; TG – D0: 25.14% and D120: 32.81%. The results exposed allow concluding that significant alterations were not observed between groups for the seminal characteristics and scrotal perimeter.   

    KEY WORDS: Aditive, bull, nutrition, semen.

  16. Perfil metabólico de touros da raça Nelore (Bos taurus indicus confinados e tratados com somatotrofina bovina recombinante (r-bST Metabolic and hormonal profile of feedlot Nellore bulls (Bos taurus indicus and treated with recombinant bovine somatotropin (r-bST

    Directory of Open Access Journals (Sweden)

    L.S. Amorim

    2007-04-01

    Full Text Available Avaliaram-se os efeitos da administração da somatotrofina bovina recombinante (r-bST sobre os metabólitos sangüíneos de touros da raça Nelore de duas diferentes idades. Foram utilizados 16 touros, distribuídos em um delineamento fatorial 2 x 2 (idades: jovens e adultos; r-bST: 0 e 500mg com quatro animais por tratamento. A idade média dos animais foi de 13,37 e 20,62 meses para jovens e adultos, respectivamente. Quatro animais por tratamento receberam, a cada 14 dias, solução salina ou 500mg de r-bST, totalizando nove aplicações por animal, em um período experimental de 120 dias. Os touros foram alimentados com silagem de milho e ração concentrada à base de farelo de milho e soja, duas vezes por dia, fornecidas em baias individuais. As coletas de sangue foram realizadas a cada três dias, para determinação da concentração dos metabólicos sangüíneos. Para análise estatística, foram compilados dados a intervalo de três aplicações, o que constituiu um período (período 1, 2 e 3. As concentrações de ácidos graxos não-esterificados (NEFA foram analisadas semanalmente. As concentrações séricas de colesterol, proteína total e plasmáticas de glicose diferiram para os períodos e nos grupos de tratamentos (P0,05.This study was carried out to evaluate the effect of recombinant bovine somatotropin (r-bST administration on profiles of blood metabolites of two different ages Nellore bulls. Sixteen bulls were randomly allotted in a factorial arrangement 2 x 2 (ages: youngs and adults; and r-bST dose: 0 and 500 mg with four animals per treatment. The mean ages of the young and adult animals were 13.37 and 20.62 months, respectively. Four animals per treatment received saline solution or r-bST 500mg, every 14 days, totaling nine applications per animal during 120 days. The Bulls were fed corn silage and concentrated diet based on corn crumb and soybean meal, twice a day, in individual stalls. Blood was collected every three days for metabolic evaluation. The statistical analyses of the data were performed in three applications, considering three periods (1, 2 and 3. Non-esterified fatty acid (NEFA concentrations were weekly analyzed. Serum cholesterol, total protein and glucose levels were affected either by period or the treatment (P0.05.

  17. Exploring genetic polymorphism in innate immune genes in Indian cattle (Bos indicus) and buffalo (Bubalus bubalis) using next generation sequencing technology.

    Science.gov (United States)

    Patel, Shreya M; Koringa, Prakash G; Nathani, Neelam M; Patel, Namrata V; Shah, Tejash M; Joshi, Chaitanya G

    2015-02-01

    Activation of innate immunity initiates various cascades of reactions that largely contribute to defense against physical, microbial or chemical damage, prompt for damage repair and removal of causative organisms as well as restoration of tissue homeostasis. Genetic polymorphism in innate immune genes plays prominent role in disease resistance capabilities in various breeds of cattle and buffalo. Here we studied single nucleotide variations (SNP/SNV) and haplotype structure in innate immune genes viz CHGA, CHGB, CHGC, NRAMP1, NRAMP2, DEFB1, BNBD4, BNBD5, TAP and LAP in Gir cattle and Murrah buffalo. Targeted sequencing of exonic regions of these genes was performed by Ion Torrent PGM sequencing platform. The sequence reads obtained corresponding to coding regions of these genes were mapped to reference genome of cattle BosTau7 by BWA program using genome analysis tool kit (GATK). Further variant analysis by Unified Genotyper revealed 54 and 224 SNPs in Gir and Murrah respectively and also 32 SNVs was identified. Among these SNPs 43, 36, 11,32,81,21 and 22 variations were in CHGA, CHGB, CHGC, NRAMP1, NRAMP2, DEFB1 and TAP genes respectively. Among these identified 278 SNPs, 24 were found to be reported in the dbSNP database. Variant analysis was followed by structure formation of haplotypes based on multiple SNPs using SAS software revealed a large number of haplotypes. The SNP discovery in innate immune genes in cattle and buffalo breeds of India would advance our understanding of role of these genes in determining the disease resistance/susceptibility in Indian breeds. The identified SNPs and haplotype data would also provide a wealth of sequence information for conservation studies, selective breeding and designing future strategies for identifying disease associations involving samples from distinct populations.

  18. Exploring genetic polymorphism in innate immune genes in Indian cattle (Bos indicus and buffalo (Bubalus bubalis using next generation sequencing technology

    Directory of Open Access Journals (Sweden)

    Shreya M. Patel

    2015-02-01

    Full Text Available Activation of innate immunity initiates various cascades of reactions that largely contribute to defense against physical, microbial or chemical damage, prompt for damage repair and removal of causative organisms as well as restoration of tissue homeostasis. Genetic polymorphism in innate immune genes plays prominent role in disease resistance capabilities in various breeds of cattle and buffalo. Here we studied single nucleotide variations (SNP/SNV and haplotype structure in innate immune genes viz CHGA, CHGB, CHGC, NRAMP1, NRAMP2, DEFB1, BNBD4, BNBD5, TAP and LAP in Gir cattle and Murrah buffalo. Targeted sequencing of exonic regions of these genes was performed by Ion Torrent PGM sequencing platform. The sequence reads obtained corresponding to coding regions of these genes were mapped to reference genome of cattle BosTau7 by BWA program using genome analysis tool kit (GATK. Further variant analysis by Unified Genotyper revealed 54 and 224 SNPs in Gir and Murrah respectively and also 32 SNVs was identified. Among these SNPs 43, 36, 11,32,81,21 and 22 variations were in CHGA, CHGB, CHGC, NRAMP1, NRAMP2, DEFB1 and TAP genes respectively. Among these identified 278 SNPs, 24 were found to be reported in the dbSNP database. Variant analysis was followed by structure formation of haplotypes based on multiple SNPs using SAS software revealed a large number of haplotypes. The SNP discovery in innate immune genes in cattle and buffalo breeds of India would advance our understanding of role of these genes in determining the disease resistance/susceptibility in Indian breeds. The identified SNPs and haplotype data would also provide a wealth of sequence information for conservation studies, selective breeding and designing future strategies for identifying disease associations involving samples from distinct populations.

  19. Efecto de la progesterona natural con o sin la adición de benzoato de estradiol sobre la presentación de celo, ovulación y gestación en animales tipo Bos indicus en el trópico mexicano Effect of natural progesterone with and without estradiol benzoate on the onset signs of oestrus, ovulation and pregnancy in Bos indicus cattle raised under mexican tropical conditions

    Directory of Open Access Journals (Sweden)

    G.S. DIAZ

    2002-01-01

    Full Text Available Se evaluó el efecto de un dispositivo intravaginal que contiene 1.9 g de progesterona y una cápsula de 10 mg de benzoato de estradiol (BE (CIDR-B®, seguido o no de la aplicación intramuscular de BE, a las 24 horas de retirado el dispositivo, y se observó el porcentaje de estro, ovulación y gestación. Se utilizaron 122 vacas (experimento 1 y 30 novillas (experimento 2 tipo Bos indicus, que fueron asignadas aleatoriamente a tres grupos:Grupo ST: 20 vacas y 10 novillas sin tratamiento; Grupo CIDR-BE: 51 vacas y 10 novillas con un dispositivo por 10 ó 13 días respectivamente; y Grupo CIDRB+ E: 51 vacas y 10 novillas con un dispositivo por 10 ó 13 días, además de una inyección a las 24 horas de 1 ó 2 mg de BE. La detección de estros se realizó mediante la observación visual, haciéndose durante 96 horas después de retirar el CIDR-B, y posteriormente entre los 17 a 24 días posteriores a cada período de servicios, hasta concluir los 90 días que duró el empadre. Las que presentaron estro entre los días 0 a 47 fueron servidas por IA y las que lo presentaron del 48 al 90 por monta natural. Se tomaron muestras sanguíneas para medir niveles de progesterona para corroborar ovulación. El diagnóstico de gestación se realizó por palpación rectal y ultrasonografía. Las variables categóricas se analizaron mediante la prueba exacta de Fisher y las continuas mediante t de Student. Las condiciones reproductivas previas de las vacas se relacionaron con celos, ovulación y gestación con un modelo lineal logarítmico del Proc CATMOD, SAS. En ambos experimentos el grupo CIDR-B+E presentó un alto porcentaje de estro, 92.2 y 90.0% para vacas y novillas, siendo diferente (pThe effect of a intravaginal device containing 1.9 g of progesterone and one capsule of 10 mg of estradiol benzoate (EB (CIDR-B was evaluated in Bos indicus cattle. Upon withdrawal, calculations regarding estrous rate, ovulation and pregnancy were considered. 122 Bos

  20. 杂交牛(大额牛×云南黄牛)朊蛋白基因的分子克隆及其序列分析%Molecular Cloning and Sequences Characteristics Analysis of the Prion Protein Gene from the Hybrids between Gayal (Bos frontalis)and Yunnan Yellow Cattle (Bos taurus)

    Institute of Scientific and Technical Information of China (English)

    刘情; 席冬梅; 陈学礼; 李继中; 杨舒黎; 邓卫东

    2012-01-01

    朊蛋白(prion protein,PRNP)基因编码朊蛋白,是引起疯牛病的主效基因.本研究利用PCR方法首次从杂交牛(大额牛×云南黄牛)基因组中扩增了PRNP基因,GenBank登录号为HQ875337.PCR产物直接双向测序表明,该序列包含杂交牛PRNP基因795 bp的开放阅读框(ORF),编码264个氨基酸前体蛋白.生物信息学分析结果发现,该蛋白包含1个信号肽、3个α螺旋、2个β折叠、6个八肽重复序列、1个疏水区域、1个二硫键和1个糖基磷脂酰肌醇锚定位点.与已报道的其他牛PRNP基因进行序列比对分析,核苷酸和氨基酸的同源性均在97%以上.%The priori protein was encoded by the prion protein (PRNP) gene which was the major gene for affecting mad cow disease or BSE. In the present study, the PCR method was used to amplify the PRNP gene from the hybrids between Gay-al (Bos frontalis) and Yunnan Yellow cattle (Bos taurus). The sequence was deposited in the GenBank under accession number HQ875337. The PCR products were sequenced bi-directly. By sequence analysis,the length of open read frame (ORF) of the PRNP gene was 795 bp, which encodes a protein of 264 amino acids,including a signal region,a octapeptide repeat,three α-heli-ces.two β-sheets,a hydrophobic region,a disulfide bridge, a glycosyl phosphatidyl inositol (GPI) anchor site. The homology of both nucleotide and amino acid sequences with other cattle was more than 97%. All this will provide the molecular basal data for breakthrough of transmissible spongiform encephalopathy among different animal species.

  1. Ovarian, hormonal, and reproductive events associated with synchronization of ovulation and timed appointment breeding of Bos indicus-influenced cattle using intravaginal progesterone, gonadotropin-releasing hormone, and prostaglandin F2alpha.

    Science.gov (United States)

    Saldarriaga, J P; Cooper, D A; Cartmill, J A; Zuluaga, J F; Stanko, R L; Williams, G L

    2007-01-01

    The objectives of this study were to 1) compare cumulative pregnancy rates in a traditional management (TM) scheme with those using a synchronization of ovulation protocol (CO-Synch + CIDR) for timed AI (TAI) in Bos indicus-influenced cattle; 2) evaluate ovarian and hormonal events associated with CO-Synch + CIDR and CO-Synch without CIDR; and 3) determine estrual and ovulatory distributions in cattle synchronized with Select-Synch + CIDR. The CO-Synch + CIDR regimen included insertion of a controlled internal drug-releasing device (CIDR) and an injection of GnRH (GnRH-1) on d 0, removal of the CIDR and injection of PGF2alpha (PGF) on d 7, and injection of GnRH (GnRH-2) and TAI 48 h later. For Exp. 1, predominantly Brahman x Hereford (F1) and Brangus females (n = 335) were stratified by BCS, parity, and day postpartum (parous females) before random assignment to CO-Synch + CIDR or TM. To maximize the number of observations related to TAI conception rate (n = 266), an additional 96 females in which TM controls were not available for comparison also received CO-Synch + CIDR. Conception rates to TAI averaged 39 +/- 3% and were not affected by location, year, parity, AI sire, or AI technician. Cumulative pregnancy rates were greater (P < 0.05) at 30 and 60 d of the breeding season in CO-Synch + CIDR (74.1 and 95.9%) compared with TM (61.8 and 89.7%). In Exp. 2, postpartum Brahman x Hereford (F1) cows (n = 100) were stratified as in Exp. 1 and divided into 4 replicates of 25. Within each replicate, approximately one-half (12 to 13) received CO-Synch + CIDR, and the other half received CO-Synch only (no CIDR). No differences were observed between treatments, and the data were pooled. Percentages of cows ovulating to GnRH-1, developing a synchronized follicular wave, exhibiting luteal regression to PGF, and ovulating to GnRH-2 were 40 +/- 5, 60 +/- 5, 93 +/- 2, and 72 +/- 4%, respectively. In Exp. 3, primiparous Brahman x Hereford, (F1) heifers (n = 32) and pluriparous

  2. Ovarian, hormonal, and reproductive events associated with synchronization of ovulation and timed appointment breeding of Bos indicus-influenced cattle using intravaginal progesterone, gonadotropin-releasing hormone, and prostaglandin F2alpha.

    Science.gov (United States)

    Saldarriaga, J P; Cooper, D A; Cartmill, J A; Zuluaga, J F; Stanko, R L; Williams, G L

    2007-01-01

    The objectives of this study were to 1) compare cumulative pregnancy rates in a traditional management (TM) scheme with those using a synchronization of ovulation protocol (CO-Synch + CIDR) for timed AI (TAI) in Bos indicus-influenced cattle; 2) evaluate ovarian and hormonal events associated with CO-Synch + CIDR and CO-Synch without CIDR; and 3) determine estrual and ovulatory distributions in cattle synchronized with Select-Synch + CIDR. The CO-Synch + CIDR regimen included insertion of a controlled internal drug-releasing device (CIDR) and an injection of GnRH (GnRH-1) on d 0, removal of the CIDR and injection of PGF2alpha (PGF) on d 7, and injection of GnRH (GnRH-2) and TAI 48 h later. For Exp. 1, predominantly Brahman x Hereford (F1) and Brangus females (n = 335) were stratified by BCS, parity, and day postpartum (parous females) before random assignment to CO-Synch + CIDR or TM. To maximize the number of observations related to TAI conception rate (n = 266), an additional 96 females in which TM controls were not available for comparison also received CO-Synch + CIDR. Conception rates to TAI averaged 39 +/- 3% and were not affected by location, year, parity, AI sire, or AI technician. Cumulative pregnancy rates were greater (P breeding season in CO-Synch + CIDR (74.1 and 95.9%) compared with TM (61.8 and 89.7%). In Exp. 2, postpartum Brahman x Hereford (F1) cows (n = 100) were stratified as in Exp. 1 and divided into 4 replicates of 25. Within each replicate, approximately one-half (12 to 13) received CO-Synch + CIDR, and the other half received CO-Synch only (no CIDR). No differences were observed between treatments, and the data were pooled. Percentages of cows ovulating to GnRH-1, developing a synchronized follicular wave, exhibiting luteal regression to PGF, and ovulating to GnRH-2 were 40 +/- 5, 60 +/- 5, 93 +/- 2, and 72 +/- 4%, respectively. In Exp. 3, primiparous Brahman x Hereford, (F1) heifers (n = 32) and pluriparous cows (n = 18) received the

  3. NCBI nr-aa BLAST: CBRC-RMAC-01-0084 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-01-0084 ref|XP_594146.3| PREDICTED: Toll-like receptor 5 [Bos taurus] gb|...ABC68311.1| toll-like receptor 5 [Bos taurus] gb|ABU86924.1| Toll-like receptor 5 [Bos taurus x Bos indicus]... gb|ABU86926.1| Toll-like receptor 5 [Bos taurus] gb|ABU86927.1| Toll-like receptor 5 [Bos taurus] gb|ABU869...28.1| Toll-like receptor 5 [Bos taurus] gb|ABU86929.1| Toll-like receptor 5 [Bos tau...rus] gb|ABU86931.1| Toll-like receptor 5 [Bos taurus x Bos indicus] gb|ABU86932.1| Toll-like receptor 5 [Bos taurus x Bos indicus] XP_594146.3 0.0 78% ...

  4. NCBI nr-aa BLAST: CBRC-TNIG-22-0261 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TNIG-22-0261 ref|XP_594146.3| PREDICTED: Toll-like receptor 5 [Bos taurus] gb|...ABC68311.1| toll-like receptor 5 [Bos taurus] gb|ABU86924.1| Toll-like receptor 5 [Bos taurus x Bos indicus]... gb|ABU86926.1| Toll-like receptor 5 [Bos taurus] gb|ABU86927.1| Toll-like receptor 5 [Bos taurus] gb|ABU869...28.1| Toll-like receptor 5 [Bos taurus] gb|ABU86929.1| Toll-like receptor 5 [Bos tau...rus] gb|ABU86931.1| Toll-like receptor 5 [Bos taurus x Bos indicus] gb|ABU86932.1| Toll-like receptor 5 [Bos taurus x Bos indicus] XP_594146.3 9e-85 39% ...

  5. Detecção imunoistoquímica de receptores de estrógeno e progesterona no endométrio de vacas Nelore (Bos taurus indicus durante o anestro pós-parto

    Directory of Open Access Journals (Sweden)

    R.S. Lima

    2011-08-01

    Full Text Available Foram utilizadas 24 vacas Nelore P.O., em anestro pós-parto, diagnosticado pelo histórico reprodutivo, por avaliações ultrassonográficas transretais e por dosagem de progesterona plasmática, que foram submetidas à colheita de fragmento uterino via transcervical. Os animais foram divididos em dois grupos conforme o máximo diâmetro folicular: grupo 1: folículos 6mm (n=12. Para avaliar receptor de estrógeno e receptor de progesterona no epitélio glandular e no estroma, foi utilizada a técnica de imunoistoquímica. Altas contagens relativas e alta intensidade de marcação para receptor de estrógeno e progesterona no epitélio glandular e no estroma foram observadas nos dois grupos. No entanto, a intensidade de marcação para o receptor de progesterona no epitélio glandular foi mais alta no grupo 2 comparado ao grupo 1. Quando o epitélio glandular e o estroma foram comparados, o número relativo de receptor de estrógeno no grupo 1 foi mais alto no epitélio glandular comparado ao estroma, e a intensidade de marcação para o receptor de progesterona no grupo 2 foi mais alta no epitélio glandular comparado ao estroma. Os resultados sugerem que os mecanismos que controlam a expressão de receptores no anestro são semelhantes aos observados durante o ciclo estral.

  6. Detecção imunoistoquímica de receptores de estrógeno e progesterona no endométrio de vacas Nelore (Bos taurus indicus) durante o anestro pós-parto

    OpenAIRE

    Lima, R S; I. Martin; W.C. Marques Filho; M.M.P. Rodrigues; R Laufer-Amorim; Ferreira, J.C.P.

    2011-01-01

    Foram utilizadas 24 vacas Nelore P.O., em anestro pós-parto, diagnosticado pelo histórico reprodutivo, por avaliações ultrassonográficas transretais e por dosagem de progesterona plasmática, que foram submetidas à colheita de fragmento uterino via transcervical. Os animais foram divididos em dois grupos conforme o máximo diâmetro folicular: grupo 1: folículos 6mm (n=12). Para avaliar receptor de estrógeno e receptor de progesterona no epitélio glandular e no estroma, foi utilizada a técnica d...

  7. Parámetros protéicos del plasma seminal y su relación con la calidad del semen en toros de la raza nelore (bos taurus indicus

    Directory of Open Access Journals (Sweden)

    Ana Sánchez

    2006-10-01

    Full Text Available El propósito de este estudio fue investigar la presenciae incidencia de bandas proteicas específicas delplasma seminal en toros Nelore, completa y parcialmente aptos para la actividad reproductiva. Se utilizaron 68 ejemplares; 20 de variedad Padrón y 48 Mochos, con edad media de 4 años. En el perímetro escrotal (35,05±0,49 cm e 33,30±0,39cm, índice de masa corpórea (302,62±5,87 e 284,19±5,15Kg|m2 hubo diferencia (p<0,05 entre las variedades Padrón y Mocho, respectivamente. Con respecto al peso corpóreo (627,70±11,37 e 611,58±8,66Kg; la altura (1,44±0,01e 1,47±0,01m; el volumen del eyaculado (5,82±0,48 e 5,17±0,29 mL, la motilidad espermática progresiva (73,50±2,81% e75,62±0,97%, el vigor espermático (4,30±0,19 e4,27±0,11 y motilidad en masa (4,27±0,11 e3,33±0,23 no se presentó diferencia (p>0,05. En morfología espermática, tampoco hubo desigualdad entre las variedades Padrón y Mocho, respectivamente con 5,06 ± 8,20% e 5,32 ± 6,40% de defectos mayores; 9,91±6,74% e 8,36±6,06% para los defectos menores; e 14,76±13,20% e 13,82±12,61% para los defectos totales. La electroforesis del plasma seminal reveló bandas proteicas con pesos entre 5 a 105 KDa. En el 100% de toros aptos para la reproducción, la proteína con pesos de 13 Kda estuvo presente. De la misma forma ocurrió con las bandas de 20 KDa. El resto de las bandas proteicas mostraron presencia con diferentes porcentajes de incidencia en toros aptos o parcialmente aptos para la actividad reproductiva. Las dos variedades estudiadas hicieron evidente la adaptación reproductiva eficaz en condiciones de clima semejantes.

  8. Influência de diferentes concentrações de etileno glicol nO número de células da granulosa e morfometria de folículos pré-antrais inclusos em tecido ovariano de Bos taurus indicus, Linnaeus, 1758 Influence of different concentrations of the glycol in the number of granulosa cells and morphometry of the preantral ovarian follicles of Bos taurus indicus, Linnaeus, 1758

    Directory of Open Access Journals (Sweden)

    Hélder Silva e Luna

    2010-12-01

    Full Text Available A criopreservação de folículos ovarianos pré-antrais pode ajudar na conservação de muitas espécies domésticas e selvagens. Neste trabalho, objetivou-se verificar o efeito do etileno glicol, em diferentes concentrações, na morfometria e número de células da granulosa de folículos pré-antrais inclusos em tecido ovariano bovino. O teste de toxicidade foi realizado com fragmentos ovarianos expostos ao etileno glicol em concentrações de 10, 20 ou 40%. O tecido foi analisado por técnica histológica clássica. Os folículos primordiais expostos à concentração de 40% apresentaram redução do diâmetro folicular e ovocitário quando comparados ao grupo controle (sem exposição, 10% e 20% (P0,05. Esses resultados sugerem que folículos primários são mais resistentes aos efeitos do etileno glicol quando comparados aos primordiais.The cryopreservation of the ovarian preantral follicles could help the conservation of several domestic and wild animal species. The objective of this study was to verify the effect of different concentrations of ethylene glycol on the morphometry and number of granulosa cells of the preantral ovarian follicles. A toxicity test was conducted with strips of ovarian cortex using ethylene glycol (10, 20 or 40%. Tissue analysis was done using classical histology techniques. The primordial follicles expose at a concentration of 40% showed reduction of the follicular diameter and oocyte when compared to the control (non exposing, 10 and 20% groups (P0.05. These results suggest that primary follicles are more resistant to the effect of ethylene glycol when compared to primordial ones.

  9. NCBI nr-aa BLAST: CBRC-TTRU-01-1041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1041 gb|ABU86942.1| Toll-like receptor 10 [Bos taurus x Bos indicus] g...b|ABU86944.1| Toll-like receptor 10 [Bos taurus] gb|ABU86945.1| Toll-like receptor 10 [Bos taurus] gb|ABU869...46.1| Toll-like receptor 10 [Bos taurus] gb|ABU86949.1| Toll-like receptor 10 [Bos taurus x Bos indicus] ABU86942.1 0.0 83% ...

  10. NCBI nr-aa BLAST: CBRC-PVAM-01-0803 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0803 gb|ABU86942.1| Toll-like receptor 10 [Bos taurus x Bos indicus] g...b|ABU86944.1| Toll-like receptor 10 [Bos taurus] gb|ABU86945.1| Toll-like receptor 10 [Bos taurus] gb|ABU869...46.1| Toll-like receptor 10 [Bos taurus] gb|ABU86949.1| Toll-like receptor 10 [Bos taurus x Bos indicus] ABU86942.1 0.0 83% ...

  11. NCBI nr-aa BLAST: CBRC-VPAC-01-1397 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1397 gb|ABU86942.1| Toll-like receptor 10 [Bos taurus x Bos indicus] g...b|ABU86944.1| Toll-like receptor 10 [Bos taurus] gb|ABU86945.1| Toll-like receptor 10 [Bos taurus] gb|ABU869...46.1| Toll-like receptor 10 [Bos taurus] gb|ABU86949.1| Toll-like receptor 10 [Bos taurus x Bos indicus] ABU86942.1 0.0 88% ...

  12. Desenvolvimento folicular no pós-parto de vacas da raça Gir tratadas com acetato de buserelina (GnRH ou gonadotrofina coriônica humana (hCG Follicular development in Gir breed cows (Bos indicus treated with buserelin acetate or human chorionic gonadotrophin during the postpartum period

    Directory of Open Access Journals (Sweden)

    Álan Maia Borges

    2004-12-01

    Full Text Available Foram utilizadas 22 vacas da raça Gir (Bos indicus em anestro pós-parto, amamentando e mantidas sob regime de pastejo. O padrão de crescimento folicular foi estudado em 15 animais, enquanto os outros sete foram utilizados somente no acompanhamento da resposta aos tratamentos hormonais. Ultra-sonografia em tempo real foi realizada diariamente, do quarto ao qüinquagésimo dia de lactação, por meio de aparelho equipado com probe de 5MHz. Nenhum animal apresentou estro, ovulação ou luteinização folicular durante o período de avaliação. Verificaram-se quatro a oito ondas foliculares surgindo em intervalos de seis a sete dias, cujo diâmetro máximo dos folículos dominantes e subordinados foi de 8,9±0,6 e 6,3±0,7mm, respectivamente. Aos 56 dias pós-parto, as 22 vacas foram divididas em dois grupos: 11 tratadas com 4,2 mig de acetato de buserelina e 11 com 3.000UI de hCG. A ovulação, regressão e luteinização folicular foram verificadas em animais dos dois tratamentos e uma nova onda folicular surgiu dentro de dois a três dias após a terapia hormonal. Corpos lúteos de menor tamanho e concentrações de progesterona abaixo de 1ng/mL indicaram baixa atividade luteal.This experiment was carried out with 22 anestrus Gir cows (Bos indicus, with the postpartum follicular growth studied in 15 of these suckling and kept on pasture, while the seven others were used only for hormonal treatments. Daily real time ultrasonography was done from 4th to the 50th day, using B-mode ultrasound scanner equipped with a linear array 5.0MHz probe. No animal showed estrus, ovulation or follicular luteinization during de experimental period. Four to eight follicular waves emerged each six or seven days and maximum diameter of dominant and subordinate follicles were 8.9±0.6mm and 6.3±0.7mm, respectively. On day 56 of postpartum all cows were separated in two groups: 11 cows were treated either with 4.2 mug of buserelin acetate and 11 with 3,000UI of h

  13. Alteración diurna de la carga calórica corporal e interrelación de las temperaturas rectal y láctea en vacas cruzadas (6/8 Bos taurus x 2/8 Bos indicus, Pardo Suizo y Holstein bajo estrés calórico diurno durante la época seca en el clima tropical húmedo - Daytime alteration of body heat load and relationship between rectal and milk temperatures in crossbred (6/8 Bos taurus x 2/8 Bos indicus, Brown Swiss and Holstein lactating cows under heat stress during summer time in the humid tropical climate

    Directory of Open Access Journals (Sweden)

    Araúz, E. E.

    2010-11-01

    Full Text Available ResumenLas temperaturas rectal y de la secreción láctea y la carga calóricacorporal fueron evaluadas en 191 vacas en lactación (cruzadas 6/8Pardo Suizo x 2/8 Cebú y 6/8 Holstein x 2/8 Cebú: 27; Pardo Suizo:131; y Holstein: 33; bajo estrés calórico diurno en la época secadistribuidas entre 45 y 1064 msnm; con el objetivo de establecer laalteración diurna y su interrelación según el grupo genético y el grado de sensibilidad calórica.SummaryRectal and milk temperatures were measured in the afternoon (2 PM to4 PM in 191 lactating dairy cows (6/8 Brown Swiss x 2/8 Zebu and 6/8Holstein x 2/8 Zebu: 27, Brown Swiss: 131 and Holstein: 33 underheat stress in the tropical environment to evaluate daytime alterationof body heat load and establish the relationship between rectal andmilk temperature.

  14. Construction of Bovine (Bos taurus) Transgenic Cloned Embryos with Lysostaphin and Endolysin Genes by Electronic Transfection%电转染法制备奶牛转溶葡球菌酶(Lysostaphin)和内溶素(Endolysin)基因胚胎

    Institute of Scientific and Technical Information of China (English)

    杨林; 杜卫华; 郝海生; 刘岩; 秦彤; 赵学明; 王栋; 朱化彬; 王宗礼

    2013-01-01

    Lysostaphin is a single chain protease containing zinc which can kill staphylococcus aureus effectively. Endolysin which is the peculiar of the double-stranded DNA bacteriophages is a murein hydrolytic enzyme, it has a wide range of antibacterial effect. Lysostaphin and Endolysin have the high synergistic effect. In this study, the vectors pBCl-seq2 +seq3-EGFP-neo containing Endolysin and Lysostaphin genes and two other marker genes of enhenced green fluorescent protein (EGFP) andneomycin (neo) were transfected into bovine (Bos taurus) fetal fibroblast by electroporation and nucleofector of AMAXA. Stable transfected monoclonal cells which were identified to be the positive-cells in the way of PCR technique were obtained through fluorescence and G418 selection. Using transfected cells as the donor, transfected embryos were produced with somatic cell nuclear transfer, we used different conditions of AMAXA nuleofecor(A-023,V-013, V-023 and T-016) to transfect bovine fetal fibroblast, the results showed the suitable program was T-016. There were 5 times transfection efficient of AMAXA nuleofecor (20.11%) than it of electroporation. The blastocyst developed normally and the rate was of it 20.08%. In our study, we built up bovine fetal fibroblast cell line, sought out transfection parameter of high transfection efficiency, and acquired transgenic cell lines and transgenic blastocyst containing Lysostaphin and Endolysin genes, In conclusion, the results can provide technology supporting for producing anti-mastitis transgenic bovine and searching the new therapy way of mastitis.%溶葡球菌酶(Lysostaphin)是一种含锌的单链蛋白酶,能有效地杀灭金黄色葡萄球菌.内溶素(Endolysin)是双链DNA噬菌体所特有,是一类胞壁质水解酶,具有广泛的抗菌效果.内溶素与抗生素之间有高效的协同作用.本研究通过BTX电转染和AMAXA核转染的方法将含有溶葡球菌酶(Lysostaphin)和内溶素(Endolysin)两个目的基因(Seq2

  15. Modelos de regresión aleatoria para la estimación de funciones de covarianza, parámetros genéticos y predicción de valores genéticos en una población bovina multirracial bos indicus-bos taurus en colombia

    OpenAIRE

    Martínez, Carlos Alberto; Elzo, Mauricio; Manrique, Carlos; Grajales, Luis Fernando; Jiménez, Ariel

    2011-01-01

    En este trabajo presentamos una aplicación de modelos de regresión aleatoria (RRM) para obtener estimadores de máxima verosimilitud restringida de funciones de covarianza y predicciones del valor genético para datos longitudinales de área de ojo del lomo medidos por ultrasonido (REA) en una población bovina multirracial en Colombia. El conjunto de datos contenía 708 registros de 340 animales descendientes de 37 toros de 9 razas apareados con hembras Brahman Gris. Los modelos mixtos empleados ...

  16. Impact of Bos indicus genetics on the global beef industry

    Science.gov (United States)

    More than half of the cattle in the world are maintained in tropical environments between the tropics of Cancer and Capricorn. In the U.S., about 40% of the beef cows are located in subtropical environments of the hot and humid Southeast or more arid Southwest. Results of research documenting the ...

  17. Study of the temperament of bos indicus calves on weaning

    OpenAIRE

    Gustavo da Silva Freitas; Paola Moretti Rueda; Tiago da Silva Valente; Luísa Cunha Carneiro; Mateus José Rodrigues Paranhos da Costa

    2012-01-01

    Ones of the largest commercial cattle herd in the world, Brazil has its cattle characterized by the use of an extensive system and the predominance of zebu breeds, especially the Nelore and its crosses. In this system the temperament of cattle becomes a problem because of the low human-animal interaction, and bad-tempered animals can cause accidents, increase maintenance costs of facilities and provide poorer quality of the carcass, meat and leather. The aim of this study was to evaluate the ...

  18. Comparison of Skin Characterizes Between Pure Breed and Crossbred Azeri Zebu (Bos primigenius indicus or Bos indicus

    Directory of Open Access Journals (Sweden)

    Alireza Lotfi

    2011-02-01

    Full Text Available For investigation of crossbreeding efficiency in some skin characterizes in pure and crossbred cattle with Azeri Zebu, 100 head Azeri Zebu and pure breeds were divided into 4 group in 4 treatments, randomly. After cross breeding between zebu and pure cattle breeds, the diameters of skin in different parts of body were significantly increased in hybrids (offspring. Zebu hybrids, because of their strength epidemic layer on slat and legs had deep skin in compare with parents. Skin area were measured at two different parts, that more than 60% of skin were include 5 mm diameter in hybrids. As conclusion; in this investigation it has been cleared that cross-breeding in Azeri zebu (with pure cattle breeds can cause deep diameter of skin that also it can produce high quality skin for leather and shoe Industry.

  19. Polymorphism and Mobilization of Rransposons in Bos taurus

    DEFF Research Database (Denmark)

    Guldbrandtsen, Bernt; Sahana, Goutam; Lund, Mogens Sandø

    ,983 sites were polymorphic. Some were absent in one or more of the breeds, including 680 which were absent in the Jersey breed, but only 13 were completely absent in all dairy breeds. The fact that so many of the putative retrotransposons are polymorphic, suggests that retrotransposition has been happening...

  20. Bovine gene polymorphisms related to fat deposition and meat tenderness.

    Science.gov (United States)

    Fortes, Marina R S; Curi, Rogério A; Chardulo, Luis Artur L; Silveira, Antonio C; Assumpção, Mayra E O D; Visintin, José Antonio; de Oliveira, Henrique N

    2009-01-01

    Leptin, thyroglobulin and diacylglycerol O-acyltransferase play important roles in fat metabolism. Fat deposition has an influence on meat quality and consumers' choice. The aim of this study was to determine allele and genotype frequencies of polymorphisms of the bovine genes, which encode leptin (LEP), thyroglobulin (TG) and diacylglycerol O-acyltransferase (DGAT1). A further objective was to establish the effects of these polymorphisms on meat characteristics. We genotyped 147 animals belonging to the Nelore (Bos indicus), Canchim (5/8 Bos taurus + 3/8 Bos indicus), Rubia Gallega X Nelore (1/2 Bos taurus + 1/2 Bos indicus), Brangus Three-way cross (9/16 Bos taurus + 7/16 Bos indicus) and Braunvieh Three-way cross (3/4 Bos taurus + 1/4 Bos indicus) breeds. Backfat thickness, total lipids, marbling score, ribeye area and shear force were fitted, using the General Linear Model (GLM) procedure of the SAS software. The least square means of genotypes and genetic groups were compared using Tukey's test. Allele frequencies vary among the genetic groups, depending on Bos indicus versus Bos taurus influence. The LEP polymorphism segregates in pure Bos indicus Nelore animals, which is a new finding. The T allele of TG is fixed in Nelore, and DGAT1 segregates in all groups, but the frequency of allele A is lower in Nelore animals. The results showed no association between the genotypes and traits studied, but a genetic group effect on these traits was found. So, the genetic background remains relevant for fat deposition and meat tenderness, but the gene markers developed for Bos taurus may be insufficient for Bos indicus.

  1. Bovine gene polymorphisms related to fat deposition and meat tenderness

    Directory of Open Access Journals (Sweden)

    Marina R.S. Fortes

    2009-01-01

    Full Text Available Leptin, thyroglobulin and diacylglycerol O-acyltransferase play important roles in fat metabolism. Fat deposition has an influence on meat quality and consumers' choice. The aim of this study was to determine allele and genotype frequencies of polymorphisms of the bovine genes, which encode leptin (LEP, thyroglobulin (TG and diacylglycerol O-acyltransferase (DGAT1. A further objective was to establish the effects of these polymorphisms on meat characteristics. We genotyped 147 animals belonging to the Nelore (Bos indicus, Canchim (5/8 Bos taurus + 3/8 Bos indicus, Rubia Gallega X Nelore (1/2 Bos taurus + 1/2 Bos indicus, Brangus Three-way cross (9/16 Bos taurus + 7/16 Bos indicus and Braunvieh Three-way cross (3/4 Bos taurus + 1/4 Bos indicus breeds. Backfat thickness, total lipids, marbling score, ribeye area and shear force were fitted, using the General Linear Model (GLM procedure of the SAS software. The least square means of genotypes and genetic groups were compared using Tukey's test. Allele frequencies vary among the genetic groups, depending on Bos indicus versus Bos taurus influence. The LEP polymorphism segregates in pure Bos indicus Nelore animals, which is a new finding. The T allele of TG is fixed in Nelore, and DGAT1 segregates in all groups, but the frequency of allele A is lower in Nelore animals. The results showed no association between the genotypes and traits studied, but a genetic group effect on these traits was found. So, the genetic background remains relevant for fat deposition and meat tenderness, but the gene markers developed for Bos taurus may be insufficient for Bos indicus.

  2. Bovine gene polymorphisms related to fat deposition and meat tenderness.

    Science.gov (United States)

    Fortes, Marina R S; Curi, Rogério A; Chardulo, Luis Artur L; Silveira, Antonio C; Assumpção, Mayra E O D; Visintin, José Antonio; de Oliveira, Henrique N

    2009-01-01

    Leptin, thyroglobulin and diacylglycerol O-acyltransferase play important roles in fat metabolism. Fat deposition has an influence on meat quality and consumers' choice. The aim of this study was to determine allele and genotype frequencies of polymorphisms of the bovine genes, which encode leptin (LEP), thyroglobulin (TG) and diacylglycerol O-acyltransferase (DGAT1). A further objective was to establish the effects of these polymorphisms on meat characteristics. We genotyped 147 animals belonging to the Nelore (Bos indicus), Canchim (5/8 Bos taurus + 3/8 Bos indicus), Rubia Gallega X Nelore (1/2 Bos taurus + 1/2 Bos indicus), Brangus Three-way cross (9/16 Bos taurus + 7/16 Bos indicus) and Braunvieh Three-way cross (3/4 Bos taurus + 1/4 Bos indicus) breeds. Backfat thickness, total lipids, marbling score, ribeye area and shear force were fitted, using the General Linear Model (GLM) procedure of the SAS software. The least square means of genotypes and genetic groups were compared using Tukey's test. Allele frequencies vary among the genetic groups, depending on Bos indicus versus Bos taurus influence. The LEP polymorphism segregates in pure Bos indicus Nelore animals, which is a new finding. The T allele of TG is fixed in Nelore, and DGAT1 segregates in all groups, but the frequency of allele A is lower in Nelore animals. The results showed no association between the genotypes and traits studied, but a genetic group effect on these traits was found. So, the genetic background remains relevant for fat deposition and meat tenderness, but the gene markers developed for Bos taurus may be insufficient for Bos indicus. PMID:21637649

  3. Revisiting AFLP fingerprinting for an unbiased assessment of genetic structure and differentiation of taurine and zebu cattle

    NARCIS (Netherlands)

    Utsunomiya, Yuri T.; Bomba, Lorenzo; Lucente, Giordana; Colli, Licia; Negrini, Riccardo; Lenstra, Johannes A.; Erhardt, Georg; Garcia, José F.; Ajmone-Marsan, Paolo; Moazami-Goudarzi, K.; Williams, J.; Wiener, P.; Olsaker, I.; Kantanen, J.; Dunner, S.; Cañón, J.; Rodellar, C.; Martín-Burriel, I.; Valentini, A.; Zanotti, M.; Holm, L. E.; Eythorsdottir, E.; Mommens, G.; Polygen, Van Haeringen; Nijman, I. J.; Dolf, G.; Bradley, D. G.

    2014-01-01

    Background: Descendants from the extinct aurochs (Bos primigenius), taurine (Bos taurus) and zebu cattle (Bos indicus) were domesticated 10,000 years ago in Southwestern and Southern Asia, respectively, and colonized the world undergoing complex events of admixture and selection. Molecular data, in

  4. Juridica; Bos, bouw en gemeenten

    NARCIS (Netherlands)

    Kistenkas, F.H.

    2011-01-01

    Bouwen in het bos van de ecologische hoofdstructuur. Geen probleem als niemand bezwaar maakt.... Uiteindelijk is de gemeente vergunningverlener aan zichzelf, is wetgever in eigen zaak en maakt voor zichzelf een lucratief bestemmingsplan. Aldus de analyse van wetskenner Fred Kistenkas

  5. Mitochondrial DNA of Nellore and European x Nellore crossing cattle of high performance DNA mitocondrial de bovinos Nelore e cruzados Europeu x Nelore de alto desempenho

    Directory of Open Access Journals (Sweden)

    Rogério Abdallah Curi

    2007-08-01

    Full Text Available The objective of this work was to evaluate, through a polymorphism in the ND5 gene of the bovine mitochondrial DNA, the frequency of Bos taurus indicus mtDNA individuals in a sample of Nellore purebred origin animals (n = 69 and crossbred animals originated from crosses of European sires and Nellore purebred origin females (n = 275. Only 2.26% (8/354 of the animals presented Bos taurus indicus mtDNA. The high frequency of Bos taurus taurus mtDNA in these animals can be a consequence of selection, once the animals studied are originated from selected lineages of high performance for meat production.O objetivo deste trabalho foi avaliar, por meio de um polimorfismo no gene ND5 do DNA mitocondrial de bovinos, a porcentagem de indivíduos portadores de mtDNA Bos taurus indicus em animais Nelore PO (n = 69 e em animais provenientes do cruzamento entre machos europeus e fêmeas Nelore PO (n = 275. Apenas 2,26% (8/354 dos animais apresentaram mtDNA Bos taurus indicus. A alta freqüência de mtDNA Bos taurus taurus nesses animais pode ser reflexo de seleção, uma vez que os animais estudados se originam de linhagens selecionadas para alto desempenho de produção de carne.

  6. Genomic divergence of zebu and taurine cattle identified through high-density SNP genotyping

    OpenAIRE

    Porto-Neto, Laercio R; Sonstegard, Tad S; Liu, George E; Bickhart, Derek M.; Da Silva, Marcos VB; Marco A. Machado; Utsunomiya, Yuri T.; Garcia, Jose F.; Gondro, Cedric; Van Tassell, Curtis P

    2013-01-01

    Background Natural selection has molded evolution across all taxa. At an arguable date of around 330,000 years ago there were already at least two different types of cattle that became ancestors of nearly all modern cattle, the Bos taurus taurus more adapted to temperate climates and the tropically adapted Bos taurus indicus. After domestication, human selection exponentially intensified these differences. To better understand the genetic differences between these subspecies and detect genomi...

  7. Comparison of methanogen diversity of yak (Bos grunniens and cattle (Bos taurus from the Qinghai-Tibetan plateau, China

    Directory of Open Access Journals (Sweden)

    Huang Xiao

    2012-10-01

    Full Text Available Abstract Background Methane emissions by methanogen from livestock ruminants have significantly contributed to the agricultural greenhouse gas effect. It is worthwhile to compare methanogen from “energy-saving” animal (yak and normal animal (cattle in order to investigate the link between methanogen structure and low methane production. Results Diversity of methanogens from the yak and cattle rumen was investigated by analysis of 16S rRNA gene sequences from rumen digesta samples from four yaks (209 clones and four cattle (205 clones from the Qinghai-Tibetan Plateau area (QTP. Overall, a total of 414 clones (i.e. sequences were examined and assigned to 95 operational taxonomic units (OTUs using MOTHUR, based upon a 98% species-level identity criterion. Forty-six OTUs were unique to the yak clone library and 34 OTUs were unique to the cattle clone library, while 15 OTUs were found in both libraries. Of the 95 OTUs, 93 putative new species were identified. Sequences belonging to the Thermoplasmatales-affiliated Linage C (TALC were found to dominate in both libraries, accounting for 80.9% and 62.9% of the sequences from the yak and cattle clone libraries, respectively. Sequences belonging to the Methanobacteriales represented the second largest clade in both libraries. However, Methanobrevibacter wolinii (QTPC 110 was only found in the cattle library. The number of clones from the order Methanomicrobiales was greater in cattle than in the yak clone library. Although the Shannon index value indicated similar diversity between the two libraries, the Libshuff analysis indicated that the methanogen community structure of the yak was significantly different than those from cattle. Conclusion This study revealed for the first time the molecular diversity of methanogen community in yaks and cattle in Qinghai-Tibetan Plateau area in China. From the analysis, we conclude that yaks have a unique rumen microbial ecosystem that is significantly different from that of cattle, this may also help to explain why yak produce less methane than cattle.

  8. Candidate Gene Expression in Bos indicus Ovarian Tissues: Prepubertal and Postpubertal Heifers in Diestrus

    Science.gov (United States)

    Weller, Mayara Morena Del Cambre Amaral; Fortes, Marina Rufino S.; Porto-Neto, Laercio R.; Kelly, Matthew; Venus, Bronwyn; Kidd, Lisa; do Rego, João Paulo Arcelino; Edwards, Sophia; Boe-Hansen, Gry B.; Piper, Emily; Lehnert, Sigrid A.; Guimarães, Simone Eliza Facioni; Moore, Stephen Stewart

    2016-01-01

    Growth factors such as bone morphogenetic proteins 6, 7, 15, and two isoforms of transforming growth factor-beta (BMP6, BMP7, BMP15, TGFB1, and TGFB2), and insulin-like growth factor system act as local regulators of ovarian follicular development. To elucidate if these factors as well as others candidate genes, such as estrogen receptor 1 (ESR1), growth differentiation factor 9 (GDF9), follicle-stimulating hormone receptor (FSHR), luteinizing hormone receptor (LHR), bone morphogenetic protein receptor, type 2 (BMPR2), type 1 insulin-like growth factor receptor (IGFR1), and key steroidogenic enzymes cytochrome P450 aromatase and 3-β-hydroxysteroid dehydrogenase (CYP19A1 and HSD3B1) could modulate or influence diestrus on the onset of puberty in Brahman heifers, their ovarian mRNA expression was measured before and after puberty (luteal phase). Six postpubertal (POST) heifers were euthanized on the luteal phase of their second cycle, confirmed by corpus luteum observation, and six prepubertal (PRE) heifers were euthanized in the same day. Quantitative real-time PCR analysis showed that the expression of FSHR, BMP7, CYP19A1, IGF1, and IGFR1 mRNA was greater in PRE heifers, when contrasted to POST heifers. The expression of LHR and HSD3B1 was lower in PRE heifers. Differential expression of ovarian genes could be associated with changes in follicular dynamics and different cell populations that have emerged as consequence of puberty and the luteal phase. The emerging hypothesis is that BMP7 and IGF1 are co-expressed and may modulate the expression of FSHR, LHR and IGFR1, and CYP19A1. BMP7 could influence the downregulation of LHR and upregulation of FSHR and CYP19A1, which mediates the follicular dynamics in heifer ovaries. Upregulation of IGF1 expression prepuberty, compared to postpuberty diestrus, correlates with increased levels FSHR and CYP19A1. Thus, BMP7 and IGF1 may play synergic roles and were predicted to interact, from the expression data (P = 0.07, r = 0.84). The role of these co-expressed genes in puberty and heifers luteal phase merits further research. PMID:27803898

  9. Effects of roof modifications on growth performance and physiological changes of crossbred beef heifers (Bos indicus

    Directory of Open Access Journals (Sweden)

    Titaporn Khongdee

    2016-04-01

    Full Text Available The objective of the experiment was to examine and evaluate growth performance and physiological changes of cattle raised under normal roof versus a modified roof. Ten Hindu Brazil x Brahman heifers were used in the experiment. The animals were divided randomly into two groups. They were used to evaluate the effects of modified roofing on the subjects’ physiological responses to heat stress and performance under hot humid conditions. It was found that the modified roof (MR offered a more efficient way to lower heat stress in the cattle than the normal roof (NR. The difference was sufficient to enable the NR at 14:00 p.m. to have a THI higher (P<0.001 than that of the MR. Roof temperature of the MR (35.67±4.28°C was found to be lower (P<0.01 than that of the NR (44.49±7.61°C. Rectal temperature (RT and average rate of gain (ADG of the cattle kept under MR (39.02°C; 0.632 kg/d was lower (P<0.01 and higher (P<0.01, respectively than the NR (40.05 °C; 0.350 kg/d cattle

  10. Genome-wide association with residual body weight gain in Bos indicus cattle.

    Science.gov (United States)

    Santana, M H A; Gomes, R C; Utsunomiya, Y T; Neves, H H R; Novais, F J; Bonin, M N; Fukumasu, H; Garcia, J F; Alexandre, P A; Oliveira Junior, G A; Coutinho, L L; Ferraz, J B S

    2015-01-01

    Weight gain is a key performance trait for beef cat-tle; however, attention should be given to the production costs for better profitability. Therefore, a feed efficiency trait based on per-formance can be an interesting approach to improve performance without increasing food costs. To identify candidate genes and ge-nomic regions associated with residual body weight gain (RWG), we conducted a genome-wide association study (GWAS) with 720 Nellore cattle using the GRAMMAR-Gamma association test. We identified 30 significant single nucleotide polymorphisms (SNPs), especially on chromosomes 2, 8, 12, and 17. Several genes and quantitative train loci (QTLs) present in the regions identified were appointed; we highlight DMRT2 (doublesex and mab-3 related tran-scription factor 2), IFFO2 (intermediate filament family orphan 2), LNX2 (ligand of numb-protein X 2), MTIF3 (mitochondrial transla-tional initiation factor 3), and TRNAG-CCC (transfer RNA glycine anticodon CCC). The metabolic pathways that can explain part of the phenotypic variation in RWG are related to oxidative stress and muscle control. PMID:26125717

  11. Assessment of inbreeding depression in Nellore cows (Bos indicus) through high-density SNP genotypes

    Science.gov (United States)

    Inbreeding has been incriminated as a cause of decrease in reproductive performance in cattle. This negative correlation is known as ‘inbreeding depression’, and evidence supporting this hypothesis was generated from association studies between reproductive traits and estimates of inbreeding coeffic...

  12. Nellore cattle (Bos indicus) and ticks within the Brazilian Pantanal: ecological relationships.

    Science.gov (United States)

    Ramos, Vanessa N; Piovezan, Ubiratan; Franco, Ana Helena A; Rodrigues, Vinicius S; Nava, Santiago; Szabó, Matias P J

    2016-02-01

    Pantanal is a huge floodplain mostly in Brazil, and its main economic activity is extensive cattle raising, in farms characterized by an extremely wildlife-rich environment. We herein describe tick infestations of cattle and of the natural environment in Pantanal of Nhecolândia in Brazil, at areas with and without cattle during both dry and wet seasons. Environmental sampling resulted in three tick species: Amblyomma sculptum (423 nymphs and 518 adults), Amblyomma parvum (7 nymphs and 129 adults), Amblyomma ovale (3 adults) as well as three clusters and two individuals of Amblyomma sp. larvae. A significantly higher number of adult A. sculptum ticks was found in areas with cattle in the wet season. From 106 examinations of bovines 1710 ticks from three species were collected: Rhipicephalus microplus (55.7% of the total), A. sculptum (38%) and A. parvum (4.1%), as well as 32 Amblyomma sp. larvae. A significant similarity was found between Amblyomma tick fauna from environment and on cattle during both seasons. All A. sculptum females on bovines were flat whereas many of A. parvum females and A. sculptum nymphs were engorging. Although R. microplus was the most abundant tick species on cattle, overall highest tick prevalence on bovines in the dry season was of A. sculptum nymphs. Lack of R. microplus in environmental sampling, relationship between cattle and increase in adult A. sculptum numbers in the environment as well as suitability of bovine for the various tick species are discussed.

  13. Morfometría ovárica de hembras Cebú (Bos Indicus

    Directory of Open Access Journals (Sweden)

    Ana Sánchez

    2007-10-01

    Full Text Available El estudio de la morfometría ovárica está directamente relacionado con sus aplicaciones para analizar e interpretar los hallazgos, en los exámenes ginecológicos de las vacas. Para este trabajo se recolectaron 114 pares de ovarios en frigorífico, clasificados a partir del ancho, grueso, largo, volumen, diámetro del folículo, diámetro y área del cuerpo lúteo. Fue observada una diferencia significativa en el ancho (1,95cm y 1,83cm y el volumen (7,26 mL y 6,23 mL de los ovarios izquierdos y derechos, respectivamente. En cuanto al tamaño y el volumen de los folículos, el diámetro y el área de los cuerpos lúteos, no hubo diferencia relevante. En los lados hubo correlación positiva (p<0,01 entre el volumen del ovario izquierdo y el área del cuerpo lúteo. La presencia de folículos con diámetro igual o superior a 9mm, el cuerpo lúteo de tipo macizo y protruso presente en 43,39% de los 53 ovarios, predominó con relación al tipo cóncavo. De los 84 ovarios con cuerpos lúteos, el 26,20% eran de tipo extrapolado. Se concluye, que la presencia de cuerpo lúteo incluso, en vacas cebú, puede resultar en fallas diagnósticas durante el examen de palpación rectal para estimar la actividad ovárica.

  14. Proteome analysis of functionally differentiated bovine (Bos indicus) mammary epithelial cells isolated from milk

    KAUST Repository

    Janjanam, Jagadeesh

    2013-10-01

    Mammary gland is made up of a branching network of ducts that end in alveoli. Terminally differentiated mammary epithelial cells (MECs) constitute the innermost layer of aveoli. They are milk-secreting cuboidal cells that secrete milk proteins during lactation. Little is known about the expression profile of proteins in the metabolically active MECs during lactation or their functional role in the lactation process. In the present investigation, we have reported the proteome map of MECs in lactating cows using 2DE MALDI-TOF/TOF MS and 1D-Gel-LC-MS/MS. MECs were isolated from milk using immunomagnetic beads and confirmed by RT-PCR and Western blotting. The 1D-Gel-LC-MS/MS and 2DE-MS/MS based approaches led to identification of 431 and 134 proteins, respectively, with a total of 497 unique proteins. Proteins identified in this study were clustered into functional groups using bioinformatics tools. Pathway analysis of the identified proteins revealed 28 pathways (p < 0.05) providing evidence for involvement of various proteins in lactation function. This study further provides experimental evidence for the presence of many proteins that have been predicted in annotated bovine genome. The data generated further provide a set of bovine MEC-specific proteins that will help the researchers to understand the molecular events taking place during lactation. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  15. Efficiency of utilization of dietary energy for milk production in lactating crossbred cattle (Bos Indicus

    Directory of Open Access Journals (Sweden)

    Debashis Saha

    2012-09-01

    Full Text Available The present study was conducted on efficiency of utilization of dietary energy for milk production in lactating crossbred cattle. 18 lactating crossbred cattle of early to mid-lactation, approximate body weight (375.39±23.43 kg, milk yield, parity and stage of lactation were divided into three groups of six animals each and were fed 0, 50 and 100% diammonium phosphate (DAP in the mineral mixture of concentrates for 120 days. The chaffed mixed roughage (berseem + wheat straw and concentrate mixture was fed to supply about nearly 18:82 concentrate to roughage ratio on dry matter basis. Tap water was available to the animals twice daily. A metabolism trial of seven days was conducted at the end of experiment to study digestibility of organic nutrients and balances of energy. DAP did not affect the nutrient intake, body weight changes, digestibility of Dry matter (DM, Crude protein (CP, Ether extract (EE, Crude fiber (CF, Nitrogen free extract (NFE and daily milk yield. It was concluded that the at 46.07 Mcal Gross energy intake level the losses in feces, urine, methane and heat production was 45.82%, 5.40%, 4.31% and 33.01%, respectively, and net energy retention for milk production was 11.43%. The gross efficiency of conversion of metabolic energy ME for milk production was 35.69% and the net efficiency of conversion of ME for milk production was 39.56%.

  16. Nutrition, metabolic profiles and puberty in Brahman (Bos indicus) beef heifers.

    Science.gov (United States)

    Samadi, F; Blache, D; Martin, G B; D'Occhio, M J

    2014-05-01

    The aim of the present study was to gain an improved understanding of the relationships between body weight (BW), body condition (BCS), and metabolic homeostasis, and the attainment of puberty in Brahman heifers in a subtropical environment. Brahman heifers (200±3kg BW; 2.00±0.0 BCS) were assigned to a moderate nutrition (MN, n=11) or improved nutrition (IN, n=11) treatment from 11 to 23 months-of-age. The heifers were monitored at regular intervals for circulating concentrations of GH, IGF-1, insulin, glucose and leptin, and ovarian follicular activity was recorded until the first ovulation. From approximately 16 months of age, heifers on IN had a greater (PBrahman heifers on IN had a metabolic homeostasis that was supportive of reproductive maturation and puberty. PMID:24725537

  17. Mapping of quantitative trait loci controlling tick [Riphicephalus (Boophilus) microplus] resistance on bovine cjrp,psp,es 5, 7 and 14

    Science.gov (United States)

    Since Bos taurus and Bos indicus cattle breeds have diverged at approximately 10.000 years ago, the differences in the process of domestication and subsequent selection for desired phenotypes is presumed to have contributed the phenotypic and genetic differences between these subspecies. Of particu...

  18. Taurus

    Science.gov (United States)

    Murdin, P.

    2000-11-01

    (the Bull; abbrev. Tau, gen. Tauri; area 797 sq. deg.) A northern zodiacal constellation which lies between Aries and Orion, and culminates at midnight in late November. It is one of the oldest constellations, dating back to when the Sun was in that part of the sky at the vernal (spring) equinox, between about 4000 and 1800 BC. Later, in Greek mythology, it was identified with the form assumed by...

  19. Growth and reproductive development from weaning through 20 months of age among breeds of bulls in subtropical Florida.

    Science.gov (United States)

    Chase, C C; Chenoweth, P J; Larsen, R E; Olson, T A; Hammond, A C; Menchaca, M A; Randel, R D

    1997-02-01

    To determine the effect of breed on growth and reproductive development, weaned bulls in each of 2 yr were managed as a single group for approximately a year. In Year 1, the study group consisted of 24 Angus, 24 Brahman, 20 Hereford and 14 Senepol bulls, while in Year 2, it contained 25 Angus, 17 Brahman. 13 Romosinuano and 9 Nellore x Brahman bulls. Body and testicular growth measurements were recorded at 6-wk intervals. At approximately 1 yr of age and quarterly thereafter (4 periods), bulls were evaluated for libido, pubertal status, and GnRH-induced LH and testosterone secretion. Significant breed-by-age interactions occurred for most growth measurements. Brahman bulls (Bos indicus ) were (P Senepol and Romosinuano bulls (Bos taurus ). Libido scores were lowest for Brahman and Nell ore x Brahman bulls (Bos indicus ). highest for Angus and Hereford bulls (temperate Bos taurus breeds) and intermediate for Senepol and Romosinuano bulls (tropical Bos taurus breeds; P Brahman, Senepol, Romosinuano and Nellore x Brahman bulls (tropical breeds). In conclusion, reproductive development of Senepol and Romosinuano bulls (tropical Bos taurus breeds) was more similar to Angus and Hereford bulls (temperate Bos taurus breeds) than to Brahman and Nellore x Brahman bulls (Bos indicus ). PMID:16728024

  20. Development of a physiologically based pharmacokinetic model for flunixin in cattle (Bos taurus)

    Science.gov (United States)

    Violative residues of flunixin in tissues from bob veal calves and cull dairy cows has been attributed to noncompliance with the FDA-approved route of administration and withdrawal time, however, the effect of administration route and physiological differences among animals on tissue residue depleti...

  1. Expression Variants of the Lipogenic AGPAT6 Gene Affect Diverse Milk Composition Phenotypes in Bos taurus

    OpenAIRE

    Littlejohn, Mathew D; Kathryn Tiplady; Thomas Lopdell; Law, Tania A.; Andrew Scott; Chad Harland; Ric Sherlock; Kristen Henty; Vlad Obolonkin; Klaus Lehnert; Alistair Macgibbon; Spelman, Richard J; Stephen R. Davis; Snell, Russell G.

    2014-01-01

    Milk is composed of a complex mixture of lipids, proteins, carbohydrates and various vitamins and minerals as a source of nutrition for young mammals. The composition of milk varies between individuals, with lipid composition in particular being highly heritable. Recent reports have highlighted a region of bovine chromosome 27 harbouring variants affecting milk fat percentage and fatty acid content. We aimed to further investigate this locus in two independent cattle populations, consisting o...

  2. Spatial movement of free-roaming cattle (Bos Taurus) when in proximity to wolves (Canis lupus)

    Science.gov (United States)

    In 1995 and 1996, 31 wolves were reintroduced into Yellowstone National Park and 35 in central Idaho. These populations have grown to more than 1,500 with more than 835 in Idaho. As wolf populations have grown, so has predation on livestock, complicating cow and ranch management. Our study was de...

  3. Bovine Genome Database: supporting community annotation and analysis of the Bos taurus genome

    Directory of Open Access Journals (Sweden)

    Childs Kevin L

    2010-11-01

    Full Text Available Abstract Background A goal of the Bovine Genome Database (BGD; http://BovineGenome.org has been to support the Bovine Genome Sequencing and Analysis Consortium (BGSAC in the annotation and analysis of the bovine genome. We were faced with several challenges, including the need to maintain consistent quality despite diversity in annotation expertise in the research community, the need to maintain consistent data formats, and the need to minimize the potential duplication of annotation effort. With new sequencing technologies allowing many more eukaryotic genomes to be sequenced, the demand for collaborative annotation is likely to increase. Here we present our approach, challenges and solutions facilitating a large distributed annotation project. Results and Discussion BGD has provided annotation tools that supported 147 members of the BGSAC in contributing 3,871 gene models over a fifteen-week period, and these annotations have been integrated into the bovine Official Gene Set. Our approach has been to provide an annotation system, which includes a BLAST site, multiple genome browsers, an annotation portal, and the Apollo Annotation Editor configured to connect directly to our Chado database. In addition to implementing and integrating components of the annotation system, we have performed computational analyses to create gene evidence tracks and a consensus gene set, which can be viewed on individual gene pages at BGD. Conclusions We have provided annotation tools that alleviate challenges associated with distributed annotation. Our system provides a consistent set of data to all annotators and eliminates the need for annotators to format data. Involving the bovine research community in genome annotation has allowed us to leverage expertise in various areas of bovine biology to provide biological insight into the genome sequence.

  4. Y chromosome polymorphism in various breeds of cattle (Bos taurus) in Switzerland.

    Science.gov (United States)

    Stranzinger, Gerald F; Steiger, Dagmar; Kneubuhler, Josef; Hagger, Christian

    2007-01-01

    The evolutionary development of mammals involves mutations and fixations of chromosomal types. The Y chromosome polymorphism in cattle is important for the breeding strategy, since chromosomal incompatibilities in crossings result in fertility problems. In bulls of various breeds in Switzerland, data on chromosome status have been collected for over 20 years. Data from 7 years were analysed in this study through chromosome measurements and their normalization. Some highly significant differences were found between the 7 groups of breeds, especially between Holsteins and the original Swiss breeds Braunvieh and Simmental. Fleckvieh (purebred or crossbred) did not differ significantly from Black or Red Holsteins. The results were discussed with respect to fertility problems. The observed Y chromosome polymorphism should be taken into account in breeding, and research in this field should be continued.

  5. Loss of miRNAs during Processing and Storage of Cow's (Bos taurus)Milk

    OpenAIRE

    Howard, Katherine M; Kusuma, Rio Jati; Baier, Scott R.; Friemel, Taylor; Markham, Laura; Vanamala, Jairam; Zempleni, and Janos

    2015-01-01

    MicroRNAs (miRs, miRNAs) play central roles in gene regulation. Previously, we reported that miRNAs from somatic cell content, and handling by consumers on the degradation of miRNAs in milk; we also quantified miRNAs in dairy products. Pasteurization and homogenization caused a 63% loss of miR-200c, whereas a 67% loss observed for miR-29b was statistically significant only in skim milk. Effects of cold storage and somatic cell content were quantitatively minor (

  6. Loss of miRNAs during processing and storage of cow's (Bos taurus) milk.

    Science.gov (United States)

    Howard, Katherine M; Jati Kusuma, Rio; Baier, Scott R; Friemel, Taylor; Markham, Laura; Vanamala, Jairam; Zempleni, Janos

    2015-01-21

    MicroRNAs (miRs, miRNAs) play central roles in gene regulation. Previously, we reported that miRNAs from pasteurized, store-bought bovine milk have biological activity in humans. Here, we assessed the effects of milk processing, storage, somatic cell content, and handling by consumers on the degradation of miRNAs in milk; we also quantified miRNAs in dairy products. Pasteurization and homogenization caused a 63% loss of miR-200c, whereas a 67% loss observed for miR-29b was statistically significant only in skim milk. Effects of cold storage and somatic cell content were quantitatively minor (caused a 40% loss of miR-29b but no loss of miR-200c. The milk fat content had no effect on miRNA stability during storage and microwave heating. The concentrations of miRNAs in dairy products were considerably lower than in store-bought milk. We conclude that processing of milk by dairies and handling by consumers causes a significant loss of miRNAs. PMID:25565082

  7. Responses of single chorda tympani taste fibers of the calf (Bos taurus).

    Science.gov (United States)

    Hellekant, Göran; Roberts, Thomas; Elmer, Donald; Cragin, Tiffany; Danilova, Vicktoria

    2010-06-01

    In spite of a wealth of information on feed and nutrition in cattle, there little is published of what they actually can taste. Here, we attempt to remedy some of this deficiency by presenting recordings of the chorda tympani proper nerve of young Holstein calves during stimulation of approximately 30 compounds. Hierarchical cluster analysis of 46 single taste fibers separated 4 fiber clusters: N (salt best), H (sour best), and 2 clusters, which could not be related to any human taste quality. The N fibers responded best to LiCl, NaCl, urea, monosodium glutamate, and KCl, whereas the H fibers responded strongly to citric and ascorbic acid. Interestingly, propionic and butyric acid stimulated best the 3rd cluster, whereas the 4th cluster responded best to denatonium benzoate and only to a small extent to quinine hydrochloride. Sweeteners stimulated moderately all clusters. Beginning with the largest response to sweet, the order between the responses was: acesulfame-K, saccharin, D-phenylalanine, glycine, sucrose, fructose, erythritol, cyclamate, and lactose. Alitame, aspartame, and super-aspartame evoked no or little responses. Three and 5 M ethanol stimulated all clusters. Comparison with taste fibers in other species suggests that the taste world of cattle is quite different from other species'. PMID:20212013

  8. Bos taurus papillomavirus activity in peripheral blood mononuclear cells: demonstrating a productive infection.

    Science.gov (United States)

    Melo, T C; Araldi, R P; Pessoa, N S D; de-Sá-Júnior, P L; Carvalho, R F; Beçak, W; Stocco, R C

    2015-01-01

    Bovine papillomavirus (BPV) is an oncogenic virus with mucous and epithelial tropism. Possible productive virus infection in other tissues, such as blood, has been hypothesized. In order to investigate this possibility, three samples of skin papillomas and blood were collected from bovines with BPV infection and five samples of peripheral blood and one sample of normal tissue were collected from a calf without BPV infection. Peripheral blood mononuclear cells (PBMCs) were isolated from whole blood and examined by reverse transcription-polymerase chain reaction, immunofluorescence, in situ hybridization, and electron microscopy. The tissue samples were examined for histopathological and immunohistochemical features. The skin papillomas showed the presence of DNA sequences of BPV-2, BPV-11, and a putative virus type. The blood samples showed DNA sequences of BPV-1, 2, and 4 simultaneously. Immunohistochemistry showed BPV L1 protein in both epithelium and stroma and BPV E2 protein in koilocytes. In situ hybridization confirmed the presence of BPV DNA in PBMCs and immunofluorescence showed nuclear labeling of E2 and L1 BPV proteins in PBMCs. The transcription analysis revealed transcripts of BPV-1 L1, BPV-2 L2, and BPV-4 E7 in blood and papilloma samples of BPV-infected cattle. The comet assay revealed high levels of host cell DNA damage upon BPV infection. Electron microscopy analysis of PBMCs identified the presence of particles in the cytoplasm that are consistent with papillomavirus in size and shape. The productive infection of PBMCs with BPV has been previously discussed and this study provides evidence indicating that PBMCs are a target of BPV. PMID:26681018

  9. Intrinsic movement patterns of grazing Rocky Mountains elk (Cervus elaphus nelsonii) and beef cattle (Bos taurus)

    Science.gov (United States)

    Rocky Mountain elk and cattle are important components of mountainous ecosystems in the western United States and exist contemporaneously on many landscapes. These animals utilize similar resources yet the evolutionary lines that produced them have been distinct for approximately 30 million years. ...

  10. The complete mitochondrial genome of Bos taurus coreanae (Korean native cattle).

    Science.gov (United States)

    Wang, Xi; Zhang, Yuan Qing; He, Dong Chang; Yang, Xiao Ming; Li, Bo; Wang, Dong Cai; Guang, Jin; Xu, Fang; Li, Jun Ya; Gao, Xue; Gao, Hui Jiang; Zhang, Lu Pei; Zhang, Xi Zhong

    2016-01-01

    Korean native cattle is one of the famous native breeds in Korean. In the present work, we report the complete mitochondrial genome sequence of Korean native cattle for the first time. The total length of the mitogenome was 16,339 bp with the base composition of 33.4% for A, 27.2% for T, 26.0% for C, and 13.4% for G, and an A-T (60.6%)-rich feature was detected. It harbored 13 protein-coding genes, 2 ribosomal RNA genes, 22 transfer RNA genes and 1 non-coding control region (D-loop region). The arrangement of all genes was identical to the typical mitochondrial genomes of cattle. The complete mitochondrial genome sequence of Korean native cattle would serve as an important data set of the germplasm resources for further study.

  11. WHOLE GENOME ASSOCIATION ANALYSIS IDENTIFIES SUSCEPTIBILITY ALLELES FOR PARASITIC INFECTION IN BOS TAURUS CATTLE

    Science.gov (United States)

    DNA markers associated with parasite indicator traits are ideal targets for study of marker assisted selection aimed at controlling infections that reduced herd use of anthelminthics. For this study, we collected fecal egg count (FEC) data from post-weaning animals of an Angus resource population c...

  12. Expansion of the preimmune antibody repertoire by junctional diversity in Bos taurus.

    Directory of Open Access Journals (Sweden)

    Jenni Liljavirta

    Full Text Available Cattle have a limited range of immunoglobulin genes which are further diversified by antigen independent somatic hypermutation in fetuses. Junctional diversity generated during somatic recombination contributes to antibody diversity but its relative significance has not been comprehensively studied. We have investigated the importance of terminal deoxynucleotidyl transferase (TdT -mediated junctional diversity to the bovine immunoglobulin repertoire. We also searched for new bovine heavy chain diversity (IGHD genes as the information of the germline sequences is essential to define the junctional boundaries between gene segments. New heavy chain variable genes (IGHV were explored to address the gene usage in the fetal recombinations. Our bioinformatics search revealed five new IGHD genes, which included the longest IGHD reported so far, 154 bp. By genomic sequencing we found 26 new IGHV sequences that represent potentially new IGHV genes or allelic variants. Sequence analysis of immunoglobulin heavy chain cDNA libraries of fetal bone marrow, ileum and spleen showed 0 to 36 nontemplated N-nucleotide additions between variable, diversity and joining genes. A maximum of 8 N nucleotides were also identified in the light chains. The junctional base profile was biased towards A and T nucleotide additions (64% in heavy chain VD, 52% in heavy chain DJ and 61% in light chain VJ junctions in contrast to the high G/C content which is usually observed in mice. Sequence analysis also revealed extensive exonuclease activity, providing additional diversity. B-lymphocyte specific TdT expression was detected in bovine fetal bone marrow by reverse transcription-qPCR and immunofluorescence. These results suggest that TdT-mediated junctional diversity and exonuclease activity contribute significantly to the size of the cattle preimmune antibody repertoire already in the fetal period.

  13. Establishment of a pipeline to analyse non-synonymous SNPs in Bos taurus

    Directory of Open Access Journals (Sweden)

    Schreiber Mark

    2006-11-01

    Full Text Available Abstract Background Single nucleotide polymorphisms (SNPs are an abundant form of genetic variation in the genome of every species and are useful for gene mapping and association studies. Of particular interest are non-synonymous SNPs, which may alter protein function and phenotype. We therefore examined bovine expressed sequences for non-synonymous SNPs and validated and tested selected SNPs for their association with measured traits. Results Over 500,000 public bovine expressed sequence tagged (EST sequences were used to search for coding SNPs (cSNPs. A total of 15,353 SNPs were detected in the transcribed sequences studied, of which 6,325 were predicted to be coding SNPs with the remaining 9,028 SNPs presumed to be in untranslated regions. Of the cSNPs detected, 2,868 were predicted to result in a change in the amino acid encoded. In order to determine the actual number of non-synonymous polymorphic SNPs we designed assays for 920 of the putative SNPs. These SNPs were then genotyped through a panel of cattle DNA pools using chip-based MALDI-TOF mass spectrometry. Of the SNPs tested, 29% were found to be polymorphic with a minor allele frequency >10%. A subset of the SNPs was genotyped through animal resources in order to look for association with age of puberty, facial eczema resistance or meat yield. Three SNPs were nominally associated with resistance to the disease facial eczema (P Conclusion We have identified 15,353 putative SNPs in or close to bovine genes and 2,868 of these SNPs were predicted to be non-synonymous. Approximately 29% of the non-synonymous SNPs were polymorphic and common with a minor allele frequency >10%. Of the SNPs detected in this study, 99% have not been previously reported. These novel SNPs will be useful for association studies or gene mapping.

  14. Tick loads in Bos taurus cattle grazing in two contrasting production systems

    OpenAIRE

    Raquel Salazar B; Rolando Barahona-Rosales; María-Solange Sánchez P

    2016-01-01

    Objectives. To relate the effect of biotic and abiotic factors on Rhipicephalus (Boophilus) microplus tick loads on cows grazing either in intensive silvopastoral systems (ISS) (Lucerna) or in grass pastures associated with sugarcane plantations (La Isabela). Materials and methods. Tick counts were performed on 27 Lucerne breed animals that were in different physiological states, six of which were grazing on forage grass paddocks associated with commercial sugarcane plantations and the remain...

  15. PRIMER REPORTE DE Cryptosporidium parvum EN TERNEROS HOLSTEIN (Bos taurus DE MANIZALES, CALDAS, COLOMBIA4

    Directory of Open Access Journals (Sweden)

    R. J. Ocampo

    2012-01-01

    Full Text Available RESUMEN El objetivo de este estudio fue identificar especies o genotipos del protozoario parásito Cryptosporidium presentes en heces colectadas de terneros Holstein del municipio de Manizales, Departamento de Caldas, Colombia. El ADN fue extraído a 80 muestras de materia fecal, de las cuales 11 fueron diagnosticadas positivas para Cryptosporidium spp., mediante reacción en cadena de la polimerasa (PCR. El análisis PCR-RFLP del locus 18S ADNr, identificó la presencia de Cryptosporidium parvum en todas las muestras positivas analizadas. Este hallazgo sugiere que el ganado puede ser una fuente potencial de infección por Cryptosporidium en humanos y se constituye en el primer reporte publicado de C. parvum en bovinos de Manizales, Caldas.

  16. Novel Features of the Prenatal Horn Bud Development in Cattle (Bos taurus.

    Directory of Open Access Journals (Sweden)

    Dominique Judith Wiener

    Full Text Available Whereas the genetic background of horn growth in cattle has been studied extensively, little is known about the morphological changes in the developing fetal horn bud. In this study we histologically analyzed the development of horn buds of bovine fetuses between ~70 and ~268 days of pregnancy and compared them with biopsies taken from the frontal skin of the same fetuses. In addition we compared the samples from the wild type (horned fetuses with samples taken from the horn bud region of age-matched genetically hornless (polled fetuses. In summary, the horn bud with multiple layers of vacuolated keratinocytes is histologically visible early in fetal life already at around day 70 of gestation and can be easily differentiated from the much thinner epidermis of the frontal skin. However, at the gestation day (gd 212 the epidermis above the horn bud shows a similar morphology to the epidermis of the frontal skin and the outstanding layers of vacuolated keratinocytes have disappeared. Immature hair follicles are seen in the frontal skin at gd 115 whereas hair follicles below the horn bud are not present until gd 155. Interestingly, thick nerve bundles appear in the dermis below the horn bud at gd 115. These nerve fibers grow in size over time and are prominent shortly before birth. Prominent nerve bundles are not present in the frontal skin of wild type or in polled fetuses at any time, indicating that the horn bud is a very sensitive area. The samples from the horn bud region from polled fetuses are histologically equivalent to samples taken from the frontal skin in horned species. This is the first study that presents unique histological data on bovine prenatal horn bud differentiation at different developmental stages which creates knowledge for a better understanding of recent molecular findings.

  17. Establishment of a pipeline to analyse non-synonymous SNPs in Bos taurus

    OpenAIRE

    Schreiber Mark; Morris Chris A; McCulloch Alan F; Dodds Ken G; Cullen Neil G; Manley Tim R; Glass Belinda C; Keane Orla M; Lee Michael A; Warren Jonathan; Zadissa Amonida; Wilson Theresa; McEwan John C

    2006-01-01

    Abstract Background Single nucleotide polymorphisms (SNPs) are an abundant form of genetic variation in the genome of every species and are useful for gene mapping and association studies. Of particular interest are non-synonymous SNPs, which may alter protein function and phenotype. We therefore examined bovine expressed sequences for non-synonymous SNPs and validated and tested selected SNPs for their association with measured traits. Results Over 500,000 public bovine expressed sequence ta...

  18. New Q lineage found in bovine (Bos taurus) of Iberian Peninsula.

    Science.gov (United States)

    Lopez-Oceja, Andres; Muro-Verde, Amara; Gamarra, David; Cardoso, Sergio; de Pancorbo, Marian M

    2016-09-01

    The northern Iberian Peninsula is home to a variety of autochthonous cattle breeds, such as the Terreña and Pirenaica. With the objective of characterizing the matrilineal lineages of these breeds, a study of mitochondrial DNA was performed. The D-loop of 155 individuals was analyzed and most of the individuals were carriers of the T3 haplogroup, while haplogroups T and T1 were much less frequent. A Pirenaica individual belonging to the Q haplogroup was found. To verify the presence of the Q haplogroup individual, the entire mitochondrial DNA was sequenced and compared with two descendants. The individuals were assigned to the Q1 sub-haplogroup. These findings extend the geographic distribution of the Q haplogroup to the south west of the European continent. This new Q1 lineage has seven polymorphisms in the coding region, so this lineage is probably as old as the Q lineages described to date. PMID:26554433

  19. PHYTOCHEMICAL SCREENING AND ANTI MICROBIAL STUDIES OF HEMIDESMUS INDICUS

    Directory of Open Access Journals (Sweden)

    Jayasimha Rayalu Daddam

    2015-10-01

    Full Text Available Many forms of alternative medicines were available for those who cannot be helped by conventional medicine. Ayurvedha and Herbal medicine were two important forms of alternative medicine that was widely available in India. This work was mainly concerned with the identification of the therapeutic properties of Hemidesmus indicus. The ethanolic extract of hemidesmus indicus root was used for its anti oxidant and antimicrobial activity. Hemidesmus indicus root extract has very well anti oxidant and anti microbial activity. The ethanolic extract of Hemidesmus indicus was checked for anti microbial activity against pathogenic bacteria such as staphylococcus aures, pseudomonas aeruginosa andfungi Aspergillus niger.

  20. Het Nederlandse bos als vorm van bodemgebruik

    NARCIS (Netherlands)

    Slangen, L.H.G.; Boven, van B.

    1983-01-01

    Behandeling van de oppervlakte en verdeling van het bos en de veranderingen die hierin zijn opgetreden, met de bedrijfsgrootte-struktuur als belangrijke invalshoek daarbij; de rol van de overheid: doeleinden, instrumenten en effekten van het beleid

  1. Spectroscopy of Putative Brown Dwarfs in Taurus

    CERN Document Server

    Luhman, K L

    2010-01-01

    Quanz and coworkers have reported the discovery of the coolest known member of the Taurus star-forming complex (L2+/-0.5) and Barrado and coworkers have identified a possible protostellar binary brown dwarf in the same region. We have performed infrared spectroscopy on the former and the brighter component of the latter to verify their substellar nature. The resulting spectra do not exhibit the strong steam absorption bands that are expected for cool objects, demonstrating that they are not young brown dwarfs. The optical magnitudes and colors for these sources are also indicative of background stars rather than members of Taurus. Although the fainter component of the candidate protostellar binary lacks spectroscopy, we conclude that it is a galaxy rather than a substellar member of Taurus based on its colors and the constraints on its proper motion.

  2. Analgesic Activity of Sphaeranthus indicus Linn

    Directory of Open Access Journals (Sweden)

    P. Malairajan

    2012-12-01

    Full Text Available The ethanol extracts of the whole plant Sphaeranthus indicus Linn. (ALSI (Compositae was tested for analgesic activity by tail immersion method in rat models. The test extracts were tested at 250 mg and 500 mg/kg body weight. The analgesic activity was assessed by keeping pentazocine 10 mg/kg as standard drug. The parameters studied were tail withdrawal reflex and percentage protection. In tail immersion method ALSI pretreatment caused significant increase in analgesic activity and percentage protection found was 66.6 and 67.4 respectively. The result suggested that ALSI possess significant and dose dependent analgesic activity.

  3. Pilot meetnet functievervulling bos, natuur en landschap

    NARCIS (Netherlands)

    Dirkse, G.M.; Daamen, W.P.

    2000-01-01

    Alterra en Bosdata voerden in opdracht van het Expertisecentrum LNV een proef uit voor het meetnet functievervulling bos, natuur en landschap. Het meetnet schat periodiek met een geografische steekproef de oppervlakte land met een zekere kwaliteit voor recreatie, natuur, milieu en economie. De steek

  4. The Taurus Spitzer Survey: New Candidate Taurus Members Selected Using Sensitive Mid-Infrared Photometry

    CERN Document Server

    Rebull, L M; McCabe, C -E; Hillenbrand, L A; Stapelfeldt, K R; Noriega-Crespo, A; Carey, S J; Brooke, T; Huard, T; Terebey, S; Audard, M; Monin, J -L; Fukagawa, M; Guedel, M; Knapp, G R; Menard, F; Allen, L E; Angione, J R; Baldovin-Saavedra, C; Bouvier, J; Briggs, K; Dougados, C; Evans, N J; Flagey, N; Guieu, S; Grosso, N; Glauser, A M; Harvey, P; Hines, D; Latter, W B; Skinner, S L; Strom, S; Tromp, J; Wolf, S

    2009-01-01

    We report on the properties of pre-main-sequence objects in the Taurus molecular clouds as observed in 7 mid- and far-infrared bands with the Spitzer Space Telescope. There are 215 previously-identified members of the Taurus star-forming region in our ~44 square degree map; these members exhibit a range of Spitzer colors that we take to define young stars still surrounded by circumstellar dust (noting that ~20% of the bonafide Taurus members exhibit no detectable dust excesses). We looked for new objects in the survey field with similar Spitzer properties, aided by extensive optical, X-ray, and ultraviolet imaging, and found 148 candidate new members of Taurus. We have obtained follow-up spectroscopy for about half the candidate sample, thus far confirming 34 new members, 3 probable new members, and 10 possible new members, an increase of 15-20% in Taurus members. Of the objects for which we have spectroscopy, 7 are now confirmed extragalactic objects, and one is a background Be star. The remaining 93 candida...

  5. Phosphorus requirements for containerized Pterocarpus indicus seedlings

    Institute of Scientific and Technical Information of China (English)

    Eng Hai Lok; Bernard Dell

    2015-01-01

    Pterocarpus indicus Willd is a tropical woody legume that holds promise for plantation forestry. Two glasshouse experiments were undertaken on two soil types to determine the phosphorus (P) concentration ranges in the foliage of P-stressed and healthy plants, and to define cri-tical P concentrations for the diagnosis of deficiency and toxicity. There was a narrow range in rates of P fertilizer, supplied as Ca(H2PO4)2?H20, between deficiency and toxicity compared to other tree species. The relationship between shoot yield and P concentration in the youngest fully expanded leaf enabled critical P concentrations for the diagnosis of deficiency (0.17%) and toxicity (0.41%) to be determined at 90% maximum yield from linear re-gressions fitted to the data. The foliar P concentration ranges for deficiency and toxicity were similar to other nitrogen-fixing trees. The defined P concentration ranges and the critical P concentrations for the diagnosis of P deficiency and P toxicity should be useful for monitoring the P status of nursery stock and the health of young seedlings after out-planting.

  6. Quantitative trait locus affecting birth weight on bovine chromosome 5 in a F2 Gyr x Holstein population

    Directory of Open Access Journals (Sweden)

    Gustavo Gasparin

    2005-12-01

    Full Text Available Segregation between a genetic marker and a locus influencing a quantitative trait in a well delineated population is the basis for success in mapping quantitative trait loci (QTL. To detect bovine chromosome 5 (BTA5 birth weight QTL we genotyped 294 F2 Gyr (Bos indicus x Holstein (Bos taurus crossbreed cattle for five microsatellite markers. A linkage map was constructed for the markers and an interval analysis for the presence of QTL was performed. The linkage map indicated differences in the order of two markers relative to the reference map (http://www.marc.usda.gov. Interval analysis detected a QTL controlling birth weight (p < 0.01 at 69 centimorgans (cM from the most centromeric marker with an effect of 0.32 phenotypic standard-error. These results support other studies with crossbred Bos taurus x Bos indicus populations.

  7. The age of Taurus - environmental effects on disc lifetimes

    CERN Document Server

    Rees, Jon M; Bell, C P M; Jeffries, R D; Naylor, Tim

    2015-01-01

    Using semi-empirical isochrones, we find the age of the Taurus star-forming region to be 3-4 Myr. Comparing the disc fraction in Taurus to young massive clusters suggests discs survive longer in this low density environment. We also present a method of photometrically de-reddening young stars using $iZJH$ data.

  8. Breed and other effects on reproductive traits and breeding soundness categorization in young beef bulls in Florida.

    Science.gov (United States)

    Chenoweth, P J; Chase, C C; Thatcher, M J; Wilcox, C J; Larsen, R E

    1996-11-01

    Yearling, grass-fed, beef bulls at the USDA Subtropical Agricultural Research Station, Brooksville, Florida, were assessed for physical and semen traits in January, April, July and October of 1991 (Trial 1) and 1992 (Trial 2). Bulls were given a breeding soundness evaluation (BSE) using revised semen and scrotal circumference (SC) criteria. In Trial 1, the bulls consisted of Angus (n = 15), Brahman (n = 14), Hereford (n = 15) and Senepol (n = 14). In Trial 2, the breeds were Angus (n = 15), Brahman (n = 16), Romosinuano (n = 13) and Nellore x Brahman (n = 9). Trial bulls generally showed delayed growth compared with grain-fed bulls in temperate environments. Breed influenced semen traits (percentage sperm motility, normal spermatozoa and those with primary abnormalities) in both trials. Temperate Bos taurus breeds (Angus, Hereford) were generally superior to Bos indicus breeds (Brahman, Nellore x Brahman). Tropically-adapted Bos taurus breeds (Senepol, Romosinuano) were intermediate for those traits tested. In general, tropically-adapted Bos taurus breeds were more similar in reproductive development to temperate Bos taurus than to Bos indicus breeds. Breed by test period interactions occurred and were mainly influenced by delayed sexual maturity of Bos indicus bulls. Qualitative semen traits increased with bull age, particularly from 12 to 18 mo. Scrotal circumference development was slower in the Bos indicus breeds. Bulls of satisfactory BSE status at 18.1 to 22 mo of age were 73.9% in Trial 1 and 58.5% in Trial 2. Brahman bulls had the least satisfactory BSE scores in both years (Trial 1, 44.4%; Trial 2, 22.2%). Most bulls failed to achieve satisfactory BSE status due to a small SC relative to age (Trial 1, 66%; Trial 2, 72%). The most efficacious use of the BSE was > or = 15 mo in Bos taurus bulls and > 18 mo for Bos indicus bulls. Although the BSE has proven to be useful for the assessment of young, pasture-raised bulls in semi-tropical environments, use of SC

  9. Lipid Lowering Activity of Anthocephalus indicus Root in Hyperlipidemic Rats

    Directory of Open Access Journals (Sweden)

    Vishnu Kumar

    2010-01-01

    Full Text Available The lipid lowering activity of Anthocephalus indicus (family Rubiaceae; Hindi name Kadamba root extract has been studied in triton WR-1339 induced hyperlipidemia in rats. In this model, feeding with root extract (500 mg kg−1 b.w. lowered plasma lipids and reactivated post-heparin lipolytic activity in hyperlipidemic rats. Furthermore, the root extract (50–500 μM inhibited the generation of superoxide anions and hydroxyl radicals, in both enzymic and non-enzymic systems, in vitro. The results of the present study demonstrated both lipid lowering and antioxidant activities in root extract of A. indicus, which could help prevention of hyperlipidemia and related diseases.

  10. Association of single nucleotide polymorphisms in CAPN1, CAST and MB genes with meat color of Brahman and crossbreed cattle.

    Science.gov (United States)

    Castro, Susan; Ríos, Marcela; Ortiz, Yurany; Manrique, Carlos; Jiménez, Ariel; Ariza, Fernando

    2016-07-01

    The objective of this research was to determine the association of SNPs in the candidate genes Calpain (CAPN1), Calpastatin (CAST) and Myoglobin (MB) with colorimetric parameters (L *, a *, b *, C *, hue) in a F1 population (n = 164) obtained from crossing Bos taurus × Bos indicus and Bos indicus × Bos indicus. SNPs were analyzed using PCR-RFLP and SSCP. Colorimetric measurements were performed in the muscles Longissimus thoracis et lumborum (LTL) and Semitendinosus (ST) at 7, 14 and 21 days postmortem applying the methodology CIE L* a* b*. The CAST gene showed a significant effect on the b* and hue* parameters in both muscles. MB gene showed significant association with all colorimetric parameters in both LTL and ST muscles, except with b* parameter. The CAPN1 gene did not show any significant association. These results suggest an important role of genetics in meat color variation for cattle raised under the tropic conditions.

  11. Association of single nucleotide polymorphisms in CAPN1, CAST and MB genes with meat color of Brahman and crossbreed cattle.

    Science.gov (United States)

    Castro, Susan; Ríos, Marcela; Ortiz, Yurany; Manrique, Carlos; Jiménez, Ariel; Ariza, Fernando

    2016-07-01

    The objective of this research was to determine the association of SNPs in the candidate genes Calpain (CAPN1), Calpastatin (CAST) and Myoglobin (MB) with colorimetric parameters (L *, a *, b *, C *, hue) in a F1 population (n = 164) obtained from crossing Bos taurus × Bos indicus and Bos indicus × Bos indicus. SNPs were analyzed using PCR-RFLP and SSCP. Colorimetric measurements were performed in the muscles Longissimus thoracis et lumborum (LTL) and Semitendinosus (ST) at 7, 14 and 21 days postmortem applying the methodology CIE L* a* b*. The CAST gene showed a significant effect on the b* and hue* parameters in both muscles. MB gene showed significant association with all colorimetric parameters in both LTL and ST muscles, except with b* parameter. The CAPN1 gene did not show any significant association. These results suggest an important role of genetics in meat color variation for cattle raised under the tropic conditions. PMID:26946475

  12. The efficacy of a vitamin D(3) metabolite for improving the myofibrillar tenderness of meat from Bos indicus cattle.

    Science.gov (United States)

    Lawrence, R W; Doyle, J; Elliott, R; Loxton, I; McMeniman, J P; Norton, B W; Reid, D J; Tume, R W

    2006-01-01

    The influence of a once only administration of a metabolite of vitamin D(3) (HY·D(®)-25-hydroxy vitamin D(3)) on myofibrillar meat tenderness in Australian Brahman cattle was studied. Ninety-six Brahman steers of three phenotypes (Indo-Brazil, US and US/European) and with two previous hormonal growth promotant (HGP) histories (implanted or not implanted with Compudose(®)) were fed a standard feedlot ration for 70d. Treatment groups of 24 steers were offered daily 10g/head HY·D(®) (125mg 25-hydroxyvitamin D(3)) for 6, 4, or 2d before slaughter. One other group of 24 steers was given the basal diet without HY·D(®). Feed lot performance, blood and muscle samples and carcass quality data were collected at slaughter. Calcium, magnesium, potassium, sodium, iron and Vitamin D(3) metabolites were measured in plasma and longissimus dorsi muscle. Warner-Bratzler (WB) shear force (peak force, initial yield) and other objective meat quality measurements were made on the longissimus dorsi muscle of each steer after ageing for 1, 7 and 14d post-mortem at 0-2°C. There were no significant effects of HY·D(®) supplements on average daily gain (ADG, 1.28-1.45kg/d) over the experimental period. HY·D(®) supplements given 6d prior to slaughter resulted in significantly higher (Pmeat colour, ultimate pH, sarcomere length, cooking loss, instron compression or peak force. There was a significant treatment (HY·D(®)) by phenotype/HGP interaction for peak force (P=0.028), in which Indo-Brazil steers without previous HGP treatment responded positively (increased tenderness) to HY·D(®) supplements at 2d when compared with Indo-Brazil steers previously given HGP. There were no significant effects of treatment on other phenotypes. HY·D(®) supplements did not affect muscle or plasma concentrations of calcium, potassium or sodium, but did significantly decrease plasma magnesium and iron concentrations when given 2d before slaughter. There were no detectable amounts of 25-hydroxyvitamin D(3) in the blood or muscle of any cattle at slaughter. PMID:22061376

  13. Impact of puberty status and melengestrol acetate supplementation before the breeding period on reproductive efficiency of Bos indicus beef heifers.

    Science.gov (United States)

    Martins, J H; Santos, C S; Silva, M A V; Aguiar, H M V S B; França, I G; Pereira, H G; Ribeiro, D L; Chaves, R M; Souza, J A T; Monteiro, B M; Sá Filho, M F; Torres-Júnior, J R S

    2015-06-01

    Two experiments were designed to evaluate the impact of puberty status and the administration of melengestrol acetate (MGA) before onset of the breeding period on ovulatory responses (Exp. 1) and conception rate after AI performed on estrus detection during 10 d and the pregnancy rate through 80 d of breeding period (Exp. 2) of pasture-grazed beef heifers. In Exp. 1, heifers (15 pubertal and 15 prepubertal) received 0.5 mg per heifer/d -1 of MGA over 14 d. No differences in the ovulatory responses were found 10 d after the MGA administration (pubertal = 46.7% vs. prepubertal P = 53.3%; P = 0.72). In Exp. 2, 368 heifers were randomly assigned to groups according to pubertal status and the MGA treatment. All heifers were inseminated on estrus detection for up 10 d after MGA administration and following exposure to bulls between 20 and 80 d. The MGA-treated heifers exhibited a greater AI service rate than control heifers (72.1 vs. 41.6%;P breeding period (95.3 vs. 87.5%;P breeding period. At onset of the breeding period, pubertal heifers presented a greater pregnancy rate following AI (pubertal P = 42.2% vs. prepubertal P = 24.9%; P = 0.01). Therefore, pubertal heifers seem to have greater overall reproductive efficiency than prepubertal heifers, particularly at the beginning of the breeding period. Interestingly, administration of MGA before the onset of the breeding period increased AI service rate but did not alter the rate of pregnancy throughout the breeding period of pasture-grazed beef heifers.

  14. Evaluation of bovine (Bos indicus) ovarian potential for in vitro embryo production in the Adamawa plateau (Cameroon)

    OpenAIRE

    Kouamo, J.; Dawaye, S.M.; Zoli, A. P.; Bah, G. S.

    2014-01-01

    An abattoir study was conducted to evaluate the ovarian potential of 201 local zebu cattle from Ngaoundere, Adamawa region (Cameroon) for in vitro embryo production (IVEP). The ovaries were excised, submerged in normal saline solution (0.9%) and transported to the laboratory for a detailed evaluation. Follicles on each ovary were counted, their diameters (Φ) measured and were grouped into 3 categories: small (Φ 8 mm). Each ovary was then sliced in...

  15. Evaluation of bovine (Bos indicus) ovarian potential for in vitro embryo production in the Adamawa plateau (Cameroon).

    Science.gov (United States)

    Kouamo, J; Dawaye, S M; Zoli, A P; Bah, G S

    2014-01-01

    An abattoir study was conducted to evaluate the ovarian potential of 201 local zebu cattle from Ngaoundere, Adamawa region (Cameroon) for in vitro embryo production (IVEP). The ovaries were excised, submerged in normal saline solution (0.9%) and transported to the laboratory for a detailed evaluation. Follicles on each ovary were counted, their diameters (Φ) measured and were grouped into 3 categories: small (Φ 8 mm). Each ovary was then sliced into a petri dish; the oocytes were recovered in Dulbecco's phosphate buffered saline, examined under a stereoscope (x10) and graded into four groups based on the morphology of cumulus oophorus cells and cytoplasmic changes of the oocytes. Grade I (GI): oocytes with more than 4 layers of bunch of compact cumulus cells mass with evenly granulated cytoplasm; grade II (GII): oocyte with at least 2-4 layers of compact cumulus cell mass with evenly granulated cytoplasm; grade III (GIII): oocyte with at least one layer of compact cumulus cell mass with evenly granulated cytoplasm; grade IV (GIV): denuded oocyte with no cumulus cells or incomplete layer of cumulus cell or expanded cells and having dark or unevenly granulated cytoplasm. The effects of both ovarian (ovarian localization, corpus luteum, size and weight of ovary) and non-ovarian factors (breed, age, body condition score (BCS) and pregnancy status of cow) on the follicular population and oocyte recovery rate were determined. There were an average of 16.75±0.83 follicles per ovary. The small, medium and large follicles were 8.39±0.60, 8.14±0.43 and 0.21±0.02 respectively. Oocyte recovery was 10.97±0.43 per ovary (65%). Oocytes graded I, II, III and IV were 3.53±0.19 (32.21%), 2.72±0.15 (24.82%), 2.24±0.15 (20.43%) and 2.47±0.20 (22.54%) respectively. The oocyte quality index was 2.26. Younger non pregnant cows having BCS of 3 and large ovaries presented higher number of follicles and oocyte quality (P quality (grade I and II) acceptable for IVEP constituted 57.15% of the harvest. This study indicated that factors such as age, pregnancy status, BCS and ovarian size must be taken into account to increase the potential of the ovary for IVEP. PMID:26623353

  16. Assessment of adaptability of zebu cattle (Bos indicus) breeds in two different climatic conditions: using cytogenetic techniques on genome integrity.

    Science.gov (United States)

    Kumar, Anil; Waiz, Syma Ashraf; Sridhar Goud, T; Tonk, R K; Grewal, Anita; Singh, S V; Yadav, B R; Upadhyay, R C

    2016-06-01

    The aim of this study was to evaluate the genome integrity so as to assess the adaptability of three breeds of indigenous cattle reared under arid and semi-arid regions of Rajasthan (Bikaner) and Haryana (Karnal) India. The cattle were of homogenous group (same age and sex) of indigenous breeds viz. Sahiwal, Tharparkar and Kankrej. A total of 100 animals were selected for this study from both climatic conditions. The sister chromatid exchanges (SCE's), chromosomal gaps and chromatid breaks were observed in metaphase plates of chromosome preparations obtained from in vitro culture of peripheral blood lymphocytes. The mean number of breaks and gaps in Sahiwal and Tharparkar of semi-arid zone were 8.56 ± 3.16, 6.4 ± 3.39 and 8.72 ± 2.04, 3.52 ± 6.29, respectively. Similarly, the mean number of breaks and gaps in Tharparkar and Kankrej cattle of arid zone were 5.26 ± 1.76, 2.74 ± 1.76 and 5.24 ± 1.84, 2.5 ± 1.26, respectively. The frequency of SCEs in chromosomes was found significantly higher (P P P > 0.05) was observed in the same zone. The analysis of frequency of CAs and SCEs revealed significant effects of environmental conditions on the genome integrity of animals, thereby indicating an association with their adaptability. PMID:26476524

  17. Generation of bovine (Bos indicus) and buffalo (Bubalus bubalis) adipose tissue derived stem cells: isolation, characterization, and multipotentiality.

    Science.gov (United States)

    Sampaio, R V; Chiaratti, M R; Santos, D C N; Bressan, F F; Sangalli, J R; Sá, A L A; Silva, T V G; Costa, N N; Cordeiro, M S; Santos, S S D; Ambrosio, C E; Adona, P R; Meirelles, F V; Miranda, M S; Ohashi, O M

    2015-01-15

    Adult stem cells are known for their plasticity and their potential to differentiate into several different cell types; these characteristics have implications for cell therapy and reproductive biotechnologies. In this study, we report on the isolation and characterization of mesenchymal stem cells (MSC) derived from bovine and buffalo adipose tissue. Cells isolated using enzymatic digestion of bovine and buffalo adipose-tissue biopsy samples were grown in vitro for at least 15 passages, verifying their capacity to proliferate. These cells were also subjected to immunophenotypic characterization for the presence of CD90, CD105, and CD79, and the absence of CD45, CD34, and CD73, which are positive and negative markers of MSC, respectively. To prove their multipotency, the cells were induced to differentiate into three different cell types, chondrocytes, osteoblasts, and adipocytes, which were stained with tissue-specific dyes (Chondrogenic-Alcian Blue, Osteogenic-Alizarin Red, and Adipogenic-Oil-Red O, respectively) to confirm differentiation. Gene expression analysis of pluripotency-related genes was also conducted. Our results suggest that adipose tissue from bovines and buffalos can be used as a source of MSC, making adipose tissue-derived cells an interesting option for cell therapy and regenerative medicine. Additionally, these findings have implications for reproductive biotechnology because the use of MSC as nuclear donors has been linked to an increase in the efficiency of nuclear transfer.

  18. Comparison of a flow assay for brucellosis antibodies with the reference cELISA test in West African Bos indicus.

    Directory of Open Access Journals (Sweden)

    Barend M deC Bronsvoort

    Full Text Available Brucellosis is considered by the Food and Agricultural Organisation and the World Health Organisation as one of the most widespread zoonoses in the world. It is a major veterinary public health challenge as animals are almost exclusively the source of infection for people. It is often undiagnosed in both human patients and the animal sources and it is widely acknowledged that the epidemiology of brucellosis in humans and animals is poorly understood, particularly in sub-Saharan Africa. It is therefore important to develop better diagnostic tools in order to improve our understanding of the epidemiology and also for use in the field for disease control and eradication. As with any new diagnostic test, it is essential that it is validated in as many populations as possible in order to characterise its performance and improve the interpretation of its results. This paper describes a comparison between a new lateral flow assasy (LFA for bovine brucellosis and the widely used cELISA in a no gold standard analysis to estimate test performance in this West African cattle population. A Bayesian formulation of the Hui-Walter latent class model incorporated previous studies' data on sensitivity and specificity of the cELISA. The results indicate that the new LFA is very sensitive (approximately 87% and highly specific (approximately 97%. The analysis also suggests that the current cut-off of the cELSIA may not be optimal for this cattle population but alternative cut-offs did not significantly change the estimates of the LFA. This study demonstrates the potential usefulness of this simple to use test in field based surveillance and control which could be easily adopted for use in developing countries with only basic laboratory facilities.

  19. Fertility in Gyr Cows (Bos indicus) with Fixed Time Artificial Insemination and Visual Estrus Detection Using a Classification Table

    Science.gov (United States)

    Ramírez-Iglesia, Lilido Nelson; Roman Bravo, Rafael María; Díaz de Ramirez, Adelina; Torres, Leandro J.

    2014-01-01

    The aim of this research was to compare two artificial insemination protocols (AIP): hormonal synchronization with fixed time artificial insemination (SC-FTAI) and the use of a table based on visual observation of estrus signs (VO) in order to identify cows in natural or spontaneous estrus being assigned to AI (NSE-IA). Two groups were formed: in the first group 109 cows were assigned to SC-FTAI, in which a commercial protocol is used; the second one included 108 randomly chosen cows, which were assigned to NSE-AI and in this group a modified table was used. Response variable was first service fertility rate (FSF), which was coded 1 for pregnant and 0 for empty. Predictor variables were AIP, postpartum anestrus, daily milk yield, body condition score at AI and calving number. Statistical analyses included association chi-square tests and logistic regression. Results showed an overall 41.94% FSF and a significant association was detected (P 0.05). The odds ratio for the effect of AIP was only 1.050, suggesting no differences in FSF between groups. The NSE-AI protocol can enhance both the technique of VO and reproductive efficiency. Further validation of the table is required. PMID:26464929

  20. Evaluation of bovine (Bos indicus) ovarian potential for in vitro embryo production in the Adamawa plateau (Cameroon)

    Science.gov (United States)

    Kouamo, J.; Dawaye, S.M.; Zoli, A.P.; Bah, G.S.

    2014-01-01

    An abattoir study was conducted to evaluate the ovarian potential of 201 local zebu cattle from Ngaoundere, Adamawa region (Cameroon) for in vitro embryo production (IVEP). The ovaries were excised, submerged in normal saline solution (0.9%) and transported to the laboratory for a detailed evaluation. Follicles on each ovary were counted, their diameters (Φ) measured and were grouped into 3 categories: small (Φ 8 mm). Each ovary was then sliced into a petri dish; the oocytes were recovered in Dulbecco’s phosphate buffered saline, examined under a stereoscope (x10) and graded into four groups based on the morphology of cumulus oophorus cells and cytoplasmic changes of the oocytes. Grade I (GI): oocytes with more than 4 layers of bunch of compact cumulus cells mass with evenly granulated cytoplasm; grade II (GII): oocyte with at least 2-4 layers of compact cumulus cell mass with evenly granulated cytoplasm; grade III (GIII): oocyte with at least one layer of compact cumulus cell mass with evenly granulated cytoplasm; grade IV (GIV): denuded oocyte with no cumulus cells or incomplete layer of cumulus cell or expanded cells and having dark or unevenly granulated cytoplasm. The effects of both ovarian (ovarian localization, corpus luteum, size and weight of ovary) and non-ovarian factors (breed, age, body condition score (BCS) and pregnancy status of cow) on the follicular population and oocyte recovery rate were determined. There were an average of 16.75±0.83 follicles per ovary. The small, medium and large follicles were 8.39±0.60, 8.14±0.43 and 0.21±0.02 respectively. Oocyte recovery was 10.97±0.43 per ovary (65%). Oocytes graded I, II, III and IV were 3.53±0.19 (32.21%), 2.72±0.15 (24.82%), 2.24±0.15 (20.43%) and 2.47±0.20 (22.54%) respectively. The oocyte quality index was 2.26. Younger non pregnant cows having BCS of 3 and large ovaries presented higher number of follicles and oocyte quality (P BCS and ovarian size must be taken into account to increase the potential of the ovary for IVEP. PMID:26623353

  1. Evaluation of bovine (Bos indicus ovarian potential for in vitro embryo production in the Adamawa plateau (Cameroon

    Directory of Open Access Journals (Sweden)

    J. Kouamo

    2014-12-01

    Full Text Available An abattoir study was conducted to evaluate the ovarian potential of 201 local zebu cattle from Ngaoundere, Adamawa region (Cameroon for in vitro embryo production (IVEP. The ovaries were excised, submerged in normal saline solution (0.9% and transported to the laboratory for a detailed evaluation. Follicles on each ovary were counted, their diameters (Φ measured and were grouped into 3 categories: small (Φ 8 mm. Each ovary was then sliced into a petri dish; the oocytes were recovered in Dulbecco’s phosphate buffered saline, examined under a stereoscope (x10 and graded into four groups based on the morphology of cumulus oophorus cells and cytoplasmic changes of the oocytes. Grade I (GI: oocytes with more than 4 layers of bunch of compact cumulus cells mass with evenly granulated cytoplasm; grade II (GII: oocyte with at least 2-4 layers of compact cumulus cell mass with evenly granulated cytoplasm; grade III (GIII: oocyte with at least one layer of compact cumulus cell mass with evenly granulated cytoplasm; grade IV (GIV: denuded oocyte with no cumulus cells or incomplete layer of cumulus cell or expanded cells and having dark or unevenly granulated cytoplasm. The effects of both ovarian (ovarian localization, corpus luteum, size and weight of ovary and non-ovarian factors (breed, age, body condition score (BCS and pregnancy status of cow on the follicular population and oocyte recovery rate were determined. There were an average of 16.75±0.83 follicles per ovary. The small, medium and large follicles were 8.39±0.60, 8.14±0.43 and 0.21±0.02 respectively. Oocyte recovery was 10.97±0.43 per ovary (65%. Oocytes graded I, II, III and IV were 3.53±0.19 (32.21%, 2.72±0.15 (24.82%, 2.24±0.15 (20.43% and 2.47±0.20 (22.54% respectively. The oocyte quality index was 2.26. Younger non pregnant cows having BCS of 3 and large ovaries presented higher number of follicles and oocyte quality (P < 0.05 compared with other animals. Oocytes with quality (grade I and II acceptable for IVEP constituted 57.15% of the harvest. This study indicated that factors such as age, pregnancy status, BCS and ovarian size must be taken into account to increase the potential of the ovary for IVEP.

  2. The efficacy of a vitamin D(3) metabolite for improving the myofibrillar tenderness of meat from Bos indicus cattle.

    Science.gov (United States)

    Lawrence, R W; Doyle, J; Elliott, R; Loxton, I; McMeniman, J P; Norton, B W; Reid, D J; Tume, R W

    2006-01-01

    The influence of a once only administration of a metabolite of vitamin D(3) (HY·D(®)-25-hydroxy vitamin D(3)) on myofibrillar meat tenderness in Australian Brahman cattle was studied. Ninety-six Brahman steers of three phenotypes (Indo-Brazil, US and US/European) and with two previous hormonal growth promotant (HGP) histories (implanted or not implanted with Compudose(®)) were fed a standard feedlot ration for 70d. Treatment groups of 24 steers were offered daily 10g/head HY·D(®) (125mg 25-hydroxyvitamin D(3)) for 6, 4, or 2d before slaughter. One other group of 24 steers was given the basal diet without HY·D(®). Feed lot performance, blood and muscle samples and carcass quality data were collected at slaughter. Calcium, magnesium, potassium, sodium, iron and Vitamin D(3) metabolites were measured in plasma and longissimus dorsi muscle. Warner-Bratzler (WB) shear force (peak force, initial yield) and other objective meat quality measurements were made on the longissimus dorsi muscle of each steer after ageing for 1, 7 and 14d post-mortem at 0-2°C. There were no significant effects of HY·D(®) supplements on average daily gain (ADG, 1.28-1.45kg/d) over the experimental period. HY·D(®) supplements given 6d prior to slaughter resulted in significantly higher (P<0.05) initial yield values compared to supplements given 2d prior to slaughter. Supplementation had no significant effect on meat colour, ultimate pH, sarcomere length, cooking loss, instron compression or peak force. There was a significant treatment (HY·D(®)) by phenotype/HGP interaction for peak force (P=0.028), in which Indo-Brazil steers without previous HGP treatment responded positively (increased tenderness) to HY·D(®) supplements at 2d when compared with Indo-Brazil steers previously given HGP. There were no significant effects of treatment on other phenotypes. HY·D(®) supplements did not affect muscle or plasma concentrations of calcium, potassium or sodium, but did significantly decrease plasma magnesium and iron concentrations when given 2d before slaughter. There were no detectable amounts of 25-hydroxyvitamin D(3) in the blood or muscle of any cattle at slaughter.

  3. Fertility in Gyr Cows (Bos indicus) with Fixed Time Artificial Insemination and Visual Estrus Detection Using a Classification Table

    OpenAIRE

    Lilido Nelson Ramírez-Iglesia; Rafael María Roman Bravo; Adelina Díaz de Ramirez; Torres, Leandro J.

    2014-01-01

    The aim of this research was to compare two artificial insemination protocols (AIP): hormonal synchronization with fixed time artificial insemination (SC-FTAI) and the use of a table based on visual observation of estrus signs (VO) in order to identify cows in natural or spontaneous estrus being assigned to AI (NSE-IA). Two groups were formed: in the first group 109 cows were assigned to SC-FTAI, in which a commercial protocol is used; the second one included 108 randomly chosen cows, which w...

  4. Bos indicus-cross feedlot cattle with excitable temperaments have tougher meat and a higher incidence of borderline dark cutters.

    Science.gov (United States)

    Voisinet, B D; Grandin, T; O'Connor, S F; Tatum, J D; Deesing, M J

    1997-08-01

    Temperament ratings based on a numerical scale (chute score) were assessed during weighing and handling of cattle at a feedlot. Breeds studied included Braford, Red Brangus and Simbrah. Cattle were fed to a constant fat thickness of 9 to 13 mm (target = 11 mm) over the 12th rib as determined by periodic ultrasound measurements. Cattle were slaughtered in a commercial slaughter plant and stunned by captive bolt. Temperament rating had a significant effect on the incidence of borderline dark cutters which were downgraded by a USDA grader (P = 0.01). Temperament score also had a significant effect on tenderness (P < 0.001) as evaluated by Warner-Bratzler Shear (WBS) force at day 14 post mortem. The calmest animals which stood still when restrained in a hydraulic squeeze chute had a mean WBS force of 2.86 ± 11 kg and cattle which became highly agitated and struggled violently during restraint averaged 3.63 ± 19 kg. Forty percent of these cattle had WBS force values which were over 3.9 kg which is a threshold value for acceptability in food service establishments. These data show that cattle with the most excitable temperament ratings produce carcasses with tougher meat and a higher incidence of borderline dark cutters than cattle with calm temperament ratings. PMID:22062320

  5. Efecto de SNPs de genes candidatos asociados a textura de la carne en bovinos Bos indicus y sus cruces

    OpenAIRE

    Pinilla López, Yenny Catherine

    2014-01-01

    La terneza de la carne es el principal atributo de aceptación de la carne por parte del consumidor, sin olvidar las características de jugosidad y el sabor; por lo que su impacto en la rentabilidad y la calidad de la carne es de gran importancia. La terneza de la carne de bovinos está influenciada por factores genéticos y ambientales. El evaluar el desempeño de la terneza a través de factores como son el tiempo de maduración y el efecto del cruce de los animales, estos han sido de uso frecuen...

  6. Comparison of F1 Bos indicus x Hereford cows in central Texas: I. Reproductive, maternal, and size traits.

    Science.gov (United States)

    Riley, D G; Sanders, J O; Knutson, R E; Lunt, D K

    2001-06-01

    Cows (n = 116) sired by Angus, Gray Brahman, Gir, Indu-Brazil, Nellore, and Red Brahman bulls and from Hereford dams were evaluated (when bred to the same breed of bull) for reproductive performance and cow weight and height and their calves (n = 1,161) were evaluated for birth and weaning weight in central Texas (temperate winters and subtropical summers). Cows were born from 1982 to 1985 and their calves were born from 1985 to 1999. Crossbred cows sired by Angus had a higher (P Brahman crossbreds. Calves from Gir crossbreds had lighter (P Angus and Red Brahman crossbreds (39.4 and 37.2 kg). Calves from Angus crossbreds cows had lighter (P Angus were lighter (P Brahman, Indu-Brazil, and Red Brahman crossbreds (585.6, 571.9, and 577.6 kg, respectively). They also had smaller (P Angus and Indu-Brazil crossbred cows were lower (P < or = 0.10) than Gir and Nellore crossbreds for pregnancy rate, calf crop born, and(or) calf crop weaned at some, but not all, ages. Indu-Brazil crossbreds had a lower (P < or = 0.10) calf survival rate than most other breed groups at ages 11 to 14 yr. The results of this study indicate that Nellore and Gir crossbreds, but not Indu-Brazil, could perform as well or better than breeds traditionally used in cross-breeding programs of U.S. cow-calf production. PMID:11424679

  7. Assessment of adaptability of zebu cattle ( Bos indicus) breeds in two different climatic conditions: using cytogenetic techniques on genome integrity

    Science.gov (United States)

    Kumar, Anil; Waiz, Syma Ashraf; Sridhar Goud, T.; Tonk, R. K.; Grewal, Anita; Singh, S. V.; Yadav, B. R.; Upadhyay, R. C.

    2016-06-01

    The aim of this study was to evaluate the genome integrity so as to assess the adaptability of three breeds of indigenous cattle reared under arid and semi-arid regions of Rajasthan (Bikaner) and Haryana (Karnal) India. The cattle were of homogenous group (same age and sex) of indigenous breeds viz. Sahiwal, Tharparkar and Kankrej. A total of 100 animals were selected for this study from both climatic conditions. The sister chromatid exchanges (SCE's), chromosomal gaps and chromatid breaks were observed in metaphase plates of chromosome preparations obtained from in vitro culture of peripheral blood lymphocytes. The mean number of breaks and gaps in Sahiwal and Tharparkar of semi-arid zone were 8.56 ± 3.16, 6.4 ± 3.39 and 8.72 ± 2.04, 3.52 ± 6.29, respectively. Similarly, the mean number of breaks and gaps in Tharparkar and Kankrej cattle of arid zone were 5.26 ± 1.76, 2.74 ± 1.76 and 5.24 ± 1.84, 2.5 ± 1.26, respectively. The frequency of SCEs in chromosomes was found significantly higher ( P 0.05) was observed in the same zone. The analysis of frequency of CAs and SCEs revealed significant effects of environmental conditions on the genome integrity of animals, thereby indicating an association with their adaptability.

  8. Characteristics of feeding and breeding practices for intensification of smallholder dairy systems in the Kenya highlands

    OpenAIRE

    B.O. Bebe; Udo, H.M.J.; Thorpe, W.

    2008-01-01

    This study aimed at better understanding of the characteristics of feeding and breeding practices smallholder farmers adopt in intensifying their dairy production. Use of hired labour for fodder gathering, growing of fodder crops and purchase of feeds increased with increasing intensification, but Bos taurus breeds did not respond to increasing feeding intensification while Bos indicus cattle responded, calving at earlier age and yielding more milk. Overall, first calving occurred at 32 month...

  9. Circumstellar disks around binary stars in Taurus

    Energy Technology Data Exchange (ETDEWEB)

    Akeson, R. L. [NASA Exoplanet Science Institute, IPAC/Caltech, Pasadena, CA 91125 (United States); Jensen, E. L. N. [Swarthmore College, Department of Physics and Astronomy, Swarthmore, PA 19081 (United States)

    2014-03-20

    We have conducted a survey of 17 wide (>100 AU) young binary systems in Taurus with the Atacama Large Millimeter Array (ALMA) at two wavelengths. The observations were designed to measure the masses of circumstellar disks in these systems as an aid to understanding the role of multiplicity in star and planet formation. The ALMA observations had sufficient resolution to localize emission within the binary system. Disk emission was detected around all primaries and 10 secondaries, with disk masses as low as 10{sup –4} M {sub ☉}. We compare the properties of our sample to the population of known disks in Taurus and find that the disks from this binary sample match the scaling between stellar mass and millimeter flux of F{sub mm}∝M{sub ∗}{sup 1.5--2.0} to within the scatter found in previous studies. We also compare the properties of the primaries to those of the secondaries and find that the secondary/primary stellar and disk mass ratios are not correlated; in three systems, the circumsecondary disk is more massive than the circumprimary disk, counter to some theoretical predictions.

  10. A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius).

    LENUS (Irish Health Repository)

    Edwards, Ceiridwen J

    2010-01-01

    BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius) has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs) from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+\\/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer). In total, 289.9 megabases (22.48%) of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously identified

  11. Alternative genotyping method for the single nucleotide polymorphism A2959G (AF159246 of the bovine CAST gene Método alternativo de genotipagem do polimorfismo de nucleotídeo único A2959G (AF159246 do gene CAST bovino

    Directory of Open Access Journals (Sweden)

    Rogério Abdallah Curi

    2008-05-01

    Full Text Available The objective of this work was to genotype the single nucleotide polymorphism (SNP A2959G (AF159246 of bovine CAST gene by PCR-RFLP technique, and to report its use for the first time. For this, 147 Bos indicus and Bos taurus x Bos indicus animals were genotyped. The accuracy of the method was confirmed through the direct sequencing of PCR products of nine individuals. The lowest frequency of the meat tenderness favorable allele (A in Bos indicus was confirmed. The use of PCR-RFLP for the genotyping of the bovine CAST gene SNP was shown to be robust and inexpensive, which will greatly facilitate its analysis by laboratories with basic structure.O objetivo deste trabalho foi genotipar o polimorfismo de nucleotídeo único ("single nucleotide polymorphism" - SNP A2959G (AF159246 do gene CAST bovino, pela técnica de PCR-RFLP, e reportar a sua utilização pela primeira vez. Para tanto, 147 animais Bos indicus e Bos taurus x Bos indicus foram genotipados. A acurácia do método foi confirmada por meio do seqüenciamento direto de produtos de PCR de nove indivíduos. A menor freqüência do alelo A, favorável à maciez da carne, foi confirmada nos animais Bos indicus. O uso da PCR-RFLP, para a genotipagem do SNP do gene CAST bovino, mostrou-se consistente e de baixo custo, o que permite a sua análise por laboratórios dotados de estrutura básica.

  12. Bacterial flora of pond reared Penaeus indicus (Milne Edwards)

    Digital Repository Service at National Institute of Oceanography (India)

    Singh, I.S.B.; Lakshmanaperumalsamy, P.; Chandramohan, D.

    to be the major flora associated with juveniles of P. indicus in the culture environment when they were maintained in hapa. Bacterial flora of the body surface and gills of the prawns in a grow out system were predominantly composed of Pseudomonas, Coryneform...

  13. Le Flaubert de Charles Du Bos

    Directory of Open Access Journals (Sweden)

    Jacques Neefs

    2009-01-01

    Full Text Available Charles Du Bos a porté une attention constante à l’œuvre de Flaubert (à l’exclusion de Bouvard et Pécuchet qui semble ne pas exister pour lui, à Madame Bovary et à L’Éducation sentimentale en particulier. La mise en relation de son étude : « Sur le milieu intérieur chez Flaubert », écrite en 1921, avec des textes du Journal de 1923 et de 1937, les rapprochements avec Gogol, Thomas Hardy, Tolstoï, Baudelaire, Henry James qui traversent les écrits de Du Bos, permettent de suivre ce que celui-ci décrit comme « l’expérience spirituelle » d’une matérialité comprise dans la conquête de la triple exigence du Beau, du Vivant et du Vrai. Du Bos décèle la force de l’œuvre de Flaubert dans la « disproportion » du style, et dans la puissance d’absorption qui fait la densité de cette prose, et qui désigne un extraordinaire travail de conversion. L’obscure expérience spirituelle ainsi poursuivie est celle d’un absolu de l’art, expérience paradoxale d’un « mystique qui ne croit à rien » (comme se désignait Flaubert lui-même, que le critique lie à une interrogation sur sa propre conversion.Charles Du Bos devoted an unflagging attention to Flaubert’s work (except for Bouvard et Pécuchet, which, apparently, according to him did not exist, to Madame Bovary and in particular L’Éducation sentimentale. The connection between his essay “Sur le milieu intérieur chez Flaubert”, written in 1921, and extracts from his Journal, from 1923 to 1937, the comparisons with Gogol, Thomas Hardy, Tolstoy, Baudelaire, and Henry James that run through the writings of Du Bos, allow us to follow what he terms “the spiritual experience” of a materiality encompassed in the conquest of the triple demand of the Beautiful, the Living, the Truth. Du Bos detects the power of Flaubert’s work in the “disproportion” of his style, and the power of absorption that forms the density of his prose, showing an

  14. Composição lipídica de carne bovina de grupos genéticos taurinos e zebuínos terminados em confinamento Lipid composition of meat from zebu and taurine cattle finished in confinement

    Directory of Open Access Journals (Sweden)

    Lizandra Vercezi Rossato

    2009-09-01

    Full Text Available O objetivo neste trabalho foi avaliar a composição em lipídeos totais, colesterol e ácidos graxos do músculo longissimus dorsi de bovinos Bos taurus (n=40 e Bos indicus (n=40 com 30 a 36 meses de idade e peso de carcaça entre 240 e 270 kg terminados em confinamento por 90 dias. Os resultados de lipídeos totais foram semelhantes entre os dois grupos. O nível de colesterol foi mais elevado em Bos indicus (66,95 mg/100 g que em Bos taurus (37,37 mg/100 g. Os valores médios dos ácidos graxos saturados de C14:0 e C18:0 foram mais elevados nos Bos indicus (3,52 e 22,45% em comparação aos Bos taurus (3,08 e 18,67%. O C16:0 nos Bos taurus (26,14% foi maior que nos Bos indicus (24,77%. Na análise do perfil de ácidos graxos monoinsaturados (AGM, os Bos taurus apresentaram os percentuais mais elevados de C14:1 cis9, C16:1 cis9, C18:1 cis9, ΣAGM e os menores de C18:1 trans. Os animais Bos taurus apresentaram maiores percentuais de C18:3 n-3, C20:4 n-6 e C22:5 n-3 (ácidos graxos poliinsaturados. Os ácidos graxos C18:2 n-6, CLA, C20:5 n-3, C22:6 n-3, ΣAGP e Σn-6 foram semelhantes entre grupos de bovinos. A razão n-6/n-3 foi menor em Bos taurus (4,63 em comparação aos Bos indicus (5,70. Em geral, o grupo genético influencia o perfil de colesterol e ácidos graxos de bovinos e esse efeito é mais pronunciado nos ácidos graxos saturados e monoinsaturados.This study was carried out to evaluate total lipids (TL, cholesterol and fatty acids (FA in the longissimus dorsi muscle of Bos taurus (n=40 and Bos indicus (n=40 bulls, aged 30-36 months and 240-270 kg carcass weight, finished in the feedlot for 90 days. The total lipids content was similar in both groups. Cholesterol was higher in Bos indicus (66.95 mg/100 g than in Bos taurus (37.37 mg/100 g. For saturated fatty acids, the means for C14:0 and C18:0 were higher in Bos indicus (3.52 and 22.45%, than in Bos taurus (3.08 e 18.67%. The C16:0 was higher in Bos taurus (26.14%, as compared to

  15. Van 't bos los?; een verkennende studie naar de interactie tussen recreatieve gebruikers en beheerders van het Nederlandse bos

    NARCIS (Netherlands)

    Moerdijk, L.J.; Molenaar, de H.G.; Verbij, E.E.M.

    2000-01-01

    In 1998 is op een inductieve wijze onderzoek gedaan naar de vervreemding die plaatsvindt tussen bosgebruikers en bosbeheerders. Door allerlei ontwikkelingen in de samenleving is de afhankelijkheid van het bos enorm afgenomen en heeft bos vooral een functie van ontspanning en rust. In dit onderzoek i

  16. Bos in water, water in bos; kansenkaarten voor multifunctionele natte bossen met meerwaarde voor waterbeheer, natuur en recreatie

    NARCIS (Netherlands)

    Hommel, P.W.F.M.; Rooij, van S.A.M.; Waal, de R.W.; Vries, de F.; Goossen, C.M.

    2005-01-01

    Uit eerder onderzoek is gebleken dat de combinatie van water en bos gunstig kan zijn voor natuur, waterbeheer en recreatie. Dit vervolg onderzoek heeft tot doel in beeld te brengen wáár in Nederland de meest kansrijke plekken voor deze combinatie liggen. De volgende hoofdtypen 'nat bos' worden onder

  17. Characteristics and functions of a minor FSH surge near the end of an interovulatory interval in Bos taurus heifers.

    Science.gov (United States)

    Ginther, O J; Baldrighi, J M; Siddiqui, M A R; Wolf, C A

    2016-07-01

    The apparent function of a minor FSH surge based on temporality with follicular events was studied in 10 heifers with 2 follicular waves per interovulatory interval. Individual follicles were tracked from their emergence at 2 mm until their outcome was known, and a blood sample was collected for FSH and LH assay every 12 h from day -14 (day 0 = ovulation) to day 4. A minor FSH surge occurred in each heifer (peak, day -4.6 ± 0.2). Concentration of LH increased (P heifers. The maximal diameter (mean, 3.4 ± 0.9 mm) of 77% of the minor-wave follicles occurred in synchrony on day -4.4 ± 0.4. Most (59%) of minor-wave follicles regressed before ovulation and 41% decreased and then increased in diameter (recovered) on day -1.9 ± 0.3 to become part of the subsequent wave 1. A mean of 3.7 ± 0.9 regressing subordinate follicles from wave 2 recovered on the day before or at the peak of the minor FSH surge. The growth rate of the preovulatory follicle decreased (P < 0.02) for 3 d before the peak of the minor FSH surge and then increased (P < 0.03). Concentration of LH increased slightly but significantly temporally with the resurgence in growth rate of the preovulatory follicle. A minor LH surge peaked (P < 0.0002) on day 3 at the expected deviation in growth rates between the future dominant and subordinate follicles. Results indicated on a temporal basis that the recovery of some regressing subordinate follicles of wave 2 was attributable to the minor FSH surge. The hypothesis was supported that some regressing follicles from the minor follicular wave recover to become part of wave 1. PMID:27131335

  18. Variance component estimates applying random regression models for test-day milk yield in Caracu heifers (Bos taurus Artiodactyla, Bovidae

    Directory of Open Access Journals (Sweden)

    Lenira El Faro

    2008-01-01

    Full Text Available Random regression models (RRM were used to estimate covariance functions for 2,155 first-lactation milk yields of native Brazilian Caracu heifers. The models included contemporary group (defined as year-month of test and paddock fixed effects, and quadratic effect of age of cow at calving. Genetic and permanent environmental effects were fitted by a random regression model and Legendre polynomials of days in milk (DIM. Schwarz's Bayesian information criteria (BIC indicated that the best RRM assumed a six coefficient function for both random effects and a sixth order variance function for residual structure. Akaike's information criteria suggested a model with the same number of coefficients for both effects and a residual structure fitted by a step function with 15 variances. Phenotypic, additive genetic, permanent environmental and residual variances were higher at the beginning and declined during lactation. The RRM heritability estimates were 0.09 to 0.26 and generally higher at the beginning and end of lactation. Some unexpected negative genetic correlations emerged when higher order covariance functions were used. A model with four coefficients for additive genetic covariance function explains more parsimoniously the changes in genetic variation with DIM since the genetic parameter was more acceptable and BIC was close to that for a six coefficient covariance function.

  19. Sequence diversity between class I MHC loci of African native and introduced Bos taurus cattle in Theileria parva endemic regions

    DEFF Research Database (Denmark)

    Obara, Isaiah; Nielsen, Morten; Jeschek, Marie;

    2016-01-01

    There is strong evidence that the immunity induced by live vaccination for control of the protozoan parasite Theileria parva is mediated by class I MHC-restricted CD8+ T cells directed against the schizont stage of the parasite that infects bovine lymphocytes. The functional competency of class I...

  20. In-Depth Characterization of Sheep (Ovis aries) Milk Whey Proteome and Comparison with Cow (Bos taurus)

    OpenAIRE

    Minh Ha; Manya Sabherwal; Elizabeth Duncan; Stewart Stevens; Peter Stockwell; Michelle McConnell; Alaa El-Din Bekhit; Alan Carne

    2015-01-01

    An in-depth proteomic study of sheep milk whey is reported and compared to the data available in the literature for the cow whey proteome. A combinatorial peptide ligand library kit (ProteoMiner) was used to normalize protein abundance in the sheep whey proteome followed by an in-gel digest of a 1D-PAGE display and an in-solution digestion followed by OFFGEL isoelectric focusing fractionation. The peptide fractions obtained were then analyzed by LC-MS/MS. This enabled identification of 669 pr...

  1. In-Depth Characterization of Sheep (Ovis aries Milk Whey Proteome and Comparison with Cow (Bos taurus.

    Directory of Open Access Journals (Sweden)

    Minh Ha

    Full Text Available An in-depth proteomic study of sheep milk whey is reported and compared to the data available in the literature for the cow whey proteome. A combinatorial peptide ligand library kit (ProteoMiner was used to normalize protein abundance in the sheep whey proteome followed by an in-gel digest of a 1D-PAGE display and an in-solution digestion followed by OFFGEL isoelectric focusing fractionation. The peptide fractions obtained were then analyzed by LC-MS/MS. This enabled identification of 669 proteins in sheep whey that, to our knowledge, is the largest inventory of sheep whey proteins identified to date. A comprehensive list of cow whey proteins currently available in the literature (783 proteins from unique genes was assembled and compared to the sheep whey proteome data obtained in this study (606 proteins from unique genes. This comparison revealed that while the 233 proteins shared by the two species were significantly enriched for immune and inflammatory responses in gene ontology analysis, proteins only found in sheep whey in this study were identified that take part in both cellular development and immune responses, whereas proteins only found in cow whey in this study were identified to be associated with metabolism and cellular growth.

  2. Accumulation and detoxification of metals and arsenic in tissues of cattle (Bos taurus), and the risks for human consumption

    Energy Technology Data Exchange (ETDEWEB)

    Roggeman, Saskia, E-mail: saskiaroggeman@gmail.com [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium); de Boeck, Gudrun [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium); De Cock, Hilde [General Medical Laboratory (Medvet/AML), Department of Pathology, Emiel Vloorsstraat 9, 2020 Antwerpen (Belgium); Blust, Ronny; Bervoets, Lieven [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium)

    2014-01-01

    The aim of this study was to investigate metal accumulation and detoxification processes in cattle from polluted and unpolluted areas. Therefore dairy cows from farms and free ranging Galloway cows from nature reserves were used as study animals. The concentrations of Ag, Cd, Pb, Al, Cr, Mn, Fe, Co, Ni, Cu, Zn and As were determined in muscle, kidney, liver and lungs of cattle from polluted and reference areas in Belgium. In kidney and liver also the metallothionein concentrations were measured. For Ag, Mn, Co, Cu, Zn and As the concentrations in the different tissues were significantly higher in the sampled Galloways than in the sampled dairy cows. On the other hand Cd and Pb were significantly higher in tissues of both cattle breeds from polluted sites. Cadmium seemed to be the most important metal for metallothionein induction in kidneys whereas Zn seemed to be the most important metal for the induction of metallothionein in the liver. This study also suggested that only for Mn and Cd a significant part of the uptake occurs via the lungs. Although in muscle none of the Cd and Pb levels exceeded the European limits for human consumption, 40% of the livers and 85% of the kidneys of all examined cows were above the European limit for cadmium. Based on the existing minimum risk levels (MRLs) for chronic oral exposure, the present results suggested that a person of 70 kg should not eat more than 150 g cow meat per day because of the Cr levels in the muscles. - Highlights: •Cadmium induced metallothionein in kidney while Zn induced metallothionein in liver. •For Mn and Cd a significant part of the uptake happens via the lungs. •40% of the livers and 85% of the kidneys exceeded the European limit for cadmium. •A person of 70 kg should not eat more than 150 g bovine meat per day.

  3. Effects of Stocking Density or Group Size on Intake, Growth, and Meat Quality of Hanwoo Steers (Bos taurus coreanae)

    OpenAIRE

    Lee, Sang Moo; Kim, Jae Yeon; Kim, Eun Joong

    2012-01-01

    This study was conducted to investigate the effects of stocking density or group size on feed intake, daily gain, and carcass characteristics of Hanwoo (Korean indigenous breed) steers reared from 7 months to 31 months of age. Thirty Hanwoo steers were divided into four groups with three replicates each (a total of 12 pens). In each group, one (G1), two (G2), three (G3), and four steers (G4) per pen were allocated as treatments. Pen size was 32.0 m2, and therefore Hanwoo steers in G1, G2, G3,...

  4. Effects of Stocking Density or Group Size on Intake, Growth, and Meat Quality of Hanwoo Steers (Bos taurus coreanae).

    Science.gov (United States)

    Lee, Sang Moo; Kim, Jae Yeon; Kim, Eun Joong

    2012-11-01

    This study was conducted to investigate the effects of stocking density or group size on feed intake, daily gain, and carcass characteristics of Hanwoo (Korean indigenous breed) steers reared from 7 months to 31 months of age. Thirty Hanwoo steers were divided into four groups with three replicates each (a total of 12 pens). In each group, one (G1), two (G2), three (G3), and four steers (G4) per pen were allocated as treatments. Pen size was 32.0 m(2), and therefore Hanwoo steers in G1, G2, G3, and G4 were reared under different space allowances, i.e. 32.0, 16.0, 10.6, and 8.0 m(2)/steer, respectively. Steers were reared following a conventional beef cattle management method in Korea, and were offered a fixed amount of commercial concentrate with ad libitum forages. Results were subjected to analysis of variance with stocking density as the main effect, and significance was declared at pmeat yield index, and meat yield grade were similar among all levels of stocking density. However, longissimus muscle area was larger in G1 and G2 (pquality traits, including marbling score, meat color, fat color, texture, maturity and meat quality grade, as determined by a group of experts, were not significantly different among the treatments. In conclusion, lower stocking density resulted in increased feed efficiency, daily gain, and carcass weight in Hanwoo steers. However it remains unclear whether such differences are the results of stocking density or group size, or a combination of both. Nonetheless, these results confirm previous studies reporting a negative effect of increased stocking density on animal productivity. Further, animal welfare under an intensive farming system in relation to economical return is discussed. PMID:25049516

  5. Predicting wolf (Canis lupus)-cattle (Bos Taurus) encounters and consequential effects on cattle resource selection patterns

    Science.gov (United States)

    The gray wolf population in Idaho has grown dramatically from the original 35 reintroduced individuals in 1995-1996 to 94 documented packs and a minimum population of 835 individuals in 2009. Wolf depredation on livestock has also increased dramatically with this population growth. Substantial spa...

  6. Perfluorooctane Sulfonate Plasma Half-Life Determination and Long-Term Tissue Distribution in Beef Cattle (Bos taurus).

    Science.gov (United States)

    Lupton, Sara J; Dearfield, Kerry L; Johnston, John J; Wagner, Sarah; Huwe, Janice K

    2015-12-30

    Perfluorooctane sulfonate (PFOS) is used in consumer products as a surfactant and is found in industrial and consumer waste, which ends up in wastewater treatment plants (WWTPs). PFOS does not breakdown during WWTP processes and accumulates in the biosolids. Common practices include application of biosolids to pastures and croplands used for feed, and as a result, animals such as beef cattle are exposed to PFOS. To determine plasma and tissue depletion kinetics in cattle, 2 steers and 4 heifers were dosed with PFOS at 0.098 mg/kg body weight and 9.1 mg/kg, respectively. Plasma depletion half-lives for steers and heifers were 120 ± 4.1 and 106 ± 23.1 days, respectively. Specific tissue depletion half-lives ranged from 36 to 385 days for intraperitoneal fat, back fat, muscle, liver, bone, and kidney. These data indicate that PFOS in beef cattle has a sufficiently long depletion half-life to permit accumulation in edible tissues.

  7. The polymorphisms of bovine cocaine- and amphetamine-regulated transcripts and their associations with cattle (Bos taurus) growth traits

    Indian Academy of Sciences (India)

    Chun Lei Zhang; Hong Chen; Yan Hong Wang; Xian Yong Lan; Chu Zhao Lei; Xing Tang Fang

    2008-09-01

    We investigated the polymorphisms of bovine cocaine- and amphetamine-regulated transcripts (CART). The coding and regulating regions of CART were screened in 7 cattle breeds by the single-stranded conformation polymorphism (SSCP) technique. The four loci (C1, C2, C3 and C4) studied were all polymorphic. Polymerase chain reaction (PCR) products representing different SSCP variants were sequenced and a total of 9 single-nucleotide polymorphisms (SNPs) were found. The associations between polymorphic loci and the growth traits of Nanyang cattle were analysed. The results indicated that genotype A1A1 of the C1 locus was associated with a higher body weight ( < 0.05) than heterozygous A1B1. Genotype A2A2 of the C2 locus was associated with lower body weight and average daily weight gain ( ≤ 0.001) than heterozygous A2B2. C3 and C4 loci had no significant effect on Nanyang cattle growth traits (P > 0.05).

  8. Association of CAPN1 and CAST gene polymorphisms with meat tenderness in Bos taurus beef cattle from Argentina

    Directory of Open Access Journals (Sweden)

    Pablo Corva

    2007-01-01

    Full Text Available The activity of the calpains/calpastatin proteolytic system is closely related to the postmortem tenderization of meat. We investigated the association between beef tenderness and single nucleotide polymorphism (SNP markers on the CAPN1 gene (SNP316, alleles C/G; SNP530 alleles A/G and the CAST gene 3' untranslated region (SNP2870, alleles A/G. We sampled nine slaughter groups comprising 313 steers which had been reared in beef production systems in Argentina between 2002 and 2004 from crosses between Angus, Hereford and Limousin cattle. Minor allele frequencies for the markers were 0.27 to 0.46 (C, 0.02 to 0.18 (A, and 0.24 to 0.53 (A, respectively. The presence of CAPN1 markers had significant effects on meat shear force but no detectable effects were demonstrated for the CAST marker. The shear force of meat from steers with the SNP316 CC genotype was 11% lower than for the SNP316 CG genotype and 17% lower than for the SNP316 GG genotype. There were very few steers with the SNP530 AA genotype and, contrary to previous studies, meat from steers with the SNP530 GG genotype showed an 11.5% higher shear force than that from steers with the SNP530 GA genotype. Final body weight, carcass weight and rib eye area were not affected by any of the markers. These results support the concept that CAPN1 variants are associated with tenderness across a wide range of beef production systems.

  9. Localisation of aphidicolin-induced break points in Holstein-Friesian cattle (Bos taurus using RBG-banding

    Directory of Open Access Journals (Sweden)

    Mernies Beatriz

    2002-11-01

    Full Text Available Abstract Fragile sites (FS seem to play a role in genome instability and may be involved in karyotype evolution and chromosome aberrations. The majority of common fragile sites are induced by aphidicolin. Aphidicolin was used at two different concentrations (0.15 and 0.30 μM to study the occurrence of FS in the cattle karyotype. In this paper, a map of aphidicolin induced break points and fragile sites in cattle chromosomes was constructed. The statistical analysis indicated that any band with three or more breaks was significantly damaged (P r = 0.54. On the contrary, 21 FS were identified on negative R bands while 9 FS were located on positive R bands.

  10. Accumulation and detoxification of metals and arsenic in tissues of cattle (Bos taurus), and the risks for human consumption

    International Nuclear Information System (INIS)

    The aim of this study was to investigate metal accumulation and detoxification processes in cattle from polluted and unpolluted areas. Therefore dairy cows from farms and free ranging Galloway cows from nature reserves were used as study animals. The concentrations of Ag, Cd, Pb, Al, Cr, Mn, Fe, Co, Ni, Cu, Zn and As were determined in muscle, kidney, liver and lungs of cattle from polluted and reference areas in Belgium. In kidney and liver also the metallothionein concentrations were measured. For Ag, Mn, Co, Cu, Zn and As the concentrations in the different tissues were significantly higher in the sampled Galloways than in the sampled dairy cows. On the other hand Cd and Pb were significantly higher in tissues of both cattle breeds from polluted sites. Cadmium seemed to be the most important metal for metallothionein induction in kidneys whereas Zn seemed to be the most important metal for the induction of metallothionein in the liver. This study also suggested that only for Mn and Cd a significant part of the uptake occurs via the lungs. Although in muscle none of the Cd and Pb levels exceeded the European limits for human consumption, 40% of the livers and 85% of the kidneys of all examined cows were above the European limit for cadmium. Based on the existing minimum risk levels (MRLs) for chronic oral exposure, the present results suggested that a person of 70 kg should not eat more than 150 g cow meat per day because of the Cr levels in the muscles. - Highlights: •Cadmium induced metallothionein in kidney while Zn induced metallothionein in liver. •For Mn and Cd a significant part of the uptake happens via the lungs. •40% of the livers and 85% of the kidneys exceeded the European limit for cadmium. •A person of 70 kg should not eat more than 150 g bovine meat per day

  11. Technical note: Digital quantification of eye pigmentation of cattle with white faces.

    Science.gov (United States)

    Davis, K M; Smith, T; Bolt, B; Meadows, S; Powell, J G; Vann, R C; Arthington, J D; DiLorenzo, N; Lalman, D L; Rouquette, F M; Hansen, G R; Cooper, A J; Cloud, J E; Garcia, M D; Herring, A D; Hale, D S; Sanders, J O; Hairgrove, T B; DeWitt, T J; Riley, D G

    2015-07-01

    Cancer of the eye in cattle with white faces occurs less frequently in cattle with pigmented eyelids. Corneoscleral pigmentation is related to eyelid pigmentation and occurrence of lesions that may precede cancer. Objectives of this study were to assess 1) variation in the proportion of eyelid and corneoscleral pigmentation in Hereford, Bos taurus, and Bos indicus crossbreds and 2) the occurrence of lesions with the presence of pigmentation in those areas. Hereford and Bos indicus crosses (Brahman or Nellore with Angus and Hereford and straightbred Brafords) and Bos taurus crosses (Angus-Hereford) were included in the study (n = 1,083). Eyelid pigmentation proportions were estimated by pixel quantification and were evaluated as total proportions and for upper and lower eyelids distinctly for each eye. Fixed effects included breed type, age categories, and sex of the animal. Lesion presence (1) or absence (0) was obtained by visual appraisal of image and was assumed to be binomially distributed. Eyelid pigmentation proportions (overall, upper, and lower eyelids) for Hereford ranged from 0.65 ± 0.03 to 0.68 ± 0.03 and were significantly lower than Bos indicus (range from 0.93 ± 0.02 to 0.95 ± 0.02) or Bos taurus (ranged from 0.88 ± 0.02 to 0.92 ± 0.02) crosses. Corneoscleral pigmentation in Hereford cows (0.17 ± 0.06) did not differ (P = 0.91) from Hereford calves and yearlings (0.16 ± 0.07). Bos indicus and Bos taurus crossbred cows had larger corneoscleral pigmentation (0.38 ± 0.05 and 0.48 ± 0.04 for left eyes and 0.37 ± 0.05 and 0.53 ± 0.04 for right eyes, respectively) than all calves (P < 0.001), and their corneoscleral pigmentations were greater than that of Hereford cows (P < 0.003). Bos indicus and Bos taurus cows had greater proportions of left eye corneoscleral pigmentation (0.38 ± 0.05 and 0.48 ± 0.04, respectively) than Hereford cows (0.17 ± 0.06) and all young animal breed types (P < 0.05). Right eye proportions differed for all cow

  12. The role of genotype on classification grades of beef carcasses produced under mexican tropical conditions

    OpenAIRE

    José Manuel Zorrilla-Ríos; Phillip Lancaster; Carla Goad; Gerald Horn; Margarita Hernández-Gallardo

    2015-01-01

    El presente estudio identificó la distribución de 22,850 canales de bovino de diferentes genotipos. Éstos, en función del juzgamiento visual del tamaño de la giba (grande, representativa de un genotipo Bos indicus; mediana, genotipo producto de la cruza entre B. taurus y B. indicus y pequeña, considerada como genotipo B. taurus) en los grados de clasificación obtenidos bajo la norma mexicana NMX-FF-078-SCFI-2002, en el rastro Tipo Inspección Federal No. 51 de La Unión, Tabasco (México). Se de...

  13. Mitochondrial control region genetic diversity and maternal ancestry of a Brangus-Ibage cattle populations

    OpenAIRE

    Luiz Ernani Henkes; Wilson Araújo Silva Jr; José Carlos Ferrugem Moraes; Tania de Azevedo Weimer

    2005-01-01

    The genetic diversity of 277 nucleotides in the mitochondrial DNA control region (nt 15,964 to 16,240 in reference sequence) was analyzed in crossbreed beef cattle (Brangus-Ibage, 5/8 Bos primigenius taurus x 3/8 Bos primigenius indicus) as well as in some Nellore samples (B. p. indicus). Fifty-seven mutations were found in Brangus-Ibage comprising 18 haplotypes (haplotype diversity, h = 0.851 ± 0.041 and nucleotide diversity, ntd = 0.009 ± 0.006) and 66 in Nellore (h = 1.00 ± 0.27, ntd = 0.0...

  14. Ovarian and endocrine characteristics during an estrous cycle in Angus, Brahman, and Senepol cows in a subtropical environment.

    Science.gov (United States)

    Alvarez, P; Spicer, L J; Chase, C C; Payton, M E; Hamilton, T D; Stewart, R E; Hammond, A C; Olson, T A; Wettemann, R P

    2000-05-01

    To determine breed differences in ovarian function and endocrine secretion, daily rectal ultrasonography was conducted on multiparous lactating Angus (temperate Bos taurus; n = 12), Brahman (tropical Bos indicus; n = 12), and Senepol (tropical Bos taurus; n = 12) cows during an estrous cycle in summer. Blood was collected daily to quantify plasma concentrations of FSH, LH, progesterone, estradiol, GH, insulin-like growth factor (IGF)-I, IGF-II, IGF binding proteins (IGFBP), insulin, glucose, and plasma urea nitrogen (PUN). Numbers of small (2 to 5 mm), medium (6 to 8 mm), and large follicles (> or = 9 mm) were greater (P Brahman than in Angus and(or) Senepol cows. Length of the estrous cycle (SEM = .6 d) was similar (P > .10) among Senepol (20.4 d), Angus (19.5 d), and Brahman (19.7 d) cows. Senepol cows had greater (P Brahman or Senepol cows (breed x day, P .10) among breeds. Concentrations of GH, IGF-I, insulin, and PUN were greater (P Brahman than in Angus or Senepol cows. Plasma glucose concentrations were greater (P Senepol than in Brahman or Angus cows. In conclusion, Brahman (Bos indicus) and Senepol cows (tropical Bos taurus) had greater numbers of follicles in all size categories and greater diameter of CL than Angus (temperate Bos taurus) cows. These ovarian differences may be due to changes in the pattern of secretion of FSH, insulin, IGF-I, and GH but not LH, IGF-II, or IGFBP-2 or -3. PMID:10834585

  15. Heparin-binding proteins of seminal plasma in Nellore bulls Proteínas ligadoras à heparina do plasma seminal em touros Nelore

    Directory of Open Access Journals (Sweden)

    Carlos Eurico Fernandes

    2009-02-01

    Full Text Available The aim of this study was to identify heparin-binding proteins (HBPs in seminal plasma of Nellore (Bos taurus indicus bulls. Bulls (n=4, 30-36 months old, 500-550kg with satisfactory seminal quality were selected. After the centrifugation, samples of the seminal plasma were pooled and the HBPs were isolated by heparin-affinity chromatography. The recovered HBPs fractions were pooled. One-dimensional sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDSPAGE 12.5% was performed in vertical minigels. Eight bands with molecular weights ranging from 15 to 63kDa were observed. Two proteins were identified (22 and 25kDa, similar to those previously described in Bos taurus taurus bulls. Other bands identified in this study (39, 53, 58 and 63kDa have not been previously observed and possibly they are specific to Nellore semen.O objetivo deste estudo foi identificar proteínas ligadoras à heparina no plasma seminal de touros Nelore (Bos taurus indicus. Para tanto, foram selecionados quatro touros entre 30 e 36 meses de idade e peso aproximado de 500-550kg. Após centrifugação, amostras do plasma seminal foram misturadas e as proteínas ligadoras à heparina foram isoladas por meio da cromatografia por afinidade. As frações após a eluição foram agrupadas para caracterização das bandas protéicas (SDSPAGE, 12,5%. Foram identificadas oito bandas protéicas variando entre 15 e 63kDa. Duas proteínas com 22 e 25kDa foram similares às descritas em touros Bos taurus taurus. Outras proteínas identificadas com 39, 53, 58 e 63kDa ainda não foram descritas e possivelmente sejam específicas para Bos taurus indicus.

  16. Characterization and genetic analysis of bovine alpha S1-casein I variant.

    Science.gov (United States)

    Lühken, G; Caroli, A; Ibeagha-Awemu, E M; Erhardt, G

    2009-08-01

    The aim of this study was to identify the molecular genetic origin underlying the I variant of alpha(s1)-casein and to develop a DNA-based test for this polymorphism as a tool for genetic analyses independent of milk sample testing. All coding exons and flanking regions of the alpha(s1)-casein gene were sequenced in DNA samples from cattle of known alpha(s1)-casein genotypes (BI, CI, II, CC), determined by isoelectric focusing of milk samples. A nucleotide substitution (A>T) in exon 11 (g.19836A>T) leads to the exchange of Glu with Asp at amino acid position 84 of the mature protein (p.Glu84Asp) and perfectly co-segregated with the presence of the alpha(s1)-casein I variant in the milk of the analysed animals. Genotyping of a total of 680 DNA samples from 31 Bos taurus and Bos indicus cattle breeds and from Bos grunniens, Bison bison and Bison bonasus by restriction fragment length polymorphism analysis revealed the occurrence of Asp at position 84 at low frequencies in Bos taurus and Bos indicus breeds and established its origin from the alpha(s1)-casein C variant (p.Glu192Gly). Ten different intragenic haplotypes in the gene region from intron 8 to intron 12 were observed by sequencing, of which two occurred in Bison bison and one in Bison bonasus only. Using available casein gene complex information, an association of Asp at position 84 to beta-casein A(2) and kappa-casein B was shown in the Bos indicus breed Banyo Gudali. Taken together, we can postulate that the alpha(s1)-casein variant I is caused by a non-synonymous nucleotide substitution in exon 11 of the gene and that it originated within Bos indicus and spread to Bos taurus subsequently.

  17. Psychotropic Activity of Sphaeranthus indicus Linn. In Experimental Animals

    Directory of Open Access Journals (Sweden)

    V J Galani

    2009-01-01

    Full Text Available Sphaeranthus indicus Linn. (Asteraceae is a branched herb with purple color flowers, distributed in wet places. The present study evaluated the neuropharmacological effects of the hydroalcoholic extract of S. indicus (SIE in rats and mice. Effect of SIE (100, 200 and 500 mg/kg, p.o. on spontaneous motor activity, pentobarbital-induced sleeping time, motor coordination, exploratory behaviour and apomorphine-induced stereotypy were investigated in mice. SIE (100, 200 and 500 mg/kg, p.o. induced catalepsy and effect of SIE on haloperidol induced catalepsy were studied in rats. The SIE showed significant reduction of spontaneous motor activity, exploratory behaviour and prolonged pentobarbital sleeping time in the mice. Neuroleptic potential of SIE was observed by the results in which SIE antagonized apomorphine-induced stereotypy in mice, produced catalepsy and potentiated haloperidol-induced catalepsy in rats. Further, SIE had no effect on motor-coordination as determined by the rota rod test. These results provide evidence that the hydroalcoholic extract of Sphaeranthus indicus may contain psychoactive substances that are sedative in nature with possible neuroleptic properties.

  18. Mitochondrial control region genetic diversity and maternal ancestry of a Brangus-Ibage cattle populations

    Directory of Open Access Journals (Sweden)

    Luiz Ernani Henkes

    2005-03-01

    Full Text Available The genetic diversity of 277 nucleotides in the mitochondrial DNA control region (nt 15,964 to 16,240 in reference sequence was analyzed in crossbreed beef cattle (Brangus-Ibage, 5/8 Bos primigenius taurus x 3/8 Bos primigenius indicus as well as in some Nellore samples (B. p. indicus. Fifty-seven mutations were found in Brangus-Ibage comprising 18 haplotypes (haplotype diversity, h = 0.851 ± 0.041 and nucleotide diversity, ntd = 0.009 ± 0.006 and 66 in Nellore (h = 1.00 ± 0.27, ntd = 0.014 ± 0.012. These data indicated sequence identities of 99.6 and 92.1% between the B. p. taurus' reference sequence and Brangus-Ibage and Nellore, respectively. The comparison of our data with sequence data for 612 individuals recovered from GenBank showed a total of 205 haplotypes defined by 99 polymorphic sites. Most of the variability (53% was due to differentiation within breeds. The phylogenetic tree constructed using the neighbor-joining method showed clearly the well-known dichotomy between B. p. taurus and B. p. indicus. The Brangus-Ibage clustered with B. p. taurus lineages; however, the displacement of Nellore from B. p. indicus branch probably indicates a substantial B. p. taurus maternal ancestry in some Nellore samples (obtained from GenBank and reflects the primarily male-driven introduction of this breed in Brazil.

  19. Application of Background Oriented Schlieren (BOS) in Underground Mine Ventilation

    OpenAIRE

    Jong, Edmund Chime

    2011-01-01

    The schlieren technique describes an optical analysis method designed to enhance light distortions caused by air movement. The ability to visualize gas flows has significant implications for analyzing underground mine ventilation systems. Currently, the widely utilized traditional schlieren methods are impractical underground due to complex equipment and design requirements. Background oriented schlieren (BOS) provides a solution to this problem. BOS requires two primary components, a pro...

  20. A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius.

    Directory of Open Access Journals (Sweden)

    Ceiridwen J Edwards

    Full Text Available BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer. In total, 289.9 megabases (22.48% of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously

  1. Risk factors related to resistance to Rhipicephalus (Boophilus microplus and weight gain of heifers

    Directory of Open Access Journals (Sweden)

    Jenevaldo Barbosa da Silva

    2015-08-01

    Full Text Available The aim of the present study was to evaluate the influence of age and genetics in dairy heifers on resistance to the cattle tick Rhipicephalus (Boophilus microplus and correlate these parameters with weight gain. Twenty-two heifers were evaluated from birth up to two years of age. Resistance to the cattle tick was evaluated by counting the number of engorged female ticks and subjective qualification of the larvae and nymph infestation. The animals were weighted in the first 24 hours after birth and at six, 12, 18 and 24 months of age. The average tick count and weight gain were compared by Tukey’s test at 5% significance. Subsequently, linear regression was performed to verify the strength of the association between the risk factors age and genetics and infestation by R. (B. microplus. Age and genetics were both significant risk factors for R. (B. microplus infestation in heifers. Between the third and sixth months of age, the animals showed a window of susceptibility to R. (B. microplus. Regardless of age, Bos taurus heifers had higher infestations than Bos indicus, crossbred F1 (½ B. taurus x ½ B. indicus and crossbred Gir-Holstein (Girolando (? B. taurus x ? B. indicus heifers. B. taurus heifers were heavier than B. indicus heifers at birth and had significantly greater weight gain (p < 0.01.

  2. Imunoidentification of Albumin and Osteopontin in Seminal Plasma of Taurine and Zebuine Bulls/ Imunoidentificação de Albumina e Osteopontina no Plasma Seminal de Reprodutores Taurinos e Zebuínos

    Directory of Open Access Journals (Sweden)

    Rodrigo Costa Mattos

    2002-05-01

    Full Text Available Two dimensional polyacrylamide gel electrophoresis was performed in seminal plasma of seven Bos taurus taurus and seven Bos taurus indicus bulls with high semen freezability, from an artificialinsemination center. In a 8% polyacrylamide gels, three bands of 195, 66 and 55 kDa, present in 100% of the samples in both sub-species, were analyzed by their optical densities. In Bos taurus samples, the opticals densities of 55 kDa band, imunoidentified as osteopontin were superior (pAs proteínas do plasma seminal de 14 reprodutores (7 Bos taurus taurus e 7 Bos taurus indicus, foram analisadas por eletroforese bidimensional, em géis de poliacrilamida a 8%, corados por Comassie Blue. Três bandas protéicas, presentes em 100% das amostras de plasma seminal, foram quantificadas de acordo com a densidade óptica exibida: 195 kDa, pI 6,5-7,5 ; 66 kDa, pI 5,4 e 55 kDa, pI 4,5. As amostras de plasma seminal provenientes de taurinos apresentaram densidades ópticas significativamente superiores (p < 0,05 às dos zebuínos na banda de 55 kDa, que foi imunoidentificada como osteopontina. As demais proteínas analisadas não apresentaram variações significativas entre as subespécies. A banda protéica de 66 kDa, foi imunoidentificada como albumina. Nas amostras provenientes de taurinos, as densidades ópticas das três bandas protéicas quantificadas não evidenciaram variação significativa entre os reprodutores. Entretanto, nos zebuínos, as densidades ópticas da albumina apresentaram diferenças significativas entre os touros (p < 0,05.

  3. Produção de Leite em Primíparas de Bovinos Hereford e Desenvolvimento Ponderal de Terneiros Cruzas Taurinos e Zebuínos

    Directory of Open Access Journals (Sweden)

    Mendonça Gilson de

    2002-01-01

    Full Text Available O objetivo deste trabalho foi avaliar a produção de leite de vacas de corte primíparas e o desenvolvimento ponderal dos terneiros de dois genótipos entre o nascimento e o desmame. Foram utilizadas 48 novilhas da raça Hereford (Bos taurus, com idade de três anos, manejadas sobre campo natural. As raças paternas utilizadas foram Red Angus (Bos taurus e Nelore (Bos indicus, em 16 e 32 vacas respectivamente. Os fatores estudados foram genótipo do terneiro (GENOT -- Bos taurus x Bos taurus e Bos taurus x Bos indicus, época de nascimento (EPOCN distribuída em três períodos -- 1S (setembro, 2O (outubro e 3N (novembro e sexo do terneiro (SEXO. Foram realizadas dez medidas de produção de leite pelo método indireto pesagem - mamada - pesagem e onze medidas de peso para vacas e terneiros, em intervalos de 21 dias. A média diária geral de produção de leite foi de 4,80 ± 0,09 kg. Não foram verificadas diferenças significativas na produção de leite em relação aos fatores estudados. O ganho de peso dos terneiros foi influenciado significativamente pela EPOCN, mas não pelo GENOT e SEXO. Concluiu-se que a produção de leite de vacas de corte primíparas, manejadas em campo natural, não foi influenciada pelo GENOT, EPOCN e SEXO dos terneiros. O desenvolvimento ponderal dos terneiros sofreu influência apenas da EPOCN.

  4. Influence of L-arginine during bovine in vitro fertilization.

    Science.gov (United States)

    Silva, Thiago Velasco Guimarães; da Silva, Bruno Baraúna; de Sá, André Luiz Alves; da Costa, Nathalia Nogueira; Sampaio, Rafael Vilar; Cordeiro, Marcela da Silva; Santana, Priscila Di Paula Bessa; Adona, Paulo Roberto; Santos, Simone do Socorro Damasceno; Miranda, Moysés dos Santos; Ohashi, Otávio Mitio

    2014-12-01

    The objective of this work was to evaluate the effect of using L-arginine during in vitro fertilization (IVF) on in vitro embryonic development using Bos taurus and Bos indicus semen. Effect of different concentrations (0, 1, 10 and 50 mM) of L-arginine, added to the IVF medium, was evaluated on the fertilization rate at 18 h post-fertilization (hpf), NO3(-)/NO2(-) production during IVF by the Griess colorimetric method (30 hpf), cleavage and blastocyst rates (on Day 2 and Day 7 of culture, respectively) and total blastocyst cell number (Day 7 of culture). The results reveal that the addition of 50 mM L-arginine to IVF medium, with either Bos taurus or Bos indicus spermatozoa, decreased the cleavage rate and blastocyst rate compared to the control group. Other concentrations did not affect embryo production. However, 1 mM L-arginine with Bos indicus semen increased the proportion of hatched blastocysts. These results indicate that high L-arginine concentrations may exhibit toxic effects on bovine gametes during in vitro fertilization. PMID:25651608

  5. In Memoriam Dr Lute Bos (1928-2010)

    NARCIS (Netherlands)

    Vlugt, van der R.A.A.

    2010-01-01

    Tuesday July 6, 2010 we were shocked by the news that that day our former colleague Lute Bos had died unexpectedly at the age of 82. Lute was a world-famous plant virologist. From the start of his career in 1957 until his retirement from the Institute for Plant Protection (IPO-DLO) in Wageningen in

  6. Combining ART and FBP for improved fidelity of tomographic BOS

    Science.gov (United States)

    Hartmann, Ulrich; Seume, Joerg R.

    2016-09-01

    Engine component defects along the hot-gas path (HGP) of jet engines influence the density distribution of the flow, and thus result in characteristic patterns in the exhaust jet. These characteristic patterns can be reconstructed with the optical background-oriented schlieren (BOS) method in a tomographic set-up, which in turn allows the identification of defects inside the engine through an exhaust jet analysis. The quality of the tomographic reconstruction strongly influences how easily defects can be detected inside the jet engine. In particular, the presence of high gradients in the reconstruction area has a strong impact on the reconstruction quality. An algebraic reconstruction algorithm (ART) is implemented and compared to a filtered-back projection (FBP) algorithm in terms of the capability of performing high-gradient tomographic BOS reconstructions. A combination of both algorithms is presented which significantly improves the reconstruction quality of high-gradient tomographic BOS in terms of artifact reduction. The combination of both algorithms is applied to both synthetic and real measurement data in this paper, in order to show possible applications and the achievable improvement of high-gradient tomographic BOS reconstructions.

  7. [Anthraquinones isolated from Morinda officinalis and Damnacanthus indicus].

    Science.gov (United States)

    Yang, Y J; Shu, H Y; Min, Z D

    1992-01-01

    From chloroform extract of the root of Morinda officinalis, eight anthraquinones were isolated whose structures were deduced to be rubiadin (I), rubiadin-1-methyl ether (II), 1-hydroxyanthraquinone (III), 1-hydroxy-2-methylanthraquinone (IV), 1,6-dihydroxy-2,4-dimethoxyanthraquinone (V), 1,6-dihydroxy-2-methoxyanthraquinone (VI), 1-hydroxy-2-methoxyanthraquinone (VII) and physcion (VIII). Except for compound I and compound II, the other compounds, 1-hydroxy-2-hydroxymethylanthraquinone (IX), 1,3-dihydroxy-2-methoxy-anthraquinone (X), 1,4-dihydroxy-2-methylanthraquinone (XI), 1-methoxy-2-hydroxyanthraquinone (XII) and 1,4-dimethoxy-2-hydroxyanthraquinone (XIII), were isolated from chloroform extract of root of Damnacanthus indicus. Compound V, VI and XIII are new compounds. PMID:1442057

  8. Gene discovery in the horned beetle Onthophagus taurus

    Directory of Open Access Journals (Sweden)

    Yang Youngik

    2010-12-01

    Full Text Available Abstract Background Horned beetles, in particular in the genus Onthophagus, are important models for studies on sexual selection, biological radiations, the origin of novel traits, developmental plasticity, biocontrol, conservation, and forensic biology. Despite their growing prominence as models for studying both basic and applied questions in biology, little genomic or transcriptomic data are available for this genus. We used massively parallel pyrosequencing (Roche 454-FLX platform to produce a comprehensive EST dataset for the horned beetle Onthophagus taurus. To maximize sequence diversity, we pooled RNA extracted from a normalized library encompassing diverse developmental stages and both sexes. Results We used 454 pyrosequencing to sequence ESTs from all post-embryonic stages of O. taurus. Approximately 1.36 million reads assembled into 50,080 non-redundant sequences encompassing a total of 26.5 Mbp. The non-redundant sequences match over half of the genes in Tribolium castaneum, the most closely related species with a sequenced genome. Analyses of Gene Ontology annotations and biochemical pathways indicate that the O. taurus sequences reflect a wide and representative sampling of biological functions and biochemical processes. An analysis of sequence polymorphisms revealed that SNP frequency was negatively related to overall expression level and the number of tissue types in which a given gene is expressed. The most variable genes were enriched for a limited number of GO annotations whereas the least variable genes were enriched for a wide range of GO terms directly related to fitness. Conclusions This study provides the first large-scale EST database for horned beetles, a much-needed resource for advancing the study of these organisms. Furthermore, we identified instances of gene duplications and alternative splicing, useful for future study of gene regulation, and a large number of SNP markers that could be used in population

  9. A WISE Survey of Circumstellar Disks in Taurus

    CERN Document Server

    Esplin, T L; Mamajek, E E

    2014-01-01

    We have compiled photometry at 3.4, 4.6, 12 and 22 $\\mu$m from the all-sky survey performed by the Wide-field Infrared Survey Explorer (WISE) for all known members of the Taurus complex of dark clouds. Using these data and photometry from the Spitzer Space Telescope, we have identified members with infrared excess emission from circumstellar disks and have estimated the evolutionary stages of the detected disks, which include 31 new full disks and 16 new candidate transitional, evolved, evolved transitional, and debris disks. We have also used the WISE All-Sky Source Catalog to search for new disk-bearing members of Taurus based on their red infrared colors. Through optical and near-infrared spectroscopy, we have confirmed 26 new members with spectral types of M1 - M7. The census of disk-bearing stars in Taurus should now be largely complete for spectral types earlier than $\\sim$M8 ($M \\gtrsim 0.03$ $M_\\odot$).

  10. Effects of Anomalous Tensor Couplings in BOs -(B-)Os Mixing

    Institute of Scientific and Technical Information of China (English)

    CHANG Qin; HAN Lin; YANG Ya-Dong

    2012-01-01

    Motivated by the recently observed anomalous large dimuon charge asymmetry in neutral B decays,we study the effects of the anomalous tensor couplings to pursue a possible solution.With the constraints from the observables φJ/(φ)(φ,f0)s,aSsl and ΔMs,the new physics parameter spaces are severely restricted.We find that the contributions induced by the color-singlet or the color-octet tensor operators are helpful to moderate the anomaly in BOs - (B-)Osmixing.Numerically,the observable aSsl could be enhanced by about two orders of magnitude by the contributionsof color-singlet or color-octet tensor operators with their respective nontrivial new weak phase φT1 =41° ± 35° orφs =-47° ± 33° and relevant strength parameters |gT1| =(2.89 ± 1.40) × 10-2 or |gT8| =(0.79 ± 0.34) × 10-2.However,due to the fact that the NP contributions are severely suppressed by the recent LHCb measurement for φJ/φ(φ,f0)s,our theoretical result of aSsl is still much smaller than the central value of the experimental data.

  11. Calibration of a Background Oriented Schlieren (BOS) Set-up

    Science.gov (United States)

    Porta, David; Echeverría, Carlos; Cardoso, Hiroki; Aguayo, Alejandro; Stern, Catalina

    2014-11-01

    We use two materials with different known indexes of refraction to calibrate a Background Oriented Schlieren (BOS) experimental set-up, and to validate the Lorenz-Lorentz equation. BOS is used in our experiments to determine local changes of density in the shock pattern of an axisymmetric supersonic air jet. It is important to validate, in particular, the Gladstone Dale approximation (index of refraction close to one) in our experimental conditions and determine the uncertainty of our density measurements. In some cases, the index of refraction of the material is well known, but in others the density is measured and related to the displacement field. We acknowledge support from UNAM through DGAPA PAPIIT IN117712 and the Graduate Program in Mechanical Engineering.

  12. Breeding programs for the main economically important traits of zebu dairy cattle

    Directory of Open Access Journals (Sweden)

    Ariosto Ardila Silva

    2010-06-01

    Full Text Available In tropical regions, Gyr and Guzerat breeds (Bos indicus are most explored for dairy industry and are much more adapted to climate. Gyr and Guzerat are Zebu breeds very common in Brazil and they are being used to generate Bos taurus x Bos indicus crosses in order to combine good production, heat and parasite tolerance on the tropics. Breeding programs for the main economically important traits of Zebu dairy cattle have been recently introduced in Brazil and is based on the use of genetically superior sires in the herds. A major objective of QTL (Quantitative Trait Loci and candidate genes is to find genes and markers that can be implemented in breeding programs across marker assisted selection (MAS. In Zebu dairy cattle MAS could be used to pre-select young candidate bulls to progeny testing, thus increasing selection differentials, shortening generation interval and increasing genetic gain

  13. Restriction fragment length polymorphism in calpain (CAPN2 gene in crossbred cattle

    Directory of Open Access Journals (Sweden)

    Maria Aparecida Cassiano Lara

    2012-12-01

    Full Text Available With advances in molecular genetics have been possible to predict the genetic value of the animal, in particular its potential to transmit desired characters to their offspring, including characters difficult to evaluate or with low heritability, as is the case of the meat tenderization. It is known that Bos taurus indicus features differences in meat tenderization, being assigned this variability to their lowest proteolysis post-mortem, as result of high activity of calpastatin. This inhibitor decreases the activity of calpain, which are the enzymes responsible for the degradation of muscle fibers during the maturation of the meat. Moreover, there were previously observed differences in the frequencies of allele A of calpain among European breeds (Hereford, Aberdeen Angus and Holstein and Bos taurus indicus (Gir, Guzerá and Nelore. This variability has been related to tenderness of meat, as cattle with Bos taurus taurus origin have more tender meat than Bos taurus indicus, showing small values of shear force. One explanation is that the Capn2A product could confer greater proteolytic activity than the encoded by the allele Capn2B. If allele A is associated with tender meat, it will be possible the early identification of the animals that have the potential to produce meat with qualities that attend the needs of the consumer market, in order to add economic value to the final product of the animal production chain. For this reason, biochemical and genetic studies related to calpain and calpastatin systems have been considered promising for the clarification of the physiological changes that occur in muscle structure during the period post-mortem, whose results have contributed to the improvement of meat quality. The objectives of this study were to investigate the RFLP in calpain (Capn2 gene and its relation with meat tenderization in 252 crossbred (Bos taurus taurus x Bos taurus indicus. The analyses were carried through by PCR-RFLP technique

  14. Pengaruh Anggaran Bantuan Operasional Sekolah (BOS) Terhadap Peningkatan Prestasi Belajar Siswa SMP Di Kota Medan

    OpenAIRE

    Syafrida

    2014-01-01

    The objective of the research was to find out the correlation and the effectiveness of BOS (School Operation Assistance) fund with the improvement of SMP students' learning achievement in Medan. BOS program has started since July, 2005 which is aimed to ease people's burden in education cost by giving financial aid for supporting qualified nine-year learning compulsory. Although the government has distributed BOS fund to schools, there are still many poor children who drop out of school, and ...

  15. An assessment of population structure in eight breeds of cattle using a whole genome SNP panel

    Directory of Open Access Journals (Sweden)

    Gao Chuan

    2008-05-01

    Full Text Available Abstract Background Analyses of population structure and breed diversity have provided insight into the origin and evolution of cattle. Previously, these studies have used a low density of microsatellite markers, however, with the large number of single nucleotide polymorphism markers that are now available, it is possible to perform genome wide population genetic analyses in cattle. In this study, we used a high-density panel of SNP markers to examine population structure and diversity among eight cattle breeds sampled from Bos indicus and Bos taurus. Results Two thousand six hundred and forty one single nucleotide polymorphisms (SNPs spanning all of the bovine autosomal genome were genotyped in Angus, Brahman, Charolais, Dutch Black and White Dairy, Holstein, Japanese Black, Limousin and Nelore cattle. Population structure was examined using the linkage model in the program STRUCTURE and Fst estimates were used to construct a neighbor-joining tree to represent the phylogenetic relationship among these breeds. Conclusion The whole-genome SNP panel identified several levels of population substructure in the set of examined cattle breeds. The greatest level of genetic differentiation was detected between the Bos taurus and Bos indicus breeds. When the Bos indicus breeds were excluded from the analysis, genetic differences among beef versus dairy and European versus Asian breeds were detected among the Bos taurus breeds. Exploration of the number of SNP loci required to differentiate between breeds showed that for 100 SNP loci, individuals could only be correctly clustered into breeds 50% of the time, thus a large number of SNP markers are required to replace the 30 microsatellite markers that are currently commonly used in genetic diversity studies.

  16. Occurrence of abnormal starfish Astropecten indicus (Doderlein, 1888 (Echinodermata: Astroidea along Southeast coast of India

    Directory of Open Access Journals (Sweden)

    K. Prabhu

    2012-11-01

    Full Text Available Starfish Astropecten indicus was collected from bycatch landings at Mudasalodai fishing harbour, Tamil Nadu (India in November 2011. Totally 134 specimens collected among three specimens (2,2% have abnormally developed four and six arms. Normally, A. indicus has five arms and the deviation from pentamerism is a rare phenomenon in starfishes. The present observations suggest that deviations from pentamerism are not a heritable character but are a consequence of environmental perturbations on the metamorphosis of larvae and/or abnormal regeneration of arms.

  17. First results from the Herschel Gould Belt Survey in Taurus

    CERN Document Server

    Kirk, J M; Palmeirim, P; Andre, Ph; Griffin, M J; Hargrave, P J; Konyves, V; Bernard, J P; Nutter, D J; Sibthorpe, B; Di Francesco, J; Abergel, A; Arzoumanian, D; Benedettini, M; Bontemps, S; Elia, D; Hennemann, M; Hill, T; Men'shchikov, A; Motte, F; Nguyen-Luong, Q; Peretto, N; Pezzuto, S; Rygl, K L J; Sadavoy, S I; Schisano, E; Schneider, N; Testi, L; White, G

    2013-01-01

    The whole of the Taurus region (a total area of 52 sq. deg.) has been observed by the Herschel SPIRE and PACS instruments at wavelengths of 70, 160, 250, 350 and 500 {\\mu}m as part of the Herschel Gould Belt Survey. In this paper we present the first results from the part of the Taurus region that includes the Barnard 18 and L1536 clouds. A new source-finding routine, the Cardiff Source-finding AlgoRithm (CSAR), is introduced, which is loosely based on CLUMPFIND, but that also generates a structure tree, or dendrogram, which can be used to interpret hierarchical clump structure in a complex region. Sources were extracted from the data using the hierarchical version of CSAR and plotted on a mass-size diagram. We found a hierarchy of objects with sizes in the range 0.024-2.7 pc. Previous studies showed that gravitationally bound prestellar cores and unbound starless clumps appeared in different places on the mass-size diagram. However, it was unclear whether this was due to a lack of instrumental dynamic range ...

  18. Change of land use in the Turkish Taurus Mountains

    Directory of Open Access Journals (Sweden)

    Yıldız Güneş

    2016-01-01

    Full Text Available The effects of land use changes on forests and agricultural areas in the central Taurus Mountains of Turkey have been studied. In this region a progressive conversion of extensive grazing was observed towards more intensively farmed arable land in recent decades. The loss of forest land is obvious, and the remaining forests are currently severely degraded and fragmented. Based on a model area it was shown that forests accounted for more than 80% of the land cover in the 1960s. In the following decades the forest area decreased by more than 20%. To the same extent, the share of agricultural land increased, predominantly of the pastures, too. The use of pastures in turn was replaced in the 1990s by arable use, so that now for almost 30% of land use accont for production crop. Accordingly, the way of life of the rural population changed in the last 50 years. By the middle of the 20th century, people had mostly been living as nomads. Thereafter, they become increasingly stationary. While the population density decreased at the some time agriculture was intensified and livestock reduced. This change led to today to profound changes in the landscape of the Taurus Mountains and its unique habitats. Restrictive measures as a way to curb forest degradation and to intensify the use of arable land are discussed.

  19. Genome-wide association study for birth weight Brazilian Nellore cattle (Bos primigenuis indicus) points to previously described orthologous genes affecting human and bovine height

    Science.gov (United States)

    Birth weight (BW) is an economically important trait in beef cattle, and is associated with growth- and stature-related traits. One region of the cattle genome, located on bovine autosome (BTA) 14, has been previously shown to be associated with stature by multiple independent studies, and contains ...

  20. Serological survey of bovine brucellosis in Fulani nomadic cattle breeds (Bos indicus) of North-central Nigeria: Potential risk factors and zoonotic implications.

    Science.gov (United States)

    Alhaji, N B; Wungak, Y S; Bertu, W J

    2016-01-01

    A cross sectional study was conducted to investigate seroprevalence and associated risk factors of bovine brucellosis in Fulani nomadic herds in the 3 agro-ecological zones of Niger State, North-central Nigeria between January and August 2013. A total of 672 cattle in 113 herds were screened for Brucella antibodies using Rose Bengal Plate Test (RBPT) and confirmed by Lateral flow Assay (LFA). Data on herd characteristics and zoonotic factors were collected using structured questionnaire administered on Fulani herd owners. Factors associated with Brucella infection were tested using Chi-square test and multivariable logistic model. The overall cattle-level seroprevalence was 1.9% (95% CI: 1.1-3.2) with highest in agro-zone C (3.2%). Herd-level seroprevalence was 9.7% (95% CI: 5.23-16.29) and highest in agro-zone C (13.5%). Sex and agro-ecological zones were significantly (Ppractices were significantly associated with brucellosis occurrence. Inhalation of droplets from milk of infected cows, and drinking raw milk were less likely [OR 0.27; 95% CI: 0.09-0.82 and OR 0.27; 95% CI: 0.08-0.99, respectively] not to predisposed to brucellosis in humans. Eating infected raw meat, and contact with infected placenta were more likely [OR 7.49; 95% CI: 2.06-28.32 and OR 5.74; 95% CI: 1.78-18.47, respectively] to be risks for the disease in humans. These results highlighted the important risk factors for bovine brucellosis in Fulani herds. Thus, brucellosis control programs which take these factors into consideration will be beneficial. PMID:26464048

  1. Protocolos de inseminación artificial a tiempo fijo en vacas (Bos indicus en el trópico bajo

    Directory of Open Access Journals (Sweden)

    Andrés M. Sanabria-V.

    2011-02-01

    Full Text Available En una hacienda de clima tropical bajo, se evalula  respuesta  a  tres  programas de  Inseminación Artificial a Tiempo Fijo (IATF en 30 vacas vacías cebú  comercial, cíclicas,  con buena  condición corporal,  seleccionadas por  palpación  rectal  ydistribuidas al azar en  tres grupos de 10 vacas cada uno. A  éstos  se  les  asignó  un  protocolo  de sincronización de celos y ovulación diferente. En el grupo 1 se utilizó un dispositivo  intravaginal impregnado con progesterona;  las vacas del grupo 2 recibieron un  implante auricular  impregnado de Norgestomet  y  en  el  grupo  3  se  realizó  el protocolo de Ovsynch. Se diagnosticó la preñez mediante ultrasonografía, 30 días después de la inseminación en  los  tratamientos y  los datos  fueron analizados mediante  estadística descriptiva  con variables  de  tipo  cuantitativo.  Los  resultados obtenidos para el grupo 1, fueron 4 de 10 vacas preñadas, en el grupo 2, 6 de 10 vacas preñadas y en  el  grupo  3, 3  de 10  vacas. Se  encontraron diferencias  significativas  entre  las  vacas  que recibieron  el  implante  auricular,  así  como  a aquellas  vacas que  se  les hizo  el protocolo de Ovsynch,  pero  no  se  encontraron  diferencias significativas  entre  el  dispositivo  intravaginal impregnado con progesterona,  respecto de  los dos restantes. El valor más económico por preñez se obtuvo  con  la  utilización  del  protocolo  de Ovsynch; sin embargo, en  términos de eficiencia,fue mejor usar el implante auricular impregnado de  Norgestomet;  esto  por  razones  de mejoramiento  genético.  De  esta  forma  se concluyó que el protocolo del implante auricular con Norgestomet  tuvo una superior  tasa de preñez,sin que  esto  sea  una  constante,  debido  a  que  existen diferentes  factores que hacen variar  los resultados de la IATF.

  2. Serological survey of bovine brucellosis in Fulani nomadic cattle breeds (Bos indicus) of North-central Nigeria: Potential risk factors and zoonotic implications.

    Science.gov (United States)

    Alhaji, N B; Wungak, Y S; Bertu, W J

    2016-01-01

    A cross sectional study was conducted to investigate seroprevalence and associated risk factors of bovine brucellosis in Fulani nomadic herds in the 3 agro-ecological zones of Niger State, North-central Nigeria between January and August 2013. A total of 672 cattle in 113 herds were screened for Brucella antibodies using Rose Bengal Plate Test (RBPT) and confirmed by Lateral flow Assay (LFA). Data on herd characteristics and zoonotic factors were collected using structured questionnaire administered on Fulani herd owners. Factors associated with Brucella infection were tested using Chi-square test and multivariable logistic model. The overall cattle-level seroprevalence was 1.9% (95% CI: 1.1-3.2) with highest in agro-zone C (3.2%). Herd-level seroprevalence was 9.7% (95% CI: 5.23-16.29) and highest in agro-zone C (13.5%). Sex and agro-ecological zones were significantly (Pbrucellosis occurrence. Inhalation of droplets from milk of infected cows, and drinking raw milk were less likely [OR 0.27; 95% CI: 0.09-0.82 and OR 0.27; 95% CI: 0.08-0.99, respectively] not to predisposed to brucellosis in humans. Eating infected raw meat, and contact with infected placenta were more likely [OR 7.49; 95% CI: 2.06-28.32 and OR 5.74; 95% CI: 1.78-18.47, respectively] to be risks for the disease in humans. These results highlighted the important risk factors for bovine brucellosis in Fulani herds. Thus, brucellosis control programs which take these factors into consideration will be beneficial.

  3. Bos indicus cattle possess greater basal concentrations of HSP27, alpha B-crystallin, and HSP70 in skeletal muscle in vivo compared with cattle.

    Science.gov (United States)

    Mullins, C R; Zerby, H N; Fitzpatrick, L A; Parker, A J

    2016-01-01

    The objectives of the present study were to evaluate the basal concentrations of heat shock proteins (HSP) between and cattle and to determine if HSP basal concentrations change as an animal matures. A total of 40 cattle were used in a 2 × 2 factorial design to evaluate the effects of genotype and age (heifers and mature cows) on basal concentrations of heat shock protein 27 (HSP27), α B-crystallin (Cryab), and heat shock protein 70 (HSP70). Each experimental group of 10 animals was sampled on a separate day over a period of 4 wk during July 2014. A muscle sample was collected from the longissimus thoracis (LT) and concentrations of HSP were quantified using ELISA. There were no significant differences in HSP concentration for the interaction between age and genotype or for age alone. cattle had greater ( cattle. The results of this study show that basal in vivo HSP concentrations differ between and cattle. However, further studies are needed to investigate the relationship between HSP concentrations and meat tenderness with respect to genotypes to see if HSP concentrations account for at least some variability in tenderness differences.

  4. Diversidad genética de la población colombiana de ganado Cebú Brahman Americano Bos Indicus (Bovidae)

    OpenAIRE

    Novoa Bravo Miguel Adriano; Usaquén Martínez William

    2006-01-01

    La raza Cebú Brahman Americano se encuentra en Colombia alrededor de 100 años. Todo ese tiempo, esta raza ha estado bajo un proceso continuo de selección artificial dirigida, reproducción endogámica, efectos de deriva genética causados por eventos fundadores, migraciones de ejemplares entre las fincas del país y animales importados desde otros países. Estos hechos hacen a esta raza interesante y particular desde el punto de vista de la genética de poblaciones. El objetivo de este trabajo es e...

  5. Dinámica folicular y función lútea durante la gestación temprana. Estudio de un caso en Bos indicus.

    Directory of Open Access Journals (Sweden)

    Henao R Guillermo

    2003-06-01

    Full Text Available A una vaca Cebú de seis años, tres partos y 432 Kg de peso, se le practicaron ecografías ováricas transrectales y muestreos sanguíneo tres veces por semana desde el día uno al 74 de gestación. Se contó el número de folículos > 4 mm y se midió el diámetro de los folículos y el diámetro y tiempo de observación ecográfica del cuerpo lúteo. Se determinó la ovulación y se calculó la tasa de crecimiento del folículo dominante y el intervalo interdominancia. Los niveles de progesterona se midieron por radioinmunoanálisis. Durante los primeros 74 días de la gestación se desarrollaron 10 ondas foliculares; la primera fue conformada por seis folículos  4mm, de los cuales se desarrolló uno dominante que alcanzó un diámetro de 11 mm, creció a una tasa de un mm/día y presentó un intervalo interdominancia de 10 días. El folículo subordinado más desarrollado alcanzó un diámetro de 6 mm. Los folículos dominantes alcanzaron 9.11 mm de diámetro, crecieron a una tasa de 1,0  0,19 mm/día y presentaron un intervalo interdominancia de 7,5  1,73 días. El cuerpo lúteo alcanzó un diámetro máximo de 21mm el día 40 de gestación. La progesterona alcanzó niveles >10 ng/100ml a partir del día 11. Durante la gestación temprana de una vaca Cebú se presentó dinámica folicular caracterizada por el desarrollo de ondas foliculares semejantes a las producidas durante el ciclo estral y se formó un cuerpo lúteo activo productor de niveles característicos de progesterona.

  6. Comparative studies on genital infections and antimicrobial susceptibility patterns of isolates from camels (Camelus dromedarius) and cows (Bos indicus) in Maiduguri, north-eastern Nigeria.

    Science.gov (United States)

    Mshelia, Gideon Dauda; Okpaje, Godfrey; Voltaire, Yepmo Andre Casimir; Egwu, Godwin Onyeamaechi

    2014-01-01

    A total of 160 genitalia of Camels and cows were investigated in Maiduguri, north-eastern Nigeria to compare bacterial isolates and the antibacterial susceptibilities of some of the isolates. Streptococcus (Str.) pyogenes (31%), Escherichia (E.) coli (24%) and Staphylococcus (S.) aureus (20%) were the most common vaginal bacterial isolates in camels; while E. coli (73%), Str. pyogenes (18%) and S. aureus (11%) were the most frequent isolates in the cows. Of the 78 uterine isolates recovered in this study, E. coli was the most prominent in camels (8%) and cows (54%). The overall weight of genital infection in all camels and cows examined was highest (P  0.05) between vaginal and uterine bacterial isolates from camels and cows in this study. The Relative Risk (RR) for an infection of the vagina with E coli (3.04, 95% Confidence Interval (CI): 2.104 to 4.398, P < 0.0001) is more in cows compared to the camel, but the RR for vaginal infection with S. aureus and Str. pyogenes were lower in cows compared to Camels. The E. coli and S. aureus isolates were highly susceptible to the antimicrobial agents tested. Therefore effective management of reproductive disorders associated with these pathogens can be achieved with proper use of these antimicrobial agents in these animal species. PMID:24570857

  7. Marcadores moleculares asociados a la Capacidad de Retención de Agua (CRA) en carne de Bos indicus y sus cruces

    OpenAIRE

    Leal Gutiérrez, Joel David

    2013-01-01

    La Capacidad de Retención de Agua (CRA) es una de las características de la carne con mayor efecto sobre la rentabilidad del sector, al estar asociada a las mermas y a la jugosidad. Los objetivos principales son: resaltar la importancia de la CRA de la carne de bovino, evaluar el desempeño de estos parámetros según los factores tiempo de maduración y cruce de los animales y establecer polimorfismos en genes candidatos asociados al parámetro evaluado. Varios genes y sus polimorfismos han sido ...

  8. Impact of progesterone and estradiol treatment before the onset of the breeding period on reproductive performance of Bos indicus beef heifers.

    Science.gov (United States)

    Sá Filho, M F; Nasser, L F T; Penteado, L; Prestes, R; Marques, M O; Freitas, B G; Monteiro, B M; Ferreira, R M; Gimenes, L U; Baruselli, P S

    2015-09-01

    The present aimed to develop a hormonal therapy based on the insertion of a progesterone (P4) insert (PI) during 10 d plus an estradiol injection (E2) at PI removal before the onset of breeding of beef heifers. In Exp. 1, the plasma P4 profile of prepubertal heifers showed that the insertion of a PI or 24 d previously used P4 insert (UPI) sustained plasma P4 above 1 ng/mL for at least the first 7 d of the treatment. In Exp. 2 there was no positive effect of additional estradiol benzoate (EB) administered at the insertion of UPI on the proportion of heifers with a corpus luteum (CL/Treated) 30 d after UPI removal [UPI + EB = 85.3%(a) (n = 134); EB + UPI + EB = 80.8%(a) (n = 125)]; however, both were greater (P < 0.0001) than the Control group [60.3%(b) (n = 129)]. In Exp. 3, a positive effect (P=0.01) of UPI treatment and both E2 supplementations [EB and estradiol cypionate (EC); P = 0.10] at the UPI removal was observed on CL/Treated [Control = 42.5%(b) (n = 94); UPI = 58.5%(a) (n= 130); UPI + EB = 64.0%(a) (n = 128); UPI + EC = 67.2%(a) (n = 128)]. However, greater pregnancy per treated heifer (P/Treated) following artificial insemination (AI) upon estrus detection was achieved when EC was applied [Control = 20.2%(b); UPI = 29.2%(ab); UPI + EB = 26.6%(b); UPI + EC = 36.7%(a)]. In Exp. 4, the treatment prior to the timed AI (TAI) tended to improve pregnancy per TAI [P/AI; Control 43.6% (n = 298) vs. UPI+EC 51.9% (n = 342); P = 0.08], but increased P/Treated [26.5% vs. 43.3%; P < 0.001]. Thus, UPI + EC treatment were efficient in increasing the CL/Treated, tended to improve the P/AI and consequently enhanced P/Treated of zebu beef heifers.

  9. Diversidad genética de la población colombiana de ganado Cebú Brahman Americano Bos Indicus (Bovidae

    Directory of Open Access Journals (Sweden)

    Novoa Bravo Miguel Adriano

    2006-12-01

    Full Text Available La raza Cebú Brahman Americano se encuentra en Colombia alrededor de 100 años. Todo ese tiempo, esta raza ha estado bajo un proceso continuo de selección artificial dirigida, reproducción endogámica, efectos de deriva genética causados por eventos fundadores, migraciones de ejemplares entre las fincas del país y animales importados desde otros países. Estos hechos hacen a esta raza interesante y particular desde el punto de vista de la genética de poblaciones. El objetivo de este trabajo es estudiar la estructura y diversidad genética de la raza Cebú Brahman americano. Se utilizaron 162 animales registrados en la asociación colombiana de criadores de ganado cebú (ASOCEBU de 20 departamentos de Colombia. La genotipificación de los animales se llevó a cabo con el kit StockMarks® for cattle bovine genotyping de Applied Biosystems®, empleando 10 microsatélites dinucleótidos. Los resultados de los distintos análisis multivariados (Análisis de componentes principales y análisis de correspondencias múltiples, de inferencia bayesiana y distancias genéticas interindividuales, demuestran que no se presenta subestructura en la población, lo cual se explica por una alta tasa de migración de animales entre las diferentes fincas y regiones, que homogeniza las frecuencias en todo el país. Además, esta población posee un alto grado de heterocigocidad y diversidad alélica, comparado con otras razas, lo cual refleja su origen de mezcla multiracial. También se encontraron diferencias genéticas entre sexos, lo cual es causado por un proceso reproductivo diferencial, donde actúan diferentes criterios de selección entre sexos. Finalmente, al realizar un análisis de componentes principales para analizar las relaciones genéticas de Cebú Brahman americano colombiano con las razas cebuinas y taurinas, se determinó que esta raza se diferencia genéticamente de las demás razas cebuinas, debido a un aporte genético de razas taurinas europeas a esta raza.

  10. Gastrointestinal Strongyle Egg Output and its Relationship with Tick Burden in Gambian N'dama and Gobra Zebu Cattle

    Directory of Open Access Journals (Sweden)

    Mattioli, RC.

    1995-01-01

    Full Text Available Fortnightly quantitative analysis of rectal faecal samples for the presence of strongyle eggs were carried out from May 1992 to April 1993 on 11 Gambian N'dama Bos taurus and 11 Gobra zebu Bos indicus cattle. Significantly (P <0.001 lower strongyle egg outputs were found in N'dama in comparison with zebu cattle. No correlation was found between individual cumulative tick burden and strongyle egg output in either breed, although individual variations in parasite burdens were lower in N'dama than in zebu cattle. This study strenghtens the evidence for the presence of a natural resistant trait to strongyle infection in N'dama cattle.

  11. Comportamiento del metabolismo Hem en neonatos bovinos bajo condiciones experimentales en trópico bajo

    OpenAIRE

    Páez Ramírez, Paola Andrea

    2010-01-01

    Se seleccionaron 72 terneros en fase de cría pertenecientes a tres grupos raciales, dos de origen Bos taurus (Hartón de Valle, Holstein Friesian) y uno de origen Bos indicus (Cebú Brahmán) correspondientes a las razas empleadas en los sistemas de producción en condiciones tropicales del Valle del Cauca colombiano. En cada raza se aplicaron tres tratamientos diferentes, cada tratamiento fue realizado en ocho animales: al primer grupo se le inyectó 500 mg de Hierro Dextran por aplicación parent...

  12. SUSCEPTIBILIDADE DE BOVINOS DAS RAÇAS JERSEY E GIR À ACIDOSE LÁCTICA RUMINAL: I - VARIÁVEIS RUMINAIS E FECAIS

    OpenAIRE

    Maruta Celso Akio; Ortolani Enrico Lippi

    2002-01-01

    Quatro garrotes Jersey (J) (Bos taurus) e quatro Gir (G) (Bos indicus), providos de cânula ruminal, foram utilizados para comparar a susceptibilidade à acidose láctica ruminal (ALR) aguda. Para a uniformização da microbiota ruminal, os animais receberam uma alimentação padronizada por dois meses antes da indução da ALR. Esta foi realizada com o uso de sacarose administrada diretamente no rúmen, de acordo com peso metabólico corrigido. Amostras de suco ruminal e fezes foram colhidas no decorre...

  13. SUSCEPTIBILIDADE DE BOVINOS DAS RAÇAS JERSEY E GIR À ACIDOSE LÁCTICA RUMINAL: I - VARIÁVEIS RUMINAIS E FECAIS SUSCEPTIBILITY OF JERSEY AND GIR STEERS TO RUMEN LACTIC ACIDOSIS: I - RUMINAL AND FAECAL VARIABLES

    OpenAIRE

    Celso Akio Maruta; Enrico Lippi Ortolani

    2002-01-01

    Quatro garrotes Jersey (J) (Bos taurus) e quatro Gir (G) (Bos indicus), providos de cânula ruminal, foram utilizados para comparar a susceptibilidade à acidose láctica ruminal (ALR) aguda. Para a uniformização da microbiota ruminal, os animais receberam uma alimentação padronizada por dois meses antes da indução da ALR. Esta foi realizada com o uso de sacarose administrada diretamente no rúmen, de acordo com peso metabólico corrigido. Amostras de suco ruminal e fezes foram colhidas no decorre...

  14. Staphylococcus via an interaction with the ELR+ CXC chemokine ENA-78 is associated with BOS.

    Science.gov (United States)

    Gregson, A L; Wang, X; Injean, P; Weigt, S S; Shino, M; Sayah, D; DerHovanessian, A; Lynch, J P; Ross, D J; Saggar, R; Ardehali, A; Li, G; Elashoff, R; Belperio, J A

    2015-03-01

    Staphylococcus aureus is the most commonly isolated gram-positive bacterium after lung transplantation (LT) and has been associated with poor posttransplant outcomes, but its effect on bronchiolitis obliterans syndrome (BOS) and death in the context of the allograft inflammatory environment has not been studied. A three-state Cox semi-Markovian model was used to determine the influence of allograft S. aureus and the ELR+ CXC chemokines on the survival rates and cause-specific hazards for movement from lung transplant (State 1) to BOS (State 2), from transplant (State 1) to death (State 3), and from BOS (State 2) to death (State 3). Acute rejection, pseudomonas pneumonia, bronchoalveolar lavage fluid (BALF) CXCL5 and its interaction with S. aureus all increased the likelihood of transition from transplant to BOS. Transition to death from transplant was facilitated by pseudomonas infection and single lung transplant. Movement from BOS to death was affected by the interaction between aspergillus, pseudomonas and CXCL5, but not S. aureus. S. aureus isolation had state specific effects after LT and only in concert with elevated BALF CXCL5 concentrations did it augment the risk of BOS. Pseudomonas and elevated BALF concentrations of CXCL5 continued as significant risk factors for BOS and death after BOS in lung transplantation.

  15. The effect of cinnarizine and cocculus indicus on simulator sickness.

    Science.gov (United States)

    Lucertini, Marco; Mirante, Nadia; Casagrande, Maria; Trivelloni, Pierandrea; Lugli, Vittoria

    2007-05-16

    Pensacola Simulator Sickness Questionnaire (SSQ) is a valuable method to analyse symptoms evoked by exposure to a flight simulator environment that can also be adopted to evaluate the effectiveness of preventive tools, aiming at reducing simulator sickness (SS). In this study we analysed SSQ data in subjects undergoing a standard ground based spatial disorientation training inside a flight simulator, in order to evaluate the SS prevention obtained with two different pharmacological tools. Twelve males volunteers participated to an experimental design based on a double-blind, balanced administration of either 30 mg cinnarizine (CIN), or Cocculus Indicus 6CH (COC), or placebo (PLC) before one trial of about one hour spent inside a spatial disorientation trainer. All subjects underwent the three different conditions (CIN, COC, PLC) during 3 non-consecutive days separated by at least 2 weeks. During each experimental day, all subjects filled in SSQ. In addition, both postural instability (with the use of a static stabilometric platform), and sleepiness symptoms were evaluated. All the tests were performed before and after the simulated flight, at different times, in one-and-half-hour intervals. Results indicated a strong increase of sickness after flight simulation that linearly decreased, showing pre-simulator scores after 1.30 hours. In contrast to both PLC and COC, CIN showed significant side effects immediately following flight simulation, with no benefit at the simultaneous SSQ scores. Globally, no highly significant differences between COC and PLC were observed, although a minor degree of postural instability could be detected after COC administration. As far as the present exposure to a simulator environment is concerned, none of the pharmacological tools administered in this study resulted effective in reducing SS symptoms as detected by the SSQ. Moreover, CIN significantly increased sleepiness and postural instability in most subjects. PMID:17434541

  16. Diversity and ecology of Varanus indicus in Pepaya Island at Teluk Cenderawasih National Park, West Irian Jaya

    Directory of Open Access Journals (Sweden)

    DENY ANJELIUS IYAI

    2006-04-01

    Full Text Available Monitor lizard (Varanidae has dispersed widely in Indonesia, even in Papua. Papua contents of six species. It’s distribution, abundance, both in land and island have been known yet, even carrying capacity of feeding relative limited. However, species extinction rates in nature were increasing both in it. This research was done in Papaya Island in Teluk Cenderawasih National Park, Nabire, Papua since 24th -25th October 2005. Descriptive method was done to answer this study. This research resulted that in Papaya island contents only one species that is Varanus indicus. The V. indicus chosen same habitat in southern part of Papaya island. This species dispersed on 0-4 m above sea level, humidity about 78.6%, and temperature about 23.90C. Vegetation was dominated by coconut (Cocos nucifera, bitangur (Calophyllum inophyllum and tikar (Pandanus sp., papaya (Carica papaya, and ketapang (Terminalia catappa. V. indicus chosen Megapodius reinwadt nest as nesting area. Population of V. indicus was estimated as much 36.3 ≈ 36 pieces by King Method. The nest of V. indicus placed in Cassuarina sp. tree where cutting down. The diet of V. indicus was found such as megapods, sea birds, lizard (sauria, butterflies and bats (Macrochyroptera. People were caused threatened both direct and indirect toward the V. indicus existence.

  17. Gene : CBRC-ACAR-01-0189 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CTED: hypothetical protein [Bos taurus] 1e-06 28% MQIDLMTMSFVAKFGVIWFSGFVVYSIGIILSTNKTQSGYVSIISIIISMIYTPLILSTNKTQSGYVSIISII...ISMIYTPLILSTNKTQSVYVSIISIIISIIYTPLILSTNKTQSVYVSIISIIISMIYTPLILSTNKTQSVYVSITSIIISIIYTPLILSTNKTQSVYVSITSIIISIIYTPLILSTNKTQSGYVSIISIIYTPLILSTNKTQRSYVSINSISMYYYIAA ...

  18. ANTIHYPERGLYCEMIC, ANTIOXIDANT AND ANTIDYSLIPIDEMIC PROPERTIES OF HEMIDESMUS INDICUS ROOT EXTRACT STUDIED IN ALLOXAN-INDUCED EXPERIMENTAL DIABETES IN RATS

    Directory of Open Access Journals (Sweden)

    S. Subramanian et al.

    2012-01-01

    Full Text Available Diabetes mellitus is a chronic metabolic disorder associated with hyperglycemia, oxidative stress and dyslipidemia. Hemidesmus indicus is employed as an indigenous medicine for a variety of ailments from earlier days. The present study was aimed to evaluate the role of Hemidesmus indicus in alloxan-induced experimental diabetic rats. The effect of oral administration of Hemidesmus indicus root extract (400 mg/kg b.w. on glucose tolerance, the levels of blood glucose, hemoglobin, glycosylated hemoglobin, plasma insulin, protein, lipid peroxides, enzymatic and non-enzymatic antioxidants, lipid profile, muscle glycogen content were determined in control and experimental groups of rats. The altered levels of blood glucose, hemoglobin, glycosylated hemoglobin, plasma insulin, and protein in the diabetic rats were significantly reverted back to near basal values by the administration of ethanol extract of Hemidesmus indicus root to diabetic rats for 30 days. The levels of lipid peroxides in the plasma and pancreatic tissues of diabetic rats were elevated significantly and were normalized by the administration of Hemidesmus indicus root extract. The activities of pancreatic enzymic antioxidants and the levels of plasma non-enzymic antioxidants were markedly declined in the diabetic rats. Upon treatment with Hemidesmus indicus root extract to diabetic rats, these decreased levels were elevated to near normal values. The reduced level of glycogen content in muscle tissues of diabetic rats was significantly improved upon treatment with Hemidesmus indicus root extract. The altered levels of lipid profile were reverted back to near normalcy upon the extract treatment. The results of the study indicate that Hemidesmus indicus root extract possesses antihyperglycemic, antioxidant and antidyslipidemic activity. The results are comparable with glyclazide, an oral standard hypoglycemic drug. The phytochemicals present in the Hemidesmus indicus root extract may

  19. Redescription and new records of Ulomimus indicus Bates, 1873 (Coleoptera, Tenebrionidae, Tenebrioninae

    Directory of Open Access Journals (Sweden)

    Shanshan Liu

    2013-12-01

    Full Text Available Ulomimus indicus Bates, 1873 of the tribe Ulomini is recorded for the first time from China (Guangxi and Hainan, Indonesia (Sumatra and Thailand (Chiang Dao. A redescription of the male and the first description of the female are also provided.

  20. MULTINDELS-BOV: Zebu traceback method based on DNA insertion-deletion polymorphisms.

    Science.gov (United States)

    Groenner-Penna, M; Croce, E F D; Pimenta, C G; Bicalho, H M S; Pena, S D J

    2014-01-01

    Brazil is a major producer and exporter of beef, with a herd of approximately 210 million animals. For the meat industry, a reliable animal traceback from its origin to the consumer market is paramount. Of all available identification systems, DNA is the only one that survives the slaughterhouse and reaches the dish of the consumer. DNA polymorphisms are already used for cattle traceback, but primarily for the subspecies Bos taurus taurus. However, in Brazil, another subspecies, B. taurus indicus predominates. We describe here the development of a DNA traceback method designed primarily for B. taurus indicus (Zebu), without leaving B. taurus taurus aside. We used insertion/deletion (indel) polymorphisms, which have the advantage of being simple and easily automatable, since in most cases, the variable loci are biallelic. We studied 94 indels, with a difference of two or more base pairs, in DNA pools of 60 Zebu and 60 taurine animals. A set of 22 indels with heterozygosity greater than 0.3 were selected and used to construct two multiplex PCRs. On the basis of the allelic frequency of these indels, the probability of random match was calculated to be 1.12 x 10(-8) for B. taurus indicus and 1.60 x 10(-6) for B. taurus taurus. Moreover, we estimated that an analysis would cost less than US$15.00 per animal. Thus, this system (MULTINDELS-BOV) is perfectly suited for building large genetic databases and offering viable prospects of a national system for cattle traceback DNA in Brazil. PMID:25501139

  1. Taxonomy Icon Data: cattle [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available rus_L.png Bos_taurus_NL.png Bos_taurus_S.png Bos_taurus_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cg...i?i=Bos+taurus&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Bos+taurus&t=NL http://biosciencedbc.jp/taxonomy..._icon/icon.cgi?i=Bos+taurus&t=S http://biosciencedbc.jp/taxonomy_icon/ico...n.cgi?i=Bos+taurus&t=NS http://togodb.biosciencedbc.jp/togodb/view/taxonomy_icon_comment_en?species_id=28 ...

  2. A novel analytical method, Birth Date Selection Mapping, detects response of the Angus (Bos taurus genome to selection on complex traits

    Directory of Open Access Journals (Sweden)

    Decker Jared E

    2012-11-01

    Full Text Available Abstract Background Several methods have recently been developed to identify regions of the genome that have been exposed to strong selection. However, recent theoretical and empirical work suggests that polygenic models are required to identify the genomic regions that are more moderately responding to ongoing selection on complex traits. We examine the effects of multi-trait selection on the genome of a population of US registered Angus beef cattle born over a 50-year period representing approximately 10 generations of selection. We present results from the application of a quantitative genetic model, called Birth Date Selection Mapping, to identify signatures of recent ongoing selection. Results We show that US Angus cattle have been systematically selected to alter their mean additive genetic merit for most of the 16 production traits routinely recorded by breeders. Using Birth Date Selection Mapping, we estimate the time-dependency of allele frequency for 44,817 SNP loci using genomic best linear unbiased prediction, generalized least squares, and BayesCπ analyses. Finally, we reconstruct the primary phenotypes that have historically been exposed to selection from a genome-wide analysis of the 16 production traits and gene ontology enrichment analysis. Conclusions We demonstrate that Birth Date Selection Mapping utilizing mixed models corrects for time-dependent pedigree sampling effects that lead to spurious SNP associations and reveals genomic signatures of ongoing selection on complex traits. Because multiple traits have historically been selected in concert and most quantitative trait loci have small effects, selection has incrementally altered allele frequencies throughout the genome. Two quantitative trait loci of large effect were not the most strongly selected of the loci due to their antagonistic pleiotropic effects on strongly selected phenotypes. Birth Date Selection Mapping may readily be extended to temporally-stratified human or model organism populations.

  3. The prey pathway: a regional history of cattle (Bos taurus and pig (Sus scrofa domestication in the northern Jordan Valley, Israel.

    Directory of Open Access Journals (Sweden)

    Nimrod Marom

    Full Text Available The faunal assemblage from the 9(th-8(th millennium BP site at Sha'ar Hagolan, Israel, is used to study human interaction with wild suids and cattle in a time period just before the appearance of domesticated animals of these species in the Jordan Valley. Our results, based on demographic and osteometric data, indicate that full domestication of both cattle and suids occurred at the site during the 8(th millennium. Importantly, domestication was preceded in both taxa by demographic and metric population parameters indicating severe overhunting. The possible role of overhunting in shaping the characteristics of domesticated animals and the social infrastructure to ownership of herds is then explored.

  4. The prey pathway: a regional history of cattle (Bos taurus) and pig (Sus scrofa) domestication in the northern Jordan Valley, Israel.

    Science.gov (United States)

    Marom, Nimrod; Bar-Oz, Guy

    2013-01-01

    The faunal assemblage from the 9(th)-8(th) millennium BP site at Sha'ar Hagolan, Israel, is used to study human interaction with wild suids and cattle in a time period just before the appearance of domesticated animals of these species in the Jordan Valley. Our results, based on demographic and osteometric data, indicate that full domestication of both cattle and suids occurred at the site during the 8(th) millennium. Importantly, domestication was preceded in both taxa by demographic and metric population parameters indicating severe overhunting. The possible role of overhunting in shaping the characteristics of domesticated animals and the social infrastructure to ownership of herds is then explored.

  5. Studies on the food and feeding habits of Gaur Bos taurus H. Smith (Mammalia: Artiodactyla: Bovidae) in two protected areas of Goa

    OpenAIRE

    S.D. Gad; S.K. Shyama

    2009-01-01

    Feeding habits and diet composition of gaur were studied at Bhagvan Mahaveer Wildlife Sanctuary and Mollem National Park, Goa. Altogether, 32 species of plants belonging to 17 families constitute the gaur diet. The fruits, leaves, young shoots, bark and flowers are consumed, with a preference for leaves (87%). In summer gaur also consumed the bark of cashew (Anacardium occidentale) and teak (Tectona grandis) trees. Strong association was observed between food preference and season (chi-square...

  6. Studies on the food and feeding habits of Gaur Bos taurus H. Smith (Mammalia: Artiodactyla: Bovidae in two protected areas of Goa

    Directory of Open Access Journals (Sweden)

    S.D. Gad

    2009-02-01

    Full Text Available Feeding habits and diet composition of gaur were studied at Bhagvan Mahaveer Wildlife Sanctuary and Mollem National Park, Goa. Altogether, 32 species of plants belonging to 17 families constitute the gaur diet. The fruits, leaves, young shoots, bark and flowers are consumed, with a preference for leaves (87%. In summer gaur also consumed the bark of cashew (Anacardium occidentale and teak (Tectona grandis trees. Strong association was observed between food preference and season (chi-square=12.94; p=0.001. Peak feeding activity was observed early in the morning (0630 to 0830 hr and in the evening (1730 to 1845 hr. During hot hours of the day (1330 to 1530 hr, animals were found resting in the shade of large trees.

  7. Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on enzymatic mastitis indicators of milk from dairy cows experimentally inoculated with Escherichia coli

    DEFF Research Database (Denmark)

    Sørensen, Lars Peter; Engberg, Ricarda Greuel; Løvendahl, Peter;

    2015-01-01

    The aim of this study was to investigate the effect of a quantitative trait locus associated with mastitis caused by Escherichia coli, with one haplotype being more susceptible (HH) and another being more resistant (HL) to E. coli mastitis, on the activity of 4 inflammatory related milk enzymes....... In particular, we investigated the suitability of β-glucuronidase (GLU) as an early indicator of E. coli mastitis. Besides GLU, the enzymes l-lactate dehydrogenase (LDH), N-acetyl-β-d-glucosaminidase (NAGase), and alkaline phosphatase were included. The study was conducted in an experimental setup with 31...... infection but with differences in the size and profile of the activity of the 4 enzymes. The enzyme GLU was an equally good indicator of E. coli mastitis compared with the other studied enzymes, although it showed a slower response compared with LDH and NAGase....

  8. Molecular Characterization of Bovine SMO Gene and Effects of Its Genetic Variations on Body Size Traits in Qinchuan Cattle (Bos taurus).

    Science.gov (United States)

    Zhang, Ya-Ran; Gui, Lin-Sheng; Li, Yao-Kun; Jiang, Bi-Jie; Wang, Hong-Cheng; Zhang, Ying-Ying; Zan, Lin-Sen

    2015-07-27

    Smoothened (Smo)-mediated Hedgehog (Hh) signaling pathway governs the patterning, morphogenesis and growth of many different regions within animal body plans. This study evaluated the effects of genetic variations of the bovine SMO gene on economically important body size traits in Chinese Qinchuan cattle. Altogether, eight single nucleotide polymorphisms (SNPs: 1-8) were identified and genotyped via direct sequencing covering most of the coding region and 3'UTR of the bovine SMO gene. Both the p.698Ser.>Ser. synonymous mutation resulted from SNP1 and the p.700Ser.>Pro. non-synonymous mutation caused by SNP2 mapped to the intracellular C-terminal tail of bovine Smo protein; the other six SNPs were non-coding variants located in the 3'UTR. The linkage disequilibrium was analyzed, and five haplotypes were discovered in 520 Qinchuan cattle. Association analyses showed that SNP2, SNP3/5, SNP4 and SNP6/7 were significantly associated with some body size traits (p 0.05). Meanwhile, cattle with wild-type combined haplotype Hap1/Hap1 had significantly (p cattle, and the wild-type haplotype Hap1 together with the wild-type alleles of these detected SNPs in the SMO gene could be used to breed cattle with superior body size traits. Therefore, our results could be helpful for marker-assisted selection in beef cattle breeding programs.

  9. The first identification of a blood-sucking abomasal nematode Ashworthius sidemi in cattle (Bos taurus) using simple polymerase chain reaction (PCR).

    Science.gov (United States)

    Moskwa, Bożena; Bień, Justyna; Cybulska, Aleksandra; Kornacka, Aleksandra; Krzysiak, Michał; Cencek, Tomasz; Cabaj, Władysław

    2015-06-30

    A simple polymerase chain reaction (PCR) test was used to identify Ashworthius sidemi, a blood-sucking gastrointestinal nematode that commonly infects bison, red and roe deer, and moose in Poland. The present study uses this technique to confirm the possibility of transmission of A. sidemi infection from wildlife to domestic animals, such as cattle and sheep, grazing on the same natural pastures. A 406 bp fragment of genomic A. sidemi DNA was actually detected in DNA isolated from larval cultures derived from feces from cattle. A. sidemi DNA has been detected in cattle which represent a new host for this parasite. This is the first evidence of A. sidemi in cattle. The results reveal that a PCR test based on DNA from L3 larvae can be used for in vivo detection of A. sidemi invasions in breeding animals. In conclusion, the transfer of A. sidemi infection from wildlife to the farm animals sharing the same pastures appears possible.

  10. Postweaning substitution of grazed forage with a high-energy concentrate has variable long-term effects on subcutaneous fat and marbling in Bos taurus genotypes.

    Science.gov (United States)

    Greenwood, P L; Siddell, J P; Walmsley, B J; Geesink, G H; Pethick, D W; McPhee, M J

    2015-08-01

    The objective of this study was to quantify the effects and interactions of stage of growth and genotype on commercial carcass traits and intramuscular fat (IMF) content in 5 muscles of steers ( = 165) and to test the hypothesis that substituting pasture with a high-energy concentrate during the immediate postweaning period increases IMF. Cattle of 3 genotypes (Angus, Hereford, and Wagyu × Angus; = 55/genotype) were selected at weaning from commercial herds, targeting genotypic differences in marbling and subcutaneous fatness. Following weaning, steers were fed for 168 d within 2 different improved, temperate pasture-based nutritional systems: a forage-only system (FS) and forage with high-energy supplemented system (SS), with 2 replicates per system. The supplement was fed at a level of 1% of average BW adjusted every 2 wk to provide an estimated 50% of energy requirements for 168 d from weaning. Pasture on offer in both systems was managed to match the BW of the FS and SS steers during the postweaning treatment period to avoid confounding due to differences in growth rate during this period. Steers were then regrouped into 2 replicates and backgrounded on improved, temperate pasture for 158 d and then grain fed within 1 group for 105 d (short fed) or 259 d (long fed). Groups were slaughtered at commencement (d 0) and end of postweaning nutritional treatments (d 168), end of backgrounding (d 326), and after short (d 431) or long feedlotting (d 585). Serial slaughter stage had an effect on all traits assessed ( < 0.01). The FS steers had more rib fat ( < 0.01) and higher Meat Standards Australia marbling score ( < 0.05) and a tendency ( < 0.10) to have greater eye muscle area than the SS steers throughout the study. Genotypic differences were evident ( < 0.05) for all traits assessed except HCW, dressing percentage, rib fat depth, ossification score, ultimate pH, and IMF in the semitendinosus muscle. The results for marbling and IMF do not support the use of a high-energy feed as a substitute for an equivalent amount of energy from pasture during the immediate postweaning period to enhance development of marbling. PMID:26440193

  11. Molecular differentiation of Sarcocystis buffalonis and Sarcocystis levinei in water buffaloes (Bubalus bubalis) from Sarcocystis hirsuta and Sarcocystis cruzi in cattle (Bos taurus).

    Science.gov (United States)

    Gjerde, Bjørn; Hilali, Mosaad; Abbas, Ibrahim E

    2016-06-01

    The purpose of the present study was to obtain sarcocysts of Sarcocystis buffalonis and Sarcocystis levinei from water buffaloes and characterize the isolates by molecular methods in order to determine whether the two species were genetically different from Sarcocystis hirsuta and Sarcocystis cruzi, respectively, from cattle, which had been characterized before. About 35 macroscopically visible (3-4 × 1-2 mm) and 20 barely visible (1-3 × 0.2 mm) sarcocysts were excised from the esophagus of 18 naturally infected and freshly slaughtered adult water buffaloes at three slaughterhouses in Egypt. Genomic DNA was extracted from the sarcocysts, and all isolates were first characterized at the mitochondrial cytochrome c oxidase subunit I gene (cox1) gene through PCR amplification and direct sequencing. Selected isolates were subsequently further characterized at the 18S and 28S ribosomal (r) RNA genes and the internal transcribed spacer 1 (ITS1) region of the nuclear rDNA unit by direct sequencing or cloning. Only six of the isolated macroscopic sarcocysts belonged to S. buffalonis, whereas the others belonged to Sarcocystis fusiformis. Twelve of the smaller cysts belonged to S. levinei and seven to Sarcocystis sinensis. The characterization of the sarcocysts of S. sinensis and some of the sarcocysts of S. fusiformis have been reported before. Fifteen additional sarcocyst isolates of S. fusiformis were characterized at cox1 in the present study and found to be identical or closely similar to previous isolates. At cox1, the sequence identity between the six isolates of S. buffalonis was 99.8-100 % (two haplotypes), whereas the identity between the 12 isolates of S. levinei was 99.0-100 % (10 haplotypes). The identity between cox1 sequences of S. buffalonis and S. hirsuta (n = 56) was 92.9-93.6 % (on average 93.4 %), and the identity between cox1 sequences of S. levinei and S. cruzi (n = 22) was 92.9-94.0 % (on average 93.5 %). The phylogenetic analyses placed with high support the cox1 sequences of S. buffalonis and S. hirsuta into two monophyletic sister groups, and the same was true for the cox1 sequences of S. levinei and S. cruzi. Hence, the study established that S. buffalonis and S. levinei are distinct species different from S. hirsuta and S. cruzi, respectively. Nucleotide sequences of S. buffalonis could be distinguished from those of S. hirsuta also at the 28S rRNA gene (clearly different) and the ITS1 region (small and uncertain difference) but not at the 18S rRNA gene. Sequences of S. levinei could be distinguished from those of S. cruzi both at the 18S and 28S rRNA genes (ITS1 region not examined). However, the cox1 gene was superior to the 18S and 28S rRNA genes as regards the ability to unambiguously delimit the species within each species pair, since at the latter markers, the number of consistent nucleotide differences between the species was low and there was a slight overlap between the intraspecific and interspecific sequence divergence. Comparison of the newly generated 18S rRNA gene sequences of S. levinei from water buffaloes with similar sequences deposited in GenBank suggested that S. levinei and S. cruzi are not strictly intermediate host specific but might occasionally infect cattle and water buffaloes, respectively. PMID:26979729

  12. Molecular characterisation of Sarcocystis bovifelis, Sarcocystis bovini n. sp., Sarcocystis hirsuta and Sarcocystis cruzi from cattle (Bos taurus) and Sarcocystis sinensis from water buffaloes (Bubalus bubalis).

    Science.gov (United States)

    Gjerde, Bjørn

    2016-04-01

    About 200 individual sarcocysts were excised from 12 samples of cattle beef from five countries (Argentina, Brazil, Germany, New Zealand, Uruguay) and tentatively identified to species or cyst type on the basis of their size and shape and cyst wall morphology. Genomic DNA was extracted from 147 of these sarcocysts and used initially for PCR amplification and sequencing of the partial mitochondrial cytochrome c oxidase subunit I gene (cox1) in order to identify the sarcocysts to species and/or sequence type. In addition, seven Sarcocystis sinensis-like sarcocysts collected from the oesophagus of water buffaloes in Egypt were examined at cox1 for comparative purposes. Based on the results from the cox1 marker, selected sarcocyst isolates from both hosts were further characterised at one to three regions of the nuclear ribosomal (r) DNA unit, i.e. the complete 18S rRNA gene, the complete internal transcribed spacer 1 (ITS1) region and the partial 28S rRNA gene. This was done in order to compare the results with previous molecular identifications based on 18S rRNA gene sequences and to evaluate the utility of these regions for species delimitations and phylogenetic inferences. On the basis of sarcocyst morphology and molecular data, primarily the cox1 sequences, four Sarcocystis spp. were identified in the samples of cattle beef. Twenty-two microscopic sarcocysts (1 × 0.1 mm) with hair-like protrusions were assigned to Sarcocystis cruzi, 56 macroscopic sarcocysts (3-8 × 0.5 mm) with finger-like protrusions were assigned to Sarcocystis hirsuta and 45 and 24 microscopic sarcocysts (1-3 × 0.1-0.2 mm) with finger-like protrusions were assigned to Sarcocystis bovifelis and Sarcocystis bovini n. sp., respectively. Sarcocysts of S. cruzi were identified in samples of beef from Argentina and Uruguay; sarcocysts of S. hirsuta in samples from Argentina, Brazil, Germany and New Zealand; sarcocysts of S. bovifelis in samples from Argentina and Germany; and sarcocysts of S. bovini in samples from Argentina and New Zealand. The microscopic sarcocysts from water buffaloes were confirmed to belong to S. sinensis. The cox1 sequences of S. bovifelis and S. bovini, respectively, shared an identity of 93-94 % with each other, and these sequences shared an identity of 89-90 % with cox1 of S. sinensis. In contrast, the intraspecific sequence identity was 98.4-100 % (n = 45), 99.3-100 % (n = 24) and 99.5-100 % (n = 7) for sequences of S. bovifelis, S. bovini and S. sinensis, respectively. In each of the latter three species, an aberrant type of cox1 sequences was also identified, which was only 91-92 % identical with the predominant cox1 type of the same species and about 98 % identical with the aberrant types of the two other species. These aberrant cox1 sequences are believed to represent non-functional nuclear copies of the mitochondrial genes (numts or pseudogenes). They might be used as additional markers to separate the three species from each other. Sequencing of a considerable number of clones of S. bovifelis, S. bovini and S. sinensis from each of the three regions of the rDNA unit revealed intraspecific sequence variation in all loci in all species and particularly in the ITS1 locus (78-100 % identity). As regards the 18S rRNA gene, it was possible to separate the three species from each other on the basis of a few consistent nucleotide differences in the less variable 3' end half of the gene. A comparison of the new sequences with GenBank sequences obtained from S. sinensis-like sarcocysts in cattle in other studies indicated that previous sequences derived from cattle in Germany and Austria belonged to S. bovifelis, whereas those derived from cattle in China belonged to S. bovini. On the basis of the new 28S rRNA sequences, it was possible to separate S. sinensis from S. bovifelis and S. bovini, whereas the latter two species could not be separated from each other. Based on ITS1 sequences, the three species were indistinguishable. Phylogenetic analysis using maximum parsimony placed with fairly high support cox1 sequences of S. bovifelis, S. bovini and S. sinensis, respectively, into three monophyletic clusters, with S. bovifelis and S. bovini being a sister group to S. sinensis. In contrast, phylogenies based on each of the three regions of the rDNA unit did not separate sequences of the three species completely from each other. Characterisation of cox1 of 56 isolates of S. hirsuta from four countries revealed only 13 haplotypes and an intraspecific sequence identity of 99.3-100 %. In the three regions of the rDNA unit, there was more extensive sequence variation, particularly in the ITS1 region. The 22 cox1 sequences of S. cruzi displayed a moderate intraspecific variation (98.6-100 %), whereas there was no variation at the 18S rRNA gene among 10 sequenced isolates. Sequencing of 16 clones of the partial 28S rRNA gene of S. cruzi yielded two markedly different sequence types, having an overall sequence identity of 95-100 %. PMID:26677095

  13. A breeding site record of Long-billed Vulture Gyps indicus (Aves: Accipitriformes: Accipitridae) from Bejjur Reserve Forest, Telangana, India

    OpenAIRE

    Swetha Stotrabhashyam; Bharath Reddy; Venugopal Satla; Imran Siddiqui

    2015-01-01

    The Long-billed Vulture Gyps indicus is, Critically Endangered with few known breeding sites in peninsular India.  We present a previously undocumented Long-billed Vulture breeding site in Bejjur Reserve Forest, Adilabad District, northern Telangana.

  14. Hormonal protocols for in vitro production of Zebu and taurine embryos

    Directory of Open Access Journals (Sweden)

    Carlos Antônio de Carvalho Fernandes

    2014-10-01

    Full Text Available The objective of this work was to evaluate the effects of hormonal synchronization protocols, associated or not with follicular development stimulation, on the recovery of oocytes and on in vitro production of Bos indicus and B. taurus embryos, in different seasons. Ultrasound-guided follicular aspirations (n=237 were performed without pre-treatment (G1, control group and after follicular wave synchronization (G2, or after follicular wave synchronization and follicle growth induction (G3. Bos indicus produced more oocytes and embryos than B. taurus (18.7±0.9 vs. 11.9±0.6 oocytes and 4.8±0.3 vs. 2.1±0.2 embryos. On average, oocyte and embryo yields were higher in G3 than in G2, and both were greater than in G1, which lead to a higher conversion of oocytes to embryos in these treatments. The hot or the cold season did not affect the B. indicus outcomes, whereas, in B. taurus, both oocyte recovery and embryo production were higher in the cold season. Follicular wave synchronization improves ovum pick-up and in vitro production of embryos in both cattle subspecies evaluated.

  15. NCBI nr-aa BLAST: CBRC-TTRU-01-1139 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1139 gb|ACX37363.1| toll-like receptor 1 variant 7 [Bos indicus] gb|ACX37365.1| toll...-like receptor 1 variant 9 [Bos indicus] gb|ACX37367.1| toll-like receptor 1 variant 11 [Bos i...ndicus] gb|ACX37383.1| toll-like receptor 1 variant 27 [Bos indicus] gb|ACX37385.1| toll-like receptor 1 var...iant 29 [Bos indicus] gb|ACX37389.1| toll-like receptor 1 variant 33 [Bos indicus] gb|ACX37397.1| toll...-like receptor 1 variant 41 [Bos indicus] gb|ACX37398.1| toll-like receptor 1 variant 42 [Bos indicus] ACX37363.1 0.0 89% ...

  16. Star Formation in Space and Time Taurus-Auriga

    CERN Document Server

    Palla, Fabrizio; Palla, Francesco; Stahler, Steven W.

    2002-01-01

    To understand the formation of stellar groups, one must first document carefully the birth pattern within real clusters and associations. In this study of Taurus-Auriga, we combine pre-main-sequence ages from our own evolutionary tracks with stellar positions from observational surveys. Aided by the extensive, millimeter data on the molecular clouds, we develop a picture of the region's history. Star formation began, at a relatively low level and in a spatially diffuse manner, at least 10 Myr in the past. Within the last few million years, new stars have been produced at an accelerating rate, almost exclusively within a confined group of striated cloud filaments. The gas both inside and around the filaments appears to be in force balance. Thus, the appearance of the filaments is due to global, quasi-static contraction of the parent cloud material. Gravity drives this contraction and shock dissipation mediates it, but the internal motion of the gas does not appear to be turbulent. The accelerating nature of re...

  17. An Extinction Study of the Taurus Dark Cloud Complex

    CERN Document Server

    Arce, H G; Arce, Hector G.; Goodman, Alyssa A.

    1999-01-01

    We present a study of the detailed distribution of extinction in a region of the Taurus dark cloud complex. Our study uses new BVR images of the region, spectral classification data for 95 stars, and IRAS Sky Survey Atlas (ISSA) 60 and 100 micron images. We study the extinction of the region in four different ways, and we present the first inter-comparison of all these methods, which are: 1) using the color excess of background stars for which spectral types are known; 2) using the ISSA 60 and 100 micron images; 3) using star counts; and 4) using an optical (V and R) version of the average color excess method used by Lada et al. (1994). We find that all four methods give generally similar results, with important exceptions. To study the structure in the dust distribution, we compare the ISSA extinction and the extinction measured for individual stars. From the comparison, we conclude that in the relatively low extinction regions studied, with 0.9 < A_V < 3.0 mag (away from filamentary dark clouds and IR...

  18. Demographics of Transition Discs in Ophiuchus and Taurus

    CERN Document Server

    Najita, Joan R; Muzerolle, James

    2015-01-01

    Transition disc systems are young stars that appear to be on the verge of dispersing their protoplanetary discs. We explore the nature of these systems by comparing the stellar accretion rates and disc masses of transition discs and normal T Tauri stars in Taurus and Ophiuchus. After controlling for the known dependencies of stellar accretion rate and disc mass and on age, stellar accretion rate on stellar mass, and disc mass on the presence of stellar or sub-stellar companions, we find that the normal T Tauri stars show a trend of stellar accretion rate increasing with disc mass. The transition discs tend to have higher average disc masses than normal T Tauri stars as well as lower accretion rates than normal T Tauri stars of the same disc mass. These results are most consistent with the interpretation that the transition discs have formed objects massive enough to alter the accretion flow, i.e., single or multiple giant planets. Several Ophiuchus T Tauri stars that are not known transition disc systems also...

  19. C18O Depletion in Starless Cores in Taurus

    CERN Document Server

    Ford, Amanda Brady

    2011-01-01

    We present here findings for C18O depletion in eight starless cores in Taurus: TMC-2, L1498, L1512, L1489, L1517B, L1521E, L1495A-S, and L1544. We compare observations of the C18O J=2-1 transition taken with the ALMA prototype receiver on the Heinrich Hertz Submillimeter Telescope to results of radiative transfer modeling using RATRAN. We use temperature and density profiles calculated from dust continuum radiative transfer models to model the C18O emission. We present modeling of three cores, TMC-2, L1489, and L1495A-S, which have not been modeled before and compare our results for the five cores with published models. We find that all of the cores but one, L1521E, are substantially depleted. We also find that varying the temperature profiles of these model cores has a discernable effect, and varying the central density has an even larger effect. We find no trends with depletion radius or depletion fraction with the density or temperature of these cores, suggesting that the physical structure alone is insuff...

  20. Flavoring extracts of Hemidesmus indicus roots and Vanilla planifolia pods exhibit in vitro acetylcholinesterase inhibitory activities.

    Science.gov (United States)

    Kundu, Anish; Mitra, Adinpunya

    2013-09-01

    Acetylcholinesterase inhibitors (AChEIs) are important for treatment of Alzheimer's disease and other neurological disorders. Search for potent and safe AChEIs from plant sources still continues. In the present work, we explored fragrant plant extracts that are traditionally used in flavoring foods, namely, Hemidesmus indicus and Vanilla planifolia, as possible sources for AChEI. Root and pod extracts of H. indicus and V. planifolia, respectively, produce fragrant phenolic compounds, 2-hydroxy-4-methoxybenzaldehyde (MBALD) and 4-hydroxy-3-methoxybenzaldehyde (vanillin). These methoxybenzaldehydes were shown to have inhibitory potential against acetylcholinesterase (AChE). Vanillin (IC50 = 0.037 mM) was detected as more efficient inhibitor than MBALD (IC50 = 0.047 mM). This finding was supported by kinetic analysis. Thus, plant-based food flavoring agents showed capacity in curing Alzheimer's disease and other neurological dysfunctions.

  1. A randomised controlled trial of azithromycin therapy in bronchiolitis obliterans syndrome (BOS) post lung transplantation

    OpenAIRE

    Corris, Paul A; Ryan, Victoria A; Small, Therese; Lordan, James; Fisher, Andrew J.; Meachery, Gerard; Johnson, Gail; Ward, Chris

    2015-01-01

    Background We conducted a placebo-controlled trial of azithromycin therapy in bronchiolitis obliterans syndrome (BOS) post lung transplantation. Methods We compared azithromycin (250 mg alternate days, 12 weeks) with placebo. Primary outcome was FEV1 change at 12 weeks. Results 48 patients were randomised; (25 azithromycin, 23 placebo). It was established, post randomisation that two did not have BOS. 46 patients were analysed as intention to treat (ITT) with 33 ‘Completers’. ITT analysis inc...

  2. B- and A-Type Stars in the Taurus-Auriga Star-Forming Region

    Science.gov (United States)

    Mooley, Kunal; Hillenbrand, Lynne; Rebull, Luisa; Padgett, Deborah; Knapp, Gillian

    2013-01-01

    We describe the results of a search for early-type stars associated with the Taurus-Auriga molecular cloud complex, a diffuse nearby star-forming region noted as lacking young stars of intermediate and high mass. We investigate several sets of possible O, B, and early A spectral class members. The first is a group of stars for which mid-infrared images show bright nebulae, all of which can be associated with stars of spectral-type B. The second group consists of early-type stars compiled from (1) literature listings in SIMBAD, (2) B stars with infrared excesses selected from the Spitzer Space Telescope survey of the Taurus cloud, (3) magnitude- and color-selected point sources from the Two Micron All Sky Survey, and (4) spectroscopically identified early-type stars from the Sloan Digital Sky Survey coverage of the Taurus region. We evaluated stars for membership in the Taurus-Auriga star formation region based on criteria involving: spectroscopic and parallactic distances, proper motions and radial velocities, and infrared excesses or line emission indicative of stellar youth. For selected objects, we also model the scattered and emitted radiation from reflection nebulosity and compare the results with the observed spectral energy distributions to further test the plausibility of physical association of the B stars with the Taurus cloud. This investigation newly identifies as probable Taurus members three B-type stars: HR 1445 (HD 28929), t Tau (HD 29763), 72 Tau (HD 28149), and two A-type stars: HD 31305 and HD 26212, thus doubling the number of stars A5 or earlier associated with the Taurus clouds. Several additional early-type sources including HD 29659 and HD 283815 meet some, but not all, of the membership criteria and therefore are plausible, though not secure, members.

  3. Involvement of opioid peptides in the regulation of reproduction in the prawn Penaeus indicus

    Science.gov (United States)

    Sreenivasula Reddy, P.

    The possible involvement of an endogenous opioid system in the regulation of ovarian development in the prawn Penaeus indicus was investigated. Injection of leucine-enkephalin significantly increased the ovarian index and oocyte diameter in a dose-dependent manner. In contrast, injection of methionine-enkephalin significantly decreased the ovarian index and oocyte diameters. These results provide evidence to support the hypothesis that an opioid system is involved in the regulation of reproduction in crustaceans.

  4. DAYA HAMBAT FRAKSINASI EKSTRAK SEMBUNG DELAN (SPHAERANTUS INDICUS L) TERHADAP BAKTERI ESCHERICIA COLI DAN STAPHYLOCOCCUS AUREUS

    OpenAIRE

    IDA BAGUS GEDE DARMAYASA

    2008-01-01

    A research entitled "Inhibitid activity of plant fractination extract of Sembung Delan (Sphaeranthus indicus L.) to Eschericia coli and Staphylococus aureus bacterial was carried aut to find the active of plant extract that responsible for bactericidal agent. This research used absorbance disc method to determine inhibitid fractionation extratc of Sembung Delan to growth of Eschericia coli and Staphylococus aureus bacterial. Results of this study showed that the crude extract of Sembung Delan...

  5. Hemograma de bovinos (Bos indicus sadios da raça nelore no primeiro mês de vida, criados no estado de São Paulo Hemogram of healthy nelore breed (Bos indicus calf at the first month of life, raised in São Paulo state, Brazil

    Directory of Open Access Journals (Sweden)

    Alexander Welker Biondo

    1998-06-01

    Full Text Available Avaliou-se as mudanças nos constituintes do hemograma de bovinos da raça Nelore, 71 machos e 56 fêmeas, no primeiro mês de vida, criados no Estado de São Paulo. Foram utilizadas 127 amostras de sangue de bezerros criados a pasto, divididos em cinco grupos: de 0-3, 3-7, 7-14 , 14-21 e 21-30 dias de idade. Os valores médios encontrados foram: número de hemácias 8,31 ± l,84 x 10(6/ mi l; Volume globular 39 ± 6%; taxa de hemoglobina 12,89 ± 2,04g/dl; Volume Corpuscular Médio 48,19 ± 5,68fl; Concentração de Hemoglobina Corpuscular Média 32,81 ± 1,84; reticulócitos 0,27 ± 0,54% e eritroblastos 214 ± 594/mil; número de leucócitos/mil 10593 ± 3008, neutrófilos bastonetes 97 ± 165; neutrófilos segmentados 4837 ± 2201; linfócitos 5222 ± 1909; eosinófilos 86 ± 139; monócitos 346 ± 221; basófilos 4 ± 24. Os fatores sexuais não apresentaram influência significativa sobre o hemograma, com exceção dos reticulócitos e eritroblastos. Os fatores etários apresentaram influência significativa (p≤0,03 sobre as curvas de regressão do hemograma, com o volume globular, hemácias e hemoglobina diminuindo e o CHCM e reticulócitos aumentando até os 3 a 7 dias, havendo uma inversão desta variação dos sete até os 30 dias. A curva de regressão do percentual de linfócitos aumentou e de neutrófilos diminuiu gradativamente após o nascimento. O encontro destas curvas ocorreu entre o sétimo e o décimo quarto dia de vida.Changes on the hemogram parameters were evaluated for healthy Nelore purebreed bovines at the first month age, with 71 male and 56 female, and raised in São Paulo State, Brazil. For this purpose, 127 samples of blood were collected, and divided in five groups ; 0-3 , 3-7 . 7-14 , 14-21 and 21-30 days of age. The mean values were: erithrocyte counts 8.31± 1.84 x 10(6/ mu l; Package Cell Volume 39 ± 6%: hemoglobin 12.89 ± 2.04g/dl; Mean Corpuscular Volume 48.19 ± 5.68fl; Mean Corpuscular Hemoglobin Concentration 32.81 ± 1.84 ; Reticulocytes 0.27 ± 0.54%; erythroblast 214 ± 594/mul; leukocytes (mu l: 10593 ± 3008; band neutrophils 97 ± 165; segmented neutrophils 4837 ± 2201; lymphocytes 5222 ± 1909; eosinophils 86 ± 139: monocytes 346 ± 221; basophils 3 ± 24. Sex had no influencing the hemogram values except to reticulocytes and erythroblast that were higher in females. Age significantly influenced the leucogram and eritrogram values (p≤0.0 3. The Package Cell Volume, erythrocytes, and hemoglobin decreasing and the Mean Corpuscular Hemoglobin Concentration and reticulocytes increasing until the thirth to seventh days. There was an subsequent inversion of this variation in this period until the thirtieth day. The lymphocyte percentage regression curve increasing and neutrophils decreasing after birth. The intersection between the two leukocytes curves occurred between the seventh and the fourteenth day of life.

  6. Genetic diversity and relationship of Yunnan native cattle breeds and introduced beef cattle breeds.

    Science.gov (United States)

    Yu, Ying; Lian, Lin-Sheng; Wen, Ji-Kun; Shi, Xian-Wei; Zhu, Fang-Xian; Nie, Long; Zhang, Ya-Ping

    2004-02-01

    In this study, random amplified polymorphic DNA (RAPD) analysis was used to estimate genetic diversity and relationship in 134 samples belonging to two native cattle breeds from the Yunnan province of China (DeHong cattle and DiQing cattle) and four introduced beef cattle breeds (Brahman, Simmental, MurryGrey, and ShortHorn). Ten primers were used, and a total of 84 bands were scored, of which 63 bands (75.0%) were polymorphic. The genetic distance matrix was obtained by proportions of shared fragment. The results indicate that the Yunnnan DeHong cattle breed is closely related to the Brahman (Bos indicus), and the Yunnan DiQing cattle breed is closely related to the Simmental, ShortHorn, and MurryGrey (Bos taurus) breeds. Our results imply that Bos indicus and Bos taurus were the two main origins of Yunnan native cattle. The results also provide the basic genetic materials for conservation of cattle resources and crossbreeding of beef cattle breeds in South China. PMID:15068334

  7. Whole genome linkage disequilibrium maps in cattle

    Directory of Open Access Journals (Sweden)

    Mannen Hideyuki

    2007-10-01

    Full Text Available Abstract Background Bovine whole genome linkage disequilibrium maps were constructed for eight breeds of cattle. These data provide fundamental information concerning bovine genome organization which will allow the design of studies to associate genetic variation with economically important traits and also provides background information concerning the extent of long range linkage disequilibrium in cattle. Results Linkage disequilibrium was assessed using r2 among all pairs of syntenic markers within eight breeds of cattle from the Bos taurus and Bos indicus subspecies. Bos taurus breeds included Angus, Charolais, Dutch Black and White Dairy, Holstein, Japanese Black and Limousin while Bos indicus breeds included Brahman and Nelore. Approximately 2670 markers spanning the entire bovine autosomal genome were used to estimate pairwise r2 values. We found that the extent of linkage disequilibrium is no more than 0.5 Mb in these eight breeds of cattle. Conclusion Linkage disequilibrium in cattle has previously been reported to extend several tens of centimorgans. Our results, based on a much larger sample of marker loci and across eight breeds of cattle indicate that in cattle linkage disequilibrium persists over much more limited distances. Our findings suggest that 30,000–50,000 loci will be needed to conduct whole genome association studies in cattle.

  8. On the mass segregation of stars and brown dwarfs in Taurus

    CERN Document Server

    Parker, Richard J; Goodwin, Simon P; Moraux, Estelle; Allison, Richard J; Guieu, Sylvain; Guedel, Manuel

    2010-01-01

    We use the new minimum spanning tree (MST) method to look for mass segregation in the Taurus association. The method computes the ratio of MST lengths of any chosen subset of objects, including the most massive stars and brown dwarfs, to the MST lengths of random sets of stars and brown dwarfs in the cluster. This mass segregation ratio (Lambda_MSR) enables a quantitative measure of the spatial distribution of high-mass and low-mass stars, and brown dwarfs to be made in Taurus. We find that the most massive stars in Taurus are inversely mass segregated, with Lambda_MSR = 0.70 +/- 0.10 (Lambda_MSR = 1 corresponds to no mass segregation), which differs from the strong mass segregation signatures found in more dense and massive clusters such as Orion. The brown dwarfs in Taurus are not mass segregated, although we find evidence that some low-mass stars are, with an Lambda_MSR = 1.25 +/- 0.15. Finally, we compare our results to previous measures of the spatial distribution of stars and brown dwarfs in Taurus, and...

  9. New Brown Dwarfs and an Updated Initial Mass Function in Taurus

    CERN Document Server

    Luhman, K L

    2004-01-01

    I have performed a search for young low-mass stars and brown dwarfs (BDs) in 2 regions encompassing a total area of 4 deg^2 in the Taurus star-forming region, discovering 15 new members of Taurus. In addition, I present 7 new members outside of these areas from the initial stage of a survey of all of Taurus. These 22 objects exhibit spectral types of M4.5-M9.25 and masses of 0.3-0.015 M_sun according to the theoretical evolutionary models of Baraffe and Chabrier, 7 of which are likely to be BDs. Emission in H(alpha), He I, Ca II, [O I], and [S II] and excess emission in optical and near-IR bands among some of these objects suggest the presence of accretion, outflows, and circumstellar disks. The results from the 4 deg^2 survey have been combined with previous studies of Taurus to arrive at an IMF for a total area of 12.4 deg^2. As in the previous IMFs for Taurus, the updated IMF peaks at a higher mass (0.8 M_sun) than the mass functions in IC 348 and Orion (0.1-0.2 M_sun). Meanwhile, the deficit of BDs in Tau...

  10. Treatments to Optimize the Use of Artificial Insemination and Reproductive Efficiency in Beef Cattle under Tropical Environments

    Directory of Open Access Journals (Sweden)

    Ocilon Gomes de Sá Filho

    2011-01-01

    Full Text Available Bos indicus cattle, the preferred genetic group in tropical climates, are characterized by having a lower reproductive efficiency than Bos taurus. The reasons for the poorer reproductive efficiency of the Bos indicus cows include longer lengths of gestation and postpartum anestrus, a short length of estrous behavior with a high incidence of estrus occurring during the dark hours, and puberty at older age and at a higher percentage of body weight relative to mature body weight. Moreover, geography, environment, economics, and social traditions are factors contributing for a lower use of reproductive biotechnologies in tropical environments. Hormonal protocols have been developed to resolve some of the reproductive challenges of the Bos indicus cattle and allow artificial insemination, which is the main strategy to hasten genetic improvement in commercial beef ranches. Most of these treatments use exogenous sources of progesterone associated with strategies to improve the final maturation of the dominant follicle, such as temporary weaning and exogenous gonadotropins. These treatments have caused large impacts on reproductive performance of beef cattle reared under tropical areas.

  11. NCBI nr-aa BLAST: CBRC-TTRU-01-1139 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1139 gb|ACX37386.1| toll-like receptor 1 variant 30 [Bos indicus] gb|ACX37387.1| toll...-like receptor 1 variant 31 [Bos indicus] gb|ACX37395.1| toll-like receptor 1 variant 39 [Bos indicus] ACX37386.1 0.0 89% ...

  12. Subspecies differences in early fetal development and plasma pregnancy-associated glycoprotein concentrations in cattle.

    Science.gov (United States)

    Mercadante, P M; Waters, K M; Mercadante, V R G; Lamb, G C; Elzo, M A; Johnson, S E; Rae, D O; Yelich, J V; Ealy, A D

    2013-08-01

    Inclusion of Bos indicus genetics improves production traits of cattle maintained in hot climates. Limited information exists detailing pregnancy-specific events as influenced by variable amounts of Bos indicus genetics. Three experiments were completed to examine the effect of Bos taurus and Bos indicus genotypes on fetal size and plasma pregnancy-associated glycoprotein (PAG) concentrations. In all experiments, cows were bred by AI after synchronization of ovulation. Fetal measurements were completed by transrectal ultrasonography and plasma PAG concentrations were quantified from plasma harvested the day of each fetal measurement. In Exp. 1, fetal size and plasma PAG concentrations were measured at d 53 of pregnancy in cows composed of various fractions of Angus and Brahman (n = 9 to 21 cows/group). Fetus size was greater in cows containing >80% Angus genetics compared with cows containing 80% Angus genetics when compared with their contemporaries (6.0 ± 1.5 ng/mL vs. 9.4 ± 1.5 ng/mL). In Exp. 2, fetal measurements and plasma PAG concentrations were determined at d 35 and 62 of pregnancy in Angus and Brangus cows. Breed did not affect fetus size at d 35, but Angus cows contained larger fetuses than Brangus cows at d 62 [3.0 ± 0.03 vs. 2.8 ± 0.03 cm crown-nose length (CNL; P > 0.01)]. Plasma PAG concentrations were not different between breed at d 35 and 62 (P > 0.1). In Exp. 3, fetal measurements and plasma samples were collected at d 33/34, 40/41, 47/48, and 54/55 post-AI in Angus and Brangus cows. Fetus size was not different (P > 0.05) between genotypes on d 33/34, 40/41, and 47/48. Angus fetuses were larger than Brangus fetuses at d 54/55 (2.1 ± 0.03 vs. 1.9 ± 0.03 cm CNL; P = 0.001). Plasma PAG concentrations were less in Angus than Brangus cows at each time point (average 4.9 ± 0.9 vs. 8.2 ± 0.9 ng/mL; P = 0.005). In conclusion, these studies determined that the Bos taurus × Bos indicus genotype impacts fetal size and rate of fetal development by

  13. The first complete mitochondrial genome of a Belostomatidae species, Lethocerus indicus, the giant water bug: An important edible insect.

    Science.gov (United States)

    Devi, Kshetrimayum Miranda; Shantibala, Tourangbam; Debaraj, Hajarimayum

    2016-10-10

    Lethocerus indicus of the family Belostomatidae is one of the most preferred and delicious edible insects in different parts of South-East Asia including North-East, India. The mitogenome of L. indicus represents the first complete mitogenome sequence of a Belostomatidae species in Heteroptera order. The mitogenome of L. indicus is 16,251bp and contains 37 genes including 13 protein coding genes (PCGs), 22 tRNA genes, two rRNA genes, and a large non-coding region. The genome has a typical gene order which is identical to other Heteroptera species. All tRNAs exhibit the classic cloverleaf secondary structure except tRNASer (AGN). All the PCGs employ a complete translation termination codon either TAA or TAG except COII. The nucleotide composition showed heavy biased toward AT accounting to 70.9% of total mitogenome. The overall A+T content of L. indicus mitogenome was comparatively lower than some other Heteropteran bugs mitogenomes. The control region is divided into seven different parts which includes the putative stem loop, repeats, tandem repeats, GC and AT rich regions. The phylogenetic relationship based on maximum-likelihood method using all protein coding genes was congruent with the traditional morphological classification that Belostomatidae is closely related to Nepidae. The complete mitogenome sequence of L. indicus provides fundamental data useful in conservation genetics and aquaculture diversification. PMID:27390089

  14. The first complete mitochondrial genome of a Belostomatidae species, Lethocerus indicus, the giant water bug: An important edible insect.

    Science.gov (United States)

    Devi, Kshetrimayum Miranda; Shantibala, Tourangbam; Debaraj, Hajarimayum

    2016-10-10

    Lethocerus indicus of the family Belostomatidae is one of the most preferred and delicious edible insects in different parts of South-East Asia including North-East, India. The mitogenome of L. indicus represents the first complete mitogenome sequence of a Belostomatidae species in Heteroptera order. The mitogenome of L. indicus is 16,251bp and contains 37 genes including 13 protein coding genes (PCGs), 22 tRNA genes, two rRNA genes, and a large non-coding region. The genome has a typical gene order which is identical to other Heteroptera species. All tRNAs exhibit the classic cloverleaf secondary structure except tRNASer (AGN). All the PCGs employ a complete translation termination codon either TAA or TAG except COII. The nucleotide composition showed heavy biased toward AT accounting to 70.9% of total mitogenome. The overall A+T content of L. indicus mitogenome was comparatively lower than some other Heteropteran bugs mitogenomes. The control region is divided into seven different parts which includes the putative stem loop, repeats, tandem repeats, GC and AT rich regions. The phylogenetic relationship based on maximum-likelihood method using all protein coding genes was congruent with the traditional morphological classification that Belostomatidae is closely related to Nepidae. The complete mitogenome sequence of L. indicus provides fundamental data useful in conservation genetics and aquaculture diversification.

  15. WOOD-WATER RELATIONSHIPS AND BIOLOGICAL DURABILITY OF HEAT-TREATED TAURUS FIR WOOD

    Directory of Open Access Journals (Sweden)

    Bekir Cihad BAL

    2015-09-01

    Full Text Available In this study, Taurus Fir (Abies cilicica wood was treated with hot air at temperatures of 160, 190 and 220°C for 2h durations. After heat treatment, some physical properties and wood-water relationships were evaluated, such as mass loss, density, tangential swelling, radial swelling, volumetric swelling, swelling anisotropy, and fiber saturation point. In addition, the biological durability of Taurus Fir wood was tested in the laboratory with the soil contact test, and determined weight loss. The relationships between mass loss and some of the tested properties were determined using regression analysis. The results showed that heat treatment at 220°C had significant effects on the physical properties and the biological durability of Taurus Fir wood. Further, it was determined that there was a linear-negative correlation between weight loss and mass loss.

  16. Another Look at Taurus Littrow: An Interactive Geographic Information System DataBase

    Science.gov (United States)

    Coombs, Cassandra R.; Meisburger, J. L.; Nettles, J. W.

    1998-01-01

    A variety of data has been amassed for the Apollo 17 landing site, including topography, sample locations, and imagery. These data were compiled into a Geographic Information System (GIS) to analyze their interrelationships more easily. The database will allow the evaluation of the resource potential of the Taurus Littrow region pyroclastic deposits. The database also serves as a catalog for the returned lunar samples. This catalog includes rock type, size, and location. While this project specifically targets the Taurus Littrow region, it is applicable to other regions as well.

  17. The role of genotype on classification grades of beef carcasses produced under mexican tropical conditions

    Directory of Open Access Journals (Sweden)

    José Manuel Zorrilla-Ríos

    2015-01-01

    Full Text Available El presente estudio identificó la distribución de 22,850 canales de bovino de diferentes genotipos. Éstos, en función del juzgamiento visual del tamaño de la giba (grande, representativa de un genotipo Bos indicus; mediana, genotipo producto de la cruza entre B. taurus y B. indicus y pequeña, considerada como genotipo B. taurus en los grados de clasificación obtenidos bajo la norma mexicana NMX-FF-078-SCFI-2002, en el rastro Tipo Inspección Federal No. 51 de La Unión, Tabasco (México. Se determinó el grado de asociación y la proporción de canales, juzgados por el tamaño de su giba; y el criterio de clasificación de la canal, por el procedimiento analítico de Chi-Cuadrada. Cincuenta y cuatro por ciento de las canales correspondieron al tipo de giba grande (genotipo B. indicus, 35% al de pequeña (genotipo B. taurus y el 10.70% al de mediana (genotipo producto de la cruza entre B. taurus y B. indicus. En los genotipos B. taurus y cruza se concentró un mayor número de canales con clasificación de selecta (P<0.0001; 17.90 y 18.50%, respectivamente y estándar (55.20 y 60.10%, respectivamente que el genotipo B. indicus (10.10% para canales selectas y 39.30% de estándar. El genotipo B. indicus concentró un mayor número de canales de grado comercial (36.20% y fuera de clasificación (14.40% (P<0.0001. Los tres genotipos de bovinos considerados (B. indicus, B. taurus y Cruzas dieron lugar a canales clasificadas como selectas, sugiriendo que el genotipo no sea un factor de sesgo en la norma de clasificación de canales de bovino mexicano NMX-FF-078-SCFI-2002.

  18. The effect of sire breed on the melting point and fatty acid composition of subcutaneous fat in steers.

    Science.gov (United States)

    Perry, D; Nicholls, P J; Thompson, J M

    1998-01-01

    Fatty acid composition and the melting point of subcutaneous fat was determined in 18 Hereford, 25 Brahman x Hereford, 22 Simmental x Hereford, and 15 Friesian x Hereford steers that were grown out on pasture at two sites and slaughtered when the mean weight of the Herefords at each site was ca. 450 kg. Multivariate and univariate analyses tested the relations of fatty acid composition, degree of saturation, and melting point with sire breed, environment, age, and carcass characteristics. Hereford and Brahman steers were fatter than the Simmental and Friesian steers. Fat from Brahman-sired steers had a melting point 2.5 degrees C lower than fat from the Bos taurus-sired steers at the same age and had a higher proportion of unsaturated fatty acids, independent of variation in carcass weight and fatness. Melting point and degree of saturation decreased as age increased. Step-down discriminant analyses identified a set of three acids (14:0, 16:0, and 17:1) that differed among sire breeds, independent of differences in melting point: the acids 14:0 and 16:0 discriminated between Brahman and Bos taurus steers and 17:1 between Hereford and Simmental and Friesian steers. Increase in fatness was associated with an increase in 17:1, but, at the same fatness, no acids discriminated among the Bos taurus-sired steers. The use of Bos indicus cattle or their crossbreeds in situations in which hard-setting fat is likely may mitigate the problem.

  19. An experimental study of aero-optical aberration and dithering of supersonic mixing layer via BOS

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    The optical performance of supersonic mixing layer is heavily deteriorated by the aero-optical aberration and dithering of coherent structures, but current measuring methods limit the spatiotemporal resolution in relevant studies. A high resolution whole-field aero-optical aberration and dithering measuring method based on the Background Orient Schlieren (BOS) technique was studied. The systematic structure, sensitivity and resolution of BOS are analyzed in this paper. The aero-optical aberration and dithering of streamwise structures in supersonic mixing layers were quantificationally studied with BOS. The aberration field of spanwise structures revealed the ribbon-like aberration structures, which heavily restrict the optical performance of a mixing layer. The quantifications of aero-optical aberration and dithering are very important in studying aero-optical performance of supersonic mixing layer.

  20. A high dynamic radiation measurements instrument: the Bolometric Oscillation Sensor (BOS

    Directory of Open Access Journals (Sweden)

    P. Zhu

    2014-12-01

    Full Text Available The bolometric oscillation sensor (BOS is a broadband radiation measurement instrument onboard the PICARD satellite that has been active between 2010 and 2014. The main detector is a thermistor attached black coated surface, which was permanently exposed to space without any optical and aperture accessories. The temperature measurements are used within a transfer function to determine variations in incoming solar irradiance as well as the terrestrial radiation. In the present article, the measurement principle of BOS and its transfer function are presented. The performance of the instrument is discussed based on laboratory experiments and space observations from the PICARD satellite. The comparison of the short term variation of Total Solar Irradiance (TSI with absolute radiometers such as VIRGO/SOHO and TIM/SORCE over the same period of time, suggests that BOS is a relatively much simpler but very effective sensor to monitor electromagnetic radiation variations from visible to infrared wavelengths.

  1. Effects of Plant Growth Hormones on Mucor indicus Growth and Chitosan and Ethanol Production

    OpenAIRE

    Zahra Safaei; Keikhosro Karimi; Poorandokht Golkar; Akram Zamani

    2015-01-01

    The objective of this study was to investigate the effects of indole-3-acetic acid (IAA) and kinetin (KIN) on Mucor indicus growth, cell wall composition, and ethanol production. A semi-synthetic medium, supplemented with 0–5 mg/L hormones, was used for the cultivations (at 32 °C for 48 h). By addition of 1 mg/L of each hormone, the biomass and ethanol yields were increased and decreased, respectively. At higher levels, however, an inverse trend was observed. The glucosamine fraction of the ...

  2. Outflows and Bubbles in Taurus: Star-formation Feedback Sufficient to Maintain Turbulence

    CERN Document Server

    Li, Huixian; Qian, Lei; Xu, Duo; Goldsmith, Paul F; Noriega-Crespo, Alberto; Wu, Yuefang; Song, Yuzhe; Nan, Rendong

    2015-01-01

    We have identified outflows and bubbles in the Taurus molecular cloud based on the $\\sim 100$ deg$^2$ Five College Radio Astronomy Observatory $^{12}$CO(1-0) and $^{13}$CO(1-0) maps and the Spitzer young stellar object catalogs. In the main 44 deg$^2$ area of Taurus we found 55 outflows, of which 31 were previously unknown. We also found 37 bubbles in the entire 100 deg$^2$ area of Taurus, all of which had not been found before. The total kinetic energy of the identified outflows is estimated to be $\\bf \\sim 3.9 \\times 10^{45}$ erg, which is \\textbf{1\\%} of the cloud turbulent energy. The total kinetic energy of the detected bubbles is estimated to be $\\sim 9.2 \\times 10^{46}$ erg, which is 29\\% of the turbulent energy of Taurus. The energy injection rate from outflows is $\\bf \\sim 1.3 \\times 10^{33}~\\rm erg\\ s^{-1}$, \\textbf{0.4 - 2 times} the dissipation rate of the cloud turbulence. The energy injection rate from bubbles is $\\sim 6.4 \\times 10^{33}$ erg s$^{-1}$, \\textbf{2 - 10 times} the turbulent dissipa...

  3. An Infrared/X-ray Survey for New Members of the Taurus Star-Forming Region

    CERN Document Server

    Luhman, K L; Allen, P R; Cruz, K L

    2009-01-01

    We present the results of a search for new members of the Taurus star-forming region using data from the Spitzer Space Telescope and the XMM-Newton Observatory. We have obtained optical and near-infrared spectra of 44 sources that exhibit red Spitzer colors that are indicative of stars with circumstellar disks and 51 candidate young stars that were identified by Scelsi and coworkers using XMM-Newton. We also performed spectroscopy on four possible companions to members of Taurus that were reported by Kraus and Hillenbrand. Through these spectra, we have demonstrated the youth and membership of 41 sources, 10 of which were independently confirmed as young stars by Scelsi and coworkers. Five of the new Taurus members are likely to be brown dwarfs based on their late spectral types (>M6). One of the brown dwarfs has a spectral type of L0, making it the first known L-type member of Taurus and the least massive known member of the region (M=4-7 M_Jup). Another brown dwarf exhibits a flat infrared spectral energy d...

  4. B- and A-Type Stars in the Taurus-Auriga Star Forming Region

    CERN Document Server

    Mooley, Kunal P; Rebull, Luisa M; Padgett, Deborah L; Knapp, Gillian R

    2013-01-01

    We describe the results of a search for early-type stars associated with the Taurus-Auriga molecular cloud complex, a diffuse nearby star-forming region noted as lacking young stars of intermediate and high mass. We investigate several sets of possible O, B and early A spectral class members. The first is a group of stars for which mid-infrared images show bright nebulae, all of which can be associated with stars of spectral type B. The second group consists of early-type stars compiled from (i) literature listings in SIMBAD; (ii) B stars with infrared excesses selected from the Spitzer Space Telescope survey of the Taurus cloud; (iii) magnitude- and color-selected point sources from the 2MASS; and (iv) spectroscopically identified early-type stars from the SDSS coverage of the Taurus region. We evaluated stars for membership in the Taurus-Auriga star formation region based on criteria involving: spectroscopic and parallactic distances, proper motions and radial velocities, and infrared excesses or line emiss...

  5. ETHANOL PRODUCTION FROM XYLOSE AND WOOD HYDROLYZATE BY MUCOR INDICUS AT DIFFERENT AERATION RATES

    Directory of Open Access Journals (Sweden)

    Ria Millati

    2008-11-01

    Full Text Available The fungus Mucor indicus is able to produce ethanol from xylose as well as dilute-acid lignocellulosic hydrolyzates. The fungus completely assimilated 10 g/L xylose as the sole carbon and energy source within 32 to 65 h at an aeration rate of 0.1 to 1.0 vvm. The highest ethanol yield was 0.16 g/g at 0.1 vvm. Xylitol was formed intermediately with a maximum yield of 0.22 g/g at 0.5 vvm, but disappeared towards the end of experiments. During cultivation in a mixture of xylose and glucose, the fungus did not assimilate xylose as long as glucose was present in the medium. The anaerobic cultivation of the fungus in the hydrolyzate containing 20% xylose and 80% hexoses resulted in no assimilation of xylose but complete consumption of the hexoses in less than 15 h. The ethanol yield was 0.44 g/g. However, the xylose in the hydrolyzate was consumed when the media was aerated at 0.067 to 0.333 vvm. The best ethanol yield was 0.44 g/g at 0.067 vvm. The results of this study suggest that M. indicus hydrolyzate can be first fermented anaerobically for hexose assimilation and subsequently continued under oxygen-limited conditions for xylose fermentation.

  6. Mosquitocidal and water purification properties of Cynodon dactylon, Aloe vera, Hemidesmus indicus and Coleus amboinicus leaf extracts.

    Science.gov (United States)

    Ethanolic extracts of Cynodon dactylon, Aloe vera, Hemidesmus indicus and Coleus amboinicus were tested for toxicity to 3rd instar Anopheles stephensi, Culex quinquefasciatus, and Aedes aegypti. Median lethal concentrations (LC50) were, respectively, 0.44%, 0.51%, 0.59% and 0.68%. Cynodon dactylon...

  7. Impact of Balance Of System (BOS) costs on photovoltaic power systems

    Science.gov (United States)

    Hein, G. F.; Cusick, J. P.; Poley, W. A.

    1978-01-01

    The Department of Energy has developed a program to effect a large reduction in the price of photovoltaic modules, with significant progress already achieved toward the 1986 goal of 50 cents/watt (1975 dollars). Remaining elements of a P/V power system (structure, battery storage, regulation, control, and wiring) are also significant cost items. The costs of these remaining elements are commonly referred to as Balance-of-System (BOS) costs. The BOS costs are less well defined and documented than module costs. The Lewis Research Center (LeRC) in 1976/77 and with two village power experiments that will be installed in 1978. The costs were divided into five categories and analyzed. A regression analysis was performed to determine correlations of BOS Costs per peak watt, with power size for these photovoltaic systems. The statistical relationship may be used for flat-plate, DC systems ranging from 100 to 4,000 peak watts. A survey of suppliers was conducted for comparison with the predicted BOS cost relationship.

  8. ‘Lute Bos draagt nog altijd bij aan de virologie’ : fonds laat ecologische virologie herrijzen

    NARCIS (Netherlands)

    Vlugt, van der R.A.A.; Branderhorst, A.

    2014-01-01

    Met ecologische kennis van plantenvirussen in de tuin- en akkerbouw zijn opbrengstverliezen te voorkomen. René van der Vlugt gaat het onderzoek en onderwijs in dit vakgebied nieuw leven inblazen. Dat is mogelijk dankzij een legaat van de Wageningse plantenviroloog Lute Bos.

  9. Polycyclic aromatic hydrocarbon degradation by the white rot fungus Bjerkandera sp. strain BOS55.

    NARCIS (Netherlands)

    Kotterman, M.J.J.

    1998-01-01

    Outline of this thesisIn this thesis the conditions for optimal PAH oxidation by the white rot fungus Bjerkandera sp. strain BOS55 were evaluated. In Chapter 2, culture conditions like aeration and cosubstrate concentrations, which influenced the oxidation of the PAH compound anthra

  10. The preliminary measurements from the Bolometer Oscillation System (BOS) on board PICARD

    Science.gov (United States)

    Zhu, P.; Ruymbeke, M. V.; Meftah, M.; Clette, F.; Dewitte, S.; Chevalier, A.; van Ruymbeke, F.; Noel, J.

    2010-12-01

    The PICARD is a French CNES micro-satellite mission which was successfully launched on June 15, 2010 by the Russian DNEPR launcher. Its objectives are the study of the origin of the solar variability and the relations between the Sun and the Earth’s climate. The duration of the mission is about two years with possibility to extend to three or more years. SOVAP/BOS (SOlar Variability for Picard - Bolometer Oscillation System) is one of the key instruments in the PICARD payload. The main goal of SOVAP/BOS consists in measuring the TSI (Total Solar Irradiance) with very high precision. SOVAP is a new improved version of the DIARAD absolute solar radiometer, which has been successfully installed and operated on several previous missions designed by the Royal Meteorological Institute of Belgium. BOS is a pioneering experiment or to say, a complementary part of SOVAP. It consists of a solar bolometer that measures the incident electromagnetic radiation power by converting this radiation energy in a thermal signal. The radiation is measured using a differential thermometer placed in a thermal shunt. By design, this bolometer is able to measure radiation integrated over all wavelengths and provide a broad dynamic range, with high precision and combined with a fast measuring cadence of 10s, instead of typ. 2-3 minutes in earlier TSI (total solar irradiance) measurements. We will show the preliminary results of measurements made by BOS. For instance, the solar eclipse records during 11, July 2010.

  11. Avaliação comparativa da ultraestrutura e propriedades físicas do esmalte bovino, bubalino e humano

    OpenAIRE

    Bárbara C.L. Nogueira; Piero M. Fernandes; Augusto C.J. Paiva; Nathália C.F. Fagundes; Francisco B. Teixeira; Rafael R. Lima

    2014-01-01

    Este estudo teve como finalidade comparar a morfologia e propriedades físicas da estrutura do esmalte dos dentes bovinos, bubalinos e humanos. A análise deste tecido foi realizada por meio de microscopia eletrônica de varredura, composição mineral, microdureza e rugosidade superficial do esmalte em 41 incisivos bubalinos (Bos taurus indicus), 41 incisivos bovinos (Pelorovis antiques) e 30 incisivos permanentes de humanos. Os resultados mostraram que a ultraestrutura do esmalte revela uma sign...

  12. Mechanism of antibacterial action of the alcoholic extracts of Hemidesmus indicus (L.) R. Br. ex Schult, Leucas aspera (Wild.), Plumbago zeylanica L., and Tridax procumbens (L.) R. Br. ex Schult

    OpenAIRE

    Saritha, Kongari; Rajesh, Angireddy; Manjulatha, Khanapur; Setty, Oruganti H.; Yenugu, Suresh

    2015-01-01

    Herbal products derived from Hemidesmus indicus (L.) R. Br. ex Schult, Leucas aspera (Wild.), Plumbago zeylanica L., and Tridax procumbens (L.) R. Br. ex Schult. are widely used in traditional medicine. Though the extracts of these plants were found to be antimicrobial in nature and have the potential to be used in clinics, the mechanism of action of is not reported. The ethanolic extracts of Hemidesmus indicus (L.) R. Br. ex Schult, Hemidesmus indicus ethanolic extract (HIEE), Leucas aspera ...

  13. Large-Scale Distribution of Herbig-Haro Objects in Taurus

    Institute of Scientific and Technical Information of China (English)

    Ke-Feng Sun; Ji Yang; Shao-Guang Luo; Min Wang; Li-Cai Deng; Xu Zhou; Jian-Sheng Chen

    2003-01-01

    We report our new results on Herbig-Haro (HH) objects in the star forming region of Taurus from a wide-field survey with the 60/90 cm Schmidt telescope of the Beijing Astronomical Observatory. This survey using CCD imaging with a narrow band [SⅡ] filter and an intermediate band [BATC10] filter covered approximately 30 square degrees in Taurus. Besides confirming the known HH Objects in the region, we discovered seven new HH candidates, and groups. Six of these are HH 701A-B, HH 702A-D, HH 703, HH 704A-D, HH 705, HH 706 and the seventh is a group, a new component of HH 319, labeled HH 319B-D. Based on the large-scale distribution of pre-main-sequence (PMS) stars in Taurus, we analyze statistically the most probable distance from the HH objects to each PMS star,from which we estimate the typical timescale of these HH objects to be between(1.3 - 2.0) × 104 yrs; and we also obtain the birth rates of HH objects: 0.447±0.198 for Class Ⅰ PMS stars, 0.360±0.222 for Class Ⅱ PMS stars, and -0.148±0.234 for Class Ⅲ PMS stars.

  14. THE GOULD'S BELT VERY LARGE ARRAY SURVEY. IV. THE TAURUS-AURIGA COMPLEX

    Energy Technology Data Exchange (ETDEWEB)

    Dzib, Sergio A. [Max Planck Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Loinard, Laurent; Rodríguez, Luis F.; Ortiz-León, Gisela N.; Pech, Gerardo; Rivera, Juana L. [Centro de Radioastronomía y Astrofísica, Universidad Nacional Autónoma de México Apartado Postal 3-72, 58090 Morelia, Michoacán (Mexico); Mioduszewski, Amy J. [National Radio Astronomy Observatory, Domenici Science Operations Center, 1003 Lopezville Road, Socorro, NM 87801 (United States); Kounkel, Marina A.; Hartmann, Lee [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48105 (United States); Torres, Rosa M. [Instituto de Astronomía y Meteorología, Universidad de Guadalajara, Avenida Vallarta No. 2602, Col. Arcos Vallarta, CP 44130 Guadalajara, Jalisco, México (Mexico); Boden, Andrew F. [Division of Physics, Math, and Astronomy, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Evans II, Neal J. [Department of Astronomy, The University of Texas at Austin, 1 University Station, C1400, Austin, TX 78712 (United States); Briceño, Cesar [Cerro Tololo Interamerican Observatory, Casilla 603, La Serena (Chile); Tobin, John, E-mail: sdzib@mpifr-bonn.mpg.de [Leiden Observatory, Leiden University, P.O. Box 9513, 2300 RA Leiden (Netherlands)

    2015-03-10

    We present a multi-epoch radio study of the Taurus-Auriga star-forming complex made with the Karl G. Jansky Very Large Array at frequencies of 4.5 GHz and 7.5 GHz. We detect a total of 610 sources, 59 of which are related to young stellar objects (YSOs) and 18 to field stars. The properties of 56% of the young stars are compatible with non-thermal radio emission. We also show that the radio emission of more evolved YSOs tends to be more non-thermal in origin and, in general, that their radio properties are compatible with those found in other star-forming regions. By comparing our results with previously reported X-ray observations, we notice that YSOs in Taurus-Auriga follow a Güdel-Benz relation with κ = 0.03, as we previously suggested for other regions of star formation. In general, YSOs in Taurus-Auriga and in all the previous studied regions seem to follow this relation with a dispersion of ∼1 dex. Finally, we propose that most of the remaining sources are related with extragalactic objects but provide a list of 46 unidentified radio sources whose radio properties are compatible with a YSO nature.

  15. VizieR Online Data Catalog: New young star candidates in Taurus-Auriga (Rebull+, 2011)

    Science.gov (United States)

    Rebull, L. M.; Koenig, X. P.; Padgett, D. L.; Terebey, S.; McGehee, P. M.; Hillenbrand, L. A.; Knapp, G. R.; Leisawitz, D.; Liu, W.; Noriega-Crespo, A.; Ressler, M. E.; Stapelfeldt, K. R.; Fajardo-Acosta, S.; Mainzer, A.

    2011-11-01

    In the context of Rebull et al. (2010ApJS..186..259R), we assembled a substantial multi-wavelength database, spanning Sloan u through Spitzer/MIPS 160um (with some X-rays) for point sources throughout the Taurus region. We use that catalog as the core for our analysis here, updating it with confirmed Taurus members from, e.g., Kenyon et al. (2008hsf1.book..405K) and Luhman et al. (2010ApJS..186..111L) outside of our original Spitzer map. We have also searched SIMBAD (and literature references therein) for known galaxies and other contaminants in this vicinity. Our Taurus Spitzer Survey spanned ~44deg2 (figure 1). WISE data acquisition and reduction are discussed in Wright et al. (2010AJ....140.1868W), Jarrett et al. (2011, ApJ, submitted), and in the Explanatory Supplement to the WISE Preliminary Data Release Products. There are four WISE bands, with central wavelengths at 3.4, 4.6, 12, and 22um, and a spatial resolution of 6" (12" at 22um). (3 data files).

  16. NCBI nr-aa BLAST: CBRC-SARA-01-0585 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0585 ref|NP_001071387.1| hypothetical protein LOC514131 [Bos taurus] r...ef|XP_001254537.1| PREDICTED: hypothetical protein LOC514131 [Bos taurus] dbj|BAF36506.1| p97Bucentaur-2 [Bos tau...rus] gb|AAI49203.1| P97Bucentaur-2 [Bos taurus] NP_001071387.1 4e-12 32% ...

  17. Gene : CBRC-BTAU-01-2917 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available protein-coupled receptor TGR5 [Bos taurus] sp|Q862A9|GPBAR_BOVIN G-protein coupled bile acid receptor 1 dbj|...BAC55234.1| G protein-coupled receptor [Bos taurus] gb|AAI22825.1| G protein-coupled receptor TGR5 [Bos taur...us] 0.0 100% gnl|UG|Bt#S12378054 Bos taurus G protein-coupled receptor TGR5 (TGR5

  18. Length and Straightness of the Tubes for the BOS Prototype Chamber

    CERN Document Server

    Lagouri, T

    1998-01-01

    We have measured length and straightness of 50 tubes of 3.8~m length, after cleaning, wiring and testing from a batch that was used in the construction of the BOS prototype chamber. The specifi ed length (aluminum tube only, without endplug) was 3800~mm with a tolerance of $\\pm$1~mm. We found a mean value of (3805$\\pm$2)~mm with a standard deviation of (0.3$\\pm$0.1)~mm. The measureme nts of the straightness of the 50 BOS MDT tubes gave a mean of the maximum deviation of 150~$\\mu$m for 10 measured points along the tubes at 0$^{\\circ}$, 90$^{\\circ}$, 180$^{\\circ}$ and 270$^{\\circ }$ around the tube diameter and a mean value of all deviations of 20~$\\mu$m with a measuring accuracy of 10~$\\mu$m.

  19. The Use of Eugenol as an Anesthetic in Transportation of With Indian Shrimp (Fenneropenaeus indicus) Post Larvae

    OpenAIRE

    Akbari, Sohrab; Khoshnod, Mohammad J.; Rajaian, Hamid; Afsharnasab, Mohammad

    2010-01-01

    The safe margin of eugenol for sedation of the healthy post larvae (PL) of white Indian shrimp (Fenneropenaeus indicus) was determined by estimating the median lethal concentration of eugenol during 24 hours (24hLC50). Sedation concentration of eugenol was obtained experimentally by considering behavioral factors of PLs such as response to indirect stimuli and changes in water quality parameters. Applying the estimated concentrations of eugenol for 12 hours transportation of PLs, biometric pa...

  20. Pharmacological and biomedical properties of sea anemones Paracondactylis indicus, Paracondactylis sinensis, Heteractis magnificaand Stichodactyla haddonifrom East coast of India

    Institute of Scientific and Technical Information of China (English)

    Bragadeeswaran Subramanian; Thangaraj Sangappellai; Rajiv Chandra Rajak; Balaji Diraviam

    2011-01-01

    Objective:To explore the biomedical and pharmacological activity ofParacondactylis indicus (P. indicus),Paracondactylis sinensis(P. sinensis),Heteractis magnifica (H. magnifica) and Stichodactyla haddoni (S. haddoni).Methods: The live sea anemones were kept inside the glass bowl along with some amount of distilled water in an ice container for15 min. During stress condition, nematocysts released from the tentacles were collected and centrifuged at5 000 rpm for 15 min. The supernatant were collected in separate cleaned beakers for lyophilisation.Results:The protein content of crude extracts was15.2, 28.7, 18.2 and35.4μg/mL. In hemolytic assay, the P. indicus was sensitive (16.842 HT/mg) on chicken blood butP. sinensis was less sensitive (1.114 HT/mg) on chicken and goat blood. WhereasH. magnificaandS. haddoni showed hemolysis (0.879, 0.903 HT/mg and 56.263, 0.451 HT/mg) in chicken and goat blood. In antimicrobial assay, the methanol extract ofP. indicus showed maximum inhibition zone of9.7mm againstS. typhii andP. sinensisshowed9.8 mm againstK. pneumonia in methanol and ethanol extracts. Whereas theH. magnifica andS. haddoni showed maximum of10 mm againstS. typhii, K. pneumonia in methanol and ethanol extracts.Conclusions: The high toxic sea anemones may also contain some biologically active agents which has haemolytic, analgesic and anti-infilamatory activity.

  1. Bosreservaat Bos Ter Rijst (Heikruis): basisrapport:situering, standplaats, historiek en onderzoek

    OpenAIRE

    Baeté, Hans; Christiaens, Bart; De Keersmaeker, Luc; Esprit, Marc; Van de Kerckhove, Peter; Vandekerkhove, Kris; Walleyn, Ruben

    2006-01-01

    This report is a reference report linked to the monitoring of forest reserve Bos Ter Rijst in Heikruis/Hautecroix near Edingen/Enghien in central Belgium (bilingual region across a linguistic, regional and provincial frontier). It covers various topics:administrative situation and protective status of the reserveits location, soil characteristics and habitatshistorical ecology of the seignory Ter Rijst/Risoir, Ter Rijst/Risoir Wood and the Strijdhout/Strihoux Forestthe reserve's management hi...

  2. Collection, analysis and cryopreservation of semen from Malayan gaur (Bos gaurus hubbacki): A preliminary study

    OpenAIRE

    M.S. Khairiah; I. Zawawi; H. Wahid; Hajarian, H.; Fahrul, F.J.; M.D. Hafiz; Hafiz, M.M.; Z.F. Ann; M.I. Iswadi; O.A. Mazni

    2012-01-01

    The Malayan gaur (Bos gaurus hubbacki) or Seladang is classified as vulnerable by the International Union for Conservation of Nature and Natural Resources (IUCN). The Malayan gaur is mainly distributed in the tropical woodlands of Peninsular Malaysia and Southern Thailand. The aim of this study was to collect, analyze and cryopreserve the semen of wild Malayan gaur. Transrectal massage (TM) and electroejaculation (EEJ) technique was applied in semen collection of the Malayan gaur. The semen w...

  3. Magnetic Resonance Imaging of the Normal Stifle Joint in Buffaloes (Bos Bubalis): An Anatomic Study

    OpenAIRE

    Moustafa Samy Sherif; Mohammed Attia; Hatem Bahgaat; Ahmed Kassab

    2014-01-01

    The aim of the present study was to describe the normal anatomy of the stifle joint in buffaloes (Bos bubalis) on magnetic resonance images and related anatomical sectional slices to facilitate the interpretation of all these images, as well as to understand the basis for diseases diagnosis. The hind limbs of ten healthy adult buffaloes (Twenty stifle joints) were used. After slaughtering, MR images were made in sagittal, transverse, and dorsal planes. The limbs then were frozen at -20° then ...

  4. A high dynamic radiation measurements instrument: the Bolometric Oscillation Sensor (BOS)

    OpenAIRE

    Zhu, P.; Ruymbeke, M. Van; Ö. Karatekin; J.-P. Noël; Thuillier, G.; S. Dewitte; Chevalier, A.; C. Conscience; Janssen, E.; M. Meftah; Irbah, A.

    2014-01-01

    The bolometric oscillation sensor (BOS) is a broadband radiation measurement instrument onboard the PICARD satellite that has been active between 2010 and 2014. The main detector is a thermistor attached black coated surface, which was permanently exposed to space without any optical and aperture accessories. The temperature measurements are used within a transfer function to determine variations in incoming solar irradiance as well as the terrestrial radi...

  5. A high dynamic radiation measurements instrument : the Bolometric Oscillation Sensor (BOS)

    OpenAIRE

    Zhu, P.; Ruymbeke, M. Van; Karatekin, Ö.; Noël, J.-P.; Thuillier, G.; S. Dewitte; Chevalier, A.; C. Conscience; Janssen, E.; M. Meftah; Irbah, A.

    2015-01-01

    The Bolometric Oscillation Sensor (BOS) is a broadband radiation measurement instrument onboard the PICARD satellite that was active between 2010 and 2014. The main detector is a thermistor attached black coated surface, which was permanently exposed to space without any optical and aperture accessories. The temperature measurements are used within a transfer function to determine variations in incoming solar irradiance as well as the terrestrial radiation. In the present ar...

  6. Polycyclic aromatic hydrocarbon degradation by the white rot fungus Bjerkandera sp. strain BOS55.

    OpenAIRE

    Kotterman, M.J.J.

    1998-01-01

    Outline of this thesisIn this thesis the conditions for optimal PAH oxidation by the white rot fungus Bjerkandera sp. strain BOS55 were evaluated. In Chapter 2, culture conditions like aeration and cosubstrate concentrations, which influenced the oxidation of the PAH compound anthracene and the ligninolytic indicator dye Poly R-478 by the white rot fungus, were studied. Two parameters were identified as the most important PAH oxidation rate-limiting factors: the hydrogen peroxide production r...

  7. Influence of Type of Electric Bright Light on the Attraction of the African Giant Water Bug, Lethocerus indicus (Hemiptera: Belostomatidae

    Directory of Open Access Journals (Sweden)

    Luke Chinaru Nwosu

    2012-01-01

    Full Text Available This study investigated the influence of type of electric bright light (produced by fluorescent light tube and incandescent light bulb on the attraction of the African giant water bug, Lethocerus indicus (Hemiptera: Belostomatidae. Four fluorescent light tubes of 15 watts each, producing white-coloured light and four incandescent light bulbs of 60 watts each, producing yellow-coloured light, but both producing the same amount of light, were varied and used for the experiments. Collections of bugs at experimental house were done at night between the hours of 8.30 pm and 12 mid-night on daily basis for a period of four months per experiment in the years 2008 and 2009. Lethocerus indicus whose presence in any environment has certain implications was the predominant belostomatid bug in the area. Use of incandescent light bulbs in 2009 significantly attracted more Lethocerus indicus 103 (74.6% than use of fluorescent light tubes 35 (25.41% in 2008 [4.92=0.0001]. However, bug’s attraction to light source was not found sex dependent [>0.05; (>0.18=0.4286 and >0.28=0.3897]. Therefore, this study recommends the use of fluorescent light by households, campgrounds, and other recreational centres that are potentially exposed to the nuisance of the giant water bugs. Otherwise, incandescent light bulbs should be used when it is desired to attract the presence of these aquatic bugs either for food or scientific studies.

  8. Application of background-oriented schlieren (BOS) technique to a laser-induced underwater shock wave

    CERN Document Server

    Yamamoto, Shota; Kameda, Masaharu

    2015-01-01

    We build an ultra-high-speed imaging system based on the background-oriented schlieren (BOS) technique in order to capture a laser-induced underwater shock wave. This BOS technique is able to provide two-dimensional density-gradient field of fluid and requires a simple setup. The imaging system consists of an ultra-high speed video camera, a laser stroboscope, and a patterned background. This system takes images every 0.2 $\\mu$s. Furthermore, since the density change of water disturbed by the shock is exceedingly small, the system has high spatial resolution $\\sim$ 10 $\\mu$m/pixel. Using this BOS system, we examine temporal position of a shock wave. The position agrees well with that measured by conventional shadowgraph, which indicates that the high-speed imaging system can successfully capture the instantaneous position of the underwater shock wave that propagates with the speed of about 1500 m/s. The local density gradient can be determined up to $O$(10$^3$ kg/m$^4$), which is confirmed by the gradient est...

  9. NCBI nr-aa BLAST: CBRC-FCAT-01-0063 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-0063 ref|NP_001015581.1| chemokine binding protein 2 [Bos taurus] gb|A...AX46341.1| chemokine binding protein 2 [Bos taurus] gb|AAX46675.1| chemokine binding protein 2 [Bos taurus] NP_001015581.1 2e-49 86% ...

  10. NCBI nr-aa BLAST: CBRC-OANA-01-0052 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-0052 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-113 62% ...

  11. NCBI nr-aa BLAST: CBRC-CFAM-37-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-37-0004 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-173 82% ...

  12. NCBI nr-aa BLAST: CBRC-HSAP-03-0018 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-03-0018 ref|NP_001015581.1| chemokine binding protein 2 [Bos taurus] gb|A...AX46341.1| chemokine binding protein 2 [Bos taurus] gb|AAX46675.1| chemokine binding protein 2 [Bos taurus] NP_001015581.1 1e-169 79% ...

  13. NCBI nr-aa BLAST: CBRC-MMUS-01-0025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-01-0025 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-145 71% ...

  14. NCBI nr-aa BLAST: CBRC-MDOM-07-0080 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-07-0080 ref|NP_001094755.1| interleukin 8 receptor beta [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-148 71% ...

  15. NCBI nr-aa BLAST: CBRC-MMUR-01-0053 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0053 ref|NP_001094755.1| interleukin 8 receptor beta [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 6e-33 72% ...

  16. NCBI nr-aa BLAST: CBRC-OCUN-01-1390 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-1390 ref|NP_001015581.1| chemokine binding protein 2 [Bos taurus] gb|A...AX46341.1| chemokine binding protein 2 [Bos taurus] gb|AAX46675.1| chemokine binding protein 2 [Bos taurus] NP_001015581.1 6e-88 76% ...

  17. NCBI nr-aa BLAST: CBRC-PCAP-01-1467 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1467 ref|NP_001069804.1| solute carrier family 16, member 7 [Bos tauru...s] gb|ABD39318.1| monocarboxylate transporter 2 [Bos taurus] gb|AAI40525.1| SLC16A7 protein [Bos taurus] NP_001069804.1 1e-117 81% ...

  18. NCBI nr-aa BLAST: CBRC-ETEL-01-1472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-1472 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-121 76% ...

  19. NCBI nr-aa BLAST: CBRC-MEUG-01-2178 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2178 ref|NP_001071415.1| G protein-coupled receptor 77 [Bos taurus] gb...|AAI23494.1| G protein-coupled receptor 77 [Bos taurus] gb|ABI98946.1| C5L2 [Bos taurus] NP_001071415.1 1e-61 57% ...

  20. NCBI nr-aa BLAST: CBRC-TSYR-01-1334 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1334 ref|NP_001069804.1| solute carrier family 16, member 7 [Bos tauru...s] gb|ABD39318.1| monocarboxylate transporter 2 [Bos taurus] gb|AAI40525.1| SLC16A7 protein [Bos taurus] NP_001069804.1 1e-134 79% ...

  1. NCBI nr-aa BLAST: CBRC-ACAR-01-0816 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0816 ref|NP_001069804.1| solute carrier family 16, member 7 [Bos tauru...s] gb|ABD39318.1| monocarboxylate transporter 2 [Bos taurus] gb|AAI40525.1| SLC16A7 protein [Bos taurus] NP_001069804.1 1e-125 79% ...

  2. NCBI nr-aa BLAST: CBRC-ACAR-01-0732 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0732 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-113 59% ...

  3. NCBI nr-aa BLAST: CBRC-MLUC-01-0338 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0338 ref|NP_001071415.1| G protein-coupled receptor 77 [Bos taurus] gb...|AAI23494.1| G protein-coupled receptor 77 [Bos taurus] gb|ABI98946.1| C5L2 [Bos taurus] NP_001071415.1 1e-124 68% ...

  4. NCBI nr-aa BLAST: CBRC-MEUG-01-2252 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2252 ref|NP_001094755.1| interleukin 8 receptor beta [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 4e-70 71% ...

  5. A search for companions to brown dwarfs in the Taurus and Chamaeleon star-forming regions

    Energy Technology Data Exchange (ETDEWEB)

    Todorov, K. O.; Luhman, K. L. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Konopacky, Q. M. [Lawrence Livermore National Laboratory, 7000 East Avenue, Livermore, CA 94550 (United States); McLeod, K. K. [Whitin Observatory, Wellesley College, Wellesley, MA 02481 (United States); Apai, D.; Pascucci, I. [Department of Astronomy, University of Arizona, 933 N. Cherry Avenue, Tucson, AZ 85721 (United States); Ghez, A. M. [Division of Astronomy and Astrophysics, University of California, Los Angeles, CA 90095 (United States); Robberto, M., E-mail: todorovk@phys.ethz.ch [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States)

    2014-06-10

    We have used WFPC2 on board the Hubble Space Telescope to obtain images of 47 members of the Taurus and Chamaeleon I star-forming regions that have spectral types of M6-L0 (M ∼ 0.01-0.1 M {sub ☉}). An additional late-type member of Taurus, FU Tau (M7.25+M9.25), was also observed with adaptive optics at Keck Observatory. In these images, we have identified promising candidate companions to 2MASS J04414489+2301513 (ρ = 0.''105/15 AU), 2MASS J04221332+1934392 (ρ = 0.''05/7 AU), and ISO 217 (ρ = 0.''03/5 AU). We reported the first candidate in a previous study, showing that it has a similar proper motion as the primary in images from WFPC2 and Gemini adaptive optics. We have collected an additional epoch of data with Gemini that further supports that result. By combining our survey with previous high-resolution imaging in Taurus, Chamaeleon I, and Upper Sco (τ ∼ 10 Myr), we measure binary fractions of 14/93 = 0.15{sub −0.03}{sup +0.05} for M4-M6 (M ∼ 0.1-0.3 M {sub ☉}) and 4/108 = 0.04{sub −0.01}{sup +0.03} for >M6 (M ≲ 0.1 M {sub ☉}) at separations of >10 AU. Given the youth and low density of these regions, the lower binary fraction at later types is probably primordial rather than due to dynamical interactions among association members. The widest low-mass binaries (>100 AU) also appear to be more common in Taurus and Chamaeleon I than in the field, which suggests that the widest low-mass binaries are disrupted by dynamical interactions at >10 Myr, or that field brown dwarfs have been born predominantly in denser clusters where wide systems are disrupted or inhibited from forming.

  6. Cambrian small shelly fossils from the Çal Tepe Formation, Taurus Mountains, Turkey

    OpenAIRE

    Sarmiento, Graciela N.; Fernández Remolar, David Carlos; Göncüoglu, M. Cemal

    2001-01-01

    [EN] Lower and Middle Cambrian carbonate rocks of the Çal Tepe Formation, cropping out in the western Taurus Mountains, yielded a large number of microfossil remains. Small shelly fossils from a single level in the upper Lower Cambrian represent a high diversity biota that could be related to the «Cambrian explosion». Microfossil association from the lower Middle Cambrian sediments of the Çal Tepe Formation is taxonomically very reduced and a dominant taxon is Hadimopanella GEDIK. Th...

  7. Cambrian small shelly fossils from the Çal Tepe Formation, Taurus Mountains, Turkey

    OpenAIRE

    Sarmiento, Graciela; Fernández Remolar, David Carlos; Göncüoglu, M. Cemal

    2001-01-01

    Lower and Middle Cambrian carbonate rocks of the Çal Tepe Formation, cropping out in the western Taurus Mountains, yielded a large number of microfossil remains. Small shelly fossils from a single level in the upper Lower Cambrian represent a high diversity biota that could be related to the «Cambrian explosion». Microfossil association from the lower Middle Cambrian sediments of the Çal Tepe Formation is taxonomically very reduced and a dominant taxon is Hadimopanella GEDIK. This sudden chan...

  8. VLBA determination of the distance to nearby star-forming regions II. Hubble 4 and HDE 283572 in Taurus

    CERN Document Server

    Torres, Rosa M; Mioduszewski, Amy J; Rodriguez, Luis F

    2007-01-01

    The non-thermal 3.6 cm radio continuum emission from the naked T Tauri stars Hubble 4 and HDE 283572 in Taurus has been observed with the Very Long Baseline Array (VLBA) at 6 epochs between September 2004 and December 2005 with a typical separation between successive observations of 3 months. Thanks to the remarkably accurate astrometry delivered by the VLBA, the trajectory described by both stars on the plane of the sky could be traced very precisely, and modeled as the superposition of their trigonometric parallax and uniform proper motion. The best fits yield distances to Hubble 4 and HDE 283572 of 132.8 +/- 0.5 and 128.5 +/- 0.6 pc, respectively. Combining these results with the other two existing VLBI distance determinations in Taurus, we estimate the mean distance to the Taurus association to be 137 pc with a dispersion (most probably reflecting the depth of the complex) of about 20 pc.

  9. Massive gene acquisitions in Mycobacterium indicus pranii provide a perspective on mycobacterial evolution.

    Science.gov (United States)

    Saini, Vikram; Raghuvanshi, Saurabh; Khurana, Jitendra P; Ahmed, Niyaz; Hasnain, Seyed E; Tyagi, Akhilesh K; Tyagi, Anil K

    2012-11-01

    Understanding the evolutionary and genomic mechanisms responsible for turning the soil-derived saprophytic mycobacteria into lethal intracellular pathogens is a critical step towards the development of strategies for the control of mycobacterial diseases. In this context, Mycobacterium indicus pranii (MIP) is of specific interest because of its unique immunological and evolutionary significance. Evolutionarily, it is the progenitor of opportunistic pathogens belonging to M. avium complex and is endowed with features that place it between saprophytic and pathogenic species. Herein, we have sequenced the complete MIP genome to understand its unique life style, basis of immunomodulation and habitat diversification in mycobacteria. As a case of massive gene acquisitions, 50.5% of MIP open reading frames (ORFs) are laterally acquired. We show, for the first time for Mycobacterium, that MIP genome has mosaic architecture. These gene acquisitions have led to the enrichment of selected gene families critical to MIP physiology. Comparative genomic analysis indicates a higher antigenic potential of MIP imparting it a unique ability for immunomodulation. Besides, it also suggests an important role of genomic fluidity in habitat diversification within mycobacteria and provides a unique view of evolutionary divergence and putative bottlenecks that might have eventually led to intracellular survival and pathogenic attributes in mycobacteria. PMID:22965120

  10. Assessment of antimicrobial activity of c-type lysozyme from Indian shrimp Fenneropenaeus indicus

    Directory of Open Access Journals (Sweden)

    Viswanathan Karthik

    2014-10-01

    Full Text Available Objective: To assess the multitudinal antimicrobial effects of recombinant lysozyme from Fenneropenaeus indicus (rFi-Lyz in comparison with commercially available recombinant hen egg white lysozyme (rHEWL. Methods: Antimicrobial activity of the recombinant rFi-Lyz using several Gram positive, Gram negative bacteria and fungi in comparison with rHEWL has been evaluated. rFi-Lyz was expressed and purified using Ni2+ affinity chromatography. The effect of rFi-Lyz in the growth of yeast Candida krusei, plant molds Rhizoctonia solani and Fusarium solani was assessed by well diffusion assay in petri plates with potato dextrose agar. Results: rFi-Lyz exhibited high inhibitory activity on Gram positive bacteria such as Staphylococcus aureus and Bacillus subtilis. Among various Gram negative bacteria tested Klebsiella pneumoniae exhibited the highest inhibition followed by Pseudomonas aeruginosa and Shigella dysenteriae. rFi-Lyz also exhibited significant inhibition on two marine pathogens Aeromonas veronii and Vibrio alginolyticus. Among the various fungal strains tested, rFi-Lyz inhibited the growth of budding yeast Candida krusei significantly. Further the growth of two other plants fungus Rhizoctonia solani and Fusarium oxysporum were retarded by rFi-Lyz in the plate inhibition assay. Conclusions: rFi-Lyz exhibits a broad spectrum of antimicrobial activity like a natural antibiotic on various pathogenic bacteria and fungal strains.

  11. Assessment of antimicrobial activity of c-type lysozyme from Indian shrimp Fenneropenaeus indicus

    Institute of Scientific and Technical Information of China (English)

    Viswanathan Karthik; Thomas Ancy; Dharmaraj Ramkumar; Narayanasamy Mathivanan; Rangarajan Badri Narayanan

    2014-01-01

    Objective: To assess the multitudinal antimicrobial effects of recombinant lysozyme fromFenneropenaeus indicus (rFi-Lyz) in comparison with commercially available recombinant hen egg white lysozyme (rHEWL).Methods:Antimicrobial activity of the recombinant rFi-Lyz using several Gram positive, Gram negative bacteria and fungi in comparison with rHEWL has been evaluated. rFi-Lyz was expressed and purified using Ni2+ affinity chromatography. The effect of rFi-Lyz in the growth of yeast Candida krusei, plant molds Rhizoctonia solani and Fusarium solani was assessed by well diffusion assay in petri plates with potato dextrose agar.Results: rFi-Lyz exhibited high inhibitory activity on Gram positive bacteria such as Staphylococcus aureus and Bacillus subtilis. Among various Gram negative bacteria testedKlebsiella pneumoniae exhibited the highest inhibition followed by Pseudomonas aeruginosa and Shigella dysenteriae. rFi-Lyz also exhibited significant inhibition on two marine pathogens Aeromonas veronii and Vibrio alginolyticus. Among the various fungal strains tested, rFi-Lyz inhibited the growth of budding yeast Candida krusei significantly. Further the growth of two other plants fungus Rhizoctonia solani and Fusarium oxysporum were retarded by rFi-Lyz in the plate inhibition assay.Conclusions: rFi-Lyz exhibits a broad spectrum of antimicrobial activity like a natural antibiotic on various pathogenic bacteria and fungal strains.

  12. The trans-Himalayan flights of bar-headed geese (Anser indicus)

    Science.gov (United States)

    Hawkes, L.A.; Balachandran, S.; Batbayar, N.; Butler, P.J.; Frappell, P.B.; Milsom, W.K.; Tseveenmyadag, N.; Newman, S.H.; Scott, G.R.; Sathiyaselvam, P.; Takekawa, J.Y.; Wikelski, M.; Bishop, C.M.

    2011-01-01

    Birds that fly over mountain barriers must be capable of meeting the increased energetic cost of climbing in low-density air, even though less oxygen may be available to support their metabolism. This challenge is magnified by the reduction in maximum sustained climbing rates in large birds. Bar-headed geese (Anser indicus) make one of the highest and most iconic transmountain migrations in the world. We show that those populations of geese that winter at sea level in India are capable of passing over the Himalayas in 1 d, typically climbing between 4,000 and 6,000min 7-8 h. Surprisingly, these birds do not rely on the assistance of upslope tailwinds that usually occur during the day and can support minimum climb rates of 0.8-2.2 km??h-1, even in the relative stillness of the night. They appear to strategically avoid higher speed winds during the afternoon, thus maximizing safety and control during flight. It would seem, therefore, that bar-headed geese are capable of sustained climbing flight over the passes of the Himalaya under their own aerobic power.

  13. Hemidesmus indicus and Hibiscus rosa-sinensis Affect Ischemia Reperfusion Injury in Isolated Rat Hearts

    Directory of Open Access Journals (Sweden)

    Vinoth Kumar Megraj Khandelwal

    2011-01-01

    Full Text Available Hemidesmus indicus (L. R. Br. (HI and Hibiscus rosa-sinensis L. (HRS are widely used traditional medicine. We investigated cardioprotective effects of these plants applied for 15 min at concentrations of 90, 180, and 360 μg/mL in Langendorff-perfused rat hearts prior to 25-min global ischemia/120-min reperfusion (I/R. Functional recovery (left ventricular developed pressure—LVDP, and rate of development of pressure, reperfusion arrhythmias, and infarct size (TTC staining served as the endpoints. A transient increase in LVDP (32%–75% occurred at all concentrations of HI, while coronary flow (CF was significantly increased after HI 180 and 360. Only a moderate increase in LVDP (21% and 55% and a tendency to increase CF was observed at HRS 180 and 360. HI and HRS at 180 and 360 significantly improved postischemic recovery of LVDP. Both the drugs dose-dependently reduced the numbers of ectopic beats and duration of ventricular tachycardia. The size of infarction was significantly decreased by HI 360, while HRS significantly reduced the infarct size at all concentrations in a dose-dependent manner. Thus, it can be concluded that HI might cause vasodilation, positive inotropic effect, and cardioprotection, while HRS might cause these effects at higher concentrations. However, further study is needed to elucidate the exact mechanism of their actions.

  14. A Search for Companions to Brown Dwarfs in the Taurus and Chamaeleon Star Forming Regions

    CERN Document Server

    Todorov, K O; Konopacky, Q M; McLeod, K K; Apai, D; Ghez, A M; Pascucci, I; Robberto, M

    2014-01-01

    We present the results of a search for companions to young brown dwarfs in the Taurus and Chamaeleon I star forming regions (1/2-3 Myr). We have used WFPC2 on board HST to obtain F791W and F850LP images of 47 members of these regions that have spectral types of M6-L0 (0.01-0.1 Msun). An additional late-type member of Taurus, FU Tau (M7.25+M9.25), was also observed with adaptive optics at Keck Observatory. We have applied PSF subtraction to the primaries and have searched the resulting images for objects that have colors and magnitudes that are indicative of young low-mass objects. Through this process, we have identified promising candidate companions to 2MASS J04414489+2301513 (rho=0.105"/15 AU), 2MASS J04221332+1934392 (rho=0.05"/7 AU), and ISO 217 (rho=0.03"/5 AU). We reported the discovery of the first candidate in a previous study, showing that it has a similar proper motion as the primary through a comparison of astrometry measured with WFPC2 and Gemini adaptive optics. We have collected an additional e...

  15. A survey of T Tauri stars with AKARI toward the Taurus-Auriga region

    CERN Document Server

    Takita, Satoshi; Kitamura, Yoshimi; Ishihara, Daisuke; Ita, Yoshifusa; Oyabu, Shinki; Ueno, Munetaka

    2010-01-01

    Aims: We search new T Tauri star (TTS) candidates with the mid-infrared (MIR) part of the AKARI All-Sky Survey at 9 and 18 um wavelengths. Methods: We used the point source catalogue (PSC), obtained by the Infrared Camera (IRC) on board AKARI. We combined the 2MASS PSC and the 3rd version of the USNO CCD Astrograph Catalogue (UCAC) with the AKARI IRC-PSC, and surveyed 517 known TTSs over a 1800-square-degree part of the Taurus-Auriga region to find criteria to extract TTSs. We considered asymptotic giant branch (AGB) stars, post-AGB stars, Planetary Nebulae (PNe), and galaxies, which have similar MIR colours, to separate TTSs from these sources. Results: Of the 517 known TTSs, we detected 133 sources with AKARI. Based on the colour-colour and colour-magnitude diagrams made from the AKARI, 2MASS, and UCAC surveys, we propose the criteria to extract TTS candidates from the AKARI All-Sky data. On the basis of our criteria, we selected 176/14725 AKARI sources as TTS candidates which are located around the Taurus-...

  16. VizieR Online Data Catalog: Outflows and bubbles in Taurus (Li+, 2015)

    Science.gov (United States)

    Li, H.; Li, D.; Qian, L.; Xu, D.; Goldsmith, P. F.; Noriega-Crespo, A.; Wu, Y.; Song, Y.; Nan, R.

    2015-11-01

    In our study, we used the 12CO(1-0) and 13CO(1-0 with the 13.7m FCRAO telescope. The FCRAO CO survey was taken between 2003 and 2005. The FWHM beam width is 45" for 12CO and 47" for 13CO. The MIPS maps were created as part of the final products from the Spitzer Legacy Taurus I and II surveys (Padgett et al. 2007AAS...211.1206P). The data were obtained in fast scan mode in three bands, 24, 70, and 160um, over an area of 44deg2. The observations were performed in three epochs between 2005 and 2007, with integration times of 30s (24um) and 15s (70 and 160um). We also adopted the up-to-date catalog of Spitzer YSOs where 215 YSOs and 140 new YSO candidates in Taurus are reported (Rebull et al. 2010, J/ApJS/186/259). (3 data files).

  17. Striations in the Taurus molecular cloud: Kelvin-Helmholtz instability or MHD waves?

    CERN Document Server

    Heyer, M; Yildiz, U A; Snell, R L; Falgarone, E; Pineda, J

    2016-01-01

    The origin of striations aligned along the local magnetic field direction in the translucent envelope of the Taurus molecular cloud is examined with new observations of 12CO and 13CO J=2-1 emission obtained with the 10~m submillimeter telescope of the Arizona Radio Observatory. These data identify a periodic pattern of excess blue and redshifted emission that is responsible for the striations. For both 12CO and 13CO, spatial variations of the J=2-1 to J=1-0 line ratio are small and are not spatially correlated with the striation locations. A medium comprised of unresolved CO emitting substructures (cells) with a beam area filling factor less than unity at any velocity is required to explain the average line ratios and brightness temperatures. We propose that the striations result from the modulation of velocities and the beam filling factor of the cells as a result of either the Kelvin-Helmholtz instability or magnetosonic waves propagating through the envelope of the Taurus molecular cloud. Both processes ar...

  18. Isolation and partial purification of antimicrobial peptides/proteins from dung beetle, Onthophagus taurus immune hemolymph

    International Nuclear Information System (INIS)

    Antimicrobial peptides are important in the first line of the host defense system of all insect species. In the present study antimicrobial peptide(s) were isolated from the hemolymph of the dung beetle Onthophagus taurus. Both non induced and immune induced hemolymphs were tested for their antimicrobial activity against different bacterial strains and C. albicans. Induction was done by injecting E. coli into the abdominal cavity of the O. taurus. The non induced hemolymph did not show activity against any of the tested fungal and bacterial strains where as induced hemolymph showed activity against all tested bacterial strains but no activity against C. albicans. The induced hemolymph was subjected to non reducing SDS-PAGE and UV wavelength scan was performed to detect the presence of peptides. The immune induced hemolymph was purified by gel filtration chromatography to separate the proteins responsible for the antibacterial activity. The fractions within the peak were tested against those bacteria which previously showed sensitivity to the crude immune induced hemolymph. All fractions were found to be active against all tested bacteria with difference in zone of inhibition. The peptides are active against prokaryotes and not against eukaryotes. These properties reveal its unique characteristics and therapeutic application. (author)

  19. Applying a one-dimensional PDR model to the Taurus molecular cloud and its atomic envelope

    CERN Document Server

    Heiner, J S

    2012-01-01

    In this contribution, we test our previously published one-dimensional PDR model for deriving total hydrogen volume densities from HI column density measurements in extragalactic regions by applying it to the Taurus molecular cloud, where its predictions can be compared to available data. Also, we make the first direct detailed comparison of our model to CO(1-0) and far-infrared emission. Using an incident UV flux G0 of 4.25 ({\\chi} = 5) throughout the main body of the cloud, we derive total hydrogen volume densities of \\approx 430 cm-3, consistent with the extensive literature available on Taurus. The distribution of the volume densities shows a log-normal shape with a hint of a power-law shape on the high density end. We convert our volume densities to H2 column densities assuming a cloud depth of 5 parsec and compare these column densities to observed CO emission. We find a slope equivalent to a CO conversion factor relation that is on the low end of reported values for this factor in the literature (0.9 x...

  20. ISOLATION AND PARTIAL PURIFICATION OF ANTIMICROBIAL PEPTIDES/PROTEINS FROM DUNG BEETLE, ONTHOPHAGUS TAURUS IMMUNE HEMOLYMPH

    Directory of Open Access Journals (Sweden)

    Vasanth Patil H.B

    2013-06-01

    Full Text Available Antimicrobial peptides are important in the first line of the host defense system of all insect species. In the present study antimicrobial peptide(s were isolated from the hemolymph of the dung beetle Onthophagus taurus. Both non induced and immune induced hemolymphs were tested for their antimicrobial activity against different bacterial strains and C. albicans. Induction was done by injecting E. coli into the abdominal cavity of the O. taurus. The non induced hemolymph did not show activity against any of the tested fungal and bacterial strains where as induced hemolymph showed activity against all tested bacterial strains but no activity against C. albicans. The induced hemolymph was subjected to non reducing SDS-PAGE and UV wavelength scan was performed to detect the presence of peptides. The immune induced hemolymph was purified by gel filtration chromatography to separate the proteins responsible for the antibacterial activity. The fractions within the peak were tested against those bacteria which previously showed sensitivity to the crude immune induced hemolymph. All fractions were found to be active against all tested bacteria with difference in zone of inhibition. The peptides are active against prokaryotes & not against eukaryotes. These properties reveal its unique characteristics and therapeutic application.

  1. The XMM-Newton Extended Survey of the Taurus Molecular Cloud (XEST)

    CERN Document Server

    Güdel, M; Arzner, K; Audard, M; Bouvier, J; Feigelson, E D; Franciosini, E; Glauser, A; Grosso, N; Micela, G; Monin, J L; Montmerle, T; Padgett, D L; Palla, F; Pillitteri, I; Rebull, L M; Scelsi, L; Silva, B; Skinner, S L; Stelzer, B; Telleschi, A

    2006-01-01

    (abridged:) The XMM-Newton Extended Survey of the Taurus Molecular Cloud (XEST) surveys the most populated ~5 square degrees of the Taurus star formation region, using the XMM-Newton X-ray observatory to study the thermal structure, variability, and long-term evolution of hot plasma, to investigate the magnetic dynamo, and to search for new potential members of the association. Many targets are also studied in the optical, and high-resolution X-ray grating spectroscopy has been obtained for selected bright sources. The X-ray spectra have been coherently analyzed with two different thermal models (2-component thermal model, and a continuous emission measure distribution model). We present overall correlations with fundamental stellar parameters that were derived from the previous literature. A few detections from Chandra observations have been added. The present overview paper introduces the project and provides the basic results from the X-ray analysis of all sources detected in the XEST survey.Comprehensive ...

  2. Fatores etários no leucograma de fêmeas zebuínas sadias da raça Nelore (Bos indicus Influence of age on the leukogram values for healthy Nelore (Zebu cattle

    Directory of Open Access Journals (Sweden)

    Joselito Nunes Costa

    2000-06-01

    Full Text Available Para avaliar-se a influência dos fatores etários sobre o leucograma de fêmeas zebuínas da raça Nelore, examinaram-se amostras de sangue de 158 animais, distribuídos por sete grupos etários ( até 3 meses; 3 a 6 meses; 6 a 12 meses; 12 a 24 meses; 24 a 48 meses; 48 a 72 meses e maior que 72 meses. Os resultados expressos em valores médios (± desvios padrões máximo (máx. e mínimo (mín. em milhares de células por mm³ para os diferentes componentes do leucograma foram os seguintes: leucócitos total máx. - 16992 ± 4104 ( 6 a 12 meses e min. -10353 ± 2397 (48 a 72 meses ; neutrófilos total máx. - 3931 ± 1578 (até 3 meses e min. - 2416 ± 1118 ( 6 a 12 meses ; eosinófilos máx. - 999 ± 499 (24 a 48 meses e min. - 265 ± 276 ( 3 a 6 meses ; basófilos máx. - 67 ± 88 (> 72 meses e min. - 39 ± 78 (6 a 12 meses; linfócitos típicos máx. - 12758 ± 3608 (6 a 12 meses e min. - 5906 ± 1883 (48 a 72 meses; linfócitos atípicos máx. - 1310 ± 603 (3 a 6 meses e min. - 760 ± 419 ( 48 a 72 meses ; linfócitos total máx. - 14079 ± 4027 (6 a 12 meses e min. - 6666 ± 2059 ( 48 a 72 meses ; monócitos máx. -27 ± 62 ( até 3 meses e min.- 0 ( 6 a 12 meses. A existência de diferenças (p > 0,05 entre grupos demonstrando diminuição dos neutrófilos e aumento dos linfócitos no primeiro ano de vida; a diminuição dos valores do total de leucócitos a partir de um ano de idade, como reflexo de comportamento similar dos números de linfócitos (típicos e atípicos e o aumento dos eosinófilos entre 24 e 48 meses de vida, caracterizaram a influência dos fatores etários sobre a variação dos valores dos componentes do leucograma de fêmeas zebuínas da raça Nelore criadas em São Paulo - Brasil.In order to evaluate the influence of the age on the white blood cell counts of Nelore (Zebu cattle, 158 blood samples from seven groups of different ages (group I-up to three months; group II-three to six months; group III-six to 12 months; group IV-12 to 24 months; group V-24 to 48 months; group VI-48 to 72 months and group VII-older than 72 months were studied. The highest and lowest mean values observed were total white blood cell/mm³-16992±4104 (group III and 10353±2397 (group VI; neutrophils/mm³-3931±1578 (group I and 2416 ±1118 (group III; eosinophils/ mm³-999±499 (group V and 265±276 (group II; basophils/mm³-67±88 (group VII and 39±78 (group III; typical lymphocytes/ mm³-12758±3608 (group III and 5906±1883 (group VI; atypical lymphocytes/ mm³-1310±603 (group II and 760±419 (group VI ; lymphocytes total/ mm³-14079±4027 (group III and 6666±2059 (group VI; monocytes/mm³-27±62 (group I and 0 (group III. The differences (p>0.05 observed among the groups in relation to total white blood cell, lymphocytes, neutrophils and eosinophils can be related to the influence of the age on leukogram of Nelore (Zebu cattle raised in São Paulo- Brazil.

  3. Effects of equine chorionic gonadotrophin on follicular, luteal and conceptus development of non-lactating Bos indicus beef cows subjected to a progesterone plus estradiol-based timed artificial insemination protocol

    Directory of Open Access Journals (Sweden)

    Paulo Pitaluga Costa e Silva Filho

    2013-08-01

    Full Text Available The aim of this study was to evaluate the effects of equine chorionic gonadotropin (eCG on ovarian follicular responses, corpus luteum (CL development and conceptus length on day 16 after timed artificial insemination (TAI. A total of 124 cows at day 0 (D0 received 2 mg of estradiol benzoate (EB and the insertion of a progesterone (P4 intravaginal device. Eight days later, the device was removed, and cows received 0.15 mg of prostaglandin and 0.5 mg of estradiol cypionate (EC, and were randomly assigned to 1 of 2 treatments: eCG (n=60, in which cows received 300 U of eCG; and control (n=64. Cows were TAI 48 h after P4 device removal. The diameter of the largest follicle (LF present on D8 and D10 and of CL on D15 and D26 were measured. Conceptus recovered rate, conceptus length, CL diameter and weight were determined at slaughter on D26. Plasma P4 concentration was determined on D15 and D26. Follicular growth from D8 to D10 (P=0.03, the diameter of CL at D15 (P=0.03 and D26 (P=0.003 and the CL weight at day 26 (P=0.04 were greater in the eCG group than the control. However, there was no effect of eCG treatment on oestrus occurrence, conceptus recovery rate and length, or P4 concentrations on either D15 or D26. In conclusion, although eCG increases follicular responses and the diameter of the CL, this gonadotropin treatment does not influence the length of the conceptus or the P4 concentration on the subsequent oestrus cycle.

  4. Whole-genome association study of fatty acid composition in a diverse range of beef cattle breeds.

    Science.gov (United States)

    Kelly, M J; Tume, R K; Fortes, M; Thompson, J M

    2014-05-01

    Fatty acid composition of adipose tissue associated with meat is an important factor for the beef industry because of its implications for human health, processing, meat quality, and palatability. Individual fatty acid composition is a trait under genetic control, so improvement via selective breeding of cattle is possible. The objective of this study was to investigate the genetic architecture of fatty acid composition and identify genes associated with this trait in 3 breed types: Bos indicus (Brahman), Bos taurus (4 breeds), and tropically adapted composites (2 breeds). Using high-density data, regions on chromosomes 1, 9, 14, 16, 19, 23, 26, 29, and X were associated with fat composition and quantity traits. Known candidate genes, such as fatty acid synthase (FASN; chromosome 19) and stearoyl-CoA desaturase (SCD; chromosome 26), were confirmed in our results. Other candidate genes and regions represent novel association results, requiring further validation. PMID:24782392

  5. Modelo matemático aplicado a la curva de lactancia en ganado vacuno dobre propósito

    OpenAIRE

    Botero A, Luz; Vertel, Melba

    2006-01-01

    Objetivo. Seleccionar un modelo matemático para la curva de lactancia de la producción de leche de hembras vacunas. Materiales y métodos. Durante 11 meses, se estudió la producción de leche en 500 novillas doble propósito Bos taurus x Bos indicus, de las sabanas del trópico bajo colombiano. La producción se cuantificó en kilogramos. Se incluyeron los datos de la producción de leche en época (seca-lluviosa) y número de lactancias (primera; segunda y tercera y, más de tres). Los datos hacen par...

  6. MODELO MATEMÁTICO APLICADO A LA CURVA DE LACTANCIA EN GANADO VACUNO DOBLE PROPÓSITO

    OpenAIRE

    Luz Botero; Melba Vertel.

    2006-01-01

    hembras vacunas. Materiales y métodos. Durante 11 meses, se estudió la producción de leche en 500novillas doble propósito Bos taurus x Bos indicus, de las sabanas del trópico bajo colombiano. Laproducción se cuantificó en kilogramos. Se incluyeron los datos de la producción de leche en época(seca-lluviosa) y número de lactancias (primera; segunda y tercera y, más de tres). Los datos hacen partedel archivo de la Ganadería XB, ubicada en las sabanas de Bolívar, Colombia, recopilados desde el añ...

  7. Characterization of a Dairy Gyr herd with respect to its mitochondrial DNA (mt DNA origin

    Directory of Open Access Journals (Sweden)

    Anibal Eugênio Vercesi Filho

    2010-01-01

    Full Text Available The Zebu breeds were introduced in Brazil mainly in the last century by imports from the Indian subcontinent. When the Zebu cattle arrived, the national herd suffered a significative change by backcrossing the national cows of taurine origin with Zebu sires. These processes created a polymorphism in the mitochondrial DNA (mtDNA in the Zebu animals with are in a major part derived from backcrossing and sharing mtDNA of taurine origin. To verify the maternal origin of cows belonging to the Dairy Gyr herd of APTA, Mococa 60 females were analyzed and 33 presented mtDNA from Bos taurus origin and 27 presented mtDNA from Bos indicus origin. None of these animals presented patterns of both mtDNA origins, indicating absence of heteroplasmy for these mitochondrial genotypes.

  8. Calf rearing in the tropics: growth rates and utilisation of milk substitute diets.

    Science.gov (United States)

    Black, D H

    1982-08-01

    Twelve Brahman (Bos indicus) and 36 Holstein (Bos taurus) calves in Trinidad were fed on an amount of milk substitute equivalent to either 10 or 20% of their body weight each day. The diets contained either 10, 20 or 30% added fat. Nutrient balances were studied for 21 days. The liveweight gains of the calves depended on the quantity of milk fed and the breed of calf (Holstein greater than Brahman) but were independent of fat level. The Brahman calves were reluctant to accept milk substitute from a bucket. The digestibility of dry matter, nitrogen and fat was slightly higher for the Holstein than for the Brahman calves but there was little difference between the ME requirements for the 2 breeds. PMID:7123668

  9. The Genetic Diversity and Phylogenetic Status of Luxi Cattle

    Institute of Scientific and Technical Information of China (English)

    MAO Yong-jiang; CHANG Hong; YANG Zhang-ping; XU Ming; ZHANG Liu; CHANG Guo-bin; SONG Wei-tao; WANG Dong-lei

    2006-01-01

    A total of 87 individuals of Luxi cattle from Juanchen and Liangshan counties, Shangdong Province, China, were sampled by simple random sampling in typical colony. Twenty-one blood proteins and enzymes loci were detected by polyacrylamide gel electrophoresis (PAGE) and starch gel electrophoresis (SGE). In the meantime, the data of 7 loci of 13 cattle populations in China and other countries were collected and phylogeny relationships were studied. The results indicated that 9 out of 21 loci showed polymorphism (42.86%); the level of genetic variation in Luxi cattle population was relatively high, the mean heterozygosity was 0.1416. The Luxi cattle have a close phylogenetic relationship with the cattle populations of east and south of Asia, and this further confirmed the fact that Luxi cattle were the cross-breed between the Bos taurus and Bos indicus in China, but it is impossible that yellow cattle contained the blood of of Bali.

  10. Effectiveness of a 95 SNP panel for the screening of breed label fraud in the Chinese meat market.

    Science.gov (United States)

    Rogberg-Muñoz, A; Wei, S; Ripoli, M V; Guo, B L; Carino, M H; Lirón, J P; Prando, A J; Vaca, R J A; Peral-García, P; Wei, Y M; Giovambattista, G

    2016-01-01

    Breed assignment has proved to be useful to control meat trade and protect the value of special productions. Meat-related frauds have been detected in China; therefore, 95 SNPs selected from the ISAG core panel were evaluated to develop an automated and technologically updated tool to screen breed label fraud in the Chinese meat market. A total of 271 animals from four Chinese yellow cattle (CYC) populations, six Bos taurus breeds, two Bos indicus and one composite were used. The allocation test distinguished European, Japanese and Zebu breeds, and two Chinese genetic components. It correctly allocated Japanese Black, Zebu and British breeds in 100, 90 and 89% of samples, respectively. CYC evidenced the Zebu, Holstein and Limousin introgression. The test did not detect CYC components in any of the 25 samples from Argentinean butchers. The method could be useful to certify Angus, Hereford and Japanese Black meat, but a modification in the panel would be needed to differentiate other breeds.

  11. Foot-and-mouth disease virus carrier status in Bos grunniens yaks

    OpenAIRE

    Chang, Huiyun; Ma, Yanbin; Lin, Tong; Cong, Guozheng; Du, Junzheng; Ma, Jinling

    2013-01-01

    Background The carrier status of foot-and-mouth disease virus (FMDV) is complicated, and the role of carrier animals in virus transmission is controversial. To investigate the carrier status of FMDV in animals that live in high altitude, Bos grunniens yaks were infected experimentally with FMDV O/Akesu/58. Results All of the yaks showed clinical signs of foot-and-mouth disease (FMD). Total antibody levels against FMDV measured by liquid-phase blocking enzyme-linked immunosorbent assay (LPB-EL...

  12. A Survey for New Members of the Taurus Star-Forming Region with the Sloan Digital Sky Survey

    CERN Document Server

    Luhman, K L; Shukla, S J; Loutrel, N P

    2016-01-01

    Previous studies have found that ~1 deg2 fields surrounding the stellar aggregates in the Taurus star-forming region exhibit a surplus of solar-mass stars relative to denser clusters like IC~348 and the Orion Nebula Cluster. To test whether this difference reflects mass segregation in Taurus or a variation in the IMF, we have performed a survey for members of Taurus across a large field (~40 deg2) that was imaged by the Sloan Digital Sky Survey (SDSS). We obtained optical and near-infrared spectra of candidate members identified with those images and the Two Micron All Sky Survey, as well as miscellaneous candidates that were selected with several other diagnostics of membership. We have classified 22 of the candidates as new members of Taurus, which includes one of the coolest known members (M9.75). Our updated census of members within the SDSS field shows a surplus of solar-mass stars relative to clusters, although it is less pronounced than in the smaller fields towards the stellar aggregates that were sur...

  13. Antioxidative activity of protein hydrolysate produced by alcalase hydrolysis from shrimp waste (Penaeus monodon and Penaeus indicus)

    OpenAIRE

    Dey, Satya Sadhan; Dora, Krushna Chandra

    2011-01-01

    Protein hydrolysates prepared by hydrolysis of shrimp waste (Penaeus monodon and Penaeus indicus) for 90 min. using Alcalase enzyme following pH-stat method. Antioxidative activities of SWPH were assessed determining FRAP, ABTS and DPPH radical scavenging activities, which increased linearly with increasing concentration of protein hydrolysate upto 5 mg/ml maintaining good correlation. SWPH showed high stability over wide ranges of pH (2–11) and temperature (up to 100 °C for 150 min), in whic...

  14. The XMM-Newton Extended Survey of the Taurus Molecular Cloud (XEST)

    Science.gov (United States)

    Guedel, M.; Briggs, K. R.; Arzner, K.; Audard, M.; Bouvier, J.; Feigelson, E. D.; Franciosini, E.; Glauser, A.; Grosso, N.; Micela, G.; Monin, J.-L.; Montmerle, T.; Padgett, D. L.; Palla, F.; Pillitteri, I.; Rebull, L.; Scelsi, L.; Silva, B.; Skinner, S. L.; Stelzer, B.; Telleschi, A.

    2007-01-01

    The Taurus Molecular Cloud (TMC) is the nearest large star-forming region, prototypical for the distributed mode of low-mass star formation. Pre-main sequence stars are luminous X-ray sources, probably mostly owing to magnetic energy release. Aims. The XMM-Newton Extended Survey of the Taurus Molecular Cloud (EST) presented in this paper surveys the most populated =5 square degrees of the TMC, using the XMM-Newton X-ray observatory to study the thermal structure, variability, and long-term evolution of hot plasma, to investigate the magnetic dynamo, and to search for new potential members of the association. Many targets are also studied in the optical, and high-resolution X-ray grating spectroscopy has been obtained for selected bright sources. Methods. The X-ray spectra have been coherently analyzed with two different thermal models (2-component thermal model, and a continuous emission measure distribution model). We present overall correlations with fundamental stellar parameters that were derived from the previous literature. A few detections from Chandra observations have been added. Results. The present overview paper introduces the project and provides the basic results from the X-ray analysis of all sources detected in the XEST survey. Comprehensive tables summarize the stellar properties of all targets surveyed. The survey goes deeper than previous X-ray surveys of Taurus by about an order of magnitude and for the first time systematically accesses very faint and strongly absorbed TMC objects. We find a detection rate of 85% and 98% for classical and weak-line T Tau stars (CTTS resp. WTTS), and identify about half of the surveyed protostars and brown dwarfs. Overall, 136 out of 169 surveyed stellar systems are detected. We describe an X-ray luminosity vs. mass correlation, discuss the distribution of X-ray-to-bolometric luminosity ratios, and show evidence for lower X-ray luminosities in CTTS compared to WTTS. Detailed analysis (e.g., variability, rotation

  15. Polyphasic taxonomic analysis establishes Mycobacterium indicus pranii as a distinct species.

    Directory of Open Access Journals (Sweden)

    Vikram Saini

    Full Text Available BACKGROUND: Mycobacterium indicus pranii (MIP, popularly known as Mw, is a cultivable, non-pathogenic organism, which, based on its growth and metabolic properties, is classified in Runyon Group IV along with M. fortuitum, M. smegmatis and M. vaccae. The novelty of this bacterium was accredited to its immunological ability to undergo antigen driven blast transformation of leukocytes and delayed hypersensitivity skin test in leprosy patients, a disease endemic in the Indian sub-continent. Consequently, MIP has been extensively evaluated for its biochemical and immunological properties leading to its usage as an immunomodulator in leprosy and tuberculosis patients. However, owing to advances in sequencing and culture techniques, the citing of new strains with almost 100% similarity in the sequences of marker genes like 16S rRNA, has compromised the identity of MIP as a novel species. Hence, to define its precise taxonomic position, we have carried out polyphasic taxonomic studies on MIP that integrate its phenotypic, chemotaxonomic and molecular phylogenetic attributes. METHODOLOGY/PRINCIPAL FINDINGS: The comparative analysis of 16S rRNA sequence of MIP by using BLAST algorithm at NCBI (nr database revealed a similarity of > or =99% with M. intracellulare, M. arosiense, M. chimaera, M. seoulense, M. avium subsp. hominissuis, M. avium subsp. paratuberculosis and M. bohemicum. Further analysis with other widely used markers like rpoB and hsp65 could resolve the phylogenetic relationship between MIP and other closely related mycobacteria apart from M. intracellulare and M. chimaera, which shares > or =99% similarity with corresponding MIP orthologues. Molecular phylogenetic analysis, based on the concatenation of candidate orthologues of 16S rRNA, hsp65 and rpoB, also substantiated its distinctiveness from all the related organisms used in the analysis excluding M. intracellulare and M. chimaera with which it exhibited a close proximity. This

  16. Mitochondrial pathway mediates the antileukemic effects of Hemidesmus indicus, a promising botanical drug.

    Directory of Open Access Journals (Sweden)

    Carmela Fimognari

    Full Text Available BACKGROUND: Although cancers are characterized by the deregulation of multiple signalling pathways, most current anticancer therapies involve the modulation of a single target. Because of the enormous biological diversity of cancer, strategic combination of agents targeted against the most critical of those alterations is needed. Due to their complex nature, plant products interact with numerous targets and influence several biochemical and molecular cascades. The interest in further development of botanical drugs has been increasing steadily and the FDA recently approved the first new botanical prescription drug. The present study is designed to explore the potential antileukemic properties of Hemidesmus indicus with a view to contributing to further development of botanical drugs. Hemidesmus was submitted to an extensive in vitro preclinical evaluation. METHODOLOGY/PRINCIPAL FINDINGS: A variety of cellular assays and flow cytometry, as well as a phytochemical screening, were performed on different leukemic cell lines. We have demonstrated that Hemidesmus modulated many components of intracellular signaling pathways involved in cell viability and proliferation and altered the protein expression, eventually leading to tumor cell death, mediated by a loss of mitochondrial transmembrane potential and increased Bax/Bcl-2 ratio. ADP, adenine nucleotide translocator and mitochondrial permeability transition pore inhibitors did not reverse Hemidesmus-induced mitochondrial depolarization. Hemidesmus induced a significant [Ca(2+](i raise through the mobilization of intracellular Ca(2+ stores. Moreover, Hemidesmus significantly enhanced the antitumor activity of three commonly used chemotherapeutic drugs (methotrexate, 6-thioguanine, cytarabine. A clinically relevant observation is that its cytotoxic activity was also recorded in primary cells from acute myeloid leukemic patients. CONCLUSIONS/SIGNIFICANCE: These results indicate the molecular basis of

  17. Food selection of the Malayan tapir (Tapirus indicus) under semi-wild conditions

    Science.gov (United States)

    Simpson, Boyd K.; Shukor, M. N.; Magintan, David

    2013-11-01

    A study on the selection of food plants by captive Malayan tapirs (Tapirus indicus) was undertaken in a 30 hectare natural forest enclosure at the Sungai Dusun Wildlife Reserve, Malaysia. Tapirs browsed on 217 species of plants (from 99 genera and 49 families) from a total of the 1142 specimens collected and identified. Food plants were heavily dominated by sapling trees and shrubs which comprised 93% of all plants taken, with the remainder comprising woody lianas, vines and herbaceous plants. Although tapirs browsed on a wide variety of plant species, the top 30 species consumed represented more than 60% of all the plants selected, whilst the vast majority of species were rarely eaten. More than 80 species of trees and shrubs were available, but not eaten at all. The most readily consumed species were the sub-canopy and understorey trees Xerospermum noronhianum, Aporosa prainiana and Baccaurea parviflora, while Aporosa, Knema and Xerospermum were the dominant plant genera. The Phyllanthaceae (leaf flowers), Myristicaceae (nutmegs) and Sapindaceae (rambutans) were the most commonly selected families comprising 45% of the diet. Tapirs fed on saplings trees up to 8.3 m in height, while plants taller than about 1.6 m were bent, broken or pushed to the ground to gain access to the foliage. Sapling stems up to 4.2 cm in diameter could be snapped by biting, while larger trees to 7 cm diameter could be pushed down. Tapirs typically fed on the newer leaves and shoots, however, often only consuming half of the available foliage on a plant. This study documents 160 new plant species suitable as Malayan tapir food, and is consistent with the generalist, but selective browsing nature of the Tapirus species in general.

  18. DAYA HAMBAT FRAKSINASI EKSTRAK SEMBUNG DELAN (SPHAERANTUS INDICUS L TERHADAP BAKTERI ESCHERICIA COLI DAN STAPHYLOCOCCUS AUREUS

    Directory of Open Access Journals (Sweden)

    IDA BAGUS GEDE DARMAYASA

    2008-12-01

    Full Text Available A research entitled "Inhibitid activity of plant fractination extract of Sembung Delan (Sphaeranthus indicus L. to Eschericia coli and Staphylococus aureus bacterial was carried aut to find the active of plant extract that responsible for bactericidal agent. This research used absorbance disc method to determine inhibitid fractionation extratc of Sembung Delan to growth of Eschericia coli and Staphylococus aureus bacterial. Results of this study showed that the crude extract of Sembung Delan inhibited the growth of Eschericia coli and Staphylococus aureus on Muller- Hinton medium, indicated by the formation of inhibition zone around the disc loaded with plant extract at concentration of 10,000 ppm, 20,000 ppm, 30,000 ppm, 40,000 ppm, and 50,000 ppm, with diamtre of 10mm, llmm, 12mm, 13mm and 16 mm respectively to S. aureus, forE. coli crude extract at concentration of 10,000 ppm, 20,000 ppm, 30,000 ppm, 40,000 ppm, and 50,000 ppm using diametre each of 12 mm, 13 mm, 15 mm, 17 mm and 19 mm respectively . From 17 fractions obtained from fractionation, fraction No. Vm (eluted with ethyl acetate:hexan with Rf value of 0,9 ; 0,8 ; 0,7 ; 0,68 ; and 0,62, fraction No. DC (eluted with etihil acetate : hexan with Rf value of : 0,98, ; 0,94 ; and 0,82, fraction No. XV (eluted with ethyl acetate 100% Rf value of : 0.03; 0.23; 0.35 and fraction No. XVI (eluted with ethyl acetate 100% with Rf value of: 0.03; 0.14; 0.17; 0.21, effectivity inhibited the growth of test bacterial.

  19. Bioflocculant exopolysaccharide production by Azotobacter indicus using flower extract of Madhuca latifolia L.

    Science.gov (United States)

    Patil, Satish V; Salunkhe, Rahul B; Patil, Chandrashekhar D; Patil, Deepak M; Salunke, Bipinchandra K

    2010-10-01

    Efficacy of Azotobacter indicus ATCC 9540 strain for production exopolysaccharide (EPS) bioflocculant was investigated. Mahua flower extract (Madhuca latifolia L), a natural substrate at the concentration of 20 g L(-1), gave maximum recovery of EPS followed by sucrose and mannitol as compared to other carbon sources after 172 h. Yeast extract was found to be the most effective nitrogen source as compared to beef extract, sodium nitrate, ammonium sulfate, casein hydrolysate, and urea for the production of EPS. EPS production was increased in presence of nitrogen (5.51 g L(-1)) as compared to nitrogen-free medium (3.51 g L(-1)), and fermentation time was also reduced by 28 h. Maximum EPS production (6.10 g L(-1)) was found in the presence of 20 g L(-1) flower extract and 0.5 g L(-1) yeast extract containing Ashby's media with 180 rpm at 30 degrees C at 144 h, under controlled conditions in 2.5 L fermenter using optimized medium. The isolated EPS showed cation-dependent flocculating activity. Concentration of EPS played an important role in bioflocculating activity which increased in a concentration-dependent manner up to a certain limit, with the maximum flocculation of 72% at 500 mg L(-1) concentration but remained almost static after this concentration. Extracted polymer was characterized by different chemical tests, FT-IR spectroscopy, and TLC which showed presence of uronic acids, O-acetyl groups, and Orcinol with suggestive indication of alginate like polymer. This study suggests that use of M. latifolia L. flowers can be a potential alternative bioresource for production of exopolysaccharide. PMID:19921493

  20. Effect of breed and nutrition on the productive traits of beef cattle in south-east Brazil: Part 3-Meat quality.

    Science.gov (United States)

    Norman, G A

    1982-02-01

    Significant differences in a number of economically important appearance and palatability traits were recorded between the Bos indicus and Bos taurus breeds. Muscles from the Charolais and Canchim animals were consistently and significantly lighter in colour than those from the zebu breeds, even after pH effects had been taken into account. Differences were shown to be directly related to variations in muscle myoglobin levels, but may have been complicated by observed textural differences. Muscles from the zebu animals were not noticeably coarser grained, having significantly larger fibre diameters and fibre bundle sizes. The inferiority of the Bos indicus breeds in terms of muscle tenderness was clearly demonstrated. Significantly higher shear force values were recorded in all muscles from the Nelore and Guzera breeds, except the Psoas major. These differences were also detected by taste panel evaluation. Major differences between breeds were demonstrated in the thermo-stability of extracted intra-muscular connective tissue elements, being highest in the zebu breeds, intermediate in the Canchim and lowest in the Charolais. These solubility characteristics were thought to be due to differences in the relative proportions of genetically different collagen types in the muscles and an association between coarseness of texture and toughness was shown. PMID:22054790

  1. Geographic distribution of haplotype diversity at the bovine casein locus

    Directory of Open Access Journals (Sweden)

    Moazami-Goudarzi Katy

    2004-03-01

    Full Text Available Abstract The genetic diversity of the casein locus in cattle was studied on the basis of haplotype analysis. Consideration of recently described genetic variants of the casein genes which to date have not been the subject of diversity studies, allowed the identification of new haplotypes. Genotyping of 30 cattle breeds from four continents revealed a geographically associated distribution of haplotypes, mainly defined by frequencies of alleles at CSN1S1 and CSN3. The genetic diversity within taurine breeds in Europe was found to decrease significantly from the south to the north and from the east to the west. Such geographic patterns of cattle genetic variation at the casein locus may be a result of the domestication process of modern cattle as well as geographically differentiated natural or artificial selection. The comparison of African Bos taurus and Bos indicus breeds allowed the identification of several Bos indicus specific haplotypes (CSN1S1*C-CSN2*A2-CSN3*AI/CSN3*H that are not found in pure taurine breeds. The occurrence of such haplotypes in southern European breeds also suggests that an introgression of indicine genes into taurine breeds could have contributed to the distribution of the genetic variation observed.

  2. IMF from infrared photometry of young stellar clusters in Taurus-Auriga and Orion

    CERN Document Server

    Salas, Luis

    2009-01-01

    We applied the extinction-disk-principal vectors approach to near infrared photometric data of the Taurus-Auriga region and Orion Nebula young stellar clusters. By assuming that the cluster age is represented by the median value of the age distribution we are able to derive the distribution of stellar masses. We showed that the resulting initial mass function (IMF) for these two young stellar clusters compares remarkably well and might be a robust representation of the IMF obtained by spectroscopic or photometric methods. The method also yields extinction and disk contribution for each star. The overall extinction distribution for the Orion cluster is analyzed and compares well with previous work. The frequency of T Tauri stars with disks is dominant.

  3. Magnetically Regulated Star Formation in 3D: The Case of Taurus Molecular Cloud Complex

    CERN Document Server

    Nakamura, Fumitaka

    2008-01-01

    We carry out three-dimensional MHD simulations of star formation in turbulent, magnetized clouds, including ambipolar diffusion and feedback from protostellar outflows. The calculations focus on relatively diffuse clouds threaded by a strong magnetic field capable of resisting severe tangling by turbulent motions and retarding global gravitational contraction in the cross-field direction. They are motivated by observations of the Taurus molecular cloud complex (and, to a lesser extent, Pipe Nebula), which shows an ordered large-scale magnetic field, as well as elongated condensations that are generally perpendicular to the large-scale field. We find that stars form in earnest in such clouds when enough material has settled gravitationally along the field lines that the mass-to-flux ratios of the condensations approach the critical value. Only a small fraction (of order 1% or less) of the nearly magnetically-critical, condensed material is turned into stars per local free-fall time, however. The slow star form...

  4. Morphological identification of vesicular-arbuscular mycorrhiza on bulbous plants (Taurus mountain in Turkey

    Directory of Open Access Journals (Sweden)

    Karaarslan Emel

    2015-01-01

    Full Text Available This study was conducted to investigate the morphological identification of vesicular-arbuscular mycorrhiza (VAM on bulbous plants in the Taurus Mountains in Turkey. Thirteen soil samples and bulbous roots were taken from the rhizosphere of bulbous plants. The soils were analyzed for the number of VAM spores and chemical and physical properties. In addition, the roots were examined for infection levels, and morphological identification of VAM spores was made. All tested plants are considered mycorrhizal plants. We determined three spore species (Glomus mosseae, Glomus hoi and Scutellospora calospora from the surveyed soils. The spore distribution rates were as follows: G. Mossea 61.54 %, G. Hoi 23.07 % and Scutellospora calospora 15.38 %. Results suggest that VAM fungal spores and root colonization display variation in rhizosphere under bulbous plants in different ecological conditions.

  5. The Five College Radio Astronomy Observatory CO Mapping Survey of the Taurus Molecular Cloud

    CERN Document Server

    Narayanan, Gopal; Brunt, Christopher; Goldsmith, Paul F; Snell, Ronald; Li, Di

    2008-01-01

    The FCRAO Survey of the Taurus Molecular Cloud observed the 12CO and 13CO J=1-0 emission from 98 square degrees of this important, nearby star forming region. This set of data with 45" resolution comprises the highest spatial dynamic range image of an individual molecular cloud constructed to date, and provides valuable insights to the molecular gas distribution, kinematics, and the star formation process. In this contribution, we describe the observations, calibration, data processing, and characteristics of the noise and line emission of the survey. The angular distribution of 12CO and 13CO emission over 1 km/s velocity intervals and the full velocity extent of the cloud are presented. These reveal a complex, dynamic medium of cold, molecular gas.

  6. IMAGING OF THE CCS 22.3 GHz EMISSION IN THE TAURUS MOLECULAR CLOUD COMPLEX

    International Nuclear Information System (INIS)

    Thioxoethenylidene (CCS) is an abundant interstellar molecule and a good tracer of high density and evolutionary stage of dense molecular clouds. It is also a suitable candidate for Zeeman splitting observations for its high splitting factor and narrow thermal line widths. We report here Expanded Very Large Array 22.3 GHz observations of three dense molecular cores TMC-1, TMC-1C, and L1521B in the Taurus molecular cloud complex to image the CCS 21-10 transition. For all three sources, the clumpy CCS emission is most likely tracing the starless cores. However, these compact structures account for only ∼1%-13% of the integrated emission detected in single-dish observations, indicating the presence of significant large-scale diffuse emission in favorable conditions for producing CCS.

  7. Imaging of the CCS 22.3 GHz emission in the Taurus Molecular Cloud complex

    CERN Document Server

    Roy, Nirupam; Momjian, Emmanuel; Sarma, Anuj P

    2011-01-01

    Thioxoethenylidene (CCS) is an abundant interstellar molecule, and a good tracer of high density and evolutionary stage of dense molecular clouds. It is also a suitable candidate for Zeeman splitting observations for its high splitting factor and narrow thermal linewidths. We report here EVLA 22.3 GHz observations of three dense molecular cores TMC-1, TMC-1C and L1521B in the Taurus Molecular Cloud complex to image the CCS 2_1-1_0 transition. For all three sources, the clumpy CCS emission is most likely tracing the starless cores. However, these compact structures account for only ~ 1-13% of the integrated emission detected in single-dish observations, indicating the presence of significant large scale diffuse emission in favorable conditions for producing CCS.

  8. Determinación de las condiciones de crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del tracto intestinal de terneros (Bos taurus

    Directory of Open Access Journals (Sweden)

    José Ávila

    2010-07-01

    Full Text Available El objetivo de este estudio fue conocer el efecto de la temperatura, pH y la concentración de inóculo sobre el crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del intestino delgado de terneros. Para ello se utilizó en el primer caso, el método de superficie de respuesta para determinar las condiciones de pH y temperatura óptimas de la cepa, y en el segundo, un diseño experimental completamente aleatorizado considerando el factor concentración de inóculo inicial a seis niveles, donde el crecimiento (en medio De Man, Rogosa y Sharpe expresado en unidades de Absorbancia, constituyó la variable respuesta; presentándose una máxima respuesta (0,806 uA para 5 % de concentración inicial de inóculo. Los valores de pH y temperatura utilizados permitieron el establecimiento de una zona óptima de crecimiento in vitro en los siguientes intervalos, pH entre 5,1 y 5,6; y temperatura entre 38,0 y 41,5 °C, donde el máximo crecimiento se obtuvo a pH 5,31 y a 39,38 °C. Por otro lado se encontraron incrementos significativos del crecimiento in vitro (p < 0,05 a medida que se utiliza menor concentración de inóculo inicial. Con la información obtenida se espera incrementar los rendimientos de la cepa y así promover la producción de productos probióticos para el consumo animal en Venezuela.

  9. Determinación de las condiciones de crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del tracto intestinal de terneros (Bos taurus

    Directory of Open Access Journals (Sweden)

    José Ávila

    2010-06-01

    Full Text Available El objetivo de este estudio fue conocer el efecto de la temperatura, pH y la concentración de inóculo sobre el crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del intestino delgado de terneros. Para ello se utilizó en el primer caso, el método de superficie de respuesta para determinar las condiciones de pH y temperatura óptimas de la cepa, y en el segundo, un diseño experimental completamente aleatorizado considerando el factor concentración de inóculo inicial a seis niveles, donde el crecimiento (en medio De Man, Rogosa y Sharpe expresado en unidades de Absorbancia, constituyó la variable respuesta; presentándose una máxima respuesta (0,806 uA para 5 % de concentración inicial de inóculo. Los valores de pH y temperatura utilizados permitieron el establecimiento de una zona óptima de crecimiento in vitroen los siguientes intervalos, pH entre 5,1 y 5,6; y temperatura entre 38,0 y 41,5 °C, donde el máximo crecimiento se obtuvo a pH 5,31 y a 39,38 °C. Por otro lado se encontraron incrementos significativos del crecimiento in vitro (p < 0,05 a medida que se utiliza menor concentración de inóculo inicial. Con la información obtenida se espera incrementar los rendimientos de la cepa y así promover la producción de productos probióticos para el consumo animal en Venezuela.

  10. Análisis de los tipos de fibras musculares del toro bravo (Bos Taurus ibericus): su relación con algunas enzimas de fatiga muscular y el comportamiento durante la lidia

    OpenAIRE

    Ros Sempere, Juan

    2016-01-01

    Muestras de músculo esquelético y sangre fueron tomadas a 48 toros bravos (novillos) lidiados en la plaza de toros de Calasparra (Murcia). Los músculos seleccionados, cabeza larga del tríceps braquial y semitendinoso, fueron analizados desde el punto de vista histológico, con el fin de estudiar las características morfológicas e histoquímicas de los distintos tipos de miocitos y las posibles alteraciones consecuencia de la lidia. Las técnicas histoquímicas han posibilitado reconocer tres tipo...

  11. Análisis de los tipos de fibras musculares del toro bravo (Bos Taurus ibericus): su relación con algunas enzimas de fatiga muscular y el comportamiento durante la lidia

    OpenAIRE

    Ros Sempere, Juan

    2016-01-01

    Muestras de músculo esquelético y sangre fueron tomadas a 48 toros bravos (novillos) lidiados en la plaza de toros de Calasparra (Murcia). Los músculos seleccionados, cabeza larga del tríceps braquial y semitendinoso, fueron analizados desde el punto de vista histológico, con el fin de estudiar las características morfológicas e histoquímicas de los distintos tipos de miocitos y las posibles alteraciones consecuencia de la lidia. Las técnicas histoquímicas han posibilitado reconocer tres tip...

  12. Tipos de fibras en el músculo esquelético del toro bravo (bos taurus ibericus) : su relación con la caída durante la lídia / 2001.

    OpenAIRE

    Martínez Gomariz, Francisco

    2001-01-01

    Tesis-Universidad de Murcia. Consulte la tesis en: BCA. GENERAL. ARCHIVO UNIVERSITARIO. T.M.-2275. Consulte la tesis en: BCA. GENERAL. Fac. Veterinaria. Departamentos. E002B TESIS 95. Consulte la tesis en: BCA. GENERAL. Fac. Veterinaria. Sala de estudio. Tesis-V 153.

  13. Brood ball-mediated transmission of microbiome members in the dung beetle, Onthophagus taurus (Coleoptera: Scarabaeidae.

    Directory of Open Access Journals (Sweden)

    Anne M Estes

    Full Text Available Insects feeding on plant sap, blood, and other nutritionally incomplete diets are typically associated with mutualistic bacteria that supplement missing nutrients. Herbivorous mammal dung contains more than 86% cellulose and lacks amino acids essential for insect development and reproduction. Yet one of the most ecologically necessary and evolutionarily successful groups of beetles, the dung beetles (Scarabaeinae feeds primarily, or exclusively, on dung. These associations suggest that dung beetles may benefit from mutualistic bacteria that provide nutrients missing from dung. The nesting behaviors of the female parent and the feeding behaviors of the larvae suggest that a microbiome could be vertically transmitted from the parental female to her offspring through the brood ball. Using sterile rearing and a combination of molecular and culture-based techniques, we examine transmission of the microbiome in the bull-headed dung beetle, Onthophagus taurus. Beetles were reared on autoclaved dung and the microbiome was characterized across development. A ~1425 bp region of the 16S rRNA identified Pseudomonadaceae, Enterobacteriaceae, and Comamonadaceae as the most common bacterial families across all life stages and populations, including cultured isolates from the 3(rd instar digestive system. Finer level phylotyping analyses based on lepA and gyrB amplicons of cultured isolates placed the isolates closest to Enterobacter cloacae, Providencia stuartii, Pusillimonas sp., Pedobacter heparinus, and Lysinibacillus sphaericus. Scanning electron micrographs of brood balls constructed from sterile dung reveals secretions and microbes only in the chamber the female prepares for the egg. The use of autoclaved dung for rearing, the presence of microbes in the brood ball and offspring, and identical 16S rRNA sequences in both parent and offspring suggests that the O. taurus female parent transmits specific microbiome members to her offspring through the brood

  14. Magnetically Regulated Star Formation in Three Dimensions: The Case of the Taurus Molecular Cloud Complex

    Science.gov (United States)

    Nakamura, Fumitaka; Li, Zhi-Yun

    2008-11-01

    We carry out three-dimensional MHD simulations of star formation in turbulent, magnetized clouds, including ambipolar diffusion and feedback from protostellar outflows. The calculations focus on relatively diffuse clouds threaded by a strong magnetic field capable of resisting severe tangling by turbulent motions and retarding global gravitational contraction in the cross field direction. They are motivated by observations of the Taurus molecular cloud complex (and, to a lesser extent, Pipe Nebula), which shows an ordered large-scale magnetic field, as well as elongated condensations that are generally perpendicular to the large-scale field. We find that stars form in earnest in such clouds when enough material has settled gravitationally along the field lines that the mass-to-flux ratios of the condensations approach the critical value. Only a small fraction (of order 1% or less) of the nearly magnetically critical, condensed material is turned into stars per local free-fall time, however. The slow star formation takes place in condensations that are moderately supersonic; it is regulated primarily by magnetic fields, rather than turbulence. The quiescent condensations are surrounded by diffuse halos that are much more turbulent, as observed in the Taurus complex. Strong support for magnetic regulation of star formation in this complex comes from the extremely slow conversion of the already condensed, relatively quiescent C18O gas into stars, at a rate 2 orders of magnitude below the maximum, free-fall value. We analyze the properties of dense cores, including their mass spectrum, which resembles the stellar initial mass function.

  15. DYNA3D, INGRID, and TAURUS: an integrated, interactive software system for crashworthiness engineering

    International Nuclear Information System (INIS)

    Crashworthiness engineering has always been a high priority at Lawrence Livermore National Laboratory because of its role in the safe transport of radioactive material for the nuclear power industry and military. As a result, the authors have developed an integrated, interactive set of finite element programs for crashworthiness analysis. The heart of the system is DYNA3D, an explicit, fully vectorized, large deformation structural dynamics code. DYNA3D has the following four capabilities that are critical for the efficient and accurate analysis of crashes: (1) fully nonlinear solid, shell, and beam elements for representing a structure, (2) a broad range of constitutive models for representing the materials, (3) sophisticated contact algorithms for the impact interactions, and (4) a rigid body capability to represent the bodies away from the impact zones at a greatly reduced cost without sacrificing any accuracy in the momentum calculations. To generate the large and complex data files for DYNA3D, INGRID, a general purpose mesh generator, is used. It runs on everything from IBM PCs to CRAYS, and can generate 1000 nodes/minute on a PC. With its efficient hidden line algorithms and many options for specifying geometry, INGRID also doubles as a geometric modeller. TAURUS, an interactive post processor, is used to display DYNA3D output. In addition to the standard monochrome hidden line display, time history plotting, and contouring, TAURUS generates interactive color displays on 8 color video screens by plotting color bands superimposed on the mesh which indicate the value of the state variables. For higher quality color output, graphic output files may be sent to the DICOMED film recorders. We have found that color is every bit as important as hidden line removal in aiding the analyst in understanding his results. In this paper the basic methodologies of the programs are presented along with several crashworthiness calculations

  16. DISK EVOLUTION IN THE THREE NEARBY STAR-FORMING REGIONS OF TAURUS, CHAMAELEON, AND OPHIUCHUS

    International Nuclear Information System (INIS)

    We analyze samples of Spitzer Infrared Spectrograph spectra of T Tauri stars in the Ophiuchus, Taurus, and Chamaeleon I star-forming regions, whose median ages lie in the <1-2 Myr range. The median mid-infrared spectra of objects in these three regions are similar in shape, suggesting, on average, similar disk structures. When normalized to the same stellar luminosity, the medians follow each other closely, implying comparable mid-infrared excess emission from the circumstellar disks. We use the spectral index between 13 and 31 μm and the equivalent width of the 10 μm silicate emission feature to identify objects whose disk configuration departs from that of a continuous, optically thick accretion disk. Transitional disks, whose steep 13-31 μm spectral slope and near-IR flux deficit reveal inner disk clearing, occur with about the same frequency of a few percent in all three regions. Objects with unusually large 10 μm equivalent widths are more common (20%-30%); they could reveal the presence of disk gaps filled with optically thin dust. Based on their medians and fraction of evolved disks, T Tauri stars in Taurus and Chamaeleon I are very alike. Disk evolution sets in early, since already the youngest region, the Ophiuchus core (L1688), has more settled disks with larger grains. Our results indicate that protoplanetary disks show clear signs of dust evolution at an age of a few Myr, even as early as ∼1 Myr, but age is not the only factor determining the degree of evolution during the first few million years of a disk's lifetime.

  17. Inhibition Effect of Antagonistic Fungal Strain BOS-013 against the Pathogen of Rice Blast ( Pyricularia oryzae)%拮抗真菌菌株BOS-013对稻瘟病菌的抑制作用

    Institute of Scientific and Technical Information of China (English)

    吕跃东; 王勇; 张文革; 谢程程; 宫立晶; 王雪

    2011-01-01

    [目的]为寻找对水稻稻瘟病的有防治作用的有益微生物及其代谢产物,研究放线菌BOS-013菌株发酵液对水稻稻瘟病菌的抑制作用.[方法]以水稻稻瘟病菌作为目标指示菌,采用杯碟法和滤纸片法测定BOS-13菌株发酵液及其不同溶剂提取物的抑菌活性.[结果]研究结果表明,含菌量为4×10cfu/ml的BOS-13菌株发酵液对水稻稻瘟病菌的抑制率为92.O%±0.5%;该发酵液经高温、高压灭活后对水稻稻瘟病菌仍有抑制作用,抑制率为60.0%±0.5%.发酵液经非极性CAD-5型大孔吸附树脂吸附、60%乙醇溶液洗脱后,其抑菌活性很高,抑菌圈直径达33.0 mm.[结论]BOS-13菌株发酵液水稻稻瘟病菌有显著的抑制作用;该研究结果为进一步明确BOS-13菌株发酵液时水稻稻瘟病菌的抑制作用机理及其实际应用奠定了基础.%[ Objective ] To search for the beneficial microorganisms and their metabolic products with control effect against rice blast, the paper studied the inhibition effect of the fermentation broth of actinomycetes BOS-013 strain against the pathogen of rice blast (Pyricularia oryzae). [ Method] With the pathogen of rice blast as the target indicator fungus, the inhibition effect of the fermentation broth of BOS-013 strain and its extracts from different solvents against the pathogen were determined using cylinder plate method and filter paper method. [ Resuit] The results showed that the inhibition rate of the fermentation broth of BOS-013 strain with fungus amount of 4 × l08 cfu/ml against the pathogen of rice blast was 92.0% ± 0.5%; the fermentation broth still had inhibition effect against the pathogen of rice blast after inactivation under high temperature and high pressure, and the inhibition rate was 60.0% ± 0.5%. After absorbed by non-polar CAD-45 type macroporous adsorption resin and eluted by 60% ethanol, the antifungal activity of the fermentation broth was still high, and the diameter of

  18. VizieR Online Data Catalog: Infrared photometry of all known members in Taurus (Esplin+, 2014)

    Science.gov (United States)

    Esplin, T. L.; Luhman, K. L.; Mamajek, E. E.

    2016-08-01

    To construct a census of the circumstellar disks in Taurus, we begin by compiling a list of all known members of the region. We adopt the 352 members from Luhman et al. 2010 (cat. J/ApJS/186/111), 4 additional stars that have good evidence of membership from previous studies (Section 5.4), 32 members found in a subsequent survey by K. Luhman (in preparation; 33 if GZ Tau A and B are counted separately), and 25 new members (26 if BS Tau A and B are counted separately) that we have confirmed with spectroscopy (Section 5.3). We also adopt as a member HD 285957, which has a proper motion consistent with that of the Taurus subgroup L1551 (Zacharias et al. 2013, cat. I/322; Luhman et al. 2009ApJ...703..399L) and exhibits evidence of youth in the form of Li absorption (Wichmann et al. 2000A&A...359..181W; Sestito et al. 2008, cat. J/A+A/488/943). We make use of mid-infrared photometry for members of Taurus measured with Spitzer's Infrared Array Camera (IRAC) and the Multiband Imaging Photometer for Spitzer (MIPS). We consider the four bands of IRAC (3.6, 4.5, 5.8, and 8.0μm) and the 24μm band of MIPS, which are denoted as [3.6], [4.5], [5.8], [8.0], and [24], respectively. IRAC produced images with a field of view of 5.2'*5.2' and FWHM of 1.6''-1.9'' for [3.6] to [8.0]. MIPS had a field of view of 5.4'*5.4' and a FWHM of 5.9'' for [24]. Photometry from most Spitzer images for most members of Taurus has been measured by Luhman et al. 2010 (cat. J/ApJS/186/111) (see also Hartmann et al. 2005ApJ...629..881H; Luhman et al. 2006, cat. J/ApJ/647/1180; Guieu et al. 2007, cat. 2007A&A...465..855G; Rebull et al. 2010, cat. J/ApJS/186/259). We have measured photometry of the members that were not considered in Luhman et al. 2010 (cat. J/ApJS/186/111) and all known members appearing in Spitzer images that have become publicly available since that study (Astronomical Observation Requests 26470912, 26471168 26477056, 26475264, 26472704, 26473216, and 23272448). These data were

  19. The major cow milk allergen Bos d 5 manipulates T-helper cells depending on its load with siderophore-bound iron.

    Directory of Open Access Journals (Sweden)

    Franziska Roth-Walter

    Full Text Available The mechanisms of allergic sensitization to milk are still elusive. The major allergen Bos d 5 belongs to the lipocalin-family and thus is able to transport numerous ligands. In this study we investigated its ability to bind to iron-siderophore complexes and tested the immune-modulatory properties of Bos d 5 in either forms. Structural and in silico docking analysis of Bos d 5 revealed that Bos d 5 is able to bind to iron via catechol-based flavonoids (quercetin, myricetin, luteolin that act as siderophores as confirmed by spectral-analysis and iron staining. Calculated dissociation constants of docking analyses were below 1 µM by virtual addition of iron. When incubated with human peripheral blood mononuclear cells (PBMCs, only the apo-form of Bos d 5 led to an increase of CD4+positive cells and significantly elevated IL13 and IFNγ-levels. In contrast, holo-Bos d 5 decreased numbers of CD4 expressing cells and induced apoptosis. Taken together, our data give evidence that Bos d 5 is capable of binding iron via siderophores. Moreover, our data support for the first time the notion that the form of application (apo- or holo-form is decisive for the subsequent immune response. The apo-form promotes Th2 cells and inflammation, whereas the holo-form appears to be immunosuppressive.

  20. Reproductive deficiency in bulls from synthetic breeds according to the type of crossbreed and the morphology of the Y chromosome

    Directory of Open Access Journals (Sweden)

    Marilise M. Horn

    2005-01-01

    Full Text Available We used 550 Braford and 214 Brangus-Ibagé bulls to study the association between Y chromosome morphology and the evaluation of breeding-soundness, karyotyping and breeding records were used to assess Y chromosome morphology. In general, no direct association was detected between the individual type of Y chromosome and reproductive fitness as previously estimated through breeding soundness examination. The type of breeding strategy used to form the synthetic breeds was also analyzed. The Braford breed is about 3/8 Zebu (Bos taurus indicus and 5/8 Hereford (Bos taurus taurus but when the breeding strategy used 1/4 Zebu animals to produce Braford bulls which were 3/8 Zebu a greater percentage of the bulls had to be culled due to reproductive problems. Our study shows that certain interactions between genotypes can be detrimental to the reproductive efficiency of 3/8 Zebu animals and that breeding strategies avoiding or favoring certain genotypes can be used to reduce the percentage of bulls from synthetic breeds that are culled due to problems with semen quality.

  1. A primary screen of the bovine genome for quantitative trait loci affecting carcass and growth traits.

    Science.gov (United States)

    Stone, R T; Keele, J W; Shackelford, S D; Kappes, S M; Koohmaraie, M

    1999-06-01

    A primary genomic screen for quantitative trait loci (QTL) affecting carcass and growth traits was performed by genotyping 238 microsatellite markers on 185 out of 300 total progeny from a Bos indicus x Bos taurus sire mated to Bos taurus cows. The following traits were analyzed for QTL effects: birth weight (BWT), weaning weight (WW), yearling weight (YW), hot carcass weight (HCW), dressing percentage (DP), fat thickness (FT), marbling score (MAR), longissimus muscle area (LMA), rib bone (RibB), rib fat (RibF), and rib muscle (RibM), and the predicted whole carcass traits, retail product yield (RPYD), fat trim yield (FATYD), bone yield (BOYD), retail product weight (RPWT), fat weight (FATWT), and bone weight (BOWT). Data were analyzed by generating an F-statistic profile computed at 1-cM intervals for each chromosome by the regression of phenotype on the conditional probability of receiving the Brahman allele from the sire. There was compelling evidence for a QTL allele of Brahman origin affecting an increase in RibB and a decrease in DP on chromosome 5 (BTA5). Putative QTL at or just below the threshold for genome-wide significance were as follows: an increase in RPYD and component traits on BTA2 and BTA13, an increase in LMA on BTA14, and an increase in BWT on BTA1. Results provided represent a portion of our efforts to identify and characterize QTL affecting carcass and growth traits.

  2. A primary screen of the bovine genome for quantitative trait loci affecting carcass and growth traits.

    Science.gov (United States)

    Stone, R T; Keele, J W; Shackelford, S D; Kappes, S M; Koohmaraie, M

    1999-06-01

    A primary genomic screen for quantitative trait loci (QTL) affecting carcass and growth traits was performed by genotyping 238 microsatellite markers on 185 out of 300 total progeny from a Bos indicus x Bos taurus sire mated to Bos taurus cows. The following traits were analyzed for QTL effects: birth weight (BWT), weaning weight (WW), yearling weight (YW), hot carcass weight (HCW), dressing percentage (DP), fat thickness (FT), marbling score (MAR), longissimus muscle area (LMA), rib bone (RibB), rib fat (RibF), and rib muscle (RibM), and the predicted whole carcass traits, retail product yield (RPYD), fat trim yield (FATYD), bone yield (BOYD), retail product weight (RPWT), fat weight (FATWT), and bone weight (BOWT). Data were analyzed by generating an F-statistic profile computed at 1-cM intervals for each chromosome by the regression of phenotype on the conditional probability of receiving the Brahman allele from the sire. There was compelling evidence for a QTL allele of Brahman origin affecting an increase in RibB and a decrease in DP on chromosome 5 (BTA5). Putative QTL at or just below the threshold for genome-wide significance were as follows: an increase in RPYD and component traits on BTA2 and BTA13, an increase in LMA on BTA14, and an increase in BWT on BTA1. Results provided represent a portion of our efforts to identify and characterize QTL affecting carcass and growth traits. PMID:10375215

  3. Taurus workbenchyong用于IC制造加工工艺的实验研究%The experimental research of optimize manufacturing and procesing technique for IC on the taurus workbench

    Institute of Scientific and Technical Information of China (English)

    侯国宪; 李惠军; 赵国庆

    2004-01-01

    介绍了集成电路虚拟工厂系统Taurus Workbench.并基于CMOS工艺的特点,在Tau-rus Workbench环境下进行了亚微米级n沟器件的核心参数优化实验研究,结果印证了集成电路虚拟工厂技术为工艺优化提供了便捷有效的方法.

  4. Enterocytozoon bieneusi genotypes in yaks (Bos grunniens) and their public health potential.

    Science.gov (United States)

    Ma, Jingbo; Cai, Jinzhong; Ma, Jiawen; Feng, Yaoyu; Xiao, Lihua

    2015-01-01

    Enterocytozoon bieneusi, the most frequently diagnosed microsporidian species in humans, is also identified in a wide range of animals. To date, few data are available on E. bieneusi in yaks (Bos grunniens). In this study, we examined the occurrence and genotype identity of E. bieneusi in yaks in four counties in Qinghai Province of China. Of 327 fecal specimens examined by nested PCR analysis of the ribosomal internal transcribed spacer, 23 (7.0%) were E. bieneusi-positive. DNA sequence analysis of the PCR products revealed the presence of five distinct genotypes: three Group 2 genotypes previously reported in cattle as well as humans (BEB4, I and J) and two novel genotypes (CHN11 and CHN12) belonging to the large zoonotic group (Group 1). Data of the study suggest that these animals could be potential reservoirs for human E. bieneusi infection. PMID:25040451

  5. Study of interfaces in an Axisymmetric Supersonic Jet using Background Oriented Schlieren (BOS)

    Science.gov (United States)

    Echeverría, Carlos; Porta, David; Aguayo, Alejandro; Cardoso, Hiroki; Stern, Catalina

    2014-11-01

    We have used several techniques to study a small axisymmetric supersonic jet: Rayleigh scattering, Schlieren Toepler and PIV. Each technique gives different kind of information. In this paper, a BOS set-up is used to study the structure of the shock pattern. A shadowgraph of a dot matrix is obtained with and without a flow. The displacement field of the dots is related to changes in the index of refraction, which can be related, through the Gladstone-Dale equation, to changes in density. Previous results with this technique were not conclusive because of the relative size of the dots compared to the diameter of the nozzle. Measurements have been taken for three different exit speeds. We acknowledge support from UNAM through DGAPA PAPIIT IN117712 and the Graduate Program in Mechanical Engineering.

  6. The effect of sire breed on the melting point and fatty acid composition of subcutaneous fat in steers.

    Science.gov (United States)

    Perry, D; Nicholls, P J; Thompson, J M

    1998-01-01

    Fatty acid composition and the melting point of subcutaneous fat was determined in 18 Hereford, 25 Brahman x Hereford, 22 Simmental x Hereford, and 15 Friesian x Hereford steers that were grown out on pasture at two sites and slaughtered when the mean weight of the Herefords at each site was ca. 450 kg. Multivariate and univariate analyses tested the relations of fatty acid composition, degree of saturation, and melting point with sire breed, environment, age, and carcass characteristics. Hereford and Brahman steers were fatter than the Simmental and Friesian steers. Fat from Brahman-sired steers had a melting point 2.5 degrees C lower than fat from the Bos taurus-sired steers at the same age and had a higher proportion of unsaturated fatty acids, independent of variation in carcass weight and fatness. Melting point and degree of saturation decreased as age increased. Step-down discriminant analyses identified a set of three acids (14:0, 16:0, and 17:1) that differed among sire breeds, independent of differences in melting point: the acids 14:0 and 16:0 discriminated between Brahman and Bos taurus steers and 17:1 between Hereford and Simmental and Friesian steers. Increase in fatness was associated with an increase in 17:1, but, at the same fatness, no acids discriminated among the Bos taurus-sired steers. The use of Bos indicus cattle or their crossbreeds in situations in which hard-setting fat is likely may mitigate the problem. PMID:9464888

  7. Effects of time of suckling during the solar day on duration of the postpartum anovulatory interval in Brahman x Hereford (F1) cows.

    Science.gov (United States)

    Gazal, O S; Guzman-Vega, G A; Williams, G L

    1999-05-01

    Previously published reports have indicated that postpartum anovulatory intervals can be markedly reduced and rebreeding performance enhanced in Bos taurus cows by eliminating nighttime suckling. We sought to confirm this hypothesis by examining the effects of day, nighttime, and ad libitum suckling on suckling behavior of calves, duration of the postpartum anovulatory interval, and pregnancy rates in 45 fall-calving Brahman x Hereford (F1) cows. Beginning on d 9 to 12 postpartum, calves were removed from lactating cows from 0700 to 1900 (Night-Suckled, n = 15) or from 1900 to 0700 (Day-Suckled, n = 15), or remained with their dams continuously (Ad Libitum-Suckled, n = 15). Cows in each group were maintained with fertile Angus bulls from d 10 postpartum until the first normal luteal phase or 100 d postpartum, whichever occurred first. Cows were observed for estrous behavior twice daily, and jugular blood samples were collected twice weekly for the determination of serum progesterone concentration. Mean number of suckling episodes per 24 h was greater (P or = 1 ng/mL (32+/-2.5, 32+/-4.5, and 31+/-1.7 d, respectively), first normal luteal phase (38+/-3.1, 38+/-3.8, and 37+/-2.5 d, respectively), and first estrus (43+/-3.5, 40+/-3.9, and 36+/-1.1 d, respectively) did not differ (P > .05) among the three groups. Similarly, cumulative pregnancy rates within 100 d after calving did not differ (P > .05). These results in Bos indicus x Bos taurus (F1) cattle do not support the previous conclusions in Bos taurus that eliminating nighttime suckling reduces the postpartum anovulatory interval. PMID:10340568

  8. Interstellar Polarization in the Taurus Dark Clouds, Wavelength Dependent Position Angles and Cloud Structure Near TMC-1

    CERN Document Server

    Messinger, D W; Roberge, W G

    1997-01-01

    We use polarimetric observations of two stars (HD29647, HD283809) in the general direction of TMC-1 in the Taurus Dark Cloud to investigate grain properties and cloud structure in this region. We show the data to be consistent with a simple two-component model, in which general interstellar polarization in the Taurus Cloud is produced by a widely distributed cloud component with relatively uniform magnetic field orientation; the light from stars close to TMC-1 suffers additional polarization arising in one (or more) subcloud(s) with larger average grain size and different magnetic field directions compared with the general trend. Towards HD29647, in particular, we show that the unusually low degree of visual polarization relative to extinction is due to the presence of distinct cloud components in the line of sight with markedly different magnetic field orientations. Stokes parameter calculations allow us to separate out the polarization characteristics of the individual components. Results are fit with the S...

  9. Expression of KCNQ1OT1, CDKN1C, H19, and PLAGL1 and the methylation patterns at the KvDMR1 and H19/IGF2 imprinting control regions is conserved between human and bovine

    Directory of Open Access Journals (Sweden)

    Robbins Katherine

    2012-11-01

    Full Text Available Abstract Background Beckwith-Wiedemann syndrome (BWS is a loss-of-imprinting pediatric overgrowth syndrome. The primary features of BWS include macrosomia, macroglossia, and abdominal wall defects. Secondary features that are frequently observed in BWS patients are hypoglycemia, nevus flammeus, polyhydramnios, visceromegaly, hemihyperplasia, cardiac malformations, and difficulty breathing. BWS is speculated to occur primarily as the result of the misregulation of imprinted genes associated with two clusters on chromosome 11p15.5, namely the KvDMR1 and H19/IGF2. A similar overgrowth phenotype is observed in bovine and ovine as a result of embryo culture. In ruminants this syndrome is known as large offspring syndrome (LOS. The phenotypes associated with LOS are increased birth weight, visceromegaly, skeletal defects, hypoglycemia, polyhydramnios, and breathing difficulties. Even though phenotypic similarities exist between the two syndromes, whether the two syndromes are epigenetically similar is unknown. In this study we use control Bos taurus indicus X Bos taurus taurus F1 hybrid bovine concepti to characterize baseline imprinted gene expression and DNA methylation status of imprinted domains known to be misregulated in BWS. This work is intended to be the first step in a series of experiments aimed at determining if LOS will serve as an appropriate animal model to study BWS. Results The use of F1 B. t. indicus x B. t. taurus tissues provided us with a tool to unequivocally determine imprinted status of the regions of interest in our study. We found that imprinting is conserved between the bovine and human in imprinted genes known to be associated with BWS. KCNQ1OT1 and PLAGL1 were paternally-expressed while CDKN1C and H19 were maternally-expressed in B. t. indicus x B. t. taurus F1 concepti. We also show that in bovids, differential methylation exists at the KvDMR1 and H19/IGF2 ICRs. Conclusions Based on these findings we conclude that the

  10. Organic facies characteristics of the Carboniferous Pamucakyayla Formation, western Taurus, Antalya Nappes, Kemer (Antalya/Turkey)

    Science.gov (United States)

    Bertan Gulludag, Cevdet; Altunsoy, Mehmet; Ozcelik, Orhan

    2015-04-01

    The study area is located in the western part of the Taurus Belt (SW Turkey). This region exhibits a complex structure involving two autochthonous units surrounded and imbricated with three allochthonous complexes. Antalya Nappes is a complex tectonic imbricate structure including sedimantary and ultrabasic rocks. In this study, organic facies characteristics of Carboniferous coaly units in the Pamucakyayla region (Kemer, Antalya-Turkey) were examined. The Carboniferous Pamucakyayla Formation, which is characterized by sandstone, claystone, marl and coaly units. This units includes different levels of coal seams in different thicknesses. Organic matter is composed predominantly of woody and amorphous material, with a minor contribution of planty and coaly material. Kerogen in the deposits is type II/III, as indicated by organic petrographic observations and Rock-Eval data. Total organic carbon (TOC) values are generally between 0.01 and 1.44 %, but reach 5.81 % in the formation. Tmax values vary between 446 and 451 °C and indicate mature zone (Based on the value of 0.25 % TOC). Organic facies type BC, C and CD were identified in the investigated units. Organic facies BC is related sandstoneand marl lithofacies. This facis is deposited under an anoxic water column in a fine grained clastics, where rapid deposition creates anoxia in the sediments after deposition. This facies is characterized by average values of HI around 317 (equivalent to type II kerogene), TOC around 0.02 %, and an average of S2 of 0.04 mg HC/g of rock. Organic facies C is related to sandstone, marl and coal lithofacies. This facies is characterized by average values of HI around 176 (equivalent to type III kerogene), TOC around 0.19 %, and an average of S2 of 0.03 mg HC/g of rock. The organic matter is partly oxidized, and terrestrial. Organic facies C is the "gas-prone" facies. Organic facies CD is related to limestone, marl and coal lithofacies. This facies is characterized by average values

  11. Complete genome sequence of a new begomovirus associated with yellow mosaic disease of Hemidesmus indicus in India.

    Science.gov (United States)

    Reddy, M Sreekanth; Kanakala, S; Srinivas, K P; Hema, M; Malathi, V G; Sreenivasulu, P

    2014-05-01

    The complete DNA A genome of a virus isolate associated with yellow mosaic disease of a medicinal plant, Hemidesmus indicus, from India was cloned and sequenced. The length of DNA A was 2825 nucleotides, 35 nucleotides longer than the unit genome of monopartite begomoviruses. Comparison of the nucleotide sequence of DNA A of the virus isolate with those of other begomoviruses showed maximum sequence identity of 69 % to DNA A of ageratum yellow vein China virus (AYVCNV; AJ558120) and 68 % with tomato yellow leaf curl virus- LBa4 (TYLCV; EF185318), and it formed a distinct clade in phylogenetic analysis. The genome organization of the present virus isolate was found to be similar to that of Old World monopartite begomoviruses. The genome was considered to be monopartite, because association of DNA B and β satellite DNA components was not detected. Based on its sequence identity (yellow mosaic virus" (HeYMV) is proposed.

  12. Dicty_cDB: Contig-U16181-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s taurus Y Chr NOVECTOR CH240-507F20 (Children'... 48 0.79 1 ( AC232941 ) Bos taurus Y Chr NOVECTOR CH240-255J15 (Children...'... 48 0.79 1 ( AC232940 ) Bos taurus Y Chr NOVECTOR CH240-62I11 (Children's... 48 0.79 1 ( A...C232929 ) Bos taurus Y Chr NOVECTOR CH240-291F15 (Children'... 48 0.79 1 ( AC232768 ) Bos taurus Y Chr NOVECTOR CH240-460C15 (Childre...n'... 48 0.79 1 ( AC232755 ) Bos taurus Y Chr NOVECTOR CH240-409J7 (Children...'s... 48 0.79 1 ( AC232753 ) Bos taurus Y Chr NOVECTOR CH240-45P20 (Children's... 48 0.7

  13. Effects of breed group by location interaction on crossbred cattle in Nebraska and Florida.

    Science.gov (United States)

    Olson, T A; Euclides Filho, K; Cundiff, L V; Koger, M; Butts, W T; Gregory, K E

    1991-01-01

    Data on 2,744 calves produced in Clay Center, Nebraska and Brooksville, Florida were used to evaluate the importance of genotype x location interactions on the reproductive and maternal performance of eight breed groups of F1 crossbred cows. A total of 648 F1 crossbred cows included Bos taurus x Bos taurus (Bt x Bt) crosses: Hereford x Angus reciprocal crossbreds (HA and AH), Pinzgauer x Angus (PA), Pinzgauer x Hereford (PH); and Bos indicus x Bos taurus (Bi x Bt) crosses: Brahman x Angus (BA), Brahman x Hereford (BH), Sahiwal x Angus (SA) and Sahiwal x Hereford (SH). The first calf crop was sired by Red Poll bulls. All remaining calf crops were sired by Simmental bulls. Although the pregnancy rate was 9% higher in Nebraska, the rate of unassisted calvings and calf survival rate were both 4.6% lower in Nebraska. Calf birth and weaning weights were 8.0 and 15.6 kg heavier in Nebraska than in Florida. Bi x Bt dams exceeded (P less than .001) Bt x Bt crossbred dams for all traits except age of calf at weaning and calf-survival rates (P greater than .10). Birth weights of calves from Bi x Bt crossbred dams were 3.4 kg lighter than those from the Bt x Bt crossbred dams. The interaction of location with the breed group comparison of Bi x Bt vs Bt x Bt crossbred dams was significant for pregnancy rate, calf age at weaning, rate of unassisted calving and all weight traits. Adjusted weaning weights of calves from HA, AH, PA, PH, BA, BH, SA and SH cows were as follows: HA, 194 and 222; AH, 202 and 230; PA, 213 and 242; PH, 217 and 245; BA, 251 and 254; BH, 252 and 254; SA, 236 and 238; and SH, 238 and 243 kg, respectively, in Florida and Nebraska. Bos indicus-sired cows (BA, BH, SA and SH) weaned essentially equal-weight calves at both locations, whereas calves from Bt x Bt crossbred cows (HA, AH, PA, PH) were about 28 kg lighter in Florida. PMID:2005003

  14. Effects of breed group by location interaction on crossbred cattle in Nebraska and Florida.

    Science.gov (United States)

    Olson, T A; Euclides Filho, K; Cundiff, L V; Koger, M; Butts, W T; Gregory, K E

    1991-01-01

    Data on 2,744 calves produced in Clay Center, Nebraska and Brooksville, Florida were used to evaluate the importance of genotype x location interactions on the reproductive and maternal performance of eight breed groups of F1 crossbred cows. A total of 648 F1 crossbred cows included Bos taurus x Bos taurus (Bt x Bt) crosses: Hereford x Angus reciprocal crossbreds (HA and AH), Pinzgauer x Angus (PA), Pinzgauer x Hereford (PH); and Bos indicus x Bos taurus (Bi x Bt) crosses: Brahman x Angus (BA), Brahman x Hereford (BH), Sahiwal x Angus (SA) and Sahiwal x Hereford (SH). The first calf crop was sired by Red Poll bulls. All remaining calf crops were sired by Simmental bulls. Although the pregnancy rate was 9% higher in Nebraska, the rate of unassisted calvings and calf survival rate were both 4.6% lower in Nebraska. Calf birth and weaning weights were 8.0 and 15.6 kg heavier in Nebraska than in Florida. Bi x Bt dams exceeded (P less than .001) Bt x Bt crossbred dams for all traits except age of calf at weaning and calf-survival rates (P greater than .10). Birth weights of calves from Bi x Bt crossbred dams were 3.4 kg lighter than those from the Bt x Bt crossbred dams. The interaction of location with the breed group comparison of Bi x Bt vs Bt x Bt crossbred dams was significant for pregnancy rate, calf age at weaning, rate of unassisted calving and all weight traits. Adjusted weaning weights of calves from HA, AH, PA, PH, BA, BH, SA and SH cows were as follows: HA, 194 and 222; AH, 202 and 230; PA, 213 and 242; PH, 217 and 245; BA, 251 and 254; BH, 252 and 254; SA, 236 and 238; and SH, 238 and 243 kg, respectively, in Florida and Nebraska. Bos indicus-sired cows (BA, BH, SA and SH) weaned essentially equal-weight calves at both locations, whereas calves from Bt x Bt crossbred cows (HA, AH, PA, PH) were about 28 kg lighter in Florida.

  15. SMA and CARMA observations of young brown dwarfs in ρ Ophiuchi and Taurus

    Directory of Open Access Journals (Sweden)

    Lee C.-F.

    2011-07-01

    Full Text Available Molecular outflows provide vital information about the earliest stages in the birth of stars, studying the molecular outflow properties is therefore crucial for understanding how stars form. Brown dwarfs with masses between that of stars and planets are not massive enough to maintain stable hydrogen-burning fusion reactions during most of their lifetime. Their origins are subject to much debate in recent literature because their masses are far below the typical mass where core collapse is expected to occur. Based on Submillimeter Array (SMA and Combined Array for Research in Millimeter-wave Astronomy (CARMA observations, we present the first detections of bipolar molecular outflows from young brown dwarfs in ρ Ophiuchi and Taurus. Our results demonstrate that the bipolar molecular outflow operates down to brown dwarf masses, occurring in brown dwarfs as a scaled-down version of the universal process seen in young low-mass stars. This demonstrates that brown dwarfs and low-mass stars likely share the same formation mechanism.

  16. Variation in dust properties in a dense filament of the Taurus molecular complex (L1506)

    CERN Document Server

    Ysard, Nathalie; Ristorcelli, Isabelle; Juvela, Mika; Pagani, Laurent; Konyves, Vera; Spencer, Locke; White, Glenn; Zavagno, Annie

    2013-01-01

    We observed the L1506 filament, which is located in the Taurus molecular complex, with the Herschel PACS and SPIRE instruments. Our aim is to prove the variation in grain properties along the entire length of the filament. In particular, we want to determine above which gas density this variation arises and what changes in the grain optical properties/size distribution are required. We use the 3D radiative transfer code CRT, coupled to the dust emission and extinction code DustEM, to model the emission and extinction of the dense filament. We test a range of optical properties and size distributions for the grains: dust of the diffuse interstellar medium (interstellar PAHs and amorphous carbons and silicates) and both compact and fluffy aggregates. We find that the grain opacity has to increase across the filament to fit simultaneously the near-IR extinction and Herschel emission profiles of L1506. We interpret this change to be a consequence of the coagulation of dust grains to form fluffy aggregates. Grains...

  17. The behavioural and genetic mating system of the sand tiger shark, Carcharias taurus, an intrauterine cannibal.

    Science.gov (United States)

    Chapman, Demian D; Wintner, Sabine P; Abercrombie, Debra L; Ashe, Jimiane; Bernard, Andrea M; Shivji, Mahmood S; Feldheim, Kevin A

    2013-06-23

    Sand tiger sharks (Carcharias taurus) have an unusual mode of reproduction, whereby the first embryos in each of the paired uteri to reach a certain size ('hatchlings') consume all of their smaller siblings during gestation ('embryonic cannibalism' or EC). If females commonly mate with multiple males ('behavioural polyandry') then litters could initially have multiple sires. It is possible, however, that EC could exclude of all but one of these sires from producing offspring thus influencing the species genetic mating system ('genetic monogamy'). Here, we use microsatellite DNA profiling of mothers and their litters (n = 15, from two to nine embryos per litter) to quantify the frequency of behavioural and genetic polyandry in this system. We conservatively estimate that nine of the females we examined (60%) were behaviourally polyandrous. The genetic mating system was characterized by assessing sibling relationships between hatchlings and revealed only 40 per cent genetic polyandry (i.e. hatchlings were full siblings in 60% of litters). The discrepancy stemmed from three females that were initially fertilized by multiple males but only produced hatchlings with one of them. This reveals that males can be excluded even after fertilizing ova and that some instances of genetic monogamy in this population arise from the reduction in litter size by EC. More research is needed on how cryptic post-copulatory and post-zygotic processes contribute to determining paternity and bridging the behavioural and genetic mating systems of viviparous species. PMID:23637391

  18. A radio survey of weak T Tauri stars in Taurus-Auriga

    International Nuclear Information System (INIS)

    A multi-epoch 5 GHz survey of candidate or confirmed weak T Tauri stars in the Taurus-Auriga molecular cloud complex was conducted with the Very Large Array. The stars were chosen from those having detectable X-ray or chromospheric emission, and weak-emission-line pre-main-sequence stars found by other means. Snapshots of 99 VLA fields containing 119 candidate stars were obtained with a sensitivity of 0.7 mJy; most fields were observed on two or three dates. Nine radio sources coincident with cataloged stars were found. One may be an RS CVn binary system; the other eight are pre-main-sequence stars. Three of the detected stars - HD 283447, V410 Tau, and FK X-ray 1 - were previously known radio sources. Five new detections are Herbig's Anon 1, Hubble 4, HDE 283572, Elias 12, and HK Tau/c. At least five of the sources are variable, and no linear or circular polarization was found. Several lines of evidence suggest that the radio-detected weak T Tauri stars are quite young, perhaps younger on average than nondetected stars. 54 refs

  19. Determining the 3D Subsurface Density Structure of Taurus Littrow Valley Using Apollo 17 Gravity Data

    Science.gov (United States)

    Urbancic, N.; Ghent, R.; Stanley, S,; Johnson, C. L.; Carroll, K. A.; Hatch, D.; Williamson, M. C.; Garry, W. B.; Talwani, M.

    2016-01-01

    Surface gravity surveys can detect subsurface density variations that can reveal subsurface geologic features. In 1972, the Apollo 17 (A17) mission conducted the Traverse Gravimeter Experiment (TGE) using a gravimeter that measured the local gravity field near Taurus Littrow Valley (TLV), located on the south-eastern rim of the Serenitatis basin. TLV is hypothesized to be a basaltfilled radial graben resulting from the impact that formed Mare Serenitatis. It is bounded by both the North and South Massifs (NM and SM) as well as other smaller mountains to the East that are thought to be mainly composed of brecciated highland material. The TGE is the first and only successful gravity survey on the surface of the Moon. Other more recent satellite surveys, such as NASA's Gravity Recovery and Interior Laboratory (GRAIL) mission (2011- 2012), have produced the best global gravity field to date (approx. 13km resolution). However, these satellite surveys are not sensitive enough to detect fine-scale (data collected at the surface by A17. In the original analysis of the data a 2D forward-modelling approach was used to derive a thickness of the subsurface basalt layer of 1.0 km by assuming a simple flat-faced rectangular geometry and using densities derived from Apollo lunar samples. We are investigating whether modern 3D modelling techniques in combination with high-resolution topographical and image datasets can reveal additional fine-scale subsurface structure in TLV.

  20. AGE ESTIMATION AND MASS FUNCTIONS OF TTAURI STARS IN THE TAURUS AURIGA MOLECULAR CLOUD

    Directory of Open Access Journals (Sweden)

    I. Küçük

    2010-01-01

    Full Text Available En este trabajo se han calculado las funciones de masas en la actualidad (PDMF de las estrellas T-Tauri (TTS que est n en la fase evolutiva de presecuencia principal (PMS en el complejo de nubes moleculares de Taurus-Auriga. Con este n, mediante la aplicaci n de nuestro c digo modi cado de evoluci n estelar se utilizan modelos estelares en el intervalo de masa de 0:1 - 2:5 M para determinar la masa y la masa de edad de las TTS. La funci n de la masa obtenida se compara con la funci n de masa de Miller & Scalo (1979. La edad encontrada para las TTS es de alrededor de 1-3x10 6 a os y la funci n de masa es de aproximadamente 0.644-+0.348. De estos resultados, hemos calculado la tasa de formaci n estelar como de alrededor de 1.3 x 10-7 M a o-1 en esta regi n.

  1. FIRST ISOLATION OF TENACIBACULUM MARITIMUM IN A CAPTIVE SAND TIGER SHARK (CARCHARIAS TAURUS).

    Science.gov (United States)

    Florio, Daniela; Gridelli, Stefano; Fioravanti, Maria Letizia; Zanoni, Renato Giulio

    2016-03-01

    This report describes a case of the first isolation of Tenacibaculum maritimum from a captive-bred adult female sand tiger shark (Carcharias taurus) housed at the Cattolica Aquarium (Italy). The animal showed, between the second dorsal fin and the precaudal pit, skin lesions characterized by the presence of abundant whitish necrotic tissue. Through routine bacteriological examination, a bacterium was isolated from a skin lesion and subsequently identified as T. maritimum by phenotypic characters and species-specific polymerase chain reaction. The antimicrobial sensitivity of the isolated strain was evaluated for 11 antimicrobial agents by disk diffusion method. Antibiotic therapy was conducted with enrofloxacin at 10 mg kg(-1) i.m. on alternate days for 10 days. One month after the end of treatment skin lesions showed complete resolution and the shark recovered completely. The case presented here represents the first report of infection by T. maritimum in a sand tiger shark and highlights the potential pathogenic role of this microorganism in elasmobranchs kept in an aquarium. PMID:27010301

  2. Classifying the embedded young stellar population in Perseus and Taurus & the LOMASS database

    CERN Document Server

    Carney, M T; Mottram, J C; van Dishoeck, E F; Ramchandani, J; Jørgensen, J K

    2016-01-01

    Context. The classification of young stellar objects (YSOs) is typically done using the infrared spectral slope or bolometric temperature, but either can result in contamination of samples. More accurate methods to determine the evolutionary stage of YSOs will improve the reliability of statistics for the embedded YSO population and provide more robust stage lifetimes. Aims. We aim to separate the truly embedded YSOs from more evolved sources. Methods. Maps of HCO+ J=4-3 and C18O J=3-2 were observed with HARP on the James Clerk Maxwell Telescope (JCMT) for a sample of 56 candidate YSOs in Perseus and Taurus in order to characterize emission from high (column) density gas. These are supplemented with archival dust continuum maps observed with SCUBA on the JCMT and Herschel PACS to compare the morphology of the gas and dust in the protostellar envelopes. The spatial concentration of HCO+ J=4-3 and 850 micron dust emission are used to classify the embedded nature of YSOs. Results. Approximately 30% of Class 0+I ...

  3. Chemistry in Disks X: The Molecular Content of Proto-planetary Disks in Taurus

    CERN Document Server

    Guilloteau, S; Dutrey, A; Chapillon, E; Wakelam, V; Piétu, V; Di Folco, E; Semenov, D; Henning, Th

    2016-01-01

    (abridged) We used the IRAM 30-m to perform a sensitive wideband survey of 30 protoplanetary disks in the Taurus Auriga region. We simultaneously observed HCO$^+$(3-2), HCN(3-2), C$_2$H(3-2), CS(5-4), and two transitions of SO. We combine the results with a previous survey which observed $^{13}$CO (2-1), CN(2-1), two o-H$_2$CO lines and one of SO. We use available interferometric data to derive excitation temperatures of CN and C$_2$H in several sources. We determine characteristic sizes of the gas disks and column densities of all molecules using a parametric power-law disk model. Our study is mostly sensitive to molecules at 200-400 au from the stars. We compare the derived column densities to the predictions of an extensive gas-grain chemical disk model, under conditions representative of T Tauri disks. This survey provides 20 new detections of HCO$^+$ in disks, 18 in HCN, 11 in C$_2$H, 8 in CS and 4 in SO. HCO$^+$ is detected in almost all sources, and its J=3-2 line is essentially optically thick, provid...

  4. Molecular line study of the very young protostar IRAM 04191 in Taurus Infall, rotation, and outflow

    CERN Document Server

    Belloche, A; Despois, D; Blinder, S M

    2002-01-01

    We present a detailed millimeter line study of the circumstellar environment of the low-luminosity Class 0 protostar IRAM 04191+1522 in the Taurus molecular cloud. New line observations demonstrate that the ~14000 AU radius protostellar envelope is undergoing both extended infall and fast, differential rotation. Radiative transfer modeling of multitransition CS and C34S maps indicate an infall velocity v_inf ~ 0.15 km/s at r ~ 1500 AU and v_inf ~ 0.1 km/s up to r ~ 11000 AU, as well as a rotational angular velocity Omega ~ 3.9 x 10^{-13} rad/s, strongly decreasing with radius beyond 3500 AU down to a value Omega ~ 1.5-3 x 10^{-14} rad/s at ~ 11000 AU. Two distinct regions, which differ in both their infall and their rotation properties, therefore seem to stand out: the inner part of the envelope (r ~< 2000-4000 AU) is rapidly collapsing and rotating, while the outer part undergoes only moderate infall/contraction and slower rotation. These contrasted features suggest that angular momentum is conserved in t...

  5. Rotationally-supported disks around Class I sources in Taurus: disk formation constraints

    CERN Document Server

    Harsono, Daniel; van Dishoeck, Ewine F; Hogerheijde, Michiel R; Bruderer, Simon; Persson, Magnus V; Mottram, Joseph C

    2013-01-01

    (Abridged) Disks are observed around pre-main sequence stars, but how and when they form is still heavily debated. While disks around young stellar objects have been identified through thermal dust emission, spatially and spectrally resolved molecular line observations are needed to determine their nature. We present subarcsecond observations of dust and gas toward four Class I low-mass young stellar objects in Taurus. The 13CO and C18O J=2-1 transitions at 220 GHz were observed with the Plateau de Bure Interferometer at a spatial resolution of ~0.8'' and analyzed using uv-space position velocity diagrams to determine the nature of their observed velocity radient. Rotationally supported disks (RSDs) are detected around 3 of the 4 Class I sources studied. The derived masses identify them as Stage I objects; i.e., their stellar mass is higher than their envelope and disk masses. The outer radii of the Keplerian disks toward our sample of Class I sources are 100 AU around these sources are dominated by infallin...

  6. The JCMT Legacy Survey of the Gould Belt: a first look at Taurus with HARP

    CERN Document Server

    Davis, C J; Hatchell, J; Wouterloot, J G A; Buckle, J V; Nutter, D; Fich, M; Brunt, C; Butner, H; Cavanagh, B; Curtis, E I; Duarte-Cabral, A; Di Francesco, J; Etxaluze, M; Friberg, P; Friesen, R; Fuller, G A; Graves, S; Greaves, J S; Hogerheijde, M R; Johnstone, D; Matthews, B; Matthews, H; Rawlings, J M C; Richer, J S; Roberts, J; Sadavoy, S; Simpson, R J; Tothill, N; Tsamis, Y; Viti, S; Ward-Thompson, D; White, Glenn J; Yates, J

    2010-01-01

    As part of a JCMT Legacy Survey of star formation in the Gould Belt, we present early science results for Taurus. CO J=3-2 maps have been secured along the north-west ridge and bowl, collectively known as L 1495, along with deep 13CO and C18O J=3-2 maps in two sub-regions. With these data we search for molecular outflows, and use the distribution of flows, HH objects and shocked H2 line emission features, together with the population of young stars, protostellar cores and starless condensations to map star formation across this extensive region. In total 21 outflows are identified. It is clear that the bowl is more evolved than the ridge, harbouring a greater population of T Tauri stars and a more diffuse, more turbulent ambient medium. By comparison, the ridge contains a much younger, less widely distributed population of protostars which, in turn, is associated with a greater number of molecular outflows. We estimate the ratio of the numbers of prestellar to protostellar cores in L 1495 to be ~ 1.3-2.3, and...

  7. The behavioural and genetic mating system of the sand tiger shark, Carcharias taurus, an intrauterine cannibal.

    Science.gov (United States)

    Chapman, Demian D; Wintner, Sabine P; Abercrombie, Debra L; Ashe, Jimiane; Bernard, Andrea M; Shivji, Mahmood S; Feldheim, Kevin A

    2013-06-23

    Sand tiger sharks (Carcharias taurus) have an unusual mode of reproduction, whereby the first embryos in each of the paired uteri to reach a certain size ('hatchlings') consume all of their smaller siblings during gestation ('embryonic cannibalism' or EC). If females commonly mate with multiple males ('behavioural polyandry') then litters could initially have multiple sires. It is possible, however, that EC could exclude of all but one of these sires from producing offspring thus influencing the species genetic mating system ('genetic monogamy'). Here, we use microsatellite DNA profiling of mothers and their litters (n = 15, from two to nine embryos per litter) to quantify the frequency of behavioural and genetic polyandry in this system. We conservatively estimate that nine of the females we examined (60%) were behaviourally polyandrous. The genetic mating system was characterized by assessing sibling relationships between hatchlings and revealed only 40 per cent genetic polyandry (i.e. hatchlings were full siblings in 60% of litters). The discrepancy stemmed from three females that were initially fertilized by multiple males but only produced hatchlings with one of them. This reveals that males can be excluded even after fertilizing ova and that some instances of genetic monogamy in this population arise from the reduction in litter size by EC. More research is needed on how cryptic post-copulatory and post-zygotic processes contribute to determining paternity and bridging the behavioural and genetic mating systems of viviparous species.

  8. Two confirmed class I very low-mass objects in Taurus

    CERN Document Server

    Dang-Duc, C; Dao-Van, D T

    2016-01-01

    [GKH94] 41 and IRAS 04191+1523B were previously identified to be proto-brown dwarf candidates in Taurus. [GKH94] 41 was classified to be a class I object. The dereddened spectral energy distribution of the source was later found to be suggestive of a class II object. IRAS 04191+1523B is a class I object that is the secondary component of a binary. We determine the evolutionary stage of [GKH94] 41 and estimate the final masses of the two proto-brown dwarf candidates. We used archive millimeter observations to produce continuum maps and collected data from the literature to construct the spectral energy distribution of the targets. Our continuum maps revealed that both [GKH94] 41 and IRAS 04191+1523B are surrounded by envelopes. This provides direct evidence that [GKH94] 41 is a class I object, not class II, as previously classified. For IRAS 04191+1523B, our continuum map spatially resolved the binary. Our estimated final masses are below 49$^{+56}_{-27}$ $M_{\\rm J}$ and 75$^{+40}_{-26}$ $M_{\\rm J}$ for [GKH94...

  9. A GMRT survey of regions towards the Taurus Molecular Cloud at 323 and 608 MHz

    CERN Document Server

    Ainsworth, Rachael E; Green, David A; Scaife, Anna M M; Ray, Tom P

    2016-01-01

    We present observations of three active sites of star formation in the Taurus Molecular Cloud complex taken at 323 and 608 MHz (90 and 50 cm, respectively) with the Giant Metrewave Radio Telescope (GMRT). Three pointings were observed as part of a pathfinder project, targeted at the young stellar objects (YSOs) L1551 IRS 5, T Tau and DG Tau (the results for these target sources were presented in a previous paper). In this paper, we search for other YSOs and present a survey comprising of all three fields; a by-product of the large instantaneous field of view of the GMRT. The resolution of the survey is of order 10 arcsec and the best rms noise at the centre of each pointing is of order $100\\,\\mu$Jy beam$^{-1}$ at 323 MHz and $50\\,\\mu$Jy beam$^{-1}$ at 608 MHz. We present a catalogue of 1815 and 687 field sources detected above $5\\,\\sigma_{\\rm rms}$ at 323 and 608 MHz, respectively. A total of 440 sources were detected at both frequencies, corresponding to a total unique source count of 2062 sources. We compar...

  10. A Resolved Census of Millimeter Emission from Taurus Multiple Star Systems

    CERN Document Server

    Harris, Robert J; Wilner, David J; Kraus, Adam L

    2012-01-01

    We present a high angular resolution millimeter-wave dust continuum imaging survey of circumstellar material associated with individual components of 23 multiple star systems in the Taurus-Auriga young cluster. Combined with previous measurements, these new data permit a comprehensive look at how millimeter luminosity (a tracer of disk mass) relates to the separation and mass of a stellar companion. Approximately one third (28-37%) of individual stars in multiples have detectable millimeter emission, a rate half that for single stars (~62%). There is a strong correlation between the luminosity and projected separation (a_p) of a stellar pair. Wide pairs (a_p > 300 AU) have a similar luminosity distribution as single stars, medium pairs (a_p ~ 30-300 AU) are a factor of 5 fainter, and close pairs (a_p < 30 AU) are ~ 5 times fainter yet (aside from a small population of bright circumbinary disks). In most cases, the emission is dominated by a disk around the primary (or a wide tertiary in triples), but there...

  11. Chains of dense cores in the Taurus L1495/B213 complex

    CERN Document Server

    Tafalla, M

    2014-01-01

    (Abridged) We study the kinematics of the dense gas in the Taurus L1495/B213 filamentary region to investigate the mechanism of core formation. We use observations of N2H+(1-0) and C18O(2-1) carried out with the IRAM 30m telescope. We find that the dense cores in L1495/B213 are significantly clustered in linear chain-like groups about 0.5pc long. The internal motions in these chains are mostly subsonic and the velocity is continuous, indicating that turbulence dissipation in the cloud has occurred at the scale of the chains and not at the smaller scale of the individual cores. The chains also present an approximately constant abundance of N2H+ and radial intensity profiles that can be modeled with a density law that follows a softened power law. A simple analysis of the spacing between the cores using an isothermal cylinder model indicates that the cores have likely formed by gravitational fragmentation of velocity-coherent filaments. Combining our analysis of the cores with our previous study of the large-sc...

  12. The behavioural and genetic mating system of the sand tiger shark, Carcharias taurus, an intrauterine cannibal

    Science.gov (United States)

    Chapman, Demian D.; Wintner, Sabine P.; Abercrombie, Debra L.; Ashe, Jimiane; Bernard, Andrea M.; Shivji, Mahmood S.; Feldheim, Kevin A.

    2013-01-01

    Sand tiger sharks (Carcharias taurus) have an unusual mode of reproduction, whereby the first embryos in each of the paired uteri to reach a certain size (‘hatchlings’) consume all of their smaller siblings during gestation (‘embryonic cannibalism’ or EC). If females commonly mate with multiple males (‘behavioural polyandry’) then litters could initially have multiple sires. It is possible, however, that EC could exclude of all but one of these sires from producing offspring thus influencing the species genetic mating system (‘genetic monogamy’). Here, we use microsatellite DNA profiling of mothers and their litters (n = 15, from two to nine embryos per litter) to quantify the frequency of behavioural and genetic polyandry in this system. We conservatively estimate that nine of the females we examined (60%) were behaviourally polyandrous. The genetic mating system was characterized by assessing sibling relationships between hatchlings and revealed only 40 per cent genetic polyandry (i.e. hatchlings were full siblings in 60% of litters). The discrepancy stemmed from three females that were initially fertilized by multiple males but only produced hatchlings with one of them. This reveals that males can be excluded even after fertilizing ova and that some instances of genetic monogamy in this population arise from the reduction in litter size by EC. More research is needed on how cryptic post-copulatory and post-zygotic processes contribute to determining paternity and bridging the behavioural and genetic mating systems of viviparous species. PMID:23637391

  13. A New Method for Constraining Molecular Cloud Thickness: A study of Taurus, Perseus and Ophiuchus

    CERN Document Server

    Qian, Lei; Offner, Stella; Pan, Zhichen

    2015-01-01

    The core velocity dispersion (CVD) is a potentially useful tool for studying the turbulent velocity field of molecular clouds. CVD is based on centroid velocities of dense gas clumps, thus is less prone to density fluctuation and reflects more directly the cloud velocity field. Prior work demonstrated that the Taurus molecular cloud CVD resembles the well-known Larson's linewidth-size relation of molecular clouds. In this work, we studied the dependence of the CVD on the line-of-sight thickness of molecular clouds, a quantity which cannot be measured by direct means. We produced a simple statistical model of cores within clouds and analyzed the CVD of a variety of hydrodynamical simulations. We show that the relation between the CVD and the 2D projected separation of cores ($L_{2D}$) is sensitive to the cloud thickness. When the cloud is thin, the index of CVD-$L_{2D}$ relation ($\\gamma$ in the relation CVD$\\sim L_{2D}^{\\gamma}$) reflects the underlying energy spectrum ($E(k)\\sim k^{-\\beta}$) in that $\\gamma\\...

  14. A detailed mass distribution of a high-density core in Taurus with ALMA

    CERN Document Server

    Tokuda, Kazuki; Matsumoto, Tomoaki; Saigo, Kazuya; Kawamura, Akiko; Fukui, Yasuo; Inutsuka, Shu-ichiro; Machida, Masahiro N; Tomida, Kengo; Tachihara, Kengo; André, Philippe

    2016-01-01

    We present the results of ALMA observations of dust continuum emission and molecular rotational lines, including the ALMA Compact Array, toward a dense core MC27 (a.k.a. L1521F) in Taurus, which is considered to be at very early stage of star formation. Detailed column density distribution with a size scale from a few tens AU to ~10000 AU scale are revealed by combining the ALMA data and the single-dish data. The high angular resolution observation at 0.87 mm reveals that a protostellar source, MMS-1, is still not spatially resolved without gas association and a starless high-density core, MMS-2, has substructures both in dust and molecular emission. The averaged radial column density distribution of the inner part (r < 3000 AU) is N_H2 ~r^-0.4, clearly flatter than that of the outer part, ~r^-1.0. We found the complex velocity/spatial structure obtained with previous ALMA observations is located inside the inner flatter region, which may reflect the dynamical status of the dense core.

  15. Properties of Starless and Prestellar Cores in Taurus Revealed by Herschel SPIRE/PACS Imaging

    CERN Document Server

    Marsh, K A; Palmeirim, P; André, Ph; Kirk, J; Stamatellos, D; Ward-Thompson, D; Roy, A; Bontemps, S; Di Francesco, J; Elia, D; Hill, T; Konyves, V; Motte, F; Nguyen-Luong, Q; Peretto, N; Pezzuto, S; Rivera-Ingraham, A; Schneider, N; Spinoglio, L; White, G

    2014-01-01

    The density and temperature structures of dense cores in the L1495 cloud of the Taurus star-forming region are investigated using Herschel SPIRE and PACS images in the 70 $\\mu$m, 160 $\\mu$m, 250 $\\mu$m, 350 $\\mu$m and 500 $\\mu$m continuum bands. A sample consisting of 20 cores, selected using spectral and spatial criteria, is analysed using a new maximum likelihood technique, COREFIT, which takes full account of the instrumental point spread functions. We obtain central dust temperatures, $T_0$, in the range 6-12 K and find that, in the majority of cases, the radial density falloff at large radial distances is consistent with the $r^{-2}$ variation expected for Bonnor-Ebert spheres. Two of our cores exhibit a significantly steeper falloff, however, and since both appear to be gravitationally unstable, such behaviour may have implications for collapse models. We find a strong negative correlation between $T_0$ and peak column density, as expected if the dust is heated predominantly by the interstellar radiatio...

  16. VizieR Online Data Catalog: Spitzer observations of Taurus members (Luhman+, 2010)

    Science.gov (United States)

    Luhman, K. L.; Allen, P. R.; Espaillat, C.; Hartmann, L.; Calvet, N.

    2016-03-01

    For our census of the disk population in Taurus, we use images at 3.6, 4.5, 5.8, and 8.0um obtained with Spitzer's Infrared Array Camera (IRAC) and images at 24um obtained with the Multiband Imaging Photometer for Spitzer (MIPS). The cameras produced images with FWHM=1.6"-1.9" from 3.6 to 8.0um and FWHM=5.9" at 24um. The available data were obtained through Guaranteed Time Observations for PID = 6, 36, 37 (G. Fazio), 53 (G. Rieke), 94 (C. Lawrence), 30540 (G. Fazio, J. Houck), and 40302 (J. Houck), Director's Discretionary Time for PID = 462 (L. Rebull), Legacy programs for PID = 139, 173 (N. Evans), and 30816 (D. Padgett), and General Observer programs for PID = 3584 (D. Padgett), 20302 (P. Andre), 20386 (P. Myers), 20762 (J. Swift), 30384 (T. Bourke), 40844 (C. McCabe), and 50584 (D. Padgett). The IRAC and MIPS observations were performed through 180 and 137 Astronomical Observation Requests (AORs), respectively. The characteristics of the resulting images are summarized in Tables 1 and 2. (6 data files).

  17. The relation between gas and dust in the Taurus Molecular Cloud

    CERN Document Server

    Pineda, Jorge L; Chapman, Nicholas; Snell, Ronald L; Li, Di; Cambresy, Laurent; Brunt, Chris

    2010-01-01

    (abridged) We report a study of the relation between dust and gas over a 100deg^2 area in the Taurus molecular cloud. We compare the H2 column density derived from dust extinction with the CO column density derived from the 12CO and 13CO J= 1-0 lines. We derive the visual extinction from reddening determined from 2MASS data. The comparison is done at an angular size of 200", corresponding to 0.14pc at a distance of 140pc. We find that the relation between visual extinction Av and N(CO) is linear between Av~3 and 10 mag in the region associated with the B213--L1495 filament. In other regions the linear relation is flattened for Av > 4 mag. We find that the presence of temperature gradients in the molecular gas affects the determination of N(CO) by ~30--70% with the largest difference occurring at large column densities. Adding a correction for this effect and accounting for the observed relation between the column density of CO and CO2 ices and Av, we find a linear relationship between the column of carbon mon...

  18. FIRST ISOLATION OF TENACIBACULUM MARITIMUM IN A CAPTIVE SAND TIGER SHARK (CARCHARIAS TAURUS).

    Science.gov (United States)

    Florio, Daniela; Gridelli, Stefano; Fioravanti, Maria Letizia; Zanoni, Renato Giulio

    2016-03-01

    This report describes a case of the first isolation of Tenacibaculum maritimum from a captive-bred adult female sand tiger shark (Carcharias taurus) housed at the Cattolica Aquarium (Italy). The animal showed, between the second dorsal fin and the precaudal pit, skin lesions characterized by the presence of abundant whitish necrotic tissue. Through routine bacteriological examination, a bacterium was isolated from a skin lesion and subsequently identified as T. maritimum by phenotypic characters and species-specific polymerase chain reaction. The antimicrobial sensitivity of the isolated strain was evaluated for 11 antimicrobial agents by disk diffusion method. Antibiotic therapy was conducted with enrofloxacin at 10 mg kg(-1) i.m. on alternate days for 10 days. One month after the end of treatment skin lesions showed complete resolution and the shark recovered completely. The case presented here represents the first report of infection by T. maritimum in a sand tiger shark and highlights the potential pathogenic role of this microorganism in elasmobranchs kept in an aquarium.

  19. Cores, filaments, and bundles: hierarchical core formation in the L1495/B213 Taurus region

    CERN Document Server

    Hacar, A; Kauffmann, J; Kovacs, A

    2013-01-01

    (Abridged) Context. Core condensation is a critical step in the star-formation process, but is still poorly characterized observationally. Aims. We have studied the 10 pc-long L1495/B213 complex in Taurus to investigate how dense cores have condensed out of the lower-density cloud material. Results. From the N$_2$H$^+$ emission, we identify 19 dense cores, some starless and some protostellar. They are not distributed uniformly, but tend to cluster with relative separations on the order of 0.25 pc. From the C$^{18}$O emission, we identify multiple velocity components in the gas. We have characterized them by fitting gaussians to the spectra, and by studying the distribution of the fits in position-position-velocity space. In this space, the C$^{18}$O components appear as velocity-coherent structures, and we have identified them automatically using a dedicated algorithm (FIVe: Friends In Velocity). Using this algorithm, we have identified 35 filamentary components with typical lengths of 0.5 pc, sonic internal ...

  20. Herschel view of the Taurus B211/3 filament and striations: Evidence of filamentary growth?

    CERN Document Server

    Palmeirim, P; Kirk, J; Ward-Thompson, D; Arzoumanian, D; Könyves, V; Didelon, P; Schneider, N; Benedettini, M; Bontemps, S; Di Francesco, J; Elia, D; Griffin, M; Hennemann, M; Hill, T; Martin, P G; Men'shchikov, A; Molinari, S; Motte, F; Nutter, D; Peretto, N; Pezzuto, S; Roy, A; Rygl, K L J; Spinoglio, L; White, G

    2012-01-01

    We present first results from the Herschel Gould Belt survey for the B211/L1495 region in the Taurus molecular cloud. Thanks to their high sensitivity and dynamic range, the Herschel images reveal the structure of the dense, star-forming filament B211 with unprecedented detail, along with the presence of striations perpendicular to the filament and generally oriented along the magnetic field direction as traced by optical polarization vectors. Based on the column density and dust temperature maps derived from the Herschel data, we find that the radial density profile of the B211 filament approaches a power-law behavior {\\rho} {\\propto} r^(-2.0{\\pm}0.4) at large radii and that the temperature profile exhibits a marked drop at small radii. The observed density and temperature profiles of the B211 filament are in good agreement with a theoretical model of a cylindrical filament undergoing gravitational contraction with a polytropic equation of state: P {\\propto} {\\rho}^{\\gamma} and T {\\propto} {\\rho}^({\\gamma}-1...

  1. The XMM-Newton Optical Monitor Survey of the Taurus Molecular Cloud

    CERN Document Server

    Audard, M; Grosso, N; Güdel, M; Scelsi, L; Bouvier, J; Telleschi, A; Audard, Marc; Briggs, Kevin; Grosso, Nicolas; Guedel, Manuel; Scelsi, Luigi; Bouvier, Jerome; Telleschi, Alessandra

    2006-01-01

    The Optical Monitor (OM) on-board XMM-Newton obtained optical/ultraviolet data for the XMM-Newton Extended Survey of the Taurus Molecular Cloud (XEST), simultaneously with the X-ray detectors. With the XEST OM data, we aim to study the optical and ultraviolet properties of TMC members, and to do correlative studies between the X-ray and OM light curves. In particular, we aim to determine whether accretion plays a significant role in the optical/ultraviolet and X-ray emissions. The Neupert effect in stellar flares is also investigated. Coordinates, average count rates and magnitudes were extracted from OM images, together with light curves with low time resolution (a few kiloseconds). For a few sources, OM FAST mode data were also available, and we extracted OM light curves with high time resolution. The OM data were correlated with Two Micron All Sky Survey (2MASS) data and with the XEST catalogue in the X-rays. The XEST OM catalogue contains 2,148 entries of which 1,893 have 2MASS counterparts. However, only...

  2. Four New Dense Molecular Cores in the Taurus Molecular Cloud (TMC) Ammonia and Cyanodiacetylene Observations

    CERN Document Server

    Codella, C; Henkel, C; Benson, P; Myers, P C

    1997-01-01

    Trying to obtain a more complete picture of star forming regions in the Taurus Molecular Cloud, four newly discovered dense cores (L1521D, L1521F, L1524, L1507A) are identified and mapped through the ammonia (J,K)=(1,1) and (2,2) rotational inversion lines. These cores have sizes of 0.06-0.09 pc, hydrogen densities of order 10000 - 100000 cm-3 and kinetic temperatures between 8 and 10 K. The masses range from 0.2 - 1.0 solar masses, placing the cores with the lowest M values at the lower edge of the mass distribution for ammonia cores in the TMC. Turbulent, thermal and gravitational energies have been estimated. A comparison between these energy terms and considerations related to thermal and turbulent line broadening indicate that these cores are close to equilibrium. Moreover we report the detection of the J=9-8 transition of HC5N towards the four ammonia peak positions. The HC5N column densities are in agreement with values derived for other molecular cores in the TMC.

  3. Hvordan påvirker indvandrernes integration, ressourcer og diaspora deres bosætningspræferencer?

    DEFF Research Database (Denmark)

    Andersen, Hans Skifter

    Etniske minoriteters boligønsker må i vid udstrækning antages, at have de samme årsager, som generelt er fundet i forbindelse med studier af boligvalg i Danmark og andre europæiske lande. Men indvandreres bosætning i Danmark og andre lande afviger så meget fra den indfødte befolknings, at den ikk...

  4. Managing bronchiolitis obliterans syndrome (BOS) and chronic lung allograft dysfunction (CLAD) in children: what does the future hold?

    Science.gov (United States)

    Snell, Gregory I; Paraskeva, Miranda; Westall, Glen P

    2013-08-01

    The success of pediatric lung transplantation continues to be limited by long-term graft dysfunction. Historically this has been characterized as an obstructive spirometric defect in the form of the bronchiolitis obliterans syndrome (BOS). It is recognized, however, that this does not reflect many of the other acknowledged etiologies of chronic lung dysfunction-noting it is the sum of the parts that contribute to respiratory morbidity and mortality after transplant. The term chronic lung allograft dysfunction (CLAD) has been coined to reflect these other entities and, in particular, a group of relatively recently described lung disorders called the restrictive allograft syndrome (RAS). RAS is characterized by a restrictive spirometric defect. Although these entities have not yet been studied in a pediatric setting their association with poor compliance, antibody-mediated rejection (AMR), and post-infectious lung damage (particularly viral) warrants attention by pediatric lung transplant teams. Current therapy for the BOS subset of CLAD is otherwise limited to changing immunosuppressants and avoiding excessive infectious risk by avoiding over-immunosuppression. Long-term macrolide therapy in lung transplantation is not of proven efficacy. Reviewing previous BOS studies to explore restrictive spirometric cases and joint projects via groups like the International Pediatric Lung Transplant Collaborative will be the way forward to solve this pressing problem.

  5. Morphology and molecular analysis of Mizelleus indicus Jain () and M. longicirrus (Tripathi, ) Venkatanarasaiah & Kulkarni 1981 (Monogenea, Dactylogyridae) from the freshwater shark Wallago attu in the Ganga River, India.

    Science.gov (United States)

    Verma, C; Chaudhary, A; Singh, H S

    2016-09-01

    Species of the genus Mizelleus Jain (1957) have always been controversial regarding identification and validity. Members of this group of species differ from each other in the morphology of their hard parts, which can be misleading and subject to differing interpretation among scientists. Therefore, the main objective of present study was to identify Mizelleus worms by morphological methods and molecular analysis on the basis of 18S ribosomal DNA to clarify their phylogenetic status. In this study, specimens were isolated from the gill filaments of Wallago attu (Siluriformes) and studied morphologically. In accordance with morphological characters, the specimens were found to be Mizelleus indicus and Mizelleus longicirrus. Partial sequences of nuclear 18S rDNA of these two species were amplified. The results confirm the phylogenetic relationships and taxonomic validation of M. indicus and M. longicirrus in India.

  6. Morphology and molecular analysis of Mizelleus indicus Jain () and M. longicirrus (Tripathi, ) Venkatanarasaiah & Kulkarni 1981 (Monogenea, Dactylogyridae) from the freshwater shark Wallago attu in the Ganga River, India.

    Science.gov (United States)

    Verma, C; Chaudhary, A; Singh, H S

    2016-09-01

    Species of the genus Mizelleus Jain (1957) have always been controversial regarding identification and validity. Members of this group of species differ from each other in the morphology of their hard parts, which can be misleading and subject to differing interpretation among scientists. Therefore, the main objective of present study was to identify Mizelleus worms by morphological methods and molecular analysis on the basis of 18S ribosomal DNA to clarify their phylogenetic status. In this study, specimens were isolated from the gill filaments of Wallago attu (Siluriformes) and studied morphologically. In accordance with morphological characters, the specimens were found to be Mizelleus indicus and Mizelleus longicirrus. Partial sequences of nuclear 18S rDNA of these two species were amplified. The results confirm the phylogenetic relationships and taxonomic validation of M. indicus and M. longicirrus in India. PMID:26373618

  7. Full-length cloning and phylogenetic analyses of translationally controlled tumour protein and ferritin genes from the Indian white prawn, Fenneropenaeus indicus (H. Milne Edwards)

    Digital Repository Service at National Institute of Oceanography (India)

    Nayak, S.; Ramaiah, N.; Meena, R.M.; Sreepada, R.A.

    with antioxidant and innate immune responses, the increased expression of TCTP signifies it importance as an integral part of host response against bacterial challenges in cell death/apoptosis mechanisms. From the complete nucleotide sequence of the F. indicus...) The translationally controlled tumor protein (TCTP). The International Journal of Biochemistry & Cell Biology 36, 379-385. Chen H., Muramoto K.,Yamauchi F., Fujimoto K. & Nokihara K. (1998) Antioxidative properties of histidine-containing peptides designed from...

  8. Experimental evaluation of prophylactic and curative effect of a herbal drug Hemidesmus indicus R.Br. in drug induced ulcers in wistar albino rats

    Directory of Open Access Journals (Sweden)

    Shishira Bharadwaj

    2013-06-01

    Full Text Available Peptic Ulcers are the most common condition experienced by most of the people due to urbanized lifestyle. Hemidesmus indicus R.Br. is a herbal drug mentioned for its treatment in the ancient Indian traditional medicine. To compare the Prophylactic and Curative effects of aqueous and Alcoholic extracts of Hemidesmus indicus in Drug induced ulcers. Aqueous and Alcoholic extracts of the drug were studied for their ulcer healing activity in Wistar Albino rats. Ninety Wistar albino rats were divided into nine groups with one control, four prophylactic and four curative groups. Ulcers were induced with Indomethacin in a dose of 20 mg/kg body weight twice in a gap of 15 hours. Aqueous extract was given in a dose of 500 mg/kg body weight and alcohol in a dose of 100 mg/kg body weight. It was found that both have potential ulcer healing activity with alcoholic extract marginally better than aqueous extract. It can thus be concluded that Hemidesmus indicus R. Br is a effective drug in peptic ulcers. [Int J Res Med Sci 2013; 1(3.000: 243-247

  9. Grey nurse shark (Carcharias taurus) diving tourism: Tourist compliance and shark behaviour at Fish Rock, Australia.

    Science.gov (United States)

    Smith, Kirby; Scarr, Mark; Scarpaci, Carol

    2010-11-01

    Humans can dive with critically endangered grey nurse sharks (Carcharias taurus) along the east coast of Australia. This study investigated both compliance of tourist divers to a code of conduct and legislation and the behaviour of grey nurse sharks in the presence of divers. A total of 25 data collection dives were conducted from December 2008 to January 2009. Grey nurse shark and diver behaviour were documented using 2-min scan samples and continuous observation. The proportion of time spent observing human-shark interactions was 9.4% of total field time and mean human-shark interaction time was 15.0 min. Results were used to gauge the effectiveness of current management practices for the grey nurse shark dive industry at Fish Rock in New South Wales, Australia. Grey nurse shark dive tourists were compliant to stipulations in the code of conduct and legislation (compliance ranged from 88 to 100%). The research detailed factors that may promote compliance in wildlife tourism operations such as the clarity of the stipulations, locality of the target species and diver perceptions of sharks. Results indicated that grey nurse sharks spent the majority of their time milling (85%) followed by active swimming (15%). Milling behaviour significantly decreased in the presence of more than six divers. Distance between sharks and divers, interaction time and number of sharks were not significantly correlated with grey nurse shark school behaviour. Jaw gaping, rapid withdrawal and stiff or jerky movement were the specific behaviours of grey nurse sharks that occurred most frequently and were associated with distance between divers and sharks and the presence of six or more divers. Revision of the number of divers allowed per interaction with a school of grey nurse sharks and further research on the potential impacts that shark-diving tourism may pose to grey nurse sharks is recommended. PMID:20872140

  10. Nuclear and mitochondrial DNA reveals isolation of imperilled grey nurse shark populations (Carcharias taurus).

    Science.gov (United States)

    Ahonen, H; Harcourt, R G; Stow, A J

    2009-11-01

    Loss of sharks and other upper-trophic marine predators has sparked worldwide concern for the stability of ocean ecosystems. The grey nurse (ragged-tooth or sand tiger) shark (Carcharias taurus) is Vulnerable on a global scale, Critically Endangered in Australia and presumed extinct in parts of its historical range. We used 193 muscle and fin samples collected from six extant populations to assess global mtDNA and microsatellite diversity and the degree of global population genetic structure. Control region mtDNA diversity was low in every population, and two populations (eastern Australia and Japan) contained only a single mtDNA haplotype. Genetic signatures of recent losses of genetic variation were not yet apparent at microsatellite loci, indicating that this low mtDNA variation is not a result of anthropogenic population declines. Population differentiation was substantial between each population pair except Brazil and South Africa, F(ST) values ranged from 0.050 to 0.699 and 0.100 to 1.00 for microsatellite and mitochondrial data respectively. Bayesian analysis clearly partitioned individuals into five of the populations from which they were sampled. Our data imply a low frequency of immigrant exchange among each of these regions and we suggest that each be recognized as a distinct evolutionary significant unit. In contrast to pelagic species such as whale shark and white shark that may cross ocean basins and where cooperative international efforts are necessary for conservation, grey nurse shark, like many coastal species, need to be managed regionally.

  11. Ultrastructure of spermatozoa of Onthophagus taurus (Coleoptera, Scarabaeidae) exhibits heritable variation

    Science.gov (United States)

    Werner, Michael; Simmons, Leigh W.

    2011-03-01

    Sperm competition is thought to be an important selective pressure shaping sperm form and function. However, few studies have moved beyond gross examinations of sperm morphology. Sperm length is subject to sexual selection via sperm competition in the scarab beetle Onthophagus taurus. Here, the structure and ultrastructure of spermatozoa in this species were investigated using light and electron microscopy. Spermatozoa were found to be filiform, measuring about 1,200 mm in length. The sperm head consists of a three-layered acrosome and a nuclear region bearing the anterior extension of the centriole adjunct. Acrosome and nuclear regions are bilaterally symmetric, with their axes of symmetry being orthogonal to each other. Head and flagellar structures are connected by a well-developed centriole adjunct. The sperm heads are asymmetrically surrounded by accessory material and embedded into the cytoplasm of the spermatocyst cell. The accessory material is produced inside the spermatids and then transferred to the outside due to a new membrane formed around the sperm's organelles. The old spermatid membrane separates the accessory material from the cyst cell. The flagellum contains a 9+9+2 axoneme, two accessory bodies, and two mitochondrial derivatives of unequal size. The major mitochondrial derivative is significantly larger than the minor one. The axoneme is arranged in a sinusoidal manner parallel along the major mitochondrial derivative. The spermatozoa show no progressive motility when released in buffer solution which is likely to be the result of the flagellar arrangement and the structure of the major mitochondrial derivative. The cross-sectional area of the minor and the major mitochondrial derivatives show different patterns of genetic variation. The data provide the first estimates of genetic variation in sperm ultrastructure for any species, and give evidence for the persistence of genetic variation in ultrastructure required for the rapid and divergent

  12. A census of dense cores in the Taurus L1495 cloud from the Herschel

    Science.gov (United States)

    Marsh, K. A.; Kirk, J. M.; André, Ph.; Griffin, M. J.; Könyves, V.; Palmeirim, P.; Men'shchikov, A.; Ward-Thompson, D.; Benedettini, M.; Bresnahan, D. W.; Francesco, J. Di; Elia, D.; Motte, F.; Peretto, N.; Pezzuto, S.; Roy, A.; Sadavoy, S.; Schneider, N.; Spinoglio, L.; White, G. J.

    2016-06-01

    We present a catalogue of dense cores in a ˜4° × 2° field of the Taurus star-forming region, inclusive of the L1495 cloud, derived from Herschel SPIRE and PACS observations in the 70 μm, 160 μm, 250 μm, 350 μm, and 500 μm continuum bands. Estimates of mean dust temperature and total mass are derived using modified blackbody fits to the spectral energy distributions. We detect 525 starless cores of which ˜10-20 per cent are gravitationally bound and therefore presumably prestellar. Our census of unbound objects is ˜85 per cent complete for M > 0.015 M⊙ in low-density regions (AV ≲ 5 mag), while the bound (prestellar) subset is ˜85 per cent complete for M > 0.1 M⊙ overall. The prestellar core mass function (CMF) is consistent with lognormal form, resembling the stellar system initial mass function, as has been reported previously. All of the inferred prestellar cores lie on filamentary structures whose column densities exceed the expected threshold for filamentary collapse, in agreement with previous reports. Unlike the prestellar CMF, the unbound starless CMF is not lognormal, but instead is consistent with a power-law form below 0.3 M⊙ and shows no evidence for a low-mass turnover. It resembles previously reported mass distributions for CO clumps at low masses (M ≲ 0.3 M⊙). The volume density PDF, however, is accurately lognormal except at high densities. It is consistent with the effects of self-gravity on magnetized supersonic turbulence. The only significant deviation from lognormality is a high-density tail which can be attributed unambiguously to prestellar cores.

  13. Performance evaluation of bolt-cutter system on first Taurus launch

    Science.gov (United States)

    Baban, F.; Williams, R.; Amimoto, S.; Hansen, W.; Bixler, T.

    1994-10-01

    In rapid response to the request of the Space Test and Experimentation Directorate in Space Launch Operations, a launch-critical experimental investigation was conducted to evaluate the performance of a particular bolt-cutter system for separating stages on the first Taurus launch. The tests were to examine the variation of tension preloading on the bolt system and to demonstrate the tolerable margin on this parameter for such launches with the new types of bolts since the preloading was known to vary as much as 12% from a preset value before launch. We planned and carried out the experiment, designed and assembled the fixture to properly simulate flight application, and developed diagnostics. Four bolt cutters were purchased from the manufacturer for these tests, and one was provided by the contractor. In addition to the obvious requirement to demonstrate the successful severing of bolts under varying preloads, ignition-wire current and timing of chisel impact on the bolt were monitored. An optical diagnostic was designed to determine the flyout velocity and kinetic energy of the broken pieces. These latter measurements will be useful in anchoring performance codes simulating and assessing the structural dynamics of the bolt-cutter function for future missions. The tests were conducted successfully and the bolts were severed successfully in all five tests. The preloads were successively lowered from 2,500 lb to 2,250, 2,000, 1,500, and 1,000 lb These tests contributed in a timely manner to the STEP launch decision and to launch mission assurance. They demonstrated important margin to the nominally set 3,200 lb. preload. The entire complicated experimental program from inception to completion was accomplished in less than three weeks.

  14. Grey Nurse Shark ( Carcharias taurus) Diving Tourism: Tourist Compliance and Shark Behaviour at Fish Rock, Australia

    Science.gov (United States)

    Smith, Kirby; Scarr, Mark; Scarpaci, Carol

    2010-11-01

    Humans can dive with critically endangered grey nurse sharks ( Carcharias taurus) along the east coast of Australia. This study investigated both compliance of tourist divers to a code of conduct and legislation and the behaviour of grey nurse sharks in the presence of divers. A total of 25 data collection dives were conducted from December 2008 to January 2009. Grey nurse shark and diver behaviour were documented using 2-min scan samples and continuous observation. The proportion of time spent observing human-shark interactions was 9.4% of total field time and mean human-shark interaction time was 15.0 min. Results were used to gauge the effectiveness of current management practices for the grey nurse shark dive industry at Fish Rock in New South Wales, Australia. Grey nurse shark dive tourists were compliant to stipulations in the code of conduct and legislation (compliance ranged from 88 to 100%). The research detailed factors that may promote compliance in wildlife tourism operations such as the clarity of the stipulations, locality of the target species and diver perceptions of sharks. Results indicated that grey nurse sharks spent the majority of their time milling (85%) followed by active swimming (15%). Milling behaviour significantly decreased in the presence of more than six divers. Distance between sharks and divers, interaction time and number of sharks were not significantly correlated with grey nurse shark school behaviour. Jaw gaping, rapid withdrawal and stiff or jerky movement were the specific behaviours of grey nurse sharks that occurred most frequently and were associated with distance between divers and sharks and the presence of six or more divers. Revision of the number of divers allowed per interaction with a school of grey nurse sharks and further research on the potential impacts that shark-diving tourism may pose to grey nurse sharks is recommended.

  15. Grey nurse shark (Carcharias taurus) diving tourism: Tourist compliance and shark behaviour at Fish Rock, Australia.

    Science.gov (United States)

    Smith, Kirby; Scarr, Mark; Scarpaci, Carol

    2010-11-01

    Humans can dive with critically endangered grey nurse sharks (Carcharias taurus) along the east coast of Australia. This study investigated both compliance of tourist divers to a code of conduct and legislation and the behaviour of grey nurse sharks in the presence of divers. A total of 25 data collection dives were conducted from December 2008 to January 2009. Grey nurse shark and diver behaviour were documented using 2-min scan samples and continuous observation. The proportion of time spent observing human-shark interactions was 9.4% of total field time and mean human-shark interaction time was 15.0 min. Results were used to gauge the effectiveness of current management practices for the grey nurse shark dive industry at Fish Rock in New South Wales, Australia. Grey nurse shark dive tourists were compliant to stipulations in the code of conduct and legislation (compliance ranged from 88 to 100%). The research detailed factors that may promote compliance in wildlife tourism operations such as the clarity of the stipulations, locality of the target species and diver perceptions of sharks. Results indicated that grey nurse sharks spent the majority of their time milling (85%) followed by active swimming (15%). Milling behaviour significantly decreased in the presence of more than six divers. Distance between sharks and divers, interaction time and number of sharks were not significantly correlated with grey nurse shark school behaviour. Jaw gaping, rapid withdrawal and stiff or jerky movement were the specific behaviours of grey nurse sharks that occurred most frequently and were associated with distance between divers and sharks and the presence of six or more divers. Revision of the number of divers allowed per interaction with a school of grey nurse sharks and further research on the potential impacts that shark-diving tourism may pose to grey nurse sharks is recommended.

  16. Taurus Littrow Pyroclastic Deposit-An Optimum Feedstock for Lunar Oxygen

    Science.gov (United States)

    Allen, Carlton C.

    2014-01-01

    Future human habitation of the Moon will likely require the use of locally derived materials because of the high cost of transportation from Earth. Oxygen, extracted from oxides and silicates, is a potentially abundant lunar resource vital for life support and spacecraft propulsion. The anticipated costs of supplying all oxygen needs for a lunar base from Earth are high enough to warrant serious study of oxygen production from local resources. Over 20 different processes have been proposed for oxygen production on the Moon. Among the simplest and best studied of these processes is the reduction of oxides in lunar minerals and glass using hydrogen gas. Oxygen can be extracted from lunar soils and pyroclastic glass beads by exposing the samples to flowing hydrogen at subsolidus temperatures (approx. 1050 C). Total oxygen yield is directly correlated to the sample's abundance of FeO, but is not correlated to the abundance of any other oxide. Oxygen is extracted predominantly from FeO, with lesser contributions from TiO2 and SiO2. Oxygen yield is independent of soil maturity. All major FeO-bearing phases contribute oxygen, with extraction from ilmenite and glass significantly more efficient than from olivine and pyroxene. This study demonstrates that the optimum location for a lunar resources demonstration mission can be identified, and that the oxygen yield can be predicted, using a combination of high-resolution imaging and thermal-infrared data. A mission to Taurus Littrow will encounter a deposit at least 10 m in depth with few landing hazards, a uniform composition, and a predicted oxygen yield of approximately 3 wt. %, among the highest values on the Moon.

  17. Collection, analysis and cryopreservation of semen from Malayan gaur (Bos gaurus hubbacki): A preliminary study

    Science.gov (United States)

    Iswadi, M.I.; Ann, Z.F.; Hafiz, M.M.; Hafiz, M.D.; Fahrul, F.J.; Hajarian, H.; Wahid, H.; Zawawi, I.; Khairiah, M.S.; Mazni, O.A.

    2012-01-01

    The Malayan gaur (Bos gaurus hubbacki) or Seladang is classified as vulnerable by the International Union for Conservation of Nature and Natural Resources (IUCN). The Malayan gaur is mainly distributed in the tropical woodlands of Peninsular Malaysia and Southern Thailand. The aim of this study was to collect, analyze and cryopreserve the semen of wild Malayan gaur. Transrectal massage (TM) and electroejaculation (EEJ) technique was applied in semen collection of the Malayan gaur. The semen was then cryopreserved in liquid nitrogen using slow freezing technique. Makler counting chamber was used to evaluate sperm concentration and motility, while the sperm viability and morphology of fresh and post-thaw sperm was determined using eosin-nigrosin staining protocol. As a result, we have successfully collected the Malayan gaur semen using EEJ technique. Sperm motility, viability and morphological changes of the post-thaw semen of Malayan gaur were found undesirable due to the complication of the cryopreservation process. On the basis of current study it can be concluded that Malayan gaur bulls semen can be obtain by EEJ with no evidence of rectal trauma. Optimization of the process of cryopreservation for Malayan gaur sperm is needed to maintain the cryoviability of the good sperm quality. The data generated in this study would be useful in conservation of genetic diversity program for Malayan gaur. PMID:26623302

  18. Magnetic Resonance Imaging of the Normal Stifle Joint in Buffaloes (Bos Bubalis: An Anatomic Study

    Directory of Open Access Journals (Sweden)

    Moustafa Samy Sherif

    2014-12-01

    Full Text Available The aim of the present study was to describe the normal anatomy of the stifle joint in buffaloes (Bos bubalis on magnetic resonance images and related anatomical sectional slices to facilitate the interpretation of all these images, as well as to understand the basis for diseases diagnosis. The hind limbs of ten healthy adult buffaloes (Twenty stifle joints were used. After slaughtering, MR images were made in sagittal, transverse, and dorsal planes. The limbs then were frozen at -20° then correspondingly sectioned using an electric band saw. Clinically relevant anatomic structures were identified and labeled at each level in the corresponding images (MR and anatomic slices. MRI images were used to identify the bony and soft tissue structures of the stifle joint. The articular cartilage appeared with hyperintense signal and separated from the subcondral bone by gray line (moderate signal intensity. It is difficult to differentiate between the synovia, infrapatellar fat body and the articular cartilage because they appeared with hyperintense signal. The meniscial, femoropatellar and cruciate ligaments recognized as moderate signal intensity. However, the collateral and intermediate patellar ligaments, the common tendon of the Mm. extensor digitorum longus and peroneus tertius as well as the menisci and the medial patellar fibrocartilage appeared with hypointense signal. The knowledge of normal anatomy of the buffalo stifle joint would serve as initial reference to the evaluation of MR images in this species.

  19. The complete sequence of mitochondrial genome of polled yak (Bos grunniens).

    Science.gov (United States)

    Chu, Min; Wu, Xiaoyun; Liang, Chunnian; Pei, Jie; Ding, Xuezhi; Guo, Xian; Bao, Pengjia; Yan, Ping

    2016-05-01

    Generally speaking, the hornless trait is also known as polled. Although the POLL locus could be assigned to a 1.36-Mb interval in the centromeric region of BTA1 (Georges et al., 1993; Drögemüller et al., 2005)), and (Liu et al., 2014) reported a 147-kb segment that included three protein-coding genes was the most likely location of the POLL mutation in domestic yaks, the underlying genetic basis for the polled trait is still unknown. In this work, the complete mitochondrial genome sequence of polled yak was determined for the first time. The total length of the mitogenome is 16,324 bp long, with the base composition of 33.72% A, 27.25% T, 25.83% C, and 13.20% G. It contained 13 protein-coding genes, 22 tRNA genes, 2 rRNA genes and 1 non-coding region (D-loop region). The gene order of polled yak mitogenome is identical to that observed in most other vertebrates. The complete mitogenome sequence information of polled yak will provide useful data for further studies on protection of genetic resources and phylogenetic relationships within Bos grunniens. PMID:25347693

  20. Collection, analysis and cryopreservation of semen from Malayan gaur (Bos gaurus hubbacki: A preliminary study

    Directory of Open Access Journals (Sweden)

    M.S. Khairiah

    2012-10-01

    Full Text Available The Malayan gaur (Bos gaurus hubbacki or Seladang is classified as vulnerable by the International Union for Conservation of Nature and Natural Resources (IUCN. The Malayan gaur is mainly distributed in the tropical woodlands of Peninsular Malaysia and Southern Thailand. The aim of this study was to collect, analyze and cryopreserve the semen of wild Malayan gaur. Transrectal massage (TM and electroejaculation (EEJ technique was applied in semen collection of the Malayan gaur. The semen was then cryopreserved in liquid nitrogen using slow freezing technique. Makler counting chamber was used to evaluate sperm concentration and motility, while the sperm viability and morphology of fresh and post-thaw sperm was determined using eosin-nigrosin staining protocol. As a result, we have successfully collected the Malayan gaur semen using EEJ technique. Sperm motility, viability and morphological changes of the post-thaw semen of Malayan gaur were found undesirable due to the complication of the cryopreservation process. On the basis of current study it can be concluded that Malayan gaur bulls semen can be obtain by EEJ with no evidence of rectal trauma. Optimization of the process of cryopreservation for Malayan gaur sperm is needed to maintain the cryoviability of the good sperm quality. The data generated in this study would be useful in conservation of genetic diversity program for Malayan gaur.