WorldWideScience

Sample records for bos taurus autosome

  1. Fine mapping of a calving QTL on Bos taurus autosome 18 in Holstein cattle.

    Science.gov (United States)

    Mao, X; Kadri, N K; Thomasen, J R; De Koning, D J; Sahana, G; Guldbrandtsen, B

    2016-06-01

    Decreased calving performance not only directly impacts the economic efficiency of dairy cattle farming but also influences public concern for animal welfare. Previous studies have revealed a QTL on Bos taurus autosome (BTA) 18 that has a large effect on calving traits in Holstein cattle. In this study, fine mapping of this QTL was performed using imputed high-density SNP chip (HD) genotypes followed by imputed next-generation sequencing (NGS) variants. BTA18 was scanned for seven direct calving traits in 6113 bulls with imputed HD genotypes. SNP rs136283363 (BTA18: 57 548 213) was consistently the most significantly associated SNP across all seven traits [e.g. p-value = 2.04 × 10(-59) for birth index (BI)]. To finely map the QTL region and to explore pleiotropic effects, we studied NGS variants within the targeted region (BTA18: 57 321 450-57 625 355) for associations with direct calving traits and with three conformation traits. Significant variants were prioritized, and their biological relevance to the traits was interpreted. Considering their functional relationships with direct calving traits, SIGLEC12, CD33 and CEACAM18 were proposed as candidate genes. In addition, pleiotropic effects of this QTL region on direct calving traits and conformation traits were observed. However, the extent of linkage disequilibrium combined with the lack of complete annotation and potential errors in the Bos taurus genome assembly hampered our efforts to pinpoint the causal mutation. PMID:26486911

  2. Identification of a two-marker-haplotype on Bos taurus autosome 18 associated with somatic cell score in German Holstein cattle

    Directory of Open Access Journals (Sweden)

    Reinsch Norbert

    2009-09-01

    Full Text Available Abstract Background The somatic cell score (SCS is implemented in routine sire evaluations in many countries as an indicator trait for udder health. Somatic cell score is highly correlated with clinical mastitis, and in the German Holstein population quantitative trait loci (QTL for SCS have been repeatedly mapped on Bos taurus autosome 18 (BTA18. In the present study, we report a refined analysis of previously detected QTL regions on BTA18 with the aim of identifying marker and marker haplotypes in linkage disequilibrium with SCS. A combined linkage and linkage disequilibrium approach was implemented, and association analyses of marker genotypes and maternally inherited two-marker-haplotypes were conducted to identify marker and haplotypes in linkage disequilibrium with a locus affecting SCS in the German Holstein population. Results We detected a genome-wide significant QTL within marker interval 9 (HAMP_c.366+109G>A - BMS833 in the middle to telomeric region on BTA18 and a second putative QTL in marker interval 12-13 (BB710 - PVRL2_c.392G>A. Association analyses with genotypes of markers flanking the most likely QTL positions revealed the microsatellite marker BMS833 (interval 9 to be associated with a locus affecting SCS within the families investigated. A further analysis of maternally inherited two-marker haplotypes and effects of maternally inherited two-marker-interval gametes indicated haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A to be associated with SCS in the German Holstein population. Conclusion Our results confirmed previous QTL mapping results for SCS and support the hypothesis that more than one locus presumably affects udder health in the middle to telomeric region of BTA18. However, a subsequent investigation of the reported QTL regions is necessary to verify the two-QTL hypothesis and confirm the association of two-marker-haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A with SCS. For this

  3. Genetic effects on beef tenderness in Bos indicus composite and Bos taurus cattle.

    Science.gov (United States)

    O'Connor, S F; Tatum, J D; Wulf, D M; Green, R D; Smith, G C

    1997-07-01

    Bos indicus composite and Bos taurus cattle, originating from diverse production environments, were used to quantify genetic variation in marbling, 24-h calpastatin activity, and beef tenderness and to identify strategies for prevention of beef tenderness problems in Bos indicus composite cattle. Comparisons among 3/8 Bos indicus breeds (Braford, Red Brangus, Simbrah) revealed significant differences in marbling and 24-h calpastatin activity, but not in tenderness. Compared with Bos taurus cattle, 3/ 8 Bos indicus cattle had similar marbling scores but higher 24-h calpastatin activities. Also, beef from 3/8 Bos indicus composites aged more slowly from 1 to 7 d and was less tender at 4, 7, 14, 21, and 35 d postmortem than beef from Bos taurus cattle. However, beef from 3/8 Bos indicus cattle was relatively tender if it was aged for a sufficient period of time (21 d). The delayed response to aging and greater toughness of beef from 3/8 Bos indicus cattle was associated with Brahman breed effects and was not related to the Bos taurus germplasm source. Marbling was moderately heritable (.52 +/- .21) but exhibited positive genetic correlations with shear force at d 1 through 14 of aging, suggesting that, in these cattle, selection for increased marbling would have an unfavorable effect on beef tenderness. A low heritability estimate for 24-h calpastatin activity (.15 +/- .15), coupled with low genetic correlations between calpastatin activity and shear force at 7, 14, and 35 d, suggested that selection for low calpastatin activity would have little effect on aged beef tenderness. Panel tenderness and shear force at 7, 14, and 21 d were moderately heritable (.27 to .47), indicating that aged beef tenderness could be improved by direct selection (via progeny testing). Comparisons among Simbrah, Senegus x Simbrah, and Red Angus x Simmental steers showed that inclusion of a tropically adapted Bos taurus breed (Senepol) could be an effective strategy for preventing beef

  4. Polymorphism and Mobilization of Rransposons in Bos taurus

    DEFF Research Database (Denmark)

    Guldbrandtsen, Bernt; Sahana, Goutam; Lund, Mogens Sandø

    The bovine genome assembly was explored to detect putative retrotransposon sequences. In total 87,310 such sites were detected. Four breeds of dairy cattle (Bos taurus) were examined with respect to the presence, segregation or complete absence of the putative retrotransposon. A total of 10...

  5. Cow/calf preweaning efficiency of Nellore and Bos taurus x Bos indicus crosses.

    Science.gov (United States)

    Calegare, L; Alencar, M M; Packer, I U; Ferrell, C L; Lanna, D P D

    2009-02-01

    The objectives of this study were to determine if percentage Bos taurus (0 or 50%) of the cow had an effect on ME requirements and milk production, and to compare cow/calf efficiency among 3 mating systems. Metabolizable energy requirements were estimated during a feeding trial that encompassed a gestation and lactation feeding trial for each of 2 groups of cows. Cows were 0 or 50% Bos taurus (100 or 50% Nellore) breed type: Nellore cows (NL; n = 10) mated to Nellore bulls, NL cows (n = 9) mated to Angus bulls, Angus x Nellore (ANL; n = 10) and Simmental x Nellore (SNL; n = 10) cows mated to Canchim (5/8 Charolais 3/8 Zebu) bulls. Cows were individually fed a total mixed diet that contained 11.3% CP and 2.23 Mcal of ME/kg of DM. At 14-d intervals, cows and calves were weighed and the amount of DM was adjusted to keep shrunk BW and BCS of cows constant. Beginning at 38 d of age, corn silage was available to calves ad libitum. Milk production at 42, 98, 126, and 180 d postpartum was measured using the weigh-suckle-weigh technique. At 190 d of age, calves were slaughtered and body composition estimated using 9-10-11th-rib section to obtain energy deposition. Regression of BW change on daily ME intake (MEI) was used to estimate MEI at zero BW change. Increase in percentage Bos taurus had a significant effect on daily ME requirements (Mcal/d) during pregnancy (P < 0.01) and lactation (P < 0.01). Percentage Bos taurus had a positive linear effect on maintenance requirements of pregnant (P = 0.07) and lactating (P < 0.01) cows; during pregnancy, the ME requirements were 91 and 86% of those in lactation (131 +/- 3.5 vs. 145 +/- 3.4 Mcal x kg(-0.75) x d(-1)) for the 0 and 50% B. taurus groups, respectively. The 50% B. taurus cows, ANL and SNL, suckling crossbred calves had greater total MEI (4,319 +/- 61 Mcal; P < 0.01) than 0% B. taurus cows suckling NL (3,484 +/- 86 Mcal) or ANL calves (3,600 +/- 91 Mcal). The 0% B. taurus cows suckling ANL calves were more efficient (45

  6. Life-cycle biological efficiency of Bos indicus x Bos taurus and Bos taurus crossbred cow-calf production to weaning.

    Science.gov (United States)

    Green, R D; Cundiff, L V; Dickerson, G E

    1991-09-01

    A deterministic model was developed that accounted for all biological inputs and outputs for a theoretical herd of F1 females at age equilibrium mated to produce three-way terminal-cross calves and for the required proportion of straightbred cows needed to produce replacements. Two Bos indicus x Bos taurus vs two Bos taurus x Bos taurus types of crossbred cows were compared in the production environment of south-central Nebraska. The four types of F1 females were from Hereford (H) or Angus (A) dams and by H or A (HA), Pinzgauer (Pz), Brahman (Bm), or Sahiwal (Sw) sires. The crossbred females were assumed mated to Red Poll (R) sires for their first calving and to Simmental (S) sires thereafter. Two evaluations of efficiency for each of the four breeding systems were total cow and calf feed energy input 1) per unit of only weaned calf weight output (CALFEFF, Mcal/kg) and 2) per unit of weaned calf plus .55 x cull cow weight output (TVALEFF, Mcal/kg). Results for a terminal age of 7 yr in systems using HA, Pz, Bm, and Sw crossbred cows, respectively, were 64.9, 64.5, 60.9, and 59.3 Mcal/kg for CALFEFF and 45.7, 46.4, 44.1, and 43.7 Mcal/kg for TVALEFF. Changing terminal age to 11 yr reduced CALFEFF about 6% but increased TVALEFF about 7%, because total inputs increased more than output value (10 vs 3%) from 7 to 11 yr terminal ages. These results suggest differences in efficiency among these breed crosses favoring the Bos indicus crossbred cows by over 4% in this particular environment. PMID:1938641

  7. Evaluation of carcass characteristics and meat chemical composition of Bos indicus and Bos indicus x Bos taurus crossbred steers finished in pasture systems

    OpenAIRE

    Moreira Fernanda Barros; Souza Nilson Evelázio de; Matsushita Makoto; Prado Ivanor Nunes do; Nascimento Willian Gonçalves do

    2003-01-01

    The objective of this study was to evaluate the carcass characteristics (carcass weight, carcass yield, fat thickness, loin area, marbling and colour) and chemical composition of the Longissimus dorsi muscle (moisture, ash, crude protein, fat and cholesterol) of cuts with or without fat thickness, of Bos indicus and Bos indicus x Bos taurus crossbred steers finished in millet (Pennisetum americanum L.) or star grass (Cynodon plectostachyus Pilger) pasture systems, with mineral or mineral prot...

  8. Ganancia diaria y peso al destete en becerros de cruzas Bos taurus con Bos indicus en trópico húmedo.

    OpenAIRE

    Alejandro Córdova; Gustavo Rodríguez; Mary Córdova; Cristian Córdova,; José Pérez

    2005-01-01

    El objetivo del trabajo fue evaluar la ganancia diaria de peso desde el nacimiento hasta el destete a los cuatromeses de edad de terneros de la cruza Bos taurus con Bos indicus, manejados en pastoreo convencional, para locual se utilizaron los registros de 302 terneros. Las razas Bos taurus utilizadas para las cruzas fueron Belgianblue, Charolais, Limousine y Beef master; las Bos indicus, fueron Brahman, Nelore, Indobrasil y Simbrah. Losresultados se analizaron mediante estadística descriptiv...

  9. GANANCIA DIARIA Y PESO AL DESTETE EN TERNEROS DE CRUCES Bos taurus CON Bos indicus EN TRÓPICO HÚMEDO

    OpenAIRE

    Córdova, Alejandro; Rodriguez, Gustavo; Córdova, Mary; Córdova, Cristian; Pérez, José

    2005-01-01

    El objetivo del trabajo fue evaluar la ganancia diaria de peso desde el nacimiento hasta el destete a los cuatro meses de edad de terneros de la cruza Bos taurus con Bos indicus, manejados en pastoreo convencional, para lo cual se utilizaron los registros de 302 terneros. Las razas Bos taurus utilizadas para las cruzas fueron Belgian blue, Charolais, Limousine y Beef master; las Bos indicus, fueron Brahman, Nelore, Indobrasil y Simbrah. Los resultados se analizaron mediante estadística descri...

  10. The polled locus maps to BTA1 in a Bos indicus x Bos taurus cross.

    Science.gov (United States)

    Brenneman, R A; Davis, S K; Sanders, J O; Burns, B M; Wheeler, T C; Turner, J W; Taylor, J F

    1996-01-01

    Two hundred and nine reciprocal backcross and F2 progeny produced by embryo transfer from Angus (Bos taurus) and Brahman (Bos indicus) parents and their 60 parents and grandparents were utilized to localize the locus (POLL) responsible for the polled phenotype in a genetic map of bovine chromosome 1. Progeny were scored for polled, scurred, and horned phenotypes at 1 year of age and again following skull disection at slaughter at 20 months of age. Phenotype frequencies were independent of gender. One hundred and forty-two informative meioses for POLL and 13 microsatellite loci with an average of 267 informative meioses per locus contributed to a genetic map spanning 124.6 cM with an average interval of 9.6 cM. POLL mapped proximal to the centromere and 4.9 cM from TGLA49 supporting a previous study that employed two anonymous microsatellites. Difficulties in discriminating between scurred and horned phenotypes indicate that bracketing markers will be essential for refining the model for inheritance of the horned, scurred, and polled phenotypes and for effective marker assisted selection (MAS) for polled. PMID:8830095

  11. INTROGRESIÓN GENÉTICA DE Bos indicus (BOVIDAE EN BOVINOS CRIOLLOS COLOMBIANOS DE ORIGEN Bos taurus Genetic Introgression of Bos indicus (Bovidae in Colombian Creole Cattle Bos taurus

    Directory of Open Access Journals (Sweden)

    CARLOS ARTURO SÁNCHEZ ISAZA

    Full Text Available El presente trabajo evidencia desde el punto de vista citogenético la introgresión genética, de origen paterno, de Bos indicus en ganado criollo colombiano descendiente de Bos taurus. Para este estudio se realizó el análisis cariológico de la morfología del cromosoma Y a partir de muestras de sangre heparinizada de 67 bovinos machos pertenecientes a siete razas criollas colombianas. Se reporta la presencia de cuatro ejemplares pertenecientes a la raza Romosinuano (40% y 10 toros de la raza Casanareña (100% con cromosoma Y de tipo acrocéntrico característico de Bos indicus, lo cual estaría evidenciando un alto grado de introgresión genética, en estas dos razas, posiblemente originada por la intensiva introducción de sementales de la raza Cebú en la ganadería criolla colombiana. En las otras cinco razas (Blanco Orejinegro (BON, Chino santandereano, Costeño con cuernos, Hartón del valle y Sanmartinero, los toros presentaron el cromosoma Y submetacéntrico, característico de Bos taurus.This work evidenced, using a cytogenetics approach, that Bos indicus exerted a genetic introgression of paternal origin on Creole Colombian cattle descendent from Bos taurus. Analysis of chromosome Y morphology was carried out in heparinized blood samples of 67 bulls belonging to seven Colombian breeds. We report 4 sires belonging to the Romosinuano breed (40% and 10 bulls of the Casanareño breed (100% with acrocentric Y chromosome which is characteristic of Bos taurus. This finding indicates a high degree of genetic introgression in these two breeds probably caused by the continuous input of zebu stallions in the Colombian Creole breeds. In other five Creole breeds (Blanco Orejinegro -BON-, Chino Santandereano, Costeño con Cuernos, Hartón del Valle and Sanmartinero, the bulls had a submetacentric Y chromosome characteristic of Bos taurus.

  12. MADURACIÓN DEL SOLOMO (Biceps femoris EN VACAS DE DESCARTE Bos indicus Y Bos taurus

    Directory of Open Access Journals (Sweden)

    Roger Alonso Cubero-Rojas

    2013-01-01

    Full Text Available El objetivo de este trabajo fue evaluar el efecto de la maduración sobre la terneza del músculo Biceps femoris en vacas de descarte Bos indicus y Bos taurus. En la planta procesadora de Montecillos R.L., ubicada en Alajuela, se realizó la escogencia y sacrificio de los animales, la maduración y empaque al vacío de la carne. La cocción, determinación de la terneza y evaluación sensorial se llevó a cabo a los 0, 14 y 28 días de maduración, en el Laboratorio de Análisis Sensorial del Centro de Investigaciones en Tecnología de Alimentos de la Universidad de Costa Rica, ubicado en San Pedro de Montes de Oca, San José, en julio del año 2011. De acuerdo con la evaluación instrumental, la especie y la cronometría dental no fueron factores significativos en la determinación de la terneza de la carne, mientras que el tiempo de maduración sí mostró cambios altamente significativos (p>0,001 sobre el mismo parámetro. Los mejores resultados se obtuvieron a los 28 días, donde B. indicus mostró 3,78 kg de fuerza al corte, mientras que para B. taurus se obtuvo 3,88 kg. En la evaluación sensorial, los animales B. indicus se calificaron como más jugosos (p=0,016 y con mejor sabor (p<0,001. Se determinó una relación inversa entre sabor y tiempo de maduración, lo cual indicó que a mayor tiempo de maduración el sabor de la carne se volvió menos agradable al paladar.

  13. A whole-genome assembly of the domestic cow, Bos taurus

    Science.gov (United States)

    Background: The genome of the domestic cow, Bos taurus, was sequenced using a mixture of hierarchical and whole-genome shotgun sequencing methods. Results: We have assembled the 35 million sequence reads and applied a variety of assembly improvement techniques, creating an assembly of 2.86 billion b...

  14. Sarcocystis heydorni, n. sp. (Apicomplexa: Protozoa) with cattle (Bos taurus) and human (Homo sapiens) cycle

    Science.gov (United States)

    Cattle (Bos taurus) are intermediate hosts for four species of Sarcocystis, S. cruzi, S. hirsuta, S. hominis, and S. rommeli. Of these four species, mature sarcocysts of S. cruzi are thin-walled (< 1µm) whereas S. hirsuta, S. hominis, and S. rommeli have thick walls (4 µm or more). Here we describe ...

  15. Chemical composition of whole body and carcass of Bos indicus and tropically adapted Bos taurus breeds.

    Science.gov (United States)

    Bonilha, S F M; Tedeschi, L O; Packer, I U; Razook, A G; Nardon, R F; Figueiredo, L A; Alleoni, G F

    2011-09-01

    Relationships between the chemical composition of the 9th- to 11th-rib section and the chemical composition of the carcass and empty body were evaluated for Bos indicus (108 Nellore and 36 Guzerah; GuS) and tropically adapted Bos taurus (56 Caracu; CaS) bulls, averaging 20 to 24 mo of age at slaughter. Nellore cattle were represented by 56 animals from the selected herd (NeS) and 52 animals from the control herd (NeC). The CaS and GuS bulls were from selected herds. Selected herds were based on 20 yr of selection for postweaning BW. Carcass composition was obtained after grinding, homogenizing, sampling, and analyzing soft tissue and bones. Similarly, empty body composition was obtained after grinding, homogenizing, sampling, analyzing, and combining blood, hide, head + feet, viscera, and carcass. Bulls were separated into 2 groups. Group 1 was composed of 36 NeS, 36 NeC, 36 CaS, and 36 GuS bulls and had water, ether extract (EE), protein, and ash chemically determined in the 9th- to 11th-rib section and in the carcass. Group 2 was composed of 20 NeS, 16 NeC, and 20 CaS bulls and water, EE, protein, and ash were determined in the 9th- to 11th-rib section, carcass, and empty body. Linear regressions were developed between the carcass and the 9th- to 11th-rib section compositions for group 1 and between carcass and empty body compositions for group 2. The 9th- to 11th-rib section percentages of water (RWt) and EE (RF) predicted the percentages of carcass water (CWt) and carcass fat (CF) with high precision: CWt, % = 29.0806 + 0.4873 × RWt, % (r(2) = 0.813, SE = 1.06) and CF, % = 10.4037 + 0.5179 × RF, % (r(2) = 0.863, SE = 1.26), respectively. Linear regressions between percentage of CWt and CF and empty body water (EBWt) and empty body fat (EBF) were also predicted with high precision: EBWt, % = -9.6821 + 1.1626 × CWt, % (r(2) = 0.878, SE = 1.43) and EBF, % = 0.3739 + 1.0386 × CF, % (r(2) = 0.982, SE = 0.65), respectively. Chemical composition of the 9th- to 11

  16. INTROGRESIÓN GENÉTICA DE Bos indicus (BOVIDAE EN BOVINOS CRIOLLOS COLOMBIANOS DE ORIGEN Bos taurus

    Directory of Open Access Journals (Sweden)

    JIMÉNEZ ROBAYO LIGIA MERCEDES

    2008-04-01

    Full Text Available

    El presente trabajo evidencia desde el punto de vista citogenético la introgresión genética, de origen paterno, de Bos indicus en ganado criollo colombiano descendiente de Bos taurus. Para este estudio se realizó el análisis cariológico de la morfología del cromosoma Y a partir de muestras de sangre heparinizada de 67 bovinos machos pertenecientes a siete razas criollas colombianas. Se reporta la presencia de cuatro ejemplares pertenecientes a la raza Romosinuano (40% y 10 toros de la raza Casanareña (100% con cromosoma Y de tipo acrocéntrico característico de Bos indicus, lo cual estaría evidenciando un alto grado de introgresión genética, en estas dos razas, posiblemente originada por la intensiva introducción de sementales de la raza Cebú en la ganadería criolla colombiana. En las otras cinco razas (Blanco Orejinegro (BON, Chino santandereano, Costeño con cuernos, Hartón del valle y Sanmartinero, los toros presentaron el cromosoma Y submetacéntrico, característico de Bos taurus.

  17. Frequencies of polymorphisms associated with BSE resistance differ significantly between Bos taurus, Bos indicus, and composite cattle

    Directory of Open Access Journals (Sweden)

    Seabury Christopher M

    2008-09-01

    Full Text Available Abstract Background Transmissible spongiform encephalopathies (TSEs are neurodegenerative diseases that affect several mammalian species. At least three factors related to the host prion protein are known to modulate susceptibility or resistance to a TSE: amino acid sequence, atypical number of octapeptide repeats, and expression level. These factors have been extensively studied in breeds of Bos taurus cattle in relation to classical bovine spongiform encephalopathy (BSE. However, little is currently known about these factors in Bos indicus purebred or B. indicus × B. taurus composite cattle. The goal of our study was to establish the frequency of markers associated with enhanced susceptibility or resistance to classical BSE in B. indicus purebred and composite cattle. Results No novel or TSE-associated PRNP-encoded amino acid polymorphisms were observed for B. indicus purebred and composite cattle, and all had the typical number of octapeptide repeats. However, differences were observed in the frequencies of the 23-bp and 12-bp insertion/deletion (indel polymorphisms associated with two bovine PRNP transcription regulatory sites. Compared to B. taurus, B. indicus purebred and composite cattle had a significantly lower frequency of 23-bp insertion alleles and homozygous genotypes. Conversely, B. indicus purebred cattle had a significantly higher frequency of 12-bp insertion alleles and homozygous genotypes in relation to both B. taurus and composite cattle. The origin of these disparities can be attributed to a significantly different haplotype structure within each species. Conclusion The frequencies of the 23-bp and 12-bp indels were significantly different between B. indicus and B. taurus cattle. No other known or potential risk factors were detected for the B. indicus purebred and composite cattle. To date, no consensus exists regarding which bovine PRNP indel region is more influential with respect to classical BSE. Should one particular

  18. In vivo comparison of susceptibility between Bos indicus and Bos taurus cattle types to Theileria parva infection

    Directory of Open Access Journals (Sweden)

    S.G. Ndungu

    2005-09-01

    Full Text Available The objective of this study was to determine whether Bos taurus cattle differ form Bos indicus in their susceptibility to infection with the Muguga stabilate of Theileria parva and in their resistance to the resultant disease. Ten Friesians (B. taurus, ten improved Borans (B. indicus, ten unimproved Borans (B. indicus and ten Zebus (B. indicus born to dams from an East Coast fever (ECF endemic area were inoculated with an infective dose50 dilution of T. parva Muguga stabilate 147. All the animals except one Friesian and one Zebu developed schizont parasitosis. All the improved Borans, nine of the Friesians, eight of the unimproved Borans and six of the Zebus developed a febrile response. Four of the improved Borans, four of the Friesians and three of the unimproved Borans died of theileriosis. No significant difference (P > 0.05 in the prepatent period occurred between the groups, but the Zebus had a significantly shorter duration of schizont parasitosis (P > 0.05 and took a significantly shorter time to recover (P > 0.05 than the other three groups. There was no significant difference in the two parameters between the other three groups. The study showed that three B. indicus breds and a B. taurus breed are equally susceptible to T. parva infection. However, Zebus born to dams from an ECF endemic area showed a better ability to control the course of disease than cattle from ECF free areas.

  19. Growth traits and composition of two- and three-way-cross intact male progeny of Bos taurus and Bos indicus X Bos taurus dams.

    Science.gov (United States)

    Van Ornum, K M; Bailey, C M; Ringkob, T P; Koh, Y O

    1987-07-01

    Feedlot traits, carcass traits and distribution of commercial cuts of crossbred intact male progeny (n = 556) from young and mature Hereford, Red Poll, Hereford X Red Poll, Red Poll X Hereford, Angus X Hereford, Angus X Charolais, Brahman X Hereford and Brahman X Angus dams were evaluated. First-calf heifers were bred to Red Angus bulls; Santa Gertrudis sires were used for each cow's second and third breeding seasons. Calves from these young dams were slaughtered at 13 mo. Calves of mature dams were all sired by Limousin bulls and slaughtered at 12 mo. Dam breed was a major source of variation in most bull traits. Progeny of Brahman-cross dams were inferior (P less than .01) in daily gain, final weight, carcass weight and in edible cuts/day of age compared with progeny from Bos taurus dams. Intact male progeny of Angus X Charolais dams ranked highest in longissimus area, cutability, and edible cuts/day of age. The range of dam breed means in percentage of steak, roast, bone-in cuts (chuck short ribs and back ribs), short plate and thin cuts, and lean trim was just over 1%. Greater variation among dam breeds existed in fat measurements. Analyses in which Hereford-Red Poll diallel data for young dams and mature dams were combined showed positive maternal heterosis for dressing percentage (P less than .05), carcass weight (P less than .05), carcass weight/day of age (P less than .05), estimated carcass fat (P less than .05), fat thickness (P less than .01) and marbling score (P less than .01). Reciprocal effects were inconsequential. Results illustrate the importance of dam breed-type effects in formulating breeding strategies for commercial beef herds. PMID:3610866

  20. History and economic importance of cattle (Bos taurus L.) in Switzerland from neolithic to early middle ages

    OpenAIRE

    Schibler, J.; Schlumbaum, A.

    2007-01-01

    In Switzerland domestic cattle (Bos primigenius f. taurus resp. Bos taurus L.) first appear with the earliest Neolithic settlements (similar to 5000 BC). With the gradual deforestation of the landscape caused by human exploitation of the environment, cattle were used more intensive and in many ways. There is evidence that cattle were used as draught animal since ca. 3400 BC, probably even earlier milk was regularly used. The size of domestic cattle gradually decreased from Early Neolithic unt...

  1. Genome-Wide Detection and Characterization of Endogenous Retroviruses in Bos taurus

    OpenAIRE

    Garcia-Etxebarria, Koldo; Jugo, Begoña Marina

    2010-01-01

    Endogenous retroviruses (ERVs) are the proviral phase of exogenous retroviruses that become integrated into a host germ line. They can play an important role in the host genome. Bioinformatic tools have been used to detect ERVs in several vertebrates, primarily primates and rodents. Less information is available regarding ERVs in other mammalian groups, and the source of this information is basically experimental. We analyzed the genome of the cow (Bos taurus) using three different methods. A...

  2. Evaluation of carcass characteristics and meat chemical composition of Bos indicus and Bos indicus x Bos taurus crossbred steers finished in pasture systems

    Directory of Open Access Journals (Sweden)

    Fernanda Barros Moreira

    2003-12-01

    Full Text Available The objective of this study was to evaluate the carcass characteristics (carcass weight, carcass yield, fat thickness, loin area, marbling and colour and chemical composition of the Longissimus dorsi muscle (moisture, ash, crude protein, fat and cholesterol of cuts with or without fat thickness, of Bos indicus and Bos indicus x Bos taurus crossbred steers finished in millet (Pennisetum americanum L. or star grass (Cynodon plectostachyus Pilger pasture systems, with mineral or mineral protein supplementation. Animals were slaughtered with an average body weight of 450 kg (Bos indicus or 470 kg (Bos indicus x Bos taurus crossbreed. There was no treatments effect on carcass characteristics and meat chemical composition of cut without fat thickness. The cuts with fat thickness of steers fed millet presented the highest fat deposition. Bos indicus steers presented higher carcass yield (57.23% and fat thickness (4.88 mm compared with crossbreed (53.40% and 3.05 mm. There was no breed effect on chemical composition of meat. The mean levels of cholesterol concentration were 31.41 mg/100 and 37.55 mg/100g of meat with and without fat thickness.O objetivo deste trabalho foi avaliar as características de carcaça (peso de carcaça, rendimento de carcaça, espessura de gordura de cobertura, área de olho de lombo, marmoreio e coloração e composição química do músculo Longissimus dorsi (umidade, cinzas, proteína bruta, gordura e colesterol de cortes, com ou sem gordura de cobertura, de novilhos Bos indicus e mestiços Bos indicus x Bos taurus terminados em sistemas em pastagem de milheto (Pennisetum americanum L. ou grama estrela (Cynodon plectostachyus Pilger, com suplementação mineral ou protéica e mineral. Os animais foram abatidos com peso médio de 450 kg (Bos indicus ou 470 kg (mestiços. Não houve efeito de tratamento sobre as características de carcaça e composição da carne com ou sem gordura de cobertura. Os cortes com gordura de

  3. A disintegrin and metalloprotease-12 is type I myofiber specific in Bos taurus and Bos indicus cattle.

    Science.gov (United States)

    Coles, C A; Wadeson, J; Knight, M I; Cafe, L M; Johns, W H; White, J D; Greenwood, P L; McDonagh, M B

    2014-04-01

    A disintegrin and metalloproteinase-12 (ADAM12) is involved in the regulation of myogenesis and adipogenesis and is of interest as a potential target to manipulate skeletal muscle development and intramuscular fat (IMF) deposition in cattle to increase beef yield and improve meat quality. The longissimus thoracis muscle (LM) and semitendinosus muscle (STM) from 5 Bos taurus (Angus) and 5 Bos indicus (Brahman) cattle were collected for histological and ADAM12 gene and protein expression analysis. Myofiber typing was used to determine if ADAM12 expression patterns related to differences in muscling and IMF deposition, which are influenced by proportions of the different myofiber types. The STM was found to contain a higher proportion of glycolytic myofibers than the LM, which contained a greater proportion of oxidative myofibers (myofiber ratio of glycolytic to more oxidative types in LM and STM of 1.1 and 3.5, respectively; P < 0.05). ADAM12 gene expression, fluorescent immunohistochemical staining for ADAM12, and image analysis found ADAM12 to be greater in the LM (P < 0.05). Regression analysis found a strong, positive relationship for the distribution of ADAM12 against the proportion of type I myofibers (P < 0.05, r(2) = 0.86). These findings suggest ADAM12 is upregulated in muscles with more slow-oxidative myofibres, such as the LM, and is linked to type I myofibers in cattle. ADAM12 may be important in the regulation and maintenance slow myofibers in the LM muscle. PMID:24663211

  4. The Effect of Myogenic Factor 5 Polymorphism on the Meat Quality in Chinese Bos Taurus

    Directory of Open Access Journals (Sweden)

    J. A. Ujan

    2011-12-01

    Full Text Available In the present study, we evaluated polymorphism of myogenic factor 5, involved in growth and meat quality traits. Based on PCR-SSCP technology, a novel missense substitution SNP (single-nucleotide polymorphism g.1142 A > G was identified in the intron1 region of the MyF-5 gene, it causes an amino acid substitution (1142Glutamine/ Glycine1142. Allele frequencies, gene heterozygosity, effective allele number and polymorphism information content of the bovine MyF-5 SNP in three population breeds were determined and evaluated by the χ2 test. Results showed that the polymorphism distribution was not similar in all of the three Bos taurus breeds, the genotype distributions of two cattle breeds Jia xian red and Nanyang did not agree with Hardy–Weinberg equilibrium (P 0.05. The A/G allelic frequencies in these breeds were 0.797/0.202, 0.770/0.229, 0.863/0.136 respectively. The genotype frequencies in Jia xian red and Nanyang cattle breeds showed moderate diversity (0.25< polymorphism information content <0.5. Furthermore, least squares analysis revealed significant effects of genotype on intramuscular fat, rib area and water holding capacity in 510 individuals (P < 0.05. Our result suggests that A1142G SNP can be used as an efficacious genetic marker for meat quality traits in native Chinese cattle breeds (Bos taurus but a much large number of animals are required for Marker assisted selection.

  5. The Effect of Myogenic Factor 5 Polymorphism on the Meat Quality in Chinese Bos Taurus

    Directory of Open Access Journals (Sweden)

    S. A. Ujan

    2011-10-01

    Full Text Available In the present study, we evaluated polymorphism of myogenic factor 5, involved in growth and meat quality traits. Based on PCR-SSCP technology, a novel missense substitution SNP (single-nucleotide polymorphism g.1142 A > G was identified in the intron1 region of the MyF-5 gene, it causes an amino acid substitution (1142Glutamine/ Glycine1142. Allele frequencies, gene heterozygosity, effective allele number and polymorphism information content of the bovine MyF-5 SNP in three population breeds were determined and evaluated by the χ2 test. Results showed that the polymorphism distribution was not similar in all of the three Bos taurus breeds, the genotype distributions of two cattle breeds Jia xian red and Nanyang did not agree with Hardy–Weinberg equilibrium (P 0.05. The A/G allelic frequencies in these breeds were 0.797/0.202, 0.770/0.229, 0.863/0.136 respectively. The genotype frequencies in Jia xian red and Nanyang cattle breeds showed moderate diversity (0.25< polymorphism information content <0.5. Furthermore, least squares analysis revealed significant effects of genotype on intramuscular fat, rib area and water holding capacity in 510 individuals (P < 0.05. Our result suggests that A1142G SNP can be used as an efficacious genetic marker for meat quality traits in native Chinese cattle breeds (Bos taurus but a much large number of animals are required for Marker assisted selection.

  6. Sarcocystis heydorni, n. sp. (Apicomplexa: Sarcocystidae) with cattle (Bos taurus) and human (Homo sapiens) cycle.

    Science.gov (United States)

    Dubey, Jitender P; van Wilpe, Erna; Calero-Bernal, Rafael; Verma, Shiv Kumar; Fayer, Ronald

    2015-11-01

    Cattle (Bos taurus) are intermediate hosts for four species of Sarcocystis, namely Sarcocystis cruzi, Sarcocystis hirsuta, Sarcocystis hominis, and Sarcocystis rommeli. Of these four species, mature sarcocysts of S. cruzi are thin-walled (species of Sarcocystis with thin-walled sarcocysts in cattle. Two newborn calves were fed with sporocysts from the feces of a human volunteer who had ingested raw beef. The calves were killed 111 and 222 days later. In addition to thick-walled sarcocysts of S. hominis, both calves were coinfected with a Sarcocystis species that had a thin-walled sarcocysts, distinct from S. cruzi. The sarcocysts were mature, microscopic, up to 80 μm wide, and up to 1060 μm long. By light microscopy, the sarcocyst wall was thin (species of Sarcocystis reported from livestock. This unique species is named in honor of Dr. Alfred Otto Heydorn who provided the sporocysts. PMID:26243573

  7. Influence of calf genotype on colostral immunoglobulins in Bos taurus and Bos indicus cows and serum immunoglobulins in their calves.

    Science.gov (United States)

    Vann, R C; Holloway, J W; Carstens, G E; Boyd, M E; Randel, R D

    1995-10-01

    Purebred Bos indicus calves are documented to have lower survival rates than Bos taurus calves. Thus, this study was designed to investigate the possibility that this decreased survival rate may be attributed to dam colostral immunoglobulin (Ig) concentrations and subsequent calf serum Ig concentrations. The specific objective was to determine the effect of breed type of calf on colostrum production, immunoglobulin concentrations in colostrum and calf serum, and availability and absorption efficiency of Ig. Brahman (B) and Angus (A) cattle were reciprocally mated to produce calves of the following types: A x A (n = 8), A x B (n = 9), B x B (n = 11), and B x A (n = 11). At birth, calves were separated from their dams and a blood sample was collected before feeding pooled colostrum (30 mL/kg birth weight) at 1 and 6 h of age. From 6 to 12 h of age, each calf was placed in a box that allowed interaction with the dam but prevented suckling. At 12 h of age, each calf was fed its dam's colostrum and placed with the dam. Additional blood samples were collected at 12, 24, and 48 h after birth. Serum and colostrum samples were analyzed for IgG, IgG1, IgG2, IgM, and IgA using single radial immunodiffusion (RID) assay techniques. The cows were hand-milked after induction of milk letdown with oxytocin at 1 and 12 h after calving. Colostrum volume was recorded, and samples were collected. Brahman cows produced more (P x B and A x B breed types of calf. Brahman cows had more Ig available at 1 and 12 h than A cows due to increased production of colostrum. Breed type influenced colostral Ig in cattle. Serum concentrations of total Ig, IgG, IgG1, IgG2, IgM, and IgA in the calf and efficiency of absorption at 6 and 12 h were not affected by breed type, sex of calf, or any interaction. PMID:8617676

  8. A new single nucleotide polymorphism in CAPN1 extends the current tenderness marker test to include cattle of Bos indicus, Bos taurus, and crossbred descent.

    Science.gov (United States)

    White, S N; Casas, E; Wheeler, T L; Shackelford, S D; Koohmaraie, M; Riley, D G; Chase, C C; Johnson, D D; Keele, J W; Smith, T P L

    2005-09-01

    The three objectives of this study were to 1) test for the existence of beef tenderness markers in the CAPN1 gene segregating in Brahman cattle; 2) test existing CAPN1 tenderness markers in indicus-influenced crossbred cattle; and 3) produce a revised marker system for use in cattle of all subspecies backgrounds. Previously, two SNP in the CAPN1 gene have been described that could be used to guide selection in Bos taurus cattle (designated Markers 316 and 530), but neither marker segregates at high frequency in Brahman cattle. In this study, we examined three additional SNP in CAPN1 to determine whether variation in this gene could be associated with tenderness in a large, multisire American Brahman population. One marker (termed 4751) was associated with shear force on postmortem d 7 (P Brangus, Beefmaster, Bonsmara, Romosinuano, Hereford, and Angus referred to as the GPE Cycle 8 population). The highly significant association of Marker 4751 with shear force in this population (P < 0.001) confirms the usefulness of Marker 4751 in cattle of all subspecies backgrounds, including Bos taurus, Bos indicus, and crossbred descent. This wide applicability adds substantial value over previously released Markers 316 and 530. However, Marker 316, which had previously been shown to be associated with tenderness in the GPE Cycle 7 population, also was highly associated with shear force in the GPE Cycle 8 animals (P < 0.001). Thus, Marker 316 may continue to be useful in a variety of populations with a high percentage of Bos taurus backgrounds. An optimal marker strategy for CAPN1 in many cases will be to use both Markers 316 and 4751. PMID:16100054

  9. The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla

    Science.gov (United States)

    Ballarin, Cristina; Povinelli, Michele; Granato, Alberto; Panin, Mattia; Corain, Livio; Peruffo, Antonella; Cozzi, Bruno

    2016-01-01

    The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ), and Cerebellar Quotient (CQ). Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla) indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes. PMID:27128674

  10. Embryonic development of the bovine pineal gland (Bos taurus) during prenatal life (30 to 135 days of gestation)

    OpenAIRE

    Regodón, S.; Roncero, V

    2005-01-01

    The ontogenesis of the pineal gland of 30 bovine embryos (Bos taurus) has been analysed from 30 until 135 days of gestation by means of optical microscopy and immunohistochemical techniques. For this study, the specimens were grouped into three stages in accordance with the most relevant histological characteristics: Stage 1 (30 to 64 days of prenatal development); Stage 2 (70 to 90 days) and Stage 3 (106 to 135 days). In the cow, it is from 30 days of gestatio...

  11. The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

    Science.gov (United States)

    Ballarin, Cristina; Povinelli, Michele; Granato, Alberto; Panin, Mattia; Corain, Livio; Peruffo, Antonella; Cozzi, Bruno

    2016-01-01

    The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ), and Cerebellar Quotient (CQ). Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla) indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes. PMID:27128674

  12. Genome-wide detection and characterization of endogenous retroviruses in Bos taurus.

    Science.gov (United States)

    Garcia-Etxebarria, Koldo; Jugo, Begoña Marina

    2010-10-01

    Endogenous retroviruses (ERVs) are the proviral phase of exogenous retroviruses that become integrated into a host germ line. They can play an important role in the host genome. Bioinformatic tools have been used to detect ERVs in several vertebrates, primarily primates and rodents. Less information is available regarding ERVs in other mammalian groups, and the source of this information is basically experimental. We analyzed the genome of the cow (Bos taurus) using three different methods. A BLAST-based method detected 928 possible ERVs, LTR_STRUC detected 4,487 elements flanked by long terminal repeats (LTRs), and Retrotector detected 9,698 ERVs. The ERVs were not homogeneously distributed across chromosomes; the number of ERVs was positively correlated with chromosomal size and negatively correlated with chromosomal GC content. The bovine ERVs (BoERVs) were classified into 24 putative families, with 20 of them not previously described. One of these new families, BoERV1, was the most abundant family and appeared to be specific to ruminants. An analysis of representatives of ERV families from rodents, primates, and ruminants showed a phylogenetic relationship following their hosts' relationships. This study demonstrates the importance of using multiple methods when trying to identify new ERVs and shows that the number of bovine ERV families is not as limited as previously thought. PMID:20686017

  13. Bovine Genome Database: new tools for gleaning function from the Bos taurus genome.

    Science.gov (United States)

    Elsik, Christine G; Unni, Deepak R; Diesh, Colin M; Tayal, Aditi; Emery, Marianne L; Nguyen, Hung N; Hagen, Darren E

    2016-01-01

    We report an update of the Bovine Genome Database (BGD) (http://BovineGenome.org). The goal of BGD is to support bovine genomics research by providing genome annotation and data mining tools. We have developed new genome and annotation browsers using JBrowse and WebApollo for two Bos taurus genome assemblies, the reference genome assembly (UMD3.1.1) and the alternate genome assembly (Btau_4.6.1). Annotation tools have been customized to highlight priority genes for annotation, and to aid annotators in selecting gene evidence tracks from 91 tissue specific RNAseq datasets. We have also developed BovineMine, based on the InterMine data warehousing system, to integrate the bovine genome, annotation, QTL, SNP and expression data with external sources of orthology, gene ontology, gene interaction and pathway information. BovineMine provides powerful query building tools, as well as customized query templates, and allows users to analyze and download genome-wide datasets. With BovineMine, bovine researchers can use orthology to leverage the curated gene pathways of model organisms, such as human, mouse and rat. BovineMine will be especially useful for gene ontology and pathway analyses in conjunction with GWAS and QTL studies. PMID:26481361

  14. Mutagenic Potential ofBos taurus Papillomavirus Type 1 E6 Recombinant Protein: First Description

    Directory of Open Access Journals (Sweden)

    Rodrigo Pinheiro Araldi

    2015-01-01

    Full Text Available Bovine papillomavirus (BPV is considered a useful model to study HPV oncogenic process. BPV interacts with the host chromatin, resulting in DNA damage, which is attributed to E5, E6, and E7 viral oncoproteins activity. However, the oncogenic mechanisms of BPV E6 oncoprotein per se remain unknown. This study aimed to evaluate the mutagenic potential of Bos taurus papillomavirus type 1 (BPV-1 E6 recombinant oncoprotein by the cytokinesis-block micronucleus assay (CBMNA and comet assay (CA. Peripheral blood samples of five calves were collected. Samples were subjected to molecular diagnosis, which did not reveal presence of BPV sequences. Samples were treated with 1 μg/mL of BPV-1 E6 oncoprotein and 50 μg/mL of cyclophosphamide (positive control. Negative controls were not submitted to any treatment. The samples were submitted to the CBMNA and CA. The results showed that BPV E6 oncoprotein induces clastogenesis per se, which is indicative of genomic instability. These results allowed better understanding the mechanism of cancer promotion associated with the BPV E6 oncoprotein and revealed that this oncoprotein can induce carcinogenesis per se. E6 recombinant oncoprotein has been suggested as a possible vaccine candidate. Results pointed out that BPV E6 recombinant oncoprotein modifications are required to use it as vaccine.

  15. Sequenciamento e análise dos genes das subunidades alfa e beta do hormônio folículo estimulante de bovino (Bos taurus indicus Sequencing and analysis of subunits alpha and beta of the follicle stimulating hormone from bovine (Bos taurus indicus

    Directory of Open Access Journals (Sweden)

    Luci Sayori Murata

    2008-07-01

    Full Text Available

    Este trabalho relata uma clonagem e seqüenciamento das subunidades alfa e beta do hormônio folículo estimulante de Bos taurus indicus. Também apresenta os resultados de comparação realizada das seqüências gênicas dessas cadeias com as seqüências das cadeias alfa e beta do FSH de suínos e da cadeia beta de bovinos Bos taurus taurus já presentes no GenBank. Na comparação das seqüências de nucleotídeos e de aminoácidos predita da cadeia αFSH de Bos taurus indicus com as cadeias αFSH de outras espécies como suínos e búfalo (Bubalis bubalis, observou-se que as seqüências são bastante similares. A comparação da seqüência da subunidade αFSH de Bos taurus indicus com a de suíno demonstrou diferenças em três resíduos de aminoácidos. Na comparação com ßFSH, registrou-se modificação na primeira base do codon que levou à alteração no resíduo do aminóacido 83, que, em Bos taurus indicus, é uma glicina, ao invés da serina presente em Bos taurus taurus. Confirmaram-se essa modificação e todas as outras identificadas na seqüência dos cDNA das cadeias αFSH e βFSH em outra clonagem. A modificação Ser para Gly na posição 83 foi a única que alterou a identidade do resíduo de aminoácido na comparação entre as subunidades beta do FSH de Bos taurus indicus e Bos taurus taurus. Contudo, ela não deve alterar significativamente as propriedades fisiológicas do FSH, uma vez que o resíduo de glicina encontrado nessa posição também é encontrado na cadeia βFSH suína. Trata-se, portanto, de uma modificação particular que distingue as cadeias βFSH de B. taurus taurus e B. taurus indicus.

     

    PALAVRAS-CHAVES: Bovino, clonagem, FSH, hormônio.

    The aim this work was to promove the cloning and analysis sequencing

  16. Select Synch and Co-Synch protocols using a CIDR yield similar pregnancy rates after a fixed-time insemination in suckled Bos indicus × Bos taurus cows.

    Science.gov (United States)

    Esterman, Regina D; Alava, Erin N; Austin, Brad R; Hersom, Matthew J; Yelich, Joel V

    2016-03-15

    Primiparous and multiparous suckled Bos indicus × Bos taurus cows were used to compare a Select Synch + controlled internal drug release (CIDR) and timed artificial insemination (AI) protocol (SSC) to a modified CO-Synch + CIDR protocol (COS). Five separate groups of cows were utilized (n = 659) and within a group, cows were allotted to two treatments on the basis of body condition score (BCS) taken 10 days before and days postpartum at CIDR insertion (Day 0). Blood samples were collected on Day -10 and 0 for assessment of circulating concentrations of progesterone to determine estrous cycling status. Cows in both treatments received intramuscular (im) GnRH (100 μg) and a CIDR inserted on Day 0. On Day 7, the SSC treatment had CIDR removed and received im PGF2α (25 mg), whereas COS treatment had CIDR removed and received im PGF2α (25 mg) on Day 7.5. In the SSC treatment, estrus was detected daily at 0700 and 1700 hours for 72 hours after PGF2α administration, and cows were artificially inseminated 8 to 12 hours after a detected estrus. Cows failing to exhibit estrus were subjected to timed-AI and received im GnRH (100 μg) 76 ± 4 hours after PGF2α administration. In the COS treatment, cows received im GnRH (100 μg) and were fixed-time artificially inseminated at 64 ± 4 hours after PGF2α administration. Although group differences (P 0.05) for SSC (49.4%; n = 164 of 332) and COS (47.1%; n = 154 of 327). Estrous cycling status and days postpartum did not (P > 0.05) influence synchronized AI pregnancy rates but BCS did (P < 0.05). Cows with a BCS greater than or equal to 5 had synchronized AI pregnancy rates of 50% compared to 39% for cows with BCS lesser than 5.0. In summary, the modified COS protocol yielded similar synchronized AI pregnancy rates compared to the SSC protocol, and it appears that the modified COS protocol has the potential to be an effective timed-AI protocol in suckled Bos indicus × Bos taurus cows. PMID:26631280

  17. Sarcocystis rommeli, n. sp. (Apicomplexa: Sarcocystidae) from Cattle (Bos taurus) and its Differentiation from Sarcocystis hominis.

    Science.gov (United States)

    Dubey, Jitender P; Moré, Gastón; van Wilpe, Erna; Calero-Bernal, Rafael; Verma, Shiv K; Schares, Gereon

    2016-01-01

    Cattle (Bos taurus) are intermediate hosts for three named species of Sarcocystis, S. cruzi, S. hirsuta, and S. hominis. Recently, a fourth species was identified and named S. sinensis. However, S. sinensis originally named a species of Sarcocystis in water buffalo (Bubalus bubalis) in China. Based on unverifiable evidence, it was suggested that the same parasite infects cattle. In addition, S. sinensis was recently declared as nomen nudum because its naming violated the rules of International Code of Zoological Nomenclature. Thus, the fourth species using cattle as an intermediate host does not have a valid name. Here, we propose a new name, Sarcocystis rommeli for the S. sinensis-like parasite from cattle in Argentina, and differentiate it ultrastructurally from S. hominis sarcocysts from experimentally infected cattle. Sarcocystis rommeli sarcocysts were microscopic with a 5-μm-thick wall with slender villar protrusions (Vp); the Vp were up to 5 μm long, up to 0.5 μm wide, and of uneven thickness, often bent at an angle. The ground substance layer (Gs) was up to 0.8 μm thick and smooth. Vesicular structures were seen at the base of the Vp. The bradyzoites were 10-12 μm long. Sarcocystis hominis sarcocysts had Vp that were often upright, up to 7.5 μm long, and up to 1.8 μm wide; the Gs was up to 2 μm thick and without vesicles. Its sarcocyst wall was up to 5.6 μm thick, the vp were bent at an angle, up to 5.8 μm long, the Gs was up to 2 μm thick, but without vesicles seen in S. rommeli. Beef containing sarcocysts of S. rommeli was not orally infectious for two human volunteers and a red fox (Vulpes vulpes). The Sarcocystis described here is molecularly different from S. cruzi, S. hirsuta, and S. hominis based on 18S rRNA and cox1 gene sequences. PMID:26111603

  18. Effect of single nucleotide polymorphisms of CAPN1 and CAST genes on meat traits in Nellore beef cattle (Bos indicus) and in their crosses with Bos taurus.

    Science.gov (United States)

    Curi, R A; Chardulo, L A L; Mason, M C; Arrigoni, M D B; Silveira, A C; de Oliveira, H N

    2009-08-01

    The objectives of this work were to study the segregation of single nucleotide polymorphisms of the calpain 1, large subunit (CAPN1) and calpastatin (CAST) genes in Nellore (Bos indicus) and Nellore xBos taurus beef cattle, as well as to evaluate their effects on meat traits. For this, 300 animals, including 114 Nellore, 67 Angus x Nellore, 44 Rubia Gallega x Nellore, 41 Canchim, 19 Brangus three-way crosses and 15 Braunvieh three-way crosses, were genotyped for the CAPN4751 [AF_248054.2:g.6545C>T (GenBank accession AF248054.2)] and CAST/DdeI [AF_159246.1:g.2959A>G (GenBank accession AF159246.1)] polymorphisms and phenotyped for Ribeye Area, Backfat Thickness, Intramuscular Fat, Shear Force (SF) and Myofibrillar Fragmentation Index (MFI). In relation to the CAPN4751 polymorphism, a frequency of 10.5% was observed for the C allele in the Nellore breed. In the total sample of studied animals, a significant association was found between genotypes and meat tenderness, assessed by SF (P = 0.005) and MFI (P = 0.008), with genotype CT being more favourable than TT. For the CAST/DdeI polymorphism, a frequency of 55.7% was found for the A allele in the Nellore breed. In the total sample, a significant association was observed between genotypes and meat tenderness - SF (P = 0.004) and MFI (P = 0.006), with genotype AA being more favourable than AG. The relationship between genotypes and aged meat tenderness in confluence with the distribution of favourable alleles shows great potential for application of the CAPN4751 and CAST/DdeI polymorphisms in the genetic improvement of the Nellore breed, whilst contributing to the validation, in this breed and in its crosses with B. taurus, of the association results previously described in the literature. PMID:19392828

  19. Urinary excretion of purine derivatives as an index of microbial protein supply in cross-bred (Bos indicus x Bos taurus) cattle in tropical environment

    International Nuclear Information System (INIS)

    Four experiments were carried out to establish a response model between urinary excretion of purine derivatives (PD) and microbial production in Bos indicus x Bos taurus cross-bred cattle: LZ, MZ and HZ (3/8, 1/2 and 5/8 Bos indicus, respectively). The fasting PD excretion was considered as endogenous excretion and amounted to 268 (± 85.1), 294 (± 128.1) and 269 (± 68.4) μmol/kg W0.75 for LZ, MZ and HZ, respectively. Urinary recovery of absorbed purine bases (PB) was calculated as the urinary recovery of a single dose of intrajugular infused uric acid (1,3-15N). In HZ crossbred cattle 83% (± 20.3) of infused uric acid was recovered in the urinary PD. The relationship between duodenal purine absorption (X, mmol/d) and urinary PD excretion (Y, mmol/d) was defined in HZ crossbred cattle as Y = 0.83 X + 0.269W0.75 (± 85.1), assuming that the endogenous contribution was constant and independent of the exogenous PB supply. The activity of xanthine oxidase (EC 1.2.3.2.) was determined in HZ and MZ and was found to be higher in the liver (0.62 and 0.66 units/g, respectively) than in intestinal mucosa (0.09 and 0.03 units/g, respectively), whereas xanthine oxidase activity was practically absent in plasma of both cross breeds. The ratio PB:total N was determined in microbial extracts taken from rumen fluid of cows fed Bermuda grass (Cynodon dactylon) as the sole diet or supplemented (ratio of 80:20, grass: supplement) with gluten feed, soybean hulls or Gliricidia species and were found to range from 1.52-1.62 μmol PB/mg N. (author)

  20. Identity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus) and the suppression of Sarcocystis sinensis as a nomen nudum

    Science.gov (United States)

    There are uncertainties concerning the identity and host species specificity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus). Currently, in cattle three species are recognized with known endogenous stages, viz.: S. cruzi (with canine definitive host), S. hirsuta...

  1. Bos taurus genome sequence reveals the assortment of immunoglobulin and surrogate light chain genes in domestic cattle

    Directory of Open Access Journals (Sweden)

    Liljavirta Jenni

    2009-04-01

    Full Text Available Abstract Background The assortment of cattle immunoglobulin and surrogate light chain genes has been extracted from the version 3.1 of Bos taurus genome sequence as a part of an international effort to sequence and annotate the bovine genome. Results 63 variable lambda chain and 22 variable kappa chain genes were identified and phylogenetically assigned to 8 and 4 subgroups, respectively. The specified phylogenetic relationships are compatible with the established ruminant light chain variable gene families or subgroups. Because of gaps and uncertainties in the assembled genome sequence, the number of genes might change in the future versions of the genome sequence. In addition, three bovine surrogate light chain genes were identified. The corresponding cDNAs were cloned and the expression of the surrogate light chain genes was demonstrated from fetal material. Conclusion The bovine kappa gene locus is compact and simple which may reflect the preferential use of the lambda chain in cattle. The relative orientation of variable and joining genes in both loci are consistent with a deletion mechanism in VJ joining. The orientation of some variable genes cannot be determined from the data available. The number of functional variable genes is moderate when compared to man or mouse. Thus, post-recombinatorial mechanisms might contribute to the generation of the bovine pre-immune antibody repertoire. The heavy chains probably contribute more to recombinational immunoglobulin repertoire diversity than the light chains but the heavy chain locus could not be annotated from the version 3.1 of Bos taurus genome.

  2. Evaluation of reciprocal differences in Bos indicus x Bos taurus backcross calves produced through embryo transfer: I. Birth and weaning traits.

    Science.gov (United States)

    Amen, T S; Herring, A D; Sanders, J O; Gill, C A

    2007-02-01

    Angus (A) and Bos indicus (B; Brahman or Nellore) reciprocal backcross, embryo transfer calves, belonging to 28 full-sib families, were evaluated for differences in birth weight, gestation length, and weaning weight. Two methods were investigated; method I made no distinction between how the F(1) parents were produced, whereas method II distinguished between the 2 types of F(1) parents (AB vs. BA corresponding to A x B vs. B x A, respectively). Bos indicus backcross calves had a 4.3 d longer (P x F(1) calves had a 5.2 d longer (P = 0.01) gestation length than F(1) x B calves (290.5 vs. 285.3, respectively). Under method II analysis, there was a consistent trend for gestation length, in which BA F(1) parents produced calves that ranked greater than calves from AB F(1) parents, as sires and dams. Crosses with a greater proportion of B in the sire in relation to the amount in the dam had a heavier (P x A and B x F(1); 38.1 and 38.4 kg, respectively) than their respective reciprocal crosses (A x F(1) and F(1) x B; 34.3 and 33.5 kg, respectively). The F(1) x A and B x F(1) crosses showed a large difference in birth weight between males and females (5.3 and 4.1 kg, respectively), whereas A x F(1) and F(1) x B crosses showed a small difference (P > 0.10) in birth weight between males and females (1.5 and 1.1 kg, respectively). Further examination within each sex showed a difference between male reciprocals that was generally much larger than that between female reciprocals. Calves with a greater percentage of B in the sire compared with the proportion in the dam ranked heavier for weaning weight as for birth weight, though these differences were not significant. In breeding systems involving B x Bos taurus crosses, even when using embryo transfer, not only does the breed composition of the calves affect their preweaning performance, but the particular cross that produces the calves also should be considered in making breeding decisions. PMID:17235021

  3. Eficácia do tratamento Ovsynch associado à inseminação artificial prefixada em rebanhos Bos taurus e Bos indicus Efficacy of the Ovsynch treatment associated to fixed-time artificial insemination in Bos taurus and Bos indicus herds

    Directory of Open Access Journals (Sweden)

    Rafael Herrera Alvarez

    2003-02-01

    Full Text Available O presente trabalho objetivou avaliar a eficácia do tratamento Ovsynch associado à inseminação artificial em tempo prefixado em vacas Bos taurus e Bos indicus. Foram utilizados rebanhos das raças Holandesa, Caracu, Nelore e Mantiqueira. Também foi incluído um rebanho de vacas Gir, com problemas de fertilidade. Cada rebanho foi dividido em três grupos. O grupo 1 recebeu o tratamento Ovsynch e foi inseminado em tempo prefixado. O grupo 2 foi inseminado no cio induzido com cloprostenol. O grupo 3 foi inseminado no cio natural. As taxas de concepção e de prenhez foram determinadas por ultra-sonografia. Não existiu interação significativa das variáveis reprodutivas analisadas para rebanho, idade, período pós-parto, número de parição e presença do bezerro. A taxa de concepção não diferiu (P>0,05 entre os grupos, ao passo que a taxa de prenhez foi superior (PThe present study aimed to evaluate the efficiency of Ovsynch treatment associated with prefixed-time artificial insemination on Bos taurus and Bos indicus cows. Herds of Holstein, Caracu, Nelore and Mantiqueira breeds were used. A herd of Gir cows with poor reproductive performance was also included. Each breed was divided in tree groups. Group 1 received Ovsynch treatment and was inseminated at prefixed time. Group 2 was induced to estrus with cloprostenol and inseminated thereafter. Group 3 was inseminated at natural heat. Conception and pregnancy rates were determined by ultra-sound. No significant interactions were detected among breeds, age, parity, postpartum period and lactating cows with or without their calves. Conception rates did not differ (P>0.05 among groups while pregnancy rate was higher (P<0.05 for group 1 and 2 comparing to group 3. In the Gir herd Ovsynch treatment did not enhance conception nor pregnancy rates. Independently of breed, conception rate is similar after Ovsynch, cloprostenol and control treatments, and pregnancy rate can be improved with

  4. Mitogenomes from Egyptian Cattle Breeds: New Clues on the Origin of Haplogroup Q and the Early Spread of Bos taurus from the Near East

    OpenAIRE

    Olivieri, Anna; Gandini, Francesca; Achilli, Alessandro; Fichera, Alessandro; Rizzi, Ermanno; Bonfiglio, Silvia; Battaglia, Vincenza; Brandini, Stefania; De Gaetano, Anna; El-Beltagi, Ahmed; Lancioni, Hovirag; Agha, Saif; Semino, Ornella; Ferretti, Luca; Torroni, Antonio

    2015-01-01

    Background Genetic studies support the scenario that Bos taurus domestication occurred in the Near East during the Neolithic transition about 10 thousand years (ky) ago, with the likely exception of a minor secondary event in Italy. However, despite the proven effectiveness of whole mitochondrial genome data in providing valuable information concerning the origin of taurine cattle, until now no population surveys have been carried out at the level of mitogenomes in local breeds from the Near ...

  5. Accuracy of prediction of genomic breeding values for residual feed intake and carcass and meat quality traits in Bos taurus, Bos indicus, and composite beef cattle.

    Science.gov (United States)

    Bolormaa, S; Pryce, J E; Kemper, K; Savin, K; Hayes, B J; Barendse, W; Zhang, Y; Reich, C M; Mason, B A; Bunch, R J; Harrison, B E; Reverter, A; Herd, R M; Tier, B; Graser, H-U; Goddard, M E

    2013-07-01

    The aim of this study was to assess the accuracy of genomic predictions for 19 traits including feed efficiency, growth, and carcass and meat quality traits in beef cattle. The 10,181 cattle in our study had real or imputed genotypes for 729,068 SNP although not all cattle were measured for all traits. Animals included Bos taurus, Brahman, composite, and crossbred animals. Genomic EBV (GEBV) were calculated using 2 methods of genomic prediction [BayesR and genomic BLUP (GBLUP)] either using a common training dataset for all breeds or using a training dataset comprising only animals of the same breed. Accuracies of GEBV were assessed using 5-fold cross-validation. The accuracy of genomic prediction varied by trait and by method. Traits with a large number of recorded and genotyped animals and with high heritability gave the greatest accuracy of GEBV. Using GBLUP, the average accuracy was 0.27 across traits and breeds, but the accuracies between breeds and between traits varied widely. When the training population was restricted to animals from the same breed as the validation population, GBLUP accuracies declined by an average of 0.04. The greatest decline in accuracy was found for the 4 composite breeds. The BayesR accuracies were greater by an average of 0.03 than GBLUP accuracies, particularly for traits with known genes of moderate to large effect mutations segregating. The accuracies of 0.43 to 0.48 for IGF-I traits were among the greatest in the study. Although accuracies are low compared with those observed in dairy cattle, genomic selection would still be beneficial for traits that are hard to improve by conventional selection, such as tenderness and residual feed intake. BayesR identified many of the same quantitative trait loci as a genomewide association study but appeared to map them more precisely. All traits appear to be highly polygenic with thousands of SNP independently associated with each trait. PMID:23658330

  6. Energy requirements and cow/calf efficiency of Nellore and Continental and British Bos taurus x Nellore crosses.

    Science.gov (United States)

    Calegare, L; Alencar, M M; Packer, I U; Lanna, D P D

    2007-10-01

    The objective of this work was to compare breed types with increasing percentage of Bos taurus on cow/calf energy requirements and preweaning efficiency. Forty mature, lactating, nonpregnant cows [10 Nellore (NL), 10 Canchim x Nellore (CN), 10 Angus x Nellore (AN), and 10 Simmental x Nellore (SN)] were randomized in blocks by calving date. Calves from cross-bred cows were sired by Canchim bulls (5/8 Charolais + 3/8 Zebu), whereas calves from NL cows were sired by Nellore bulls. Cows were individually fed a pelleted diet with 50% hay (alfalfa and coastcross) and 50% concentrate from calving to weaning (20 to 180 d post-partum). Estimated diet ME content was 2.24 Mcal/kg of DM. Individual cow DMI was adjusted every 14 d to keep shrunk BW and BCS constant. Shrunk BW and BCS were 430 +/- 12 kg and 4.7 +/- 0.09 for NL, 449 +/- 10 kg and 4.8 +/- 0.09 for CN, 496 +/- 10 kg and 5.0 +/- 0.09 for AN, and 507 +/- 12 kg and 5.1 +/- 0.09 for SN. At 40 d calves were allowed ad libitum access to the same diet. Milk yield was recorded using a weigh-suckle-weigh technique. Increasing B. taurus percentage had a linear effect (P body composition was estimated at weaning using the 9-10-11th-rib section. Retained energy (Mcal) was greater (P < 0.05) in 1/4A (384 +/- 19.9) than in Nellore (298 +/- 21.6) and 3/4C calves (312 +/- 19.8), and was intermediate in 1/4S calves (333 +/- 21.6). Cow/calf energetic efficiency (kcal deposited/Mcal of MEI by the pair) was greater (P < 0.05) for AN (103 +/- 5.3) than NL (84.9 +/- 5.9), CN (83 +/- 5.3), and SN pairs (83.5 +/- 6.1). Difference (P < 0.05) between Continental and British crosses was shown in linear contrasts; SN pairs had greater MEI and lower retained energy than AN. Increasing the B. taurus percentage increased inputs as well as outputs. However, a relatively greater increase in outputs resulted in significantly greater preweaning efficiency. Purebred Nellore had lower ME requirements; however, in an environment without nutritional

  7. Candidate SNPs for carcass and meat traits in Nelore animals and in their crosses with Bos taurus

    Directory of Open Access Journals (Sweden)

    Rogério Abdallah Curi

    2012-02-01

    Full Text Available The objective of this work was to evaluate the effects of single-nucleotide polymorphisms (SNPs in the genes IGF1 (AF_017143.1:g.198C>T, MSTN (AF_320998.1:g.433C>A, MYOD1 (NC_007313:g.1274A>G and MYF5 (NC_007303:g.1911A>G on carcass and meat traits in Nelore (Bos indicus and Nelore x B. taurus. A total of 300 animals were genotyped and phenotyped for rib eye area (REA, backfat thickness (BT, intramuscular fat (IF, shear force (SF and myofibrillar fragmentation index (MFI. The effects of allele substitution for each SNP were estimated by regression of the evaluated phenotypes on the number of copies of a particular allele using the general linear model. The polymorphism at IGF1 was non-informative in Nelore animals. In crossbred animals, the IGF1 C allele was associated with greater REA. However, this relation was not significant after Bonferroni correction for multiple testing. The A allele of the MSTN polymorphism was absent in Nelore cattle and was only found in two crossbred animals. The polymorphisms of MYOD1 and MYF5 were little informative in Nelore animals with G allele frequency of 0.097 and A allele frequency of 0.031, respectively. These markers show no association with the analyzed traits in the total sample of evaluated animals.

  8. Rendimiento de la canal en búfalos de río (Bubalus bubalis y Bovinos mestizos (Bos indicus x Bos taurus en el Municipio Bayazo - Canal performance in river buffaloes (Bubalus bubalis and mixed racial bovines (Bos indicus x Bos taurus in the Bayamo Municipality

    Directory of Open Access Journals (Sweden)

    Ramírez Reyes, B

    2010-07-01

    Full Text Available ResumenCon el objetivo de determinar algunas características de rendimientoen canales bufalinas (Bubalus bubalis de animales procedentes delCentro de Ceba El Progreso y compararlas con canales vacunas (Bosindicus x Bos taurus comercializadas, se desarrolló esta investigación en el matadero Jucaibama. Se trabajaron 60 animales enteros de cada especie con edades entre 24 y 32 meses, a los cuales se les determinaron los siguientes parámetros: peso de embarque (Kg.(PE, peso vivo reposo (PV (Kg. peso de la canal en kg. (PC,rendimiento en carne en kg. (RC, rendimiento en carne de primera enKg. (RC1 y rendimiento en carne de segunda en Kg. (RC2. Losresultados fueron para (PE 543,43 y 489,92 arrojando el análisisdiferencias altamente significativas, al igual que para las (PV y (PC que fueron de 527,12 y 474,15; 271,52 y 244,83 para búfalos yvacunos respectivamente. Las variables (RC, (RC1 y (RC2 nomostraron diferencias significativas, sus valores fueron 167,37 y171,93; 88,7 y 91,12; 76,66 y 78,74 para canales bubalinas yvacunas. Se concluye que los búfalos presentaron pesos mayores alsacrificio y de canal que los vacunos evaluados. El búfalo presentómayores rendimientos en carne, parámetros que indican que tiene laposibilidad de desarrollar mayor masa muscular que sus competidoresvacunos.SummaryThis research was carried out in the drudgery Jucaibama of determining some quality characteristics in the buffaloes meat(Bubalus bubalis of animal that belong to the feeding place ElProgreso. These characteristics are compare with the ones of the beefcattle (Bos indicus x taurus that are commercialized. 60 whole maleanimals of each species were taken as sample. They were about 24and 32 months old and they were determine the following parameters:Shipment weight (Kg., weight after twelve hours, meat weight, meatservility and servility of the best showed highly significant differences, just as the ones for (PV and (PC whose results were 527,12 and 474

  9. Effects of beta agonists in the diagnosis of fasciolosis in Bos indicus x Bos taurus in the state of Puebla, Mexico

    International Nuclear Information System (INIS)

    currently in Mexico about 30 million cattle of which about 15000.000 million are in areas at high risk of infestation and about 5,000,000 million fascioliosis animals are with, if we estimate the economic losses per year gives us an approximate price of 4,500,000,000 pesos are lost annually, on the other hand, the lack of good pasture especially in times of drought in the state are helping farmers are feeding their animals with food additives in this case the betaagonist (clenbuterol and the like ), At present there are several municipal traces at the state level are discarding the livers of cattle producing very large economic losses. been conducted on prevailing level of municipal trail Atlixco (zone endemic to the disease) in the year 2001-02 with a prevalence of 32-33 % While that in 2007 set a precedence of 7% over the same track municipal; this parasitic disease that affects the liver parenchyma and pipelines, affects the metabolic activity of the liver, this organ is one of the most important thing, because it participates in many metabolic pathways, as in the production and secretion of bile, regulates the metabolism of carbohydrates, lipids and proteins among others. This parasitic disease affects the production of meat and milk in ruminant animals in this very particular case Bos taurus x Bos indicus, the affected animals, these activities are depleted in previous studies have found that animals are fed with food additives such as beta -adrenergic-agonist, whose effect is to produce lipolysis, lipogenesis, are glucoliticos, and glycogen, affecting body composition, favouring neoformation tissue by the redistribution of power, also increasing the release of fatty acids into the blood, facilitating the synthesis of protein and retains the nitrogen fed into skeletal muscle, these components used as food additives are prohibited by federal law nationals (SAGARPA NOM-015-ZOO-2002), as the consumption of meat produced visceral primarily of clinical cases as tachycardia

  10. Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle

    Directory of Open Access Journals (Sweden)

    Ali Abdirahman A

    2012-07-01

    Full Text Available Abstract Background Infectious bovine keratoconjunctivitis (IBK or ‘pinkeye’ is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified species eggs per gram of faeces and growth traits in Australian tropically adapted Bos taurus cattle were estimated. Methods Animals were clinically examined for the presence of IBK infection before and after weaning when the calves were 3 to 6 months and 15 to 18 months old, respectively and were also recorded for tick counts, helminth eggs counts as an indicator of intestinal parasites and live weights at several ages including 18 months. Results Negative genetic correlations were estimated between IBK incidence and weight traits for animals in pre-weaning and post-weaning datasets. Genetic correlations among weight measurements were positive, with moderate to high values. Genetic correlations of IBK incidence with tick counts were positive for the pre-weaning and negative for the post-weaning datasets but negative with helminth eggs counts for the pre-weaning dataset and slightly positive for the post-weaning dataset. Genetic correlations between tick and helminth eggs counts were moderate and positive for both datasets. Phenotypic correlations of IBK incidence with helminth eggs per gram of faeces were moderate and positive for both datasets, but were close to zero for both datasets with tick counts. Conclusions Our results suggest that genetic selection against IBK incidence in tropical cattle is feasible and that calves genetically prone to acquire IBK infection could also be genetically prone to have a slower growth. The positive genetic correlations among weight traits and between tick and helminth eggs counts suggest that they are controlled by common genes (with pleiotropic effects. Genetic correlations between IBK incidence

  11. [The changes of expression and Fc-gamma-receptor's polypeptide composition of fetal small intestine enterocytes in Bos primigenius taurus L].

    Science.gov (United States)

    Masiuk, D M; Nedzvets'kyĭ, V S; Tsvilikhovs'kyĭ, M I; Nerush, P O

    2008-01-01

    The expression and polypeptide composition of Fc-gamma-receptors of enterocytes from Bos primigenius taurus L. intestine at 3-, 5-, 7-, 9- month of fetal development was investigated. The results of immunobloting show similar composition of Fc-gamma-receptors extracted from apical and basolateral membranes. The proteins that bind IgG after PAAG electrophoresis and transferring on nitrocellulose were observed as 120, 87, 72 and 43 kDa polypeptide line. The changes of each polypeptide contents were related to the changes of total content of Fc-gamma-receptor proteins. The rise in concentration of Fc-gamma-receptors on apical membrane was observed from 3-rd to 7-th month of fetal development. Maximal concentration of these proteins was detected on enterocytes at 7-th month of fetal development. Fc-gamma-receptors content on basolateral side was higher than on apical side. The presence of Fc-gamma-receptors on enterocyte's membrane indicates on active recycling of these receptors on plasma membrane and reflects early development of immune system in Bos primigenius taurus L. fetus. PMID:18416181

  12. Heat tolerance in two tropically adapted Bos taurus breeds, Senepol and Romosinuano, compared with Brahman, Angus, and Hereford cattle in Florida.

    Science.gov (United States)

    Hammond, A C; Olson, T A; Chase, C C; Bowers, E J; Randel, R D; Murphy, C N; Vogt, D W; Tewolde, A

    1996-02-01

    Two trials were conducted with heifers to determine heat tolerance among temperate Bos taurus (Angus, Hereford), Bos indicus (Brahman), tropical Bos taurus (Senepol, Romosinuano), and the reciprocal crosses of Hereford and Senepol. Differences among breeds in temperament score, circulating concentrations of cortisol, and blood packed cell volume were also investigated. Trial 1 used 43 Angus, 28 Brahman, 12 Hereford, 23 Romosinuano, 16 Senepol, 5 Hereford x Senepol (H x S), and 5 Senepol x Hereford (S x H) heifers. Trial 2 used 36 Angus, 31 Brahman, 9 Hereford, 14 Senepol, 19 H x S, and 10 S x H heifers. On the hottest summer date in Trial 1, rectal temperature of Angus was greater (P Brahman, Senepol, or Romosinuano. Rectal temperature and plasma cortisol were significantly less in Senepol than in Brahman, suggesting that the differences in rectal temperature between these breeds may be due to differences in stress response possibly related to differences in temperament. Reciprocal crosses of Hereford and Senepol had rectal temperatures nearly as low as that of Senepol and displayed substantial heterosis (-9.4%, P Angus heifers had significantly faster respiration rates than Brahman, Romosinuano, or Senepol heifers, and Brahman had significantly slower respiration rates than Romosinuano or Senepol. On the hottest summer date in Trial 2, rectal temperature in Angus heifers was greater (P Brahman or Senepol had rectal temperatures similar to that of Senepol, or heterosis for log10 rectal temperature was similar to that in Trial 1 (-9.8%, P Brahman always had the slowest respiration rate and greatest packed cell volume. Brahman had significantly greater temperament scores and plasma cortisol concentrations than Angus or Senepol, except that plasma cortisol was not different between Brahman and Senepol on the hottest summer date. On this date, rectal temperature did not differ between Brahman and Senepol, which supports the hypothesis that there is a relationship

  13. Variation in meat quality characteristics between Sanga (Bos taurus africanus) and Sanga-derived cattle breeds and between Sanga and Brahman (Bos indicus).

    Science.gov (United States)

    Strydom, P E; Frylinck, L; Smith, M F

    2011-03-01

    Cattle breeds indigenous to Africa (Sanga) compare favourably to Bos indicus breeds with regard to adaptation to harsh environments. This study compared the meat quality of three Sanga breeds (Nguni, Tuli and Drakensberger), a Sanga-related breed (Bonsmara) and a B. indicus breed (Brahman) and supported these results with biochemical and histological measurements on the M. longissimus lumborum. Twelve young grain-fed steers of each breed were slaughtered and carcasses were electrically stimulated. All Sanga (and related) breeds, with the exception of the Tuli, had lower Warner-Bratzler shear force (SF) values at 2 and 21 days post mortem compared with the BR (P meat than BR, mainly due to favourable calpain-to-calpastatin ratios. Small differences in colour, drip loss and cooking properties were found among breeds (P < 0.05). PMID:22445415

  14. Impact of a trace element supplementation programme on health and performance of cross-breed (Bos indicus x Bos taurus) dairy cattle under tropical farming conditions: a double-blinded randomized field trial.

    Science.gov (United States)

    Dermauw, V; Dierenfeld, E; Du Laing, G; Buyse, J; Brochier, B; Van Gucht, S; Duchateau, L; Janssens, G P J

    2015-06-01

    Small-scale urban dairy farms (n = 16) in and around Jimma, Ethiopia with cross-bred (Bos indicus × Bos taurus) cows were enrolled in a double-blinded intervention study to investigate the effect of a trace element supplementation programme on trace element status and milk concentrations as well as performance [body condition score (BCS), milk yield, leptin], milk composition, antioxidant status (ferric-reducing ability of plasma (FRAP), thiobarbituric acid-reactive substances (TBARS)], blood biochemistry, serum proteins and immune response (antibody titre upon rabies vaccination). The farms were allocated to a (1) placebo or (2) Cu, Zn, Se, Co and I supplementation treatment for 150 d. On days 0 and 120, four lactating cows per farm were sampled for milk and plasma, and on day 150 for serum, following primo-vaccination. Cu deficiency was present in 17% and marginal Se deficiency in 30% of initially sampled cows, while no Zn shortage was detected. Over 120 days, trace element supplementation caused a bigger increase in plasma Se and Cu concentrations, but also a larger decrease of plasma Fe concentrations. A larger increase in milk Se concentrations was observed in the supplemented group, whereas none of the other elements were affected. BCS decreased more over time in the supplemented group. None of the other parameters of performance and antioxidant status nor milk composition or blood biochemistry was affected by treatment. Antibody response to rabies vaccination did not differ between groups, whereas α1-globulins tended to be lower and β-globulins tended to be higher in the supplemented group. In conclusion, despite improved Cu and Se status and Se concentrations in milk, cows on tropical urban dairy farms did not seem to benefit from trace element supplementation, with respect to the parameters investigated. PMID:24990384

  15. Evaluation of reciprocal differences in Bos indicus x Bos taurus backcross calves produced through embryo transfer: II. Postweaning, carcass, and meat traits.

    Science.gov (United States)

    Amen, T S; Herring, A D; Sanders, J O; Gill, C A

    2007-02-01

    Angus (A) x Bos indicus (B; Brahman or Nellore) reciprocal backcross, embryo transfer calves belonging to 28 full-sib families were evaluated for differences in feedyard initial BW, feedyard final BW, carcass weight, LM area, adjusted fat thickness, intramuscular fat, and Warner-Bratzler shear force. Two methods of analysis were investigated; method I made no distinction between how the F(1) parents were produced, whereas method II distinguished the 2 types of F(1) parents (AB vs. BA, corresponding to A x B vs. B x A, respectively). No significant reciprocal differences for these weight and carcass traits were detected under method I analyses, although the same trend existed for subsequent BW rankings as for birth weight and weaning weight. For each weight phase, the cross that involved a larger proportion of B in the sire in relation to the amount in the dam (F(1) x A and B x F(1)) ranked heavier than the respective reciprocal cross (A x F(1) and F(1) x B). As a whole, A backcross calves had larger (P x dam type interaction was observed for initial feedyard BW. Results from this study suggest that for weight-related traits, both the breed constitution of the embryo transfer calf and the cross that produces the calf play an important role in its ultimate performance for B crossbred calves. For body composition and meat-related traits, it appears that the breed makeup of the embryo transfer calf itself is more important to animal performance than the specific cross used to produce the calf. PMID:17235022

  16. Detection of quantitative trait loci for growth and beef carcass fatness traits in a cross between Bos taurus (Angus) and Bos indicus (Brahman) cattle.

    Science.gov (United States)

    Kim, J J; Farnir, F; Savell, J; Taylor, J F

    2003-08-01

    This study was conducted to detect quantitative trait loci (QTL) affecting growth and beef carcass fatness traits in an experimental population of Angus and Brahman crossbreds. The three-generation mapping population was generated with 602 progeny from 29 reciprocal backcross and three F2 full-sib families, and 417 genetic markers were used to produce a sex-averaged map of the 29 autosomes spanning 2,642.5 Kosambi cM. Alternative interval-mapping approaches were applied under line-cross (LC) and random infinite alleles (RA) models to detect QTL segregating between and within breeds. A total of 35 QTL (five with genomewide significant and 30 with suggestive evidence for linkage) were found on 19 chromosomes. One QTL affecting yearling weight was found with genomewide significant evidence for linkage in the interstitial region of bovine autosome (BTA) 1, and an additional 19 QTL were detected with suggestive evidence for linkage under the LC model. Many of these QTL had a dominant (complete or overdominant) mode of gene action, and only a few of the QTL were primarily additive, which reflects the fact that heterosis for growth is known to be appreciable in crosses among Brahman and British breeds. Four QTL affecting growth were detected with genomewide significant evidence for linkage under the RA model on BTA 2 and BTA 6 for birth weight, BTA 5 for yearling weight, and BTA 23 for hot carcass weight. An additional 11 QTL were detected with suggestive evidence for linkage under the RA model. None of the QTL (except for yearling weight on BTA 5) detected under the RA model were found by the LC analyses, suggesting the segregation of alternate alleles within one or both of the parental breeds. Our results reveal the utility of implementing both the LC and RA models to detect dominant QTL and also QTL with similar allele frequency distributions within parental breeds. PMID:12926775

  17. Identity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus) and the suppression of Sarcocystis sinensis as a nomen nudum.

    Science.gov (United States)

    Dubey, J P; Fayer, R; Rosenthal, B M; Calero-Bernal, R; Uggla, A

    2014-09-15

    There are uncertainties concerning the identity and host species specificity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus). Currently, in cattle three species are recognized with known endogenous stages, viz.: S. cruzi (with canine definitive host), S. hirsuta (feline definitive host), and S. hominis (primate definitive host). Recently, a fourth Sarcocystis species with an unknown life cycle has been reported from cattle. In the water buffalo, four species of Sarcocystis have been described: S. fusiformis (feline definitive host), S. buffalonis (feline definitive host), S. levinei (canine definitive host), and S. dubeyi (definitive host unknown but not cat or dog). Besides, there are studies of Sarcocystis infections in buffalo and cattle from China with results that are difficult to interpret and validate. For example, some of the studies report transmission of Sarcocystis species between cattle and buffalo, but steps to preclude exogenous exposures were not reported. A species of the water buffalo, 'S. sinensis', was proposed at a Chinese national conference in 1990, and published as an abstract without figures and with no archived type specimens for verification. The International Code of Zoological Nomenclature Articles 9 and 10 state that "abstracts of articles, papers, posters, text of lectures, and similar material when issued primarily to participants at meetings, symposia, colloquia or congress does not constitute published work"; therefore, S. sinensis is a nomen nudum. PMID:25034134

  18. Differential abundances of four forms of Binder of SPerm 1 in the seminal plasma of Bos taurus indicus bulls with different patterns of semen freezability.

    Science.gov (United States)

    Magalhães, Marcos Jorge; Martins, Leonardo Franco; Senra, Renato Lima; Santos, Thaís Ferreira Dos; Okano, Denise Silva; Pereira, Paulo Roberto Gomes; Faria-Campos, Alessandra; Campos, Sérgio Vale Aguiar; Guimarães, José Domingos; Baracat-Pereira, Maria Cristina

    2016-08-01

    The Binder of SPerm 1 (BSP1) protein is involved in the fertilization and semen cryopreservation processes and is described to be both beneficial and detrimental to sperm. Previously, the relationship of BSP1 with freezability events has not been completely understood. The objective of this work was to determine the differential abundance of the forms of the BSP1 protein in cryopreserved seminal plasma of Bos taurus indicus bulls with different patterns of semen freezability using proteomics. A wide cohort of adult bulls with high genetic value from an artificial insemination center was used as donors of high quality, fresh semen. Nine bulls presenting different patterns of semen freezability were selected. Two-dimensional gel electrophoresis showed differential abundance in a group of seven protein spots in the frozen/thawed seminal plasma from the bulls, ranging from 15 to 17 kDa, with pI values from 4.6 to 5.8. Four of these spots were confirmed to be BSP1 using mass spectrometry, proteomics, biochemical, and computational analysis (Tukey's test at P < 0.05). The protein spot weighing 15.52 ± 0.53 kDa with a pI value of 5.78 ± 0.12 is highlighted by its high abundance in bulls with low semen freezability and its absence in bulls presenting high semen freezability. This is the first report showing that more than two forms of BSP1 are found in the seminal plasma of Nelore adult bulls and not all animals have a similar abundance of each BSP1 form. Different BSP1 forms may be involved in different events of fertilization and the cryopreservation process. PMID:27118515

  19. Mitogenomes from Egyptian Cattle Breeds: New Clues on the Origin of Haplogroup Q and the Early Spread of Bos taurus from the Near East.

    Directory of Open Access Journals (Sweden)

    Anna Olivieri

    Full Text Available Genetic studies support the scenario that Bos taurus domestication occurred in the Near East during the Neolithic transition about 10 thousand years (ky ago, with the likely exception of a minor secondary event in Italy. However, despite the proven effectiveness of whole mitochondrial genome data in providing valuable information concerning the origin of taurine cattle, until now no population surveys have been carried out at the level of mitogenomes in local breeds from the Near East or surrounding areas. Egypt is in close geographic and cultural proximity to the Near East, in particular the Nile Delta region, and was one of the first neighboring areas to adopt the Neolithic package. Thus, a survey of mitogenome variation of autochthonous taurine breeds from the Nile Delta region might provide new insights on the early spread of cattle rearing outside the Near East.Using Illumina high-throughput sequencing we characterized the mitogenomes from two cattle breeds, Menofi (N = 17 and Domiaty (N = 14, from the Nile Delta region. Phylogenetic and Bayesian analyses were subsequently performed.Phylogenetic analyses of the 31 mitogenomes confirmed the prevalence of haplogroup T1, similar to most African cattle breeds, but showed also high frequencies for haplogroups T2, T3 and Q1, and an extremely high haplotype diversity, while Bayesian skyline plots pointed to a main episode of population growth ~12.5 ky ago. Comparisons of Nile Delta mitogenomes with those from other geographic areas revealed that (i most Egyptian mtDNAs are probably direct local derivatives from the founder domestic herds which first arrived from the Near East and the extent of gene flow from and towards the Nile Delta region was limited after the initial founding event(s; (ii haplogroup Q1 was among these founders, thus proving that it underwent domestication in the Near East together with the founders of the T clades.

  20. An examination of positive selection and changing effective population size in Angus and Holstein cattle populations (Bos taurus using a high density SNP genotyping platform and the contribution of ancient polymorphism to genomic diversity in Domestic cattle

    Directory of Open Access Journals (Sweden)

    Hayes Ben

    2009-04-01

    Full Text Available Abstract Background Identifying recent positive selection signatures in domesticated animals could provide information on genome response to strong directional selection from domestication and artificial selection. With the completion of the cattle genome, private companies are now providing large numbers of polymorphic markers for probing variation in domestic cattle (Bos taurus. We analysed over 7,500 polymorphic single nucleotide polymorphisms (SNP in beef (Angus and dairy (Holstein cattle and outgroup species Bison, Yak and Banteng in an indirect test of inbreeding and positive selection in Domestic cattle. Results Outgroup species: Bison, Yak and Banteng, were genotyped with high levels of success (90% and used to determine ancestral and derived allele states in domestic cattle. Frequency spectrums of the derived alleles in Angus and Holstein were examined using Fay and Wu's H test. Significant divergences from the predicted frequency spectrums expected under neutrality were identified. This appeared to be the result of combined influences of positive selection, inbreeding and ascertainment bias for moderately frequent SNP. Approximately 10% of all polymorphisms identified as segregating in B. taurus were also segregating in Bison, Yak or Banteng; highlighting a large number of polymorphisms that are ancient in origin. Conclusion These results suggest that a large effective population size (Ne of approximately 90,000 or more existed in B. taurus since they shared a common ancestor with Bison, Yak and Banteng ~1–2 million years ago (MYA. More recently Ne decreased sharply probably associated with domestication. This may partially explain the paradox of high levels of polymorphism in Domestic cattle and the relatively small recent Ne in this species. The period of inbreeding caused Fay and Wu's H statistic to depart from its expectation under neutrality mimicking the effect of selection. However, there was also evidence for selection

  1. Perfil de ácidos grasos en leche de vacas Chinampas (Bos taurus alimentadas con forraje fresco de matorral sarcocaulescente o heno de alfalfa Fatty acids profile in milk of Chinampo cows (Bos taurus fed fresh forage from sarcocaulescent shrubs or alfalfa hay

    Directory of Open Access Journals (Sweden)

    R Ortega-Pérez

    2013-01-01

    Full Text Available El objetivo del estudio fue determinar la concentración de ácidos grasos (AG en la leche de vacas Chinampas, con énfasis en los ácidos grasos conjugados (CLA. Se colectó una muestra manual de leche (10 ml de 32 vacas entre los 60 y 120 días de lactación. Un grupo (FV; n = 25 se alimentó en pastoreo con forraje verde durante la estación de lluvias de septiembre a octubre de 2009 en una zona semiárida de matorral sarcocaulescente (Municipio La Paz, B.C.S.. Otro grupo (HA; n = 7 se mantuvo en corral y se alimentó con heno de alfalfa. El análisis cromatográfico revela que la concentración de AG saturados fue menor (P The objective of the present study was to determine the concentration of fatty acids (FA in the milk of Chinampo cows (Bos taurus, with emphasis on conjugated fatty acids (CLA. A sample of 10 ml was collected from 32 cows that had been lactating at least 60 days, but not longer than 120 days. A group (FV, n = 25 was free-ranged grazed on green fresh pasture (sarcocaulescent shrub semiarid area, La Paz, B.C.S. during the wet season (September-October 2009. The second group (HA, n = 7 was penned and fed fodder of alfalfa hay. The FA analysis revealed that there were less saturated FA in the FV group (P < 0.05. This difference was basically explained by the lesser content of 14:0, 15:0, and 16:0. The concentration of total monounsaturated FA was higher in FV (P < 0.05, given by the higher concentration of 18:1 n-9 and 18:1 n-7 trans-11. The total concentration of polyunsaturated FA was similar for both groups, but there was a higher concentration of 18:2 n-6 and 18:2 n-7 cis-9 trans-11 in the FV group (P < 0.01. The proportion of omega-3 FA was similar for both groups, but the concentration of omega-6 FA was higher in FV (P < 0.01, resulting in an increased omega-6:omega-3 ratios in the FV group compared to HA. It is concluded that Chinampo cows left to free-range on fresh green pasture reduced the total saturated FA of

  2. Short communication: Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on enzymatic mastitis indicators of milk from dairy cows experimentally inoculated with Escherichia coli.

    Science.gov (United States)

    Sørensen, L P; Engberg, R M; Løvendahl, P; Larsen, T

    2015-08-01

    The aim of this study was to investigate the effect of a quantitative trait locus associated with mastitis caused by Escherichia coli, with one haplotype being more susceptible (HH) and another being more resistant (HL) to E. coli mastitis, on the activity of 4 inflammatory related milk enzymes. In particular, we investigated the suitability of β-glucuronidase (GLU) as an early indicator of E. coli mastitis. Besides GLU, the enzymes l-lactate dehydrogenase (LDH), N-acetyl-β-d-glucosaminidase (NAGase), and alkaline phosphatase were included. The study was conducted in an experimental setup with 31 Holstein cows divided into 4 groups representing repeated experiments and, within group, divided according to quantitative trait locus haplotype. All cows were inoculated with viable E. coli, and milk samples were collected 27 times from -6 to 396 h post-E. coli inoculation (PI). Activity of the 4 enzymes in milk, somatic cell count (SCC), daily milk yield, viable E. coli counts, and results of a semiquantitative polymerase chain reaction for pathogen detection, were all analyzed with a repeatability model. The response variables all expressed a strong reaction to the E. coli infection. Daily milk yield decreased significantly at 12 h PI and bacteria counts increased 100-fold and peaked at 18 h PI, which was validated by PCR. Also, SCC started to increase at 12 h PI and increased on average 70 times; however, no significant differences in SCC level were detected between HH and HL cows at any sampling point. The enzymes LDH, NAGase, and alkaline phosphatase showed similar responses, with a significantly increased activity and higher peak values for the HH than the HL cows. Significant differences between HH and HL cows were detected at different time points for these 3 enzymes, but not after adjusting P-values for multiple testing. A different pattern was also observed for GLU, where HL cows expressed the highest peak activity. Indication of differences in GLU activity between the 2 haplotype groups was only seen at 60 h PI. It was concluded that HL and HH cows expressed similar response patterns after E. coli infection but with differences in the size and profile of the activity of the 4 enzymes. The enzyme GLU was an equally good indicator of E. coli mastitis compared with the other studied enzymes, although it showed a slower response compared with LDH and NAGase. PMID:26026757

  3. Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on enzymatic mastitis indicators of milk from dairy cows experimentally inoculated with Escherichia coli

    DEFF Research Database (Denmark)

    Sørensen, Lars Peter; Engberg, Ricarda Greuel; Løvendahl, Peter;

    2015-01-01

    particular, we investigated the suitability of β-glucuronidase (GLU) as an early indicator of E. coli mastitis. Besides GLU, the enzymes l-lactate dehydrogenase (LDH), N-acetyl-β-d-glucosaminidase (NAGase), and alkaline phosphatase were included. The study was conducted in an experimental setup with 31...... adjusting P-values for multiple testing. A different pattern was also observed for GLU, where HL cows expressed the highest peak activity. Indication of differences in GLU activity between the 2 haplotype groups was only seen at 60 h PI. It was concluded that HL and HH cows expressed similar response...

  4. 杂交牛(大额牛×云南黄牛)朊蛋白基因的分子克隆及其序列分析%Molecular Cloning and Sequences Characteristics Analysis of the Prion Protein Gene from the Hybrids between Gayal (Bos frontalis)and Yunnan Yellow Cattle (Bos taurus)

    Institute of Scientific and Technical Information of China (English)

    刘情; 席冬梅; 陈学礼; 李继中; 杨舒黎; 邓卫东

    2012-01-01

    朊蛋白(prion protein,PRNP)基因编码朊蛋白,是引起疯牛病的主效基因.本研究利用PCR方法首次从杂交牛(大额牛×云南黄牛)基因组中扩增了PRNP基因,GenBank登录号为HQ875337.PCR产物直接双向测序表明,该序列包含杂交牛PRNP基因795 bp的开放阅读框(ORF),编码264个氨基酸前体蛋白.生物信息学分析结果发现,该蛋白包含1个信号肽、3个α螺旋、2个β折叠、6个八肽重复序列、1个疏水区域、1个二硫键和1个糖基磷脂酰肌醇锚定位点.与已报道的其他牛PRNP基因进行序列比对分析,核苷酸和氨基酸的同源性均在97%以上.%The priori protein was encoded by the prion protein (PRNP) gene which was the major gene for affecting mad cow disease or BSE. In the present study, the PCR method was used to amplify the PRNP gene from the hybrids between Gay-al (Bos frontalis) and Yunnan Yellow cattle (Bos taurus). The sequence was deposited in the GenBank under accession number HQ875337. The PCR products were sequenced bi-directly. By sequence analysis,the length of open read frame (ORF) of the PRNP gene was 795 bp, which encodes a protein of 264 amino acids,including a signal region,a octapeptide repeat,three α-heli-ces.two β-sheets,a hydrophobic region,a disulfide bridge, a glycosyl phosphatidyl inositol (GPI) anchor site. The homology of both nucleotide and amino acid sequences with other cattle was more than 97%. All this will provide the molecular basal data for breakthrough of transmissible spongiform encephalopathy among different animal species.

  5. Is the American Zebu really Bos indicus?

    Directory of Open Access Journals (Sweden)

    Meirelles Flávio V.

    1999-01-01

    Full Text Available The American continent was colonized in the 16th century by Europeans who first introduced cattle of Bos taurus origin. Accounts register introduction of Bos indicus cattle into South America in the 19th and continuing through the 20th century, and most reported imports were males derived from the Indian subcontinent. In the present study we show, by using mitochondrial DNA (mtDNA polymorphism, major participation of matrilineages of taurus origin in the American Zebu purebred origin, i.e., 79, 73 and 100% for the Nellore, Gyr and Brahman breeds, respectively. Moreover, we have created a restriction map identifying polymorphism among B. taurus and B. indicus mtDNA using three restriction enzymes. Results are discussed concerning American Zebu origins and potential use of this information for investigating the contribution of cytoplasmic genes in cattle production traits.

  6. Construction of Bovine (Bos taurus) Transgenic Cloned Embryos with Lysostaphin and Endolysin Genes by Electronic Transfection%电转染法制备奶牛转溶葡球菌酶(Lysostaphin)和内溶素(Endolysin)基因胚胎

    Institute of Scientific and Technical Information of China (English)

    杨林; 杜卫华; 郝海生; 刘岩; 秦彤; 赵学明; 王栋; 朱化彬; 王宗礼

    2013-01-01

    Lysostaphin is a single chain protease containing zinc which can kill staphylococcus aureus effectively. Endolysin which is the peculiar of the double-stranded DNA bacteriophages is a murein hydrolytic enzyme, it has a wide range of antibacterial effect. Lysostaphin and Endolysin have the high synergistic effect. In this study, the vectors pBCl-seq2 +seq3-EGFP-neo containing Endolysin and Lysostaphin genes and two other marker genes of enhenced green fluorescent protein (EGFP) andneomycin (neo) were transfected into bovine (Bos taurus) fetal fibroblast by electroporation and nucleofector of AMAXA. Stable transfected monoclonal cells which were identified to be the positive-cells in the way of PCR technique were obtained through fluorescence and G418 selection. Using transfected cells as the donor, transfected embryos were produced with somatic cell nuclear transfer, we used different conditions of AMAXA nuleofecor(A-023,V-013, V-023 and T-016) to transfect bovine fetal fibroblast, the results showed the suitable program was T-016. There were 5 times transfection efficient of AMAXA nuleofecor (20.11%) than it of electroporation. The blastocyst developed normally and the rate was of it 20.08%. In our study, we built up bovine fetal fibroblast cell line, sought out transfection parameter of high transfection efficiency, and acquired transgenic cell lines and transgenic blastocyst containing Lysostaphin and Endolysin genes, In conclusion, the results can provide technology supporting for producing anti-mastitis transgenic bovine and searching the new therapy way of mastitis.%溶葡球菌酶(Lysostaphin)是一种含锌的单链蛋白酶,能有效地杀灭金黄色葡萄球菌.内溶素(Endolysin)是双链DNA噬菌体所特有,是一类胞壁质水解酶,具有广泛的抗菌效果.内溶素与抗生素之间有高效的协同作用.本研究通过BTX电转染和AMAXA核转染的方法将含有溶葡球菌酶(Lysostaphin)和内溶素(Endolysin)两个目的基因(Seq2

  7. Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on the disease phenotypes of dairy cows with experimentally induced Escherichia coli mastitis

    DEFF Research Database (Denmark)

    Khatun, Momena; Sørensen, Peter; Jørgensen, Hanne Birgitte Hede;

    2013-01-01

    , rumen motility; and the paraclinical parameters: bacterial counts, somatic cell count (SCC), and milk amyloid A levels in milk; and white blood cell count, polymorphonuclear neutrophilic leukocyte (PMNL) count, and serum amyloid A levels in blood were recorded at different time points post-E. coli...

  8. Physiological responses of newborn Bos indicus and Bos indicus x Bos taurus calves after exposure to cold.

    Science.gov (United States)

    Godfrey, R W; Smith, S D; Guthrie, M J; Stanko, R L; Neuendorff, D A; Randel, R D

    1991-01-01

    Brahman (n = 9) and 1/2 Simmental x 1/4 Brahman x 1/4 Hereford (n = 11) calves were utilized to determine the influence of exposure to cold on the physiology of the neonate. All calves were removed from their dams within 20 min of birth and prior to suckling. Calves were assigned randomly within breed to either a warm (W; 31 degrees C) or cold (C; 4 degrees C) environmental treatment group. Jugular blood samples were collected via indwelling catheters at 20-min intervals for 180 min. At 100 to 120 min of sampling, all calves were given 1.2 liters of colostrum from their dams via stomach tube. At 120 min, C calves were placed in the W environment. Calf vigor score (CVS) and rectal temperature were determined at each time blood was collected. Serum or plasma was analyzed for glucose (GLU), lactate (LAC), blood urea nitrogen (BUN), hemoglobin (HEM), triglyceride (TRG), triiodothyronine (T3), thyroxine (T4), insulin (INS), cortisol (CORT) and nonesterified fatty acid (NEFA) concentration. Rectal temperature was lower (P less than .01) in C Brahman than in W Brahman and C or W crossbred calves. Crossbred calves had higher (P less than .01) CVS than Brahman calves. Calves in W had lower (P less than .01) GLU than C calves. Brahman calves had higher GLU, LAC, BUN, TRG, T3, T4 and CORT (P less than .05) than crossbred calves. The C Brahman calves had the highest (P less than .05) TRG, CORT, T3 and T4 of all groups. Concentration of NEFA were higher (P less than .01) in C than in W calves.(ABSTRACT TRUNCATED AT 250 WORDS) PMID:2005021

  9. Época de nascimento, genótipo e sexo de terneiros cruzas taurinos e zebuínos sobre o peso ao nascer, à desmama e eficiência individual de primíparas Hereford Calving season, genotype and sex of crossbred taurus and indicus calves on the birth and weaning weight and individual efficiency of primiparous Hereford

    Directory of Open Access Journals (Sweden)

    Gilson de Mendonça

    2003-12-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito da época de nascimento, genótipo e sexo do terneiro sobre a eficiência individual das vacas à desmama (relação percentual entre o peso do terneiro à desmama e o peso da vaca, peso ao nascer e peso à desmama dos terneiros. Foram utilizadas 48 vacas da raça Hereford (Bos taurus, com idade de três anos, manejadas sobre campo natural, 16 inseminadas com um touro da raça Red Angus (Bos taurus e 32 com Nelore (Bos indicus. Os fatores estudados foram genótipo do terneiro (GENOT - Bos taurus x Bos taurus e Bos taurus x Bos indicus, época de nascimento (EPOCN subdividida em três períodos - 1S (setembro, 2O (outubro e 3N (novembro e sexo do terneiro (SEXO. A produção de leite (PL foi incluída como co-variável. Foram realizadas dez medidas de produção de leite pelo método indireto pesagem - mamada - pesagem e onze medidas de peso para vacas e terneiros, em intervalos de 21 dias. Os fatores que influenciaram significativamente o PN foram GENOT e SEXO (PThe objective of the present study was to evaluate the effect of calving season, genotype and calf sex on the cows weaning individual efficiency ( percentual relationship between cow body weight and calf weaning weight, birth and weaning weight of calves. Forty-eight primiparous Hereford cows with approximate average age of 3 years and grazing only native pastures were used. Sixteen inseminated with one Red Angus bull (Bos taurus and 32 with Nelore (Bos indicus. Effects studied were calf genotype (GENOT, Bos taurus x Bos taurus and Bos taurus x Bos indicus, calving season (EPOCN concentrated in the Spring and subdivided into three periods: 1S (September, 2O (October and 3N (November and December and calf sex (SEXO. Milk production (PL was included as co-variable. Ten measurements of milk production obtained by the indirect method, weighing the calf before and after suckling, and eleven measurements of cow and calf weights, were made at 21

  10. ALGUNOS FACTORES RELACIONADOS CON LA DINÁMICA FOLICULAR EN BOS INDICUS SOME FACTORS RELATED TO FOLLICULAR DYNAMICS IN BOS INDICUS

    Directory of Open Access Journals (Sweden)

    Guillermo Henao Restrepo

    2010-12-01

    Full Text Available El desarrollo folicular bovino durante un ciclo estral normal, se caracteriza por un crecimiento en forma de ondas con presencia de dos a cinco cohortes foliculares por ciclo, de las cuales solo un folículo se torna ovulatorio. El crecimiento folicular en forma de ondas también se produce durante el período prepuberal, puberal, primer tercio de la gestación y período de anestro posparto. Aunque existe mucha similitud en el patrón fundamental del desarrollo de ondas foliculares entre Bos taurus y Bos indicus, se han encontrado diferencias en la dinámica folicular que pueden afectar el comportamiento reproductivo y la aplicación de biotecnologías reproductivas. La dinámica folicular puede variar por efectos ambientales y estados fisiológicos de hembras Bos indicus que impiden establecer un patrón específico de dinámica folicular para cada raza y etapa fisiológica. El propósito de esta revisión es analizar la función reproductiva teniendo en cuenta las diferencias de la dinámica folicular entre estados fisiológicos y condiciones ambientales de hembras bovinas con énfasis en B. indicus.The bovine follicular development during a normal estrous cycle, is characterized by a growth in wave form with presence of two to five follicular cohorts by cycle, of which only one follicle ovulate. The follicular growth in wave form also occurs during the prepubertal and pubertal periods, first quarter of the gestation, and in the postpartum anestrous period. Although there is great similarity in the fundamental pattern of the development of follicular waves between Bos taurus and Bos indicus, differences of follicular dynamics has been detected, that can affect the reproductive behavior and the application of reproductive biotechnologies. Follicular dynamics can change by environmental effects and physiological states of Bos indicus females that impede to establish a specific pattern of follicular dynamics for each breed and physiological

  11. Comportamento de vacas da raça Gir (Bos taurus indicus em estro Estrus behaviour in Gir cows (Bos taurus indicus

    Directory of Open Access Journals (Sweden)

    M.F. Ávila Pires

    2003-04-01

    Full Text Available O comportamento de vacas da raça Gir em estro e a concentração plasmática de progesterona foram avaliadas durante um estro induzido e o natural subseqüente, em 35 animais da raça Gir, no inverno e no verão de dois anos consecutivos. Observou-se efeito de interação entre estação e ano do experimento sobre a duração do ciclo estral. O proestro foi maior no verão (51,82± 4,77h do que no inverno (33,43± 4,82h e no estro natural (64,41± 4,95h do que no induzido (20,85± 4,64h. Observou-se menor duração da atividade sexual total no estro induzido do que no natural (41,62± 4,81 vs 94,83± 4,56h no inverno, e 64,00± 4,14 vs 127,44± 4,04h no verão. A duração do estro foi similar no inverno (12,33± 0,74h e no verão (11,82± 0,74h, e maior nas vacas sincronizadas (13,24± 0,70 vs 10,91± 0,78h. O número de montas recebidas durante o estro foi similar no inverno (28,16± 2,61 e no verão (22,98± 2,58 e maior nos animais sincronizados (29,97± 2,48 vs 21,17± 2,17. Observou-se efeito de interação entre estação e tipo de luteólise sobre o número de montas recebidas por hora em estro. O inverno não se constituiu em fator limitante à manifestação do estro, cuja duração e intensidade foram suficientes para permitir sua detecção; contudo, a sincronização dos estros interferiu com a manifestação do comportamento sexual.The estrus behaviour and the plasma progesterone concentration were monitored during an induced and a natural subsequent estrus, in 35 Gir cows, during the winter and summer seasons of two consecutives years. The length of estrous cycle was influenced by the interaction between season and experimental year. The proestrus period was longer in the summer (51.82± 4.77h compared to the one in the winter (33.43± 4.82h season as far as in the natural (64.41± 4.95h vs in the induced estrus (20.85± 4.64h. The total sexual activity was shorter in the induced than in the natural estrus (41.62± 4.81 vs 94.83± 4.56h in the winter, and 64.00± 4.14 vs 127.44± 4.04h in the summer. The length of estrus was similar between winter (12.33± 0.74h and summer (11.82± 0.74h, and longer in the synchronized cows (13.24± 0.70 vs 10.91± 0.78h. The number of mounts accepted during the estrus was similar between winter (28.16± 2.61 and summer (22.98± 2.58, and greater in the synchronized animals (29.97± 2.48 vs 21.17± 2.17. It was observed effect of interaction between season of the year and luteolysis type on the total received mountings per hour in estrus. The winter was not a limiting factor to the estrus manifestation, once its length and intensity allowed heat detection, however, heat synchronization meddled the manifestation of sexual behaviour.

  12. Molecular characterization of Cryptosporidium spp. in calves (Bos taurus and Bos indicus in the Formiga city, Minas Gerais - Brazil

    Directory of Open Access Journals (Sweden)

    Roberto César Araujo Lima

    2014-02-01

    Full Text Available Cryptosporidiosis is a waterborne disease, has as aggravating the difficulty of preventing environmental contamination and lack of effective therapeutic measures. With marked importance to the cattle, causes inflammation and intestinal villous atrophy resulting in loss of absorptive surface. This study aimed to perform molecular characterization of Cryptosporidium spp. in calves in the city of Formiga, Minas Gerais. A total of 300 faeces samples from Holstein calves, Nelore and indefinite breed, both healthy, were evaluated by negative contrast staining technique of malachite green and through the reaction of nested PCR for amplification of DNA fragments of the 18S subunit of the RNA gene ribosomal. Occurrence of 5.33 % ( 16/300 for malachite green and 4.66 % ( 14/300 by PCR was observed, whereas no correlation was found between positive and variables studied. Through molecular characterization were identified Cryptosporidium andersoni and Cryptosporidium ryanae species. In conclusion, we observed a low incidence of infection and elimination of Cryptosporidium spp. oocysts, the absence of clinical signs in animals, strong agreement between the results obtained by the two techniques. Beyond, with the molecular characterization ( nested PCR , species of C. andersoni and C. ryanae were diagnosed in age groups not present in the literature. These two species of Cryptosporidium are described above for the first time parasitizing cattle in the state of Minas Gerais.

  13. Comparison of methanogen diversity of yak (Bos grunniens and cattle (Bos taurus from the Qinghai-Tibetan plateau, China

    Directory of Open Access Journals (Sweden)

    Huang Xiao

    2012-10-01

    Full Text Available Abstract Background Methane emissions by methanogen from livestock ruminants have significantly contributed to the agricultural greenhouse gas effect. It is worthwhile to compare methanogen from “energy-saving” animal (yak and normal animal (cattle in order to investigate the link between methanogen structure and low methane production. Results Diversity of methanogens from the yak and cattle rumen was investigated by analysis of 16S rRNA gene sequences from rumen digesta samples from four yaks (209 clones and four cattle (205 clones from the Qinghai-Tibetan Plateau area (QTP. Overall, a total of 414 clones (i.e. sequences were examined and assigned to 95 operational taxonomic units (OTUs using MOTHUR, based upon a 98% species-level identity criterion. Forty-six OTUs were unique to the yak clone library and 34 OTUs were unique to the cattle clone library, while 15 OTUs were found in both libraries. Of the 95 OTUs, 93 putative new species were identified. Sequences belonging to the Thermoplasmatales-affiliated Linage C (TALC were found to dominate in both libraries, accounting for 80.9% and 62.9% of the sequences from the yak and cattle clone libraries, respectively. Sequences belonging to the Methanobacteriales represented the second largest clade in both libraries. However, Methanobrevibacter wolinii (QTPC 110 was only found in the cattle library. The number of clones from the order Methanomicrobiales was greater in cattle than in the yak clone library. Although the Shannon index value indicated similar diversity between the two libraries, the Libshuff analysis indicated that the methanogen community structure of the yak was significantly different than those from cattle. Conclusion This study revealed for the first time the molecular diversity of methanogen community in yaks and cattle in Qinghai-Tibetan Plateau area in China. From the analysis, we conclude that yaks have a unique rumen microbial ecosystem that is significantly different from that of cattle, this may also help to explain why yak produce less methane than cattle.

  14. Different true-protein sources do not modify the metabolism of crossbred Bos taurus × Bos indicus growing heifers

    Directory of Open Access Journals (Sweden)

    Diego Azevedo Mota

    2015-02-01

    Full Text Available The present study was conducted to investigate the effect of alternative true-protein sources to soybean meal, with different ruminal degradability, using a sugarcane-based diet, on nutrient digestion, ruminal fermentation, efficiency of microbial protein synthesis and passage rate in prepubertal dairy heifers. Eight crossbred rumen- and duodenum-cannulated Holstein × Gyr dairy heifers (202.0±11.5 kg BW were evaluated in a 4 × 4 Latin square experimental design with four treatments and four periods in two simultaneous replicates. Dietary treatments were: soybean meal; cottonseed meal; peanut meal; and sunflower meal. When associated with diets containing sugarcane, the different protein sources did not affect intake or digestibility of dry mater, crude protein, organic matter and neutral detergent fiber. The average ruminal pH, NH3-N and concentration of total volatile fatty acids were not different among the diets supplied. The concentration of butyric acid was different among the protein sources, wherein the animals fed the diet with sunflower meal presented lower values than those fed the other sources. Diets did not affect nitrogen balance, microbial nitrogen, microbial synthesisefficiency, estimated dry matter flow, or passage rate. Alternative protein sources can be used to reduce the costs without changing the animal metabolism.

  15. Different true-protein sources do not modify the metabolism of crossbred Bos taurus × Bos indicus growing heifers

    OpenAIRE

    Diego Azevedo Mota; Juliana Duarte Messana; Roberta Carrilho Canesin; Giovani Fiorentini; Alexandre Vaz Pires; Telma Teresinha Berchielli

    2015-01-01

    The present study was conducted to investigate the effect of alternative true-protein sources to soybean meal, with different ruminal degradability, using a sugarcane-based diet, on nutrient digestion, ruminal fermentation, efficiency of microbial protein synthesis and passage rate in prepubertal dairy heifers. Eight crossbred rumen- and duodenum-cannulated Holstein × Gyr dairy heifers (202.0±11.5 kg BW) were evaluated in a 4 × 4 Latin square experimental design with four treatments and four ...

  16. Evaluation of carcass characteristics of Bos indicus and tropically adapted Bos taurus breeds selected for postweaning weight.

    Science.gov (United States)

    Bonilha, S F M; Tedeschi, L O; Packer, I U; Razook, A G; Alleoni, G F; Nardon, R F; Resende, F D

    2008-08-01

    Data from 9 studies were compiled to evaluate the effects of 20 yr of selection for postweaning weight (PWW) on carcass characteristics and meat quality in experimental herds of control Nellore (NeC) and selected Nellore (NeS), Caracu (CaS), Guzerah (GuS), and Gir (GiS) breeds. These studies were conducted with animals from a genetic selection program at the Experimental Station of Sertãozinho, São Paulo State, Brazil. After the performance test (168 d postweaning), bulls (n = 490) from the calf crops born between 1992 and 2000 were finished and slaughtered to evaluate carcass traits and meat quality. Treatments were different across studies. A meta-analysis was conducted with a random coefficients model in which herd was considered a fixed effect and treatments within year and year were considered as random effects. Either calculated maturity degree or initial BW was used interchangeably as the covariate, and least squares means were used in the multiple-comparison analysis. The CaS and NeS had heavier (P = 0.002) carcasses than the NeC and GiS; GuS were intermediate. The CaS had the longest carcass (P body, carcass, and quarter weights of NeS were similar to those of CaS, NeS had more edible meat in the leg region than did CaS bulls. Selection for PWW increased rib-eye area in Nellore bulls. Selected Caracu had the lowest (most favorable) shear force values compared with the NeS (P = 0.003), NeC (P = 0.005), GuS (P = 0.003), and GiS (P = 0.008). Selection for PWW increased body, carcass, and meat retail weights in the Nellore without altering dressing percentage and body fat percentage. PMID:18407987

  17. Allelic Frequency of Kappa-Casein and Beta-Lactoglobulin in Indian Crossbred (Bos taurus X Bos indicus) Dairy Bulls

    OpenAIRE

    Patel, Rajesh K.; Chauhan, Jenabhai B.; Singh, Krishna M.; Kalpesh J. Soni

    2007-01-01

    A polymerase chain reaction - restriction fragment length polymorphism test was performed on DNA samples extracted from blood samples of 256 Holstein Friesian crossbred and 112 from Jersey crossbred bulls/bull calves to detect allelic frequency of the bovine kappa-casein and beta-lactoglobulin gene responsible for milk production traits. A 350 bp fragment of kappa-casein and a 247 bp fragment of beta-lactoglobulin were amplified and digested with Hinf I and Hae III restriction enzymes, respec...

  18. Assessment of single nucleotide polymorphisms in genes residing on chromosomes 14 and 29 for association with carcass composition traits in Bos indicus cattle.

    Science.gov (United States)

    Casas, E; White, S N; Riley, D G; Smith, T P L; Brenneman, R A; Olson, T A; Johnson, D D; Coleman, S W; Bennett, G L; Chase, C C

    2005-01-01

    Objective of this study was to assess the association of SNP in the diacylglycerol O-acyltransferase 1 (DGAT1), thyroglobulin (TG), and micromolar calcium-activated neutral protease (CAPN1) genes with carcass composition and meat quality traits in Bos indicus cattle. A population of Brahman calves (n = 479) was developed in central Florida from 1996 to 2000. Traits analyzed were ADG, hip height, slaughter weight, fat thickness, HCW, marbling score, LM area, estimated KPH fat, yield grade, retail yield, sensory panel tenderness score, carcass hump height, and cooked meat tenderness measured as Warner-Bratzler shear force at 7, 14, and 21 d postmortem. Single nucleotide polymorphisms previously reported in the TG and DGAT1 genes were used as markers on chromosome 14. Two previously reported and two new SNP in the CAPN1 gene were used as markers on chromosome 29. One SNP in CAPN1 was uninformative, and another one was associated with tenderness score (P Brahman population than in reported allele frequencies in Bos taurus populations. The results suggest that the use of molecular marker information developed in Bos taurus populations to Bos indicus populations may require development of appropriate additional markers. PMID:15583037

  19. Taurus

    Science.gov (United States)

    Murdin, P.

    2000-11-01

    (the Bull; abbrev. Tau, gen. Tauri; area 797 sq. deg.) A northern zodiacal constellation which lies between Aries and Orion, and culminates at midnight in late November. It is one of the oldest constellations, dating back to when the Sun was in that part of the sky at the vernal (spring) equinox, between about 4000 and 1800 BC. Later, in Greek mythology, it was identified with the form assumed by...

  20. Malignant catarrhal fever-like lesions associated with ovine herpesvirus-2 infection in young calves (Bos indicus: a case report

    Directory of Open Access Journals (Sweden)

    MCR Luvizotto

    2010-01-01

    Full Text Available Infection of susceptible ruminants, including domestic cattle (Bos taurus and American bison (Bison bison, with ovine herpesvirus-2 (OvHV-2 may provoke the fatal vasculitis and lymphoproliferative syndrome, known as malignant catarrhal fever (MCF, reported worldwide. To the best of our knowledge, this is the first report of a clinical case of MCF-like lesions associated with ovine herpesvirus-2 (OvHV-2 infection in young calves (Bos indicus including central nervous symptoms that occurred in Três Lagoas city, Mato Grosso do Sul state, a border town near São Paulo state, Brazil. The diagnosis was based on typical histological lesions characterized by systemic lymphohistiocytic and fibrinoid vasculitis, confirmed by polymerase chain reaction and subsequent phylogenetic analysis of detected OvHV-2 sequences. This finding indicates that MCF disease is spread among herds concentrated in border areas between Mato Grosso do Sul and São Paulo states.

  1. Development of a physiologically based pharmacokinetic model for flunixin in cattle (Bos taurus).

    Science.gov (United States)

    Leavens, Teresa L; Tell, Lisa A; Kissell, Lindsey W; Smith, Geoffrey W; Smith, David J; Wagner, Sarah A; Shelver, Weilin L; Wu, Huali; Baynes, Ronald E; Riviere, Jim E

    2014-01-01

    Frequent violation of flunixin residues in tissues from cattle has been attributed to non-compliance with the USFDA-approved route of administration and withdrawal time. However, the effect of administration route and physiological differences among animals on tissue depletion has not been determined. The objective of this work was to develop a physiologically based pharmacokinetic (PBPK) model to predict plasma, liver and milk concentrations of flunixin in cattle following intravenous (i.v.), intramuscular (i.m.) or subcutaneous (s.c.) administration for use as a tool to determine factors that may affect the withdrawal time. The PBPK model included blood flow-limited distribution in all tissues and elimination in the liver, kidney and milk. Regeneration of parent flunixin due to enterohepatic recirculation and hydrolysis of conjugated metabolites was incorporated in the liver compartment. Values for physiological parameters were obtained from the literature, and partition coefficients for all tissues but liver and kidney were derived empirically. Liver and kidney partition coefficients and elimination parameters were estimated for 14 pharmacokinetic studies (including five crossover studies) from the literature or government sources in which flunixin was administered i.v., i.m. or s.c. Model simulations compared well with data for the matrices following all routes of administration. Influential model parameters included those that may be age or disease-dependent, such as clearance and rate of milk production. Based on the model, route of administration would not affect the estimated days to reach the tolerance concentration (0.125 mg kg(-1)) in the liver of treated cattle. The majority of USDA-reported violative residues in liver were below the upper uncertainty predictions based on estimated parameters, which suggests the need to consider variability due to disease and age in establishing withdrawal intervals for drugs used in food animals. The model predicted that extravascular routes of administration prolonged flunixin concentrations in milk, which could result in violative milk residues in treated cattle. PMID:25082521

  2. Diagnosis of Sarcocystis spp. in cattle (Bos taurus) and water buffalo (Bubalus bubalis) in Northern Vietnam.

    Science.gov (United States)

    Jehle, C; Dinkel, A; Sander, A; Morent, M; Romig, T; Luc, P V; De, T V; Thai, V V; Mackenstedt, U

    2009-12-23

    Our aim was to develop a method for species diagnosis and to obtain data on the prevalence of Sarcocystis infections in cattle and water buffalo in the Son La Province of Northern Vietnam. Meat samples of naturally infected animals were examined by light and electron microscopy as well as by molecular methods. A PCR of part of the 18S rDNA gene followed by RFLP analysis was modified to detect infections with different Sarcocystis spp. in cattle and water buffaloes slaughtered in the Son La Province. It showed to be an economical method to detect multiple infections with Sarcocystis spp. Sequence analysis of the PCR amplicons was performed with selected samples and the results were compared with published sequences. With these methods the following Sarcocystis spp. were identified in cattle: Sarcocystis hirsuta, Sarcocystis cruzi and Sarcocystis hominis. Water buffaloes were infected with Sarcocystis fusiformis, S. cruzi, S. hominis and S. hirsuta. The results indicate that Sarcocystis spp. infecting cattle are also able to infect water buffaloes. So the validity of certain Sarcocystis spp. of water buffalo is discussed. Bovine lifestock in Northern Vietnam were commonly infected with Sarcocystis spp. PMID:19783101

  3. Responses of Single Chorda Tympani Taste Fibers of the Calf (Bos taurus)

    OpenAIRE

    Hellekant, Göran; Roberts, Thomas; Elmer, Donald; Cragin, Tiffany; Danilova, Vicktoria

    2010-01-01

    In spite of a wealth of information on feed and nutrition in cattle, there little is published of what they actually can taste. Here, we attempt to remedy some of this deficiency by presenting recordings of the chorda tympani proper nerve of young Holstein calves during stimulation of approximately 30 compounds. Hierarchical cluster analysis of 46 single taste fibers separated 4 fiber clusters: N (salt best), H (sour best), and 2 clusters, which could not be related to any human taste quality...

  4. Effect of Ractopamine Hydrochloride and Zilpaterol Hydrochloride on tenderness of longissimus steaks of Bos Taurus steers

    Science.gov (United States)

    Objectives: Three experiments were conducted to determine 1) the interaction of ractopamine hydrochloride (RH) inclusion rate (0 or 300 mg·hd-1·d-1 for last 30 to 34 d before harvest) and dietary protein level (13.5 or 17.5% CP) on LM slice shear force (SSF) at 14 d postmortem (Exp. 1); 2) the inter...

  5. Spatial movement of free-roaming cattle (Bos Taurus) when in proximity to wolves (Canis lupus)

    Science.gov (United States)

    In 1995 and 1996, 31 wolves were reintroduced into Yellowstone National Park and 35 in central Idaho. These populations have grown to more than 1,500 with more than 835 in Idaho. As wolf populations have grown, so has predation on livestock, complicating cow and ranch management. Our study was de...

  6. Development of a physiologically based pharmacokinetic model for flunixin in cattle (Bos taurus)

    Science.gov (United States)

    Violative residues of flunixin in tissues from bob veal calves and cull dairy cows has been attributed to noncompliance with the FDA-approved route of administration and withdrawal time, however, the effect of administration route and physiological differences among animals on tissue residue depleti...

  7. Expression Variants of the Lipogenic AGPAT6 Gene Affect Diverse Milk Composition Phenotypes in Bos taurus

    OpenAIRE

    Littlejohn, Mathew D; Kathryn Tiplady; Thomas Lopdell; Law, Tania A.; Andrew Scott; Chad Harland; Ric Sherlock; Kristen Henty; Vlad Obolonkin; Klaus Lehnert; Alistair Macgibbon; Spelman, Richard J; Stephen R. Davis; Snell, Russell G.

    2014-01-01

    Milk is composed of a complex mixture of lipids, proteins, carbohydrates and various vitamins and minerals as a source of nutrition for young mammals. The composition of milk varies between individuals, with lipid composition in particular being highly heritable. Recent reports have highlighted a region of bovine chromosome 27 harbouring variants affecting milk fat percentage and fatty acid content. We aimed to further investigate this locus in two independent cattle populations, consisting o...

  8. Responses of single chorda tympani taste fibers of the calf (Bos taurus).

    Science.gov (United States)

    Hellekant, Göran; Roberts, Thomas; Elmer, Donald; Cragin, Tiffany; Danilova, Vicktoria

    2010-06-01

    In spite of a wealth of information on feed and nutrition in cattle, there little is published of what they actually can taste. Here, we attempt to remedy some of this deficiency by presenting recordings of the chorda tympani proper nerve of young Holstein calves during stimulation of approximately 30 compounds. Hierarchical cluster analysis of 46 single taste fibers separated 4 fiber clusters: N (salt best), H (sour best), and 2 clusters, which could not be related to any human taste quality. The N fibers responded best to LiCl, NaCl, urea, monosodium glutamate, and KCl, whereas the H fibers responded strongly to citric and ascorbic acid. Interestingly, propionic and butyric acid stimulated best the 3rd cluster, whereas the 4th cluster responded best to denatonium benzoate and only to a small extent to quinine hydrochloride. Sweeteners stimulated moderately all clusters. Beginning with the largest response to sweet, the order between the responses was: acesulfame-K, saccharin, D-phenylalanine, glycine, sucrose, fructose, erythritol, cyclamate, and lactose. Alitame, aspartame, and super-aspartame evoked no or little responses. Three and 5 M ethanol stimulated all clusters. Comparison with taste fibers in other species suggests that the taste world of cattle is quite different from other species'. PMID:20212013

  9. Bos taurus papillomavirus activity in peripheral blood mononuclear cells: demonstrating a productive infection.

    Science.gov (United States)

    Melo, T C; Araldi, R P; Pessoa, N S D; de-Sá-Júnior, P L; Carvalho, R F; Beçak, W; Stocco, R C

    2015-01-01

    Bovine papillomavirus (BPV) is an oncogenic virus with mucous and epithelial tropism. Possible productive virus infection in other tissues, such as blood, has been hypothesized. In order to investigate this possibility, three samples of skin papillomas and blood were collected from bovines with BPV infection and five samples of peripheral blood and one sample of normal tissue were collected from a calf without BPV infection. Peripheral blood mononuclear cells (PBMCs) were isolated from whole blood and examined by reverse transcription-polymerase chain reaction, immunofluorescence, in situ hybridization, and electron microscopy. The tissue samples were examined for histopathological and immunohistochemical features. The skin papillomas showed the presence of DNA sequences of BPV-2, BPV-11, and a putative virus type. The blood samples showed DNA sequences of BPV-1, 2, and 4 simultaneously. Immunohistochemistry showed BPV L1 protein in both epithelium and stroma and BPV E2 protein in koilocytes. In situ hybridization confirmed the presence of BPV DNA in PBMCs and immunofluorescence showed nuclear labeling of E2 and L1 BPV proteins in PBMCs. The transcription analysis revealed transcripts of BPV-1 L1, BPV-2 L2, and BPV-4 E7 in blood and papilloma samples of BPV-infected cattle. The comet assay revealed high levels of host cell DNA damage upon BPV infection. Electron microscopy analysis of PBMCs identified the presence of particles in the cytoplasm that are consistent with papillomavirus in size and shape. The productive infection of PBMCs with BPV has been previously discussed and this study provides evidence indicating that PBMCs are a target of BPV. PMID:26681018

  10. WHOLE GENOME ASSOCIATION ANALYSIS IDENTIFIES SUSCEPTIBILITY ALLELES FOR PARASITIC INFECTION IN BOS TAURUS CATTLE

    Science.gov (United States)

    DNA markers associated with parasite indicator traits are ideal targets for study of marker assisted selection aimed at controlling infections that reduced herd use of anthelminthics. For this study, we collected fecal egg count (FEC) data from post-weaning animals of an Angus resource population c...

  11. Tick loads in Bos taurus cattle grazing in two contrasting production systems

    OpenAIRE

    Raquel Salazar B; Rolando Barahona-Rosales; María-Solange Sánchez P

    2016-01-01

    Objectives. To relate the effect of biotic and abiotic factors on Rhipicephalus (Boophilus) microplus tick loads on cows grazing either in intensive silvopastoral systems (ISS) (Lucerna) or in grass pastures associated with sugarcane plantations (La Isabela). Materials and methods. Tick counts were performed on 27 Lucerne breed animals that were in different physiological states, six of which were grazing on forage grass paddocks associated with commercial sugarcane plantations and the remain...

  12. The Effect of Myogenic Factor 5 Polymorphism on the Meat Quality in Chinese Bos Taurus

    OpenAIRE

    J. A. Ujan; Zan, L. S.; Wang, H B; Ujan, S. A.

    2011-01-01

    In the present study, we evaluated polymorphism of myogenic factor 5, involved in growth and meat quality traits. Based on PCR-SSCP technology, a novel missense substitution SNP (single-nucleotide polymorphism) g.1142 A > G was identified in the intron1 region of the MyF-5 gene, it causes an amino acid substitution (1142Glutamine/ Glycine1142). Allele frequencies, gene heterozygosity, effective allele number and polymorphism information content of the bovine MyF-5 SNP in three population bree...

  13. Novel Features of the Prenatal Horn Bud Development in Cattle (Bos taurus.

    Directory of Open Access Journals (Sweden)

    Dominique Judith Wiener

    Full Text Available Whereas the genetic background of horn growth in cattle has been studied extensively, little is known about the morphological changes in the developing fetal horn bud. In this study we histologically analyzed the development of horn buds of bovine fetuses between ~70 and ~268 days of pregnancy and compared them with biopsies taken from the frontal skin of the same fetuses. In addition we compared the samples from the wild type (horned fetuses with samples taken from the horn bud region of age-matched genetically hornless (polled fetuses. In summary, the horn bud with multiple layers of vacuolated keratinocytes is histologically visible early in fetal life already at around day 70 of gestation and can be easily differentiated from the much thinner epidermis of the frontal skin. However, at the gestation day (gd 212 the epidermis above the horn bud shows a similar morphology to the epidermis of the frontal skin and the outstanding layers of vacuolated keratinocytes have disappeared. Immature hair follicles are seen in the frontal skin at gd 115 whereas hair follicles below the horn bud are not present until gd 155. Interestingly, thick nerve bundles appear in the dermis below the horn bud at gd 115. These nerve fibers grow in size over time and are prominent shortly before birth. Prominent nerve bundles are not present in the frontal skin of wild type or in polled fetuses at any time, indicating that the horn bud is a very sensitive area. The samples from the horn bud region from polled fetuses are histologically equivalent to samples taken from the frontal skin in horned species. This is the first study that presents unique histological data on bovine prenatal horn bud differentiation at different developmental stages which creates knowledge for a better understanding of recent molecular findings.

  14. New Q lineage found in bovine (Bos taurus) of Iberian Peninsula.

    Science.gov (United States)

    Lopez-Oceja, Andres; Muro-Verde, Amara; Gamarra, David; Cardoso, Sergio; de Pancorbo, Marian M

    2016-09-01

    The northern Iberian Peninsula is home to a variety of autochthonous cattle breeds, such as the Terreña and Pirenaica. With the objective of characterizing the matrilineal lineages of these breeds, a study of mitochondrial DNA was performed. The D-loop of 155 individuals was analyzed and most of the individuals were carriers of the T3 haplogroup, while haplogroups T and T1 were much less frequent. A Pirenaica individual belonging to the Q haplogroup was found. To verify the presence of the Q haplogroup individual, the entire mitochondrial DNA was sequenced and compared with two descendants. The individuals were assigned to the Q1 sub-haplogroup. These findings extend the geographic distribution of the Q haplogroup to the south west of the European continent. This new Q1 lineage has seven polymorphisms in the coding region, so this lineage is probably as old as the Q lineages described to date. PMID:26554433

  15. Loss of miRNAs during Processing and Storage of Cow's (Bos taurus)Milk

    OpenAIRE

    Howard, Katherine M; Kusuma, Rio Jati; Baier, Scott R.; Friemel, Taylor; Markham, Laura; Vanamala, Jairam; Zempleni, and Janos

    2015-01-01

    MicroRNAs (miRs, miRNAs) play central roles in gene regulation. Previously, we reported that miRNAs from somatic cell content, and handling by consumers on the degradation of miRNAs in milk; we also quantified miRNAs in dairy products. Pasteurization and homogenization caused a 63% loss of miR-200c, whereas a 67% loss observed for miR-29b was statistically significant only in skim milk. Effects of cold storage and somatic cell content were quantitatively minor (

  16. Loss of miRNAs during processing and storage of cow's (Bos taurus) milk.

    Science.gov (United States)

    Howard, Katherine M; Jati Kusuma, Rio; Baier, Scott R; Friemel, Taylor; Markham, Laura; Vanamala, Jairam; Zempleni, Janos

    2015-01-21

    MicroRNAs (miRs, miRNAs) play central roles in gene regulation. Previously, we reported that miRNAs from pasteurized, store-bought bovine milk have biological activity in humans. Here, we assessed the effects of milk processing, storage, somatic cell content, and handling by consumers on the degradation of miRNAs in milk; we also quantified miRNAs in dairy products. Pasteurization and homogenization caused a 63% loss of miR-200c, whereas a 67% loss observed for miR-29b was statistically significant only in skim milk. Effects of cold storage and somatic cell content were quantitatively minor (caused a 40% loss of miR-29b but no loss of miR-200c. The milk fat content had no effect on miRNA stability during storage and microwave heating. The concentrations of miRNAs in dairy products were considerably lower than in store-bought milk. We conclude that processing of milk by dairies and handling by consumers causes a significant loss of miRNAs. PMID:25565082

  17. Preweaning performance and body composition of calves from straightbred Nellore and Bos taurus x Nellore crosses.

    Science.gov (United States)

    Calegare, L; Alencar, M M; Packer, I U; Leme, P R; Ferrell, C L; Lanna, D P D

    2009-05-01

    The objectives were to evaluate preweaning performance, body composition, and efficiency of calves representing straightbred Nellore (NL), F(1), and 3-breed-cross systems. Energy requirements, milk production, and efficiency of 39 cow-calf pairs were recorded from straightbred NL calves from NL cows (10), crossbred (Angus-sired) calves from NL cows (ANL: 9), and crossbred calves (CC; Canchim-sired: 5/8 Charolais, 3/8 Zebu) from ANL (10) and Simmental x NL (10) cows. Cows and their respective calves were individually fed from birth to weaning (17 to 190 d postpartum). At 38 d of age, corn silage (7.8% CP, 2.19 Mcal of ME/kg of DM) was available to calves ad libitum. Milk production at 42, 98, 126, and 180 d postpartum was recorded by weighing calves before and after suckling. The ratio between GE and ME of milk was considered 1:0.93. Calves were slaughtered at weaning and the 9th-, 10th-, and 11th-rib section was removed for body composition estimation. The ANL calves were lighter (P body energy - birth body energy) than the NL calves (388 +/- 23 for ANL, and 438 +/- 15 for CC vs. 312 +/- 22 Mcal for NL calves). Percentages of water (P = 0.74) and chemical fat (P = 0.51) were similar among groups (63.7 +/- 0.6 and 14.3 +/- 0.7% for ANL calves, 63.1 +/- 0.4 and 14.7 +/- 0.5% for CC calves, and 63.3 +/- 0.6 and 13.7 +/- 0.7% of empty BW for water and chemical fat, respectively, for NL calves). Energetic efficiency (kcal of retained energy/Mcal of ME intake) was similar (P = 0.52) among groups (358 +/- 22 for ANL calves, 355 +/- 14 for CC calves, and 327 +/- 22 for NL calves). The greater BW gains and the differences in empty body composition at weaning were not enough to compensate for the greater ME intake of crossbreds. In this study, the crossbreeding systems evaluated increased preweaning calf performance but did not affect gross or energetic calf efficiency. PMID:19122045

  18. Bovine Genome Database: supporting community annotation and analysis of the Bos taurus genome

    Directory of Open Access Journals (Sweden)

    Childs Kevin L

    2010-11-01

    Full Text Available Abstract Background A goal of the Bovine Genome Database (BGD; http://BovineGenome.org has been to support the Bovine Genome Sequencing and Analysis Consortium (BGSAC in the annotation and analysis of the bovine genome. We were faced with several challenges, including the need to maintain consistent quality despite diversity in annotation expertise in the research community, the need to maintain consistent data formats, and the need to minimize the potential duplication of annotation effort. With new sequencing technologies allowing many more eukaryotic genomes to be sequenced, the demand for collaborative annotation is likely to increase. Here we present our approach, challenges and solutions facilitating a large distributed annotation project. Results and Discussion BGD has provided annotation tools that supported 147 members of the BGSAC in contributing 3,871 gene models over a fifteen-week period, and these annotations have been integrated into the bovine Official Gene Set. Our approach has been to provide an annotation system, which includes a BLAST site, multiple genome browsers, an annotation portal, and the Apollo Annotation Editor configured to connect directly to our Chado database. In addition to implementing and integrating components of the annotation system, we have performed computational analyses to create gene evidence tracks and a consensus gene set, which can be viewed on individual gene pages at BGD. Conclusions We have provided annotation tools that alleviate challenges associated with distributed annotation. Our system provides a consistent set of data to all annotators and eliminates the need for annotators to format data. Involving the bovine research community in genome annotation has allowed us to leverage expertise in various areas of bovine biology to provide biological insight into the genome sequence.

  19. Casein genes of Bos taurus. II. Isolation and characterization of the β-casein gene

    International Nuclear Information System (INIS)

    The expression of the casein genes in the cells of the mammary gland is regulated by peptide and steroid hormones. In order to study the controlling mechanisms we have isolated and characterized the β-casein gene. The gene is 8.6 kb long and exceeds by a factor of 7.8 the length of the corresponding mRNA which is encoded by nine exons. The genomic clones incorporate in addition 8.5 kb and 4.5 kb of the 5'- and 3'-flanking regions. We have determined the sequence of the 5- and 3-terminals of the gene and have performed a comparative analysis of the corresponding regions of the rat β-casein gene. Furthermore we have identified the conversed sequences identical or homologous to the potential sections of binding to the nuclear factor CTF/NF-1 by glucocorticoid and progesterone receptors. The regulatory region of the bovine casein gene contains two variants of the TATA signal, flanking the duplication section in the promoter region

  20. Het Nederlandse bos als vorm van bodemgebruik

    NARCIS (Netherlands)

    Slangen, L.H.G.; Boven, van B.

    1983-01-01

    Behandeling van de oppervlakte en verdeling van het bos en de veranderingen die hierin zijn opgetreden, met de bedrijfsgrootte-struktuur als belangrijke invalshoek daarbij; de rol van de overheid: doeleinden, instrumenten en effekten van het beleid

  1. The Taurus Spitzer Survey: New Candidate Taurus Members Selected Using Sensitive Mid-Infrared Photometry

    CERN Document Server

    Rebull, L M; McCabe, C -E; Hillenbrand, L A; Stapelfeldt, K R; Noriega-Crespo, A; Carey, S J; Brooke, T; Huard, T; Terebey, S; Audard, M; Monin, J -L; Fukagawa, M; Guedel, M; Knapp, G R; Menard, F; Allen, L E; Angione, J R; Baldovin-Saavedra, C; Bouvier, J; Briggs, K; Dougados, C; Evans, N J; Flagey, N; Guieu, S; Grosso, N; Glauser, A M; Harvey, P; Hines, D; Latter, W B; Skinner, S L; Strom, S; Tromp, J; Wolf, S

    2009-01-01

    We report on the properties of pre-main-sequence objects in the Taurus molecular clouds as observed in 7 mid- and far-infrared bands with the Spitzer Space Telescope. There are 215 previously-identified members of the Taurus star-forming region in our ~44 square degree map; these members exhibit a range of Spitzer colors that we take to define young stars still surrounded by circumstellar dust (noting that ~20% of the bonafide Taurus members exhibit no detectable dust excesses). We looked for new objects in the survey field with similar Spitzer properties, aided by extensive optical, X-ray, and ultraviolet imaging, and found 148 candidate new members of Taurus. We have obtained follow-up spectroscopy for about half the candidate sample, thus far confirming 34 new members, 3 probable new members, and 10 possible new members, an increase of 15-20% in Taurus members. Of the objects for which we have spectroscopy, 7 are now confirmed extragalactic objects, and one is a background Be star. The remaining 93 candida...

  2. Patterns of cell proliferation and apoptosis by topographic region in normal Bos taurus vs. Bos indicus crossbreeds bovine placentae during pregnancy

    Directory of Open Access Journals (Sweden)

    Ambrósio Carlos E

    2009-03-01

    Full Text Available Abstract Background Placental and fetal growth requires high rates of cellular turnover and differentiation, which contributes to conceptus development. The trophoblast has unique properties and a wide range of metabolic, endocrine and angiogenic functions, but the proliferative profile of the bovine placenta characterized by flow cytometry analysis and its role in fetal development are currently uncharacterized. Complete understanding of placental apoptotic and proliferative rates may be relevant to development, especially if related to the pathogenesis of pregnancy losses and placental abnormalities. Methods In this study, the proliferation activity and apoptosis in different regions of normal bovine placenta (central and boundary regions of placentomes, placentomal fusion, microplacentomes, and interplacentomal regions, from distinct gestation periods (Days 70 to 290 of pregnancy, were analyzed by flow cytometry. Results Our results indicated that microplacentomes presented a lower number of apoptotic cells throughout pregnancy, with a higher proliferative activity by the end of gestation, suggesting that such structures do not contribute significantly to normal of placental functions and conceptus development during pregnancy. The placentome edges revealed a higher number of apoptotic cells from Day 170 on, which suggests that placentome detachment may well initiate in this region. Conclusion Variations involving proliferation and apoptotic rates may influence placental maturation and detachment, compromising placental functions and leading to fetal stress, abnormalities in development and abortion, as frequently seen in bovine pregnancies from in vitro fertilization and cloning procedures. Our findings describing the pattern of cell proliferation and apoptosis in normal bovine pregnancies may be useful for unraveling some of the developmental deviations seen in nature and after in vitro embryo manipulations.

  3. Preweaning growth of Angus- (Bos taurus), Brahman- (Bos indicus), and Tuli- (Sanga) sired calves and reproductive performance of their Brahman dams.

    Science.gov (United States)

    Browning, R; Leite-Browning, M L; Neuendorff, D A; Randel, R D

    1995-09-01

    Calves born to Angus (A), Brahman (B), or Tuli (T) bulls and B cows were evaluated to determine sire breed of calf effects on preweaning calf growth and reproductive performance of their dams. Records from 242 cow-calf pairs over 2 yr were used to assess birth weight, calf ADG, weaning weight, gestation length, and postpartum interval to estrus (PPI). The sire breed x sex of calf interaction was important (P Angus-sired F1 calves and similar to straightbred Brahman calves in preweaning growth. Crossbred calves had shorter gestations but longer postpartum intervals than purebred calves. PMID:8582844

  4. Purebred-crossbred performance and genetic evaluation of postweaning growth and carcass traits in Bos indicus x Bos taurus crosses in Australia.

    Science.gov (United States)

    Newman, S; Reverter, A; Johnston, D J

    2002-07-01

    Growth and carcass data on 7,154 cattle from a purebred project and 1,241 cattle from a crossbred project, comprising 916 first-crosses and 325 purebred Brahman controls, were analyzed to estimate genetic parameters, including the genetic correlations between purebred and crossbred performance (rpc). The data also allowed the estimation of sire breed means for various growth and carcass traits. Crossbred calves were produced using 9 Angus, 8 Hereford, 7 Shorthorn, 14 Belmont Red, and 8 Santa Gertrudis sires bred to Brahman dams. These same sires produced 1,568 progeny in a separate purebreeding project. Cattle in both projects were managed under two finishing regimens (pasture and feedlot) to representative market live weights of 400 (domestic), 520 (Korean), and 600 kg (Japanese). The traits studied included live weight at around 400 d of age (400W), hot carcass weight (CWT), retail beef yield percentage (RBY), intramuscular fat percentage (IMF), rump fat depth (P8), and preslaughter ultrasound scanned eye muscle area (SEMA). Estimated breeding values (EBV) of sires from their BREEDPLAN genetic evaluations were used to assess their value in predicting crossbred performance. Regressions of actual crossbred calf performance on sire EBV for each of the traits differed little from their expectation of 0.5. Angus sires produced crossbred carcasses with the highest P8 and lowest RBY but highest IMF. In contrast, crossbred progeny from Belmont Red sires had the lightest 400W and CWT, lowest P8, and highest RBY. Estimates of rpc were 0.48, 0.48, 0.83, 0.95, 1.00, and 0.78 for 400W, CWT, RBY, IMF, P8, and SEMA, respectively. Commercial breeders selecting sires for crossbreeding programs with Brahman females, based on EBV computed from purebred data, might encounter some reranking of sire's performance for weight-related traits, with little expected change in carcass traits. PMID:12162647

  5. A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius).

    LENUS (Irish Health Repository)

    Edwards, Ceiridwen J

    2010-01-01

    BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius) has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs) from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+\\/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer). In total, 289.9 megabases (22.48%) of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously identified

  6. Circumstellar disks around binary stars in Taurus

    International Nuclear Information System (INIS)

    We have conducted a survey of 17 wide (>100 AU) young binary systems in Taurus with the Atacama Large Millimeter Array (ALMA) at two wavelengths. The observations were designed to measure the masses of circumstellar disks in these systems as an aid to understanding the role of multiplicity in star and planet formation. The ALMA observations had sufficient resolution to localize emission within the binary system. Disk emission was detected around all primaries and 10 secondaries, with disk masses as low as 10–4 M ☉. We compare the properties of our sample to the population of known disks in Taurus and find that the disks from this binary sample match the scaling between stellar mass and millimeter flux of Fmm∝M∗1.5--2.0 to within the scatter found in previous studies. We also compare the properties of the primaries to those of the secondaries and find that the secondary/primary stellar and disk mass ratios are not correlated; in three systems, the circumsecondary disk is more massive than the circumprimary disk, counter to some theoretical predictions.

  7. Circumstellar disks around binary stars in Taurus

    Energy Technology Data Exchange (ETDEWEB)

    Akeson, R. L. [NASA Exoplanet Science Institute, IPAC/Caltech, Pasadena, CA 91125 (United States); Jensen, E. L. N. [Swarthmore College, Department of Physics and Astronomy, Swarthmore, PA 19081 (United States)

    2014-03-20

    We have conducted a survey of 17 wide (>100 AU) young binary systems in Taurus with the Atacama Large Millimeter Array (ALMA) at two wavelengths. The observations were designed to measure the masses of circumstellar disks in these systems as an aid to understanding the role of multiplicity in star and planet formation. The ALMA observations had sufficient resolution to localize emission within the binary system. Disk emission was detected around all primaries and 10 secondaries, with disk masses as low as 10{sup –4} M {sub ☉}. We compare the properties of our sample to the population of known disks in Taurus and find that the disks from this binary sample match the scaling between stellar mass and millimeter flux of F{sub mm}∝M{sub ∗}{sup 1.5--2.0} to within the scatter found in previous studies. We also compare the properties of the primaries to those of the secondaries and find that the secondary/primary stellar and disk mass ratios are not correlated; in three systems, the circumsecondary disk is more massive than the circumprimary disk, counter to some theoretical predictions.

  8. Detection of Sarcocystis spp. in cattle (Bos taurus) and water buffaloes (Bubalus bubalis) in Iran by PCR-RFLP.

    Science.gov (United States)

    Hamidinejat, Hossein; Razi Jalali, Mohammad Hossein; Gharibi, Darioush; Molayan, Pedram Haddad

    2015-12-01

    Sarcocystis species are cyst-forming intracellular protozoan parasites. Cattle are mainly infected with Sarcocystis cruzi, Sarcocystis hominis and Sarcocystis hirsuta. Water buffaloes are intermediate hosts for Sarcocystis fusiformis, Sarcocystis levinei (S. cruzi-like species), Sarcocystis dubeyi, Sarcocystis sinensis (S. hominis-like species) and Sarcocystis buffalonis (S. hirsuta- like species). The aim of this study was Identification of Sarcocystis spp. in slaughtered cattle and water buffaloes in Ahvaz, Khuzestan province by PCR-restriction fragment length polymorphism. Meat inspection was done on 124 cattle and 147 water buffaloes. From each animal tissue samples (each 50 g) from heart, esophagus, diaphragm and intercostal muscle were collected during meat inspection. Samples examined with digestion method. Genomic DNA of 80 positive samples was extracted and their 18S rRNA gene was amplified. PCR products were digested by restricted enzymes (FokI, SspI and DraI). S. cruzi in cattle and S. fusiformis in water buffaloes were identified. Our study clarified that sarcocystosis in cattle in Ahvaz district may be results acute infection according to determined species, but in buffaloes as S. fusiformis was detected we may expect only economic loss follow up slaughterhouse inspection. PMID:26688630

  9. Comparative proteomics and transcriptomics analyses of livers from two different Bos taurus breeds: "Chianina and Holstein Friesian".

    Science.gov (United States)

    Timperio, Anna Maria; D'Alessandro, Angelo; Pariset, Lorraine; D'Amici, Gian Maria; Valentini, Alessio; Zolla, Lello

    2009-12-01

    The Holstein Friesian and Chianina cattle breeds are representative of extreme selection for milk and meat traits, respectively, with significant changes in metabolism resulting from human selection over the past centuries. In the present study, we wanted to assess whether selection for different purposes has had a measurable effect on liver metabolism through a comparison of the protein and gene expression profiles of the two breeds. We applied 2-DE in order to identify proteins which were differentially expressed in the livers of the two breeds and relate them to different liver functions. We expected to find that only a small number of proteins would be differentially expressed, due to the relatively short phylogenetic distance between these cattle breeds. Nonetheless, thirty nine differentially-expressed proteins were characterized between Chianina and Holstein Friesian, out of a total of 560+/-57 spots that matched. Microarray analyses evidenced the differential expression of 167 genes (148 for the Holstein Friesian and 19 for the Chianina). Despite being closely related at the genetic level, the disparity of the proteomic and transcriptomic profiles of these two breeds allows us to perform pathway analysis thus to pinpoint proteins whose expression might render the latter capable of greater milk production, or proteins involved in altered thermoregulatory ability or hormone production. On the other hand, we found proteins and gene transcripts in Chianina, not expressed in Holstein, which, upon interaction pathway analysis, were mainly involved in anabolic pathways. In brief, our integrated study provides molecular evidences to support the physiological differences between Holstein and Chianina cattle breeds. PMID:19782776

  10. The Agersoe cattle: the last remnants of the Danish island cattle (Bos taurus)?

    DEFF Research Database (Denmark)

    Withen, K B; Brüniche-Olsen, A; Pedersen, B.V.;

    2011-01-01

    A phenotypically interesting strain of cattle existed on the small island of Agersoe, on the west coast of Zealand, Denmark, in the beginning of the last decade. The cattle share a great resemblance to the extinct Danish breed, the Island cattle. The objective of this study was to genetically...... characterize the Agersoe cattle, using microsatellites, amplified fragment length polymorphism (AFLP) and mtDNA markers, and analyse the genetic variability within the breed and the genetic relationship to 14 European breeds with focus on the Red Danish and Jutland breed. The results show diversity in nuclear...... breeds. Several arguments based on this survey have been put forward in favour of characterizing the Agersoe cattle as being the last remnants of the Danish Island Cattle...

  11. The polymorphisms of bovine cocaine- and amphetamine-regulated transcripts and their associations with cattle (Bos taurus) growth traits

    Indian Academy of Sciences (India)

    Chun Lei Zhang; Hong Chen; Yan Hong Wang; Xian Yong Lan; Chu Zhao Lei; Xing Tang Fang

    2008-09-01

    We investigated the polymorphisms of bovine cocaine- and amphetamine-regulated transcripts (CART). The coding and regulating regions of CART were screened in 7 cattle breeds by the single-stranded conformation polymorphism (SSCP) technique. The four loci (C1, C2, C3 and C4) studied were all polymorphic. Polymerase chain reaction (PCR) products representing different SSCP variants were sequenced and a total of 9 single-nucleotide polymorphisms (SNPs) were found. The associations between polymorphic loci and the growth traits of Nanyang cattle were analysed. The results indicated that genotype A1A1 of the C1 locus was associated with a higher body weight ( < 0.05) than heterozygous A1B1. Genotype A2A2 of the C2 locus was associated with lower body weight and average daily weight gain ( ≤ 0.001) than heterozygous A2B2. C3 and C4 loci had no significant effect on Nanyang cattle growth traits (P > 0.05).

  12. Association of CAPN1 and CAST gene polymorphisms with meat tenderness in Bos taurus beef cattle from Argentina

    OpenAIRE

    Pablo Corva; Liliana Soria; Alejandro Schor; Edgardo Villarreal; Macarena Pérez Cenci; Mariana Motter; Carlos Mezzadra; Lilia Melucci; Cristina Miquel; Enrique Paván; Gustavo Depetris; Francisco Santini; Juan Grigera Naón

    2007-01-01

    The activity of the calpains/calpastatin proteolytic system is closely related to the postmortem tenderization of meat. We investigated the association between beef tenderness and single nucleotide polymorphism (SNP) markers on the CAPN1 gene (SNP316, alleles C/G; SNP530 alleles A/G) and the CAST gene 3' untranslated region (SNP2870, alleles A/G). We sampled nine slaughter groups comprising 313 steers which had been reared in beef production systems in Argentina between 2002 and 2004 from cro...

  13. Association of CAPN1 and CAST gene polymorphisms with meat tenderness in Bos taurus beef cattle from Argentina

    Directory of Open Access Journals (Sweden)

    Pablo Corva

    2007-01-01

    Full Text Available The activity of the calpains/calpastatin proteolytic system is closely related to the postmortem tenderization of meat. We investigated the association between beef tenderness and single nucleotide polymorphism (SNP markers on the CAPN1 gene (SNP316, alleles C/G; SNP530 alleles A/G and the CAST gene 3' untranslated region (SNP2870, alleles A/G. We sampled nine slaughter groups comprising 313 steers which had been reared in beef production systems in Argentina between 2002 and 2004 from crosses between Angus, Hereford and Limousin cattle. Minor allele frequencies for the markers were 0.27 to 0.46 (C, 0.02 to 0.18 (A, and 0.24 to 0.53 (A, respectively. The presence of CAPN1 markers had significant effects on meat shear force but no detectable effects were demonstrated for the CAST marker. The shear force of meat from steers with the SNP316 CC genotype was 11% lower than for the SNP316 CG genotype and 17% lower than for the SNP316 GG genotype. There were very few steers with the SNP530 AA genotype and, contrary to previous studies, meat from steers with the SNP530 GG genotype showed an 11.5% higher shear force than that from steers with the SNP530 GA genotype. Final body weight, carcass weight and rib eye area were not affected by any of the markers. These results support the concept that CAPN1 variants are associated with tenderness across a wide range of beef production systems.

  14. Predicting wolf (Canis lupus)-cattle (Bos Taurus) encounters and consequential effects on cattle resource selection patterns

    Science.gov (United States)

    The gray wolf population in Idaho has grown dramatically from the original 35 reintroduced individuals in 1995-1996 to 94 documented packs and a minimum population of 835 individuals in 2009. Wolf depredation on livestock has also increased dramatically with this population growth. Substantial spa...

  15. Accumulation and detoxification of metals and arsenic in tissues of cattle (Bos taurus), and the risks for human consumption

    Energy Technology Data Exchange (ETDEWEB)

    Roggeman, Saskia, E-mail: saskiaroggeman@gmail.com [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium); de Boeck, Gudrun [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium); De Cock, Hilde [General Medical Laboratory (Medvet/AML), Department of Pathology, Emiel Vloorsstraat 9, 2020 Antwerpen (Belgium); Blust, Ronny; Bervoets, Lieven [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium)

    2014-01-01

    The aim of this study was to investigate metal accumulation and detoxification processes in cattle from polluted and unpolluted areas. Therefore dairy cows from farms and free ranging Galloway cows from nature reserves were used as study animals. The concentrations of Ag, Cd, Pb, Al, Cr, Mn, Fe, Co, Ni, Cu, Zn and As were determined in muscle, kidney, liver and lungs of cattle from polluted and reference areas in Belgium. In kidney and liver also the metallothionein concentrations were measured. For Ag, Mn, Co, Cu, Zn and As the concentrations in the different tissues were significantly higher in the sampled Galloways than in the sampled dairy cows. On the other hand Cd and Pb were significantly higher in tissues of both cattle breeds from polluted sites. Cadmium seemed to be the most important metal for metallothionein induction in kidneys whereas Zn seemed to be the most important metal for the induction of metallothionein in the liver. This study also suggested that only for Mn and Cd a significant part of the uptake occurs via the lungs. Although in muscle none of the Cd and Pb levels exceeded the European limits for human consumption, 40% of the livers and 85% of the kidneys of all examined cows were above the European limit for cadmium. Based on the existing minimum risk levels (MRLs) for chronic oral exposure, the present results suggested that a person of 70 kg should not eat more than 150 g cow meat per day because of the Cr levels in the muscles. - Highlights: •Cadmium induced metallothionein in kidney while Zn induced metallothionein in liver. •For Mn and Cd a significant part of the uptake happens via the lungs. •40% of the livers and 85% of the kidneys exceeded the European limit for cadmium. •A person of 70 kg should not eat more than 150 g bovine meat per day.

  16. In-Depth Characterization of Sheep (Ovis aries) Milk Whey Proteome and Comparison with Cow (Bos taurus)

    OpenAIRE

    Minh Ha; Manya Sabherwal; Elizabeth Duncan; Stewart Stevens; Peter Stockwell; Michelle McConnell; Alaa El-Din Bekhit; Alan Carne

    2015-01-01

    An in-depth proteomic study of sheep milk whey is reported and compared to the data available in the literature for the cow whey proteome. A combinatorial peptide ligand library kit (ProteoMiner) was used to normalize protein abundance in the sheep whey proteome followed by an in-gel digest of a 1D-PAGE display and an in-solution digestion followed by OFFGEL isoelectric focusing fractionation. The peptide fractions obtained were then analyzed by LC-MS/MS. This enabled identification of 669 pr...

  17. In-Depth Characterization of Sheep (Ovis aries Milk Whey Proteome and Comparison with Cow (Bos taurus.

    Directory of Open Access Journals (Sweden)

    Minh Ha

    Full Text Available An in-depth proteomic study of sheep milk whey is reported and compared to the data available in the literature for the cow whey proteome. A combinatorial peptide ligand library kit (ProteoMiner was used to normalize protein abundance in the sheep whey proteome followed by an in-gel digest of a 1D-PAGE display and an in-solution digestion followed by OFFGEL isoelectric focusing fractionation. The peptide fractions obtained were then analyzed by LC-MS/MS. This enabled identification of 669 proteins in sheep whey that, to our knowledge, is the largest inventory of sheep whey proteins identified to date. A comprehensive list of cow whey proteins currently available in the literature (783 proteins from unique genes was assembled and compared to the sheep whey proteome data obtained in this study (606 proteins from unique genes. This comparison revealed that while the 233 proteins shared by the two species were significantly enriched for immune and inflammatory responses in gene ontology analysis, proteins only found in sheep whey in this study were identified that take part in both cellular development and immune responses, whereas proteins only found in cow whey in this study were identified to be associated with metabolism and cellular growth.

  18. Accumulation and detoxification of metals and arsenic in tissues of cattle (Bos taurus), and the risks for human consumption

    International Nuclear Information System (INIS)

    The aim of this study was to investigate metal accumulation and detoxification processes in cattle from polluted and unpolluted areas. Therefore dairy cows from farms and free ranging Galloway cows from nature reserves were used as study animals. The concentrations of Ag, Cd, Pb, Al, Cr, Mn, Fe, Co, Ni, Cu, Zn and As were determined in muscle, kidney, liver and lungs of cattle from polluted and reference areas in Belgium. In kidney and liver also the metallothionein concentrations were measured. For Ag, Mn, Co, Cu, Zn and As the concentrations in the different tissues were significantly higher in the sampled Galloways than in the sampled dairy cows. On the other hand Cd and Pb were significantly higher in tissues of both cattle breeds from polluted sites. Cadmium seemed to be the most important metal for metallothionein induction in kidneys whereas Zn seemed to be the most important metal for the induction of metallothionein in the liver. This study also suggested that only for Mn and Cd a significant part of the uptake occurs via the lungs. Although in muscle none of the Cd and Pb levels exceeded the European limits for human consumption, 40% of the livers and 85% of the kidneys of all examined cows were above the European limit for cadmium. Based on the existing minimum risk levels (MRLs) for chronic oral exposure, the present results suggested that a person of 70 kg should not eat more than 150 g cow meat per day because of the Cr levels in the muscles. - Highlights: •Cadmium induced metallothionein in kidney while Zn induced metallothionein in liver. •For Mn and Cd a significant part of the uptake happens via the lungs. •40% of the livers and 85% of the kidneys exceeded the European limit for cadmium. •A person of 70 kg should not eat more than 150 g bovine meat per day

  19. Differences in PAR-2 activating potential by king crab (Paralithodes camtschaticus), salmon (Salmo salar), and bovine (Bos taurus) trypsin

    OpenAIRE

    Larsen, Anett Kristin; Kristiansen, Kurt; Sylte, Ingebrigt; Seternes, Ole Morten; Bang, Berit

    2013-01-01

    Background: Salmon trypsin is shown to increase secretion of the pro-inflammatory cytokine interleukin (IL)-8 from human airway epithelial cells through activation of PAR-2. Secretion of IL-8 induced by king crab trypsin is observed in a different concentration range compared to salmon trypsin, and seems to be only partially related to PAR-2 activation. This report aim to identify differences in the molecular structure of king crab trypsin (Paralithodes camtschaticus) compared to salmon (S...

  20. Influencia del encierro en la respuesta fisiológica del toro (Bos Taurus, L.) durante la lidia

    OpenAIRE

    Salamanca Llorente, Francisco

    2012-01-01

    La raza bovina de lidia dispone de una serie de particularidades, en su producción, manejo, selección y comportamiento que la hacen única en el mundo. La raza dispone de un censo aproximado a los 251.000 ejemplares (Lomillos et al, 2012), de los que derivan las reses que demandan los 16.000 espectáculos taurinos (de plaza de toros y populares), que se celebran cada año en España (Ministerio del Interior, 2010). El sector taurino mantiene una cifra cercana a los 200.000 puestos de trabajo y ge...

  1. Localisation of aphidicolin-induced break points in Holstein-Friesian cattle (Bos taurus using RBG-banding

    Directory of Open Access Journals (Sweden)

    Mernies Beatriz

    2002-11-01

    Full Text Available Abstract Fragile sites (FS seem to play a role in genome instability and may be involved in karyotype evolution and chromosome aberrations. The majority of common fragile sites are induced by aphidicolin. Aphidicolin was used at two different concentrations (0.15 and 0.30 μM to study the occurrence of FS in the cattle karyotype. In this paper, a map of aphidicolin induced break points and fragile sites in cattle chromosomes was constructed. The statistical analysis indicated that any band with three or more breaks was significantly damaged (P r = 0.54. On the contrary, 21 FS were identified on negative R bands while 9 FS were located on positive R bands.

  2. Effects of Stocking Density or Group Size on Intake, Growth, and Meat Quality of Hanwoo Steers (Bos taurus coreanae)

    OpenAIRE

    Lee, Sang Moo; Kim, Jae Yeon; Kim, Eun Joong

    2012-01-01

    This study was conducted to investigate the effects of stocking density or group size on feed intake, daily gain, and carcass characteristics of Hanwoo (Korean indigenous breed) steers reared from 7 months to 31 months of age. Thirty Hanwoo steers were divided into four groups with three replicates each (a total of 12 pens). In each group, one (G1), two (G2), three (G3), and four steers (G4) per pen were allocated as treatments. Pen size was 32.0 m2, and therefore Hanwoo steers in G1, G2, G3,...

  3. Effects of Stocking Density or Group Size on Intake, Growth, and Meat Quality of Hanwoo Steers (Bos taurus coreanae).

    Science.gov (United States)

    Lee, Sang Moo; Kim, Jae Yeon; Kim, Eun Joong

    2012-11-01

    This study was conducted to investigate the effects of stocking density or group size on feed intake, daily gain, and carcass characteristics of Hanwoo (Korean indigenous breed) steers reared from 7 months to 31 months of age. Thirty Hanwoo steers were divided into four groups with three replicates each (a total of 12 pens). In each group, one (G1), two (G2), three (G3), and four steers (G4) per pen were allocated as treatments. Pen size was 32.0 m(2), and therefore Hanwoo steers in G1, G2, G3, and G4 were reared under different space allowances, i.e. 32.0, 16.0, 10.6, and 8.0 m(2)/steer, respectively. Steers were reared following a conventional beef cattle management method in Korea, and were offered a fixed amount of commercial concentrate with ad libitum forages. Results were subjected to analysis of variance with stocking density as the main effect, and significance was declared at pmeat yield index, and meat yield grade were similar among all levels of stocking density. However, longissimus muscle area was larger in G1 and G2 (pquality traits, including marbling score, meat color, fat color, texture, maturity and meat quality grade, as determined by a group of experts, were not significantly different among the treatments. In conclusion, lower stocking density resulted in increased feed efficiency, daily gain, and carcass weight in Hanwoo steers. However it remains unclear whether such differences are the results of stocking density or group size, or a combination of both. Nonetheless, these results confirm previous studies reporting a negative effect of increased stocking density on animal productivity. Further, animal welfare under an intensive farming system in relation to economical return is discussed. PMID:25049516

  4. Autosomal dominant isolated ('uncomplicated') microcephaly.

    OpenAIRE

    Merlob, P; Steier, D; Reisner, S H

    1988-01-01

    A large family (13 affected members in three generations) is reported in which isolated microcephaly occurred without any other dysmorphic or neurological abnormalities. The family pedigree confirms the autosomal dominant mode of inheritance with incomplete penetrance, including one example of male to male transmission and the occurrence of a non-manifesting heterozygote resulting in a 'skipped generation'. There is considerable variation in the phenotypic expression of autosomal dominant mic...

  5. Physical composition, primary cuts and meat cuts of carcasses from Zebu and Bos taurus X Bos indicus crossbred cattle Composição física, cortes primários e cortes cárneos da carcaça de bovinos Zebu e de mestiços Bos taurus X Bos indicus

    Directory of Open Access Journals (Sweden)

    Daniel Perotto

    2009-09-01

    Full Text Available Data on hot carcass weight, hot carcass yield, hindquarter weights and physical components, forequarter and spare ribs, and the weights of the main commercial cuts from the hindquarters of twenty young intact bulls were assessed. The animals, belonging to four genetic groups (Nellore, ½ Guzerath + ½ Nellore (½ G + ½ N, ½ Red Angus + ½ Nellore (½ R + ½ N and ½ Marchigiana + ½ Nellore (½ M + ½ N, were raised on pastures, finished in dry lot and slaughtered at live weights ranging from 445 to 517 kg, and at ages ranging from 679 to 863 days. During the dry lot period, which lasted 114 days, animals were fed sorghum silage offered ad libitum, and a concentrate (13.5 MJ of ME, 18% CP in the DM at 1% live weight per day. Genetic group influenced hot carcass weight, forequarter weight, meat weight in the spare ribs, as well as meat and bone weights in the forequarter. Animals in the ½ M + ½ N group were superior both to those in the Nellore and in the ½ G + ½ N groups for hot carcass weight, forequarter weight and meat weight in the spare ribs. The ½ M + ½ N group also differed from the ½ R + ½ N and from the ½ G + ½ N groups in terms of forequarter weight and meat weight in the forequarter, respectively. Conversely, forequarter bone weight of ½ M + ½ N animals was higher than in animals from the Nellore and the ½ R + ½ N groups, respectively. There was no effect of genetic group on hindquarter cuts, except for higher shank and knuckle weights in the ½ M + ½ N group compared to the ½ G + ½ N and Nellore groups, respectively.Foram avaliados o peso e o rendimento de carcaça quente, os pesos dos cortes primários, os pesos dos componentes físicos dos cortes primários e os pesos dos principais cortes comerciais do traseiro especial de 20 bovinos machos não-castrados dos grupos genéticos Nelore, ½ Guzerá + ½ Nelore (½ G + ½ N, ½ Red Angus + ½ Nelore (½ R + ½ N e ½ Marchigiana + ½ Nelore (½ M + ½ N terminados em confinamento. O experimento durou em média 114 dias, período no qual os animais foram alimentados com silagem de sorgo à vontade e concentrado composto de 73,5% de grão de milho, 25% de caroço de algodão e 1,5% de ureia, perfazendo 13,5 MJ de EM e 18% de PB por kg de MS, fornecido à base de 1% do peso vivo do animal por dia. O grupo genético influenciou os pesos de carcaça quente, do dianteiro, da carne do costilhar e os pesos da carne e dos ossos do dianteiro. Animais do grupo ½ M + ½ N superaram os Nelore e os ½ G + ½ N em peso de carcaça quente e em peso do corte dianteiro e da porção de carne do costilhar. O grupo ½ M + ½ N distinguiu-se também do ½ R + ½ N quanto ao peso de dianteiro e do ½ G + ½ N quanto ao peso da carne do dianteiro. Por outro lado, a quantidade de ossos do dianteiro dos animais ½ M + ½ N foi superior à dos animais dos grupos Nelore e ½ R + ½ N. Não houve efeito de grupo genético sobre os cortes resultantes do desdobramento do traseiro especial, exceto pelo fato de os animais ½ M + ½ N apresentarem maior peso de músculo em comparação aos ½ G + ½ N e maior peso de patinho em comparação aos Nelore.

  6. Parâmetros genéticos entre características de leite, de peso e a idade ao primeiro parto em gado mestiço leiteiro (Bos taurus x Bos indicus Genetic parameters between milk traits, weight traits and age at first calving in crossbreed dairy cattle (Bos taurus x Bos indicus

    Directory of Open Access Journals (Sweden)

    A.E. Vercesi Filho

    2007-08-01

    Full Text Available Foram estimadas as correlações genéticas entre características de produção de leite (produção de leite, gordura, proteína e duração da lactação em até 305 dias, na primeira lactação, características de peso (taxa de crescimento de novilhas entre 12-24 meses e peso médio de vacas e idade ao primeiro parto, em uma população de fêmeas Mestiço Leiteiro Brasileiro (MLB, por meio de metodologia REML, sob modelo animal. As estimativas de herdabilidade das características estudadas na ordem acima foram, respectivamente, 0,28± 0,08, 0,30±0,11, 0,28±0,09, 0,19±0,07, 0,18±0,06, 0,42±0,10 e 0,48±0,12. As correlações genéticas entre peso médio da vaca e a produção de leite, gordura e proteína foram, respectivamente, -0,22±0,22, -0,49±0,31 e -0,22±0,23 e da taxa de crescimento das novilhas com a produção de leite, gordura e proteína foram respectivamente, -0,59±0,35, -0,73±0,44 e -0,62±0,37. As correlações genéticas entre produção de leite, peso médio das vacas e taxa de crescimento das novilhas com idade ao primeiro parto foram respectivamente, 0,05±0,18, -0,05±0,18 e 0,02±0,20. A alta correlação genética (0,93±0,02 entre produção de leite e duração da lactação indicou que não se deve remover a variação na duração da lactação na seleção de gado leiteiro tropical.Genetic correlations between milk production (milk, fat, protein yield lactation length in 305-d lactation, live weight (average cow live weight, growth rate between 12-24 mo and age at first calving traits were estimated in a population of Mestiço Leiteiro Brasileiro (MLB females using REML methodology and animal model. The estimates of heritability were respectively, 0.28± 0.08, 0.30±0.11, 0.28±0.09, 0.19±0.07, 0.18±0.06, 0.42±0.10 and 0.48±0.12 for those traits. Genetic correlations between milk, fat and protein yield with cow average weight were, respectively, -0.22±0.22, -0.49±0.31, -0.22±0.23, and between milk, fat and protein yield with heifer live weight gain, -0.59±0.35, -0.73±0.44, -0.62±0.37 as well. Genetic correlations between milk yield, cow average weight and heifer live weight gain with age at first calving were, respectively, 0.05±0.18, -0.05±0.18, 0.02±0.20. The high genetic correlation between milk production and lactation length (0.93±0.02 indicated that variation of the lactation length should not be removed when selecting tropical dairy cattle.

  7. Application of Background Oriented Schlieren (BOS) in Underground Mine Ventilation

    OpenAIRE

    Jong, Edmund Chime

    2011-01-01

    The schlieren technique describes an optical analysis method designed to enhance light distortions caused by air movement. The ability to visualize gas flows has significant implications for analyzing underground mine ventilation systems. Currently, the widely utilized traditional schlieren methods are impractical underground due to complex equipment and design requirements. Background oriented schlieren (BOS) provides a solution to this problem. BOS requires two primary components, a pro...

  8. Transcriptome analysis and SNP identification in SCC of horn in (Bos indicus) Indian cattle.

    Science.gov (United States)

    Koringa, Prakash G; Jakhesara, Subhash J; Bhatt, Vaibhav D; Patel, Anand B; Dash, Debabrata; Joshi, Chaitanya G

    2013-11-01

    Single Nucleotide Polymorphisms (SNPs) have become the marker of choice for genome wide association studies. In order to provide the best genome coverage for the analysis of disease, production and performance traits, a large number of relatively evenly distributed SNPs are needed. The main objective of present work was to identify large numbers of gene-associated SNPs using high-throughput sequencing in squamous cell carcinoma of horn. RNA-seq analysis was conducted on 2 tissues viz. Horn Cancer (HC) and Horn Normal (HN) in Kankrej breed of cattle. A total of 909,362 reads with average read length of 405 bp for HC and 583,491 reads with average read length of 411 bp for HN were obtained. We found 9532 and 7065 SNPs as well as 1771 and 1172 Indels in HC and HN, respectively, from which, 7889 SNPs and 1736 Indels were uniquely present in HC, 5886 SNPs and 1146 Indels were uniquely present in HN and reported first time in Bos indicus, whereas the rest are already reported in Bos taurus dbSNP database. The gene-associated SNPs and Indels were high in upregulated genes of HC as compared to HN. Analysis of differentially expressed genes was identified, these genes are involved in regulation of cell proliferation, apoptosis, gene transcription, cell survival and metabolism through various metabolic pathways. The result of transcriptome expression profiling was validated using Real Time quantitative PCR in nine randomly selected genes. We identified numbers aberrant signaling pathways responsible for carcinogenesis in HC which are also commonly altered in squamous cell carcinoma (SCC) of lung in human being. We conclude that a large number of altered genes and dysfunction of multiple pathways are involved in the development of Horn Cancer. The present findings contribute to theoretical information for further screening of genes and identification of markers for early diagnosis of HC as well as SNPs identified in this report provide a much needed resource for genetic

  9. A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius.

    Directory of Open Access Journals (Sweden)

    Ceiridwen J Edwards

    Full Text Available BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer. In total, 289.9 megabases (22.48% of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously

  10. Combining ART and FBP for improved fidelity of tomographic BOS

    Science.gov (United States)

    Hartmann, Ulrich; Seume, Joerg R.

    2016-09-01

    Engine component defects along the hot-gas path (HGP) of jet engines influence the density distribution of the flow, and thus result in characteristic patterns in the exhaust jet. These characteristic patterns can be reconstructed with the optical background-oriented schlieren (BOS) method in a tomographic set-up, which in turn allows the identification of defects inside the engine through an exhaust jet analysis. The quality of the tomographic reconstruction strongly influences how easily defects can be detected inside the jet engine. In particular, the presence of high gradients in the reconstruction area has a strong impact on the reconstruction quality. An algebraic reconstruction algorithm (ART) is implemented and compared to a filtered-back projection (FBP) algorithm in terms of the capability of performing high-gradient tomographic BOS reconstructions. A combination of both algorithms is presented which significantly improves the reconstruction quality of high-gradient tomographic BOS in terms of artifact reduction. The combination of both algorithms is applied to both synthetic and real measurement data in this paper, in order to show possible applications and the achievable improvement of high-gradient tomographic BOS reconstructions.

  11. Autosomal-dominant osteopetrosis: An incidental finding

    Directory of Open Access Journals (Sweden)

    Rajathi Maria

    2010-01-01

    Full Text Available Osteopetrosis is a descriptive term that refers to a group of rare, heritable disorders of the skeleton. Osteopetrotic conditions vary greatly in their presentation and severity, from just as an incidental finding on radiographs to causing life-threatening complications such as bone marrow suppression. It is caused by failure of osteoclast development and function. Osteopetrosis can be inherited as autosomal-recessive, autosomal-dominant or as X-linked traits, with the most severe forms being the autosomal-recessive ones. The severity of the disease is mild to moderate in the autosomal-dominant forms, with normal life expectancy. Diagnosis is largely based on clinical and radiographic evaluation. The present paper reports a case of autosomal-dominant osteopetrosis complicated by osteomyelitis with a short review of the condition.

  12. Calibration of a Background Oriented Schlieren (BOS) Set-up

    Science.gov (United States)

    Porta, David; Echeverría, Carlos; Cardoso, Hiroki; Aguayo, Alejandro; Stern, Catalina

    2014-11-01

    We use two materials with different known indexes of refraction to calibrate a Background Oriented Schlieren (BOS) experimental set-up, and to validate the Lorenz-Lorentz equation. BOS is used in our experiments to determine local changes of density in the shock pattern of an axisymmetric supersonic air jet. It is important to validate, in particular, the Gladstone Dale approximation (index of refraction close to one) in our experimental conditions and determine the uncertainty of our density measurements. In some cases, the index of refraction of the material is well known, but in others the density is measured and related to the displacement field. We acknowledge support from UNAM through DGAPA PAPIIT IN117712 and the Graduate Program in Mechanical Engineering.

  13. Genetic polymorphism of milk proteins in some Bos genus populations

    Directory of Open Access Journals (Sweden)

    A.M. Guastella

    2011-03-01

    Full Text Available In cattle the analysis of the genetic polymorphism of milk proteins provides an effective tool both to characterize the genetic diversity and to improve the efficiency of selection for specific production traits. Four genes, αS1-casein (CSN1S1, β-casein (CSN2, κ-casein (CSN3 and β-lactoglobulin (BLG have showed a high level of genetic polymorphism and are candidate to play a role in selection programmes in order to improve milk production. In this work three Bos genus populations, one taurine breed autochthonous of South-East of Sicily (Modicana and two Bos indicus populations (Azaouak and Gudali reared in Niger and Cameroon, respectively,..........

  14. Accuracy of genomic predictions in Bos indicus (Nellore) cattle

    OpenAIRE

    Neves, Haroldo HR; Carvalheiro, Roberto; O’Brien, Ana M Pérez; Utsunomiya, Yuri T; do Carmo, Adriana S; Schenkel, Flávio S; Sölkner, Johann; McEwan, John C; Van Tassell, Curtis P.; Cole, John B; da Silva, Marcos VGB; Queiroz, Sandra A; Tad S. Sonstegard; Garcia, José Fernando

    2014-01-01

    Background Nellore cattle play an important role in beef production in tropical systems and there is great interest in determining if genomic selection can contribute to accelerate genetic improvement of production and fertility in this breed. We present the first results of the implementation of genomic prediction in a Bos indicus (Nellore) population. Methods Influential bulls were genotyped with the Illumina Bovine HD chip in order to assess genomic predictive ability for weight and carcas...

  15. Pengaruh Anggaran Bantuan Operasional Sekolah (BOS) Terhadap Peningkatan Prestasi Belajar Siswa SMP Di Kota Medan

    OpenAIRE

    Syafrida

    2014-01-01

    The objective of the research was to find out the correlation and the effectiveness of BOS (School Operation Assistance) fund with the improvement of SMP students' learning achievement in Medan. BOS program has started since July, 2005 which is aimed to ease people's burden in education cost by giving financial aid for supporting qualified nine-year learning compulsory. Although the government has distributed BOS fund to schools, there are still many poor children who drop out of school, and ...

  16. Genetics Home Reference: autosomal recessive hypotrichosis

    Science.gov (United States)

    ... Autosomal recessive hypotrichosis is a condition that affects hair growth. People with this condition have sparse hair ( hypotrichosis ) ... erosions) on the scalp. In areas of poor hair growth, they may also develop bumps called hyperkeratotic follicular ...

  17. Genetics Home Reference: autosomal dominant vitreoretinochoroidopathy

    Science.gov (United States)

    ... Diagnosis & Management These resources address the diagnosis or management of autosomal dominant vitreoretinochoroidopathy: American Foundation for the Blind: Living with Vision Loss Genetic Testing Registry: Vitreoretinochoroidopathy dominant These resources ...

  18. N2H+ Observations of Molecular Cloud Cores in Taurus

    OpenAIRE

    Tatematsu, K; Umemoto, T; Kandori, R.; Y. Sekimoto

    2004-01-01

    N2H+ observations of molecular cloud cores in Taurus with the Nobeyama 45 m radio telescope are reported. We compare ``cores with young stars'' with ``cores without young stars''. The differences in core radius, linewidth, and core mass are small. Linewidth is dominated by thermal motions in both cases. N2H+ maps show that the intensity distribution does not differ much between cores without stars and those with stars. This is in contrast to the result previously obtained in H13CO+ toward Tau...

  19. Change of land use in the Turkish Taurus Mountains

    Directory of Open Access Journals (Sweden)

    Yıldız Güneş

    2016-01-01

    Full Text Available The effects of land use changes on forests and agricultural areas in the central Taurus Mountains of Turkey have been studied. In this region a progressive conversion of extensive grazing was observed towards more intensively farmed arable land in recent decades. The loss of forest land is obvious, and the remaining forests are currently severely degraded and fragmented. Based on a model area it was shown that forests accounted for more than 80% of the land cover in the 1960s. In the following decades the forest area decreased by more than 20%. To the same extent, the share of agricultural land increased, predominantly of the pastures, too. The use of pastures in turn was replaced in the 1990s by arable use, so that now for almost 30% of land use accont for production crop. Accordingly, the way of life of the rural population changed in the last 50 years. By the middle of the 20th century, people had mostly been living as nomads. Thereafter, they become increasingly stationary. While the population density decreased at the some time agriculture was intensified and livestock reduced. This change led to today to profound changes in the landscape of the Taurus Mountains and its unique habitats. Restrictive measures as a way to curb forest degradation and to intensify the use of arable land are discussed.

  20. Seminal plasma proteome of electroejaculated Bos indicus bulls.

    Science.gov (United States)

    Rego, J P A; Crisp, J M; Moura, A A; Nouwens, A S; Li, Y; Venus, B; Corbet, N J; Corbet, D H; Burns, B M; Boe-Hansen, G B; McGowan, M R

    2014-07-01

    The present study describes the seminal plasma proteome of Bos indicus bulls. Fifty-six, 24-month old Australian Brahman sires were evaluated and subjected to electroejaculation. Seminal plasma proteins were separated by 2-D SDS-PAGE and identified by mass spectrometry. The percentage of progressively motile and morphologically normal sperm of the bulls were 70.4 ± 2.3 and 64 ± 3.2%, respectively. A total of 108 spots were identified in the 2-D maps, corresponding to 46 proteins. Binder of sperm proteins accounted for 55.8% of all spots detected in the maps and spermadhesins comprised the second most abundant constituents. Other proteins of the Bos indicus seminal plasma include clusterin, albumin, transferrin, metalloproteinase inhibitor 2, osteopontin, epididymal secretory protein E1, apolipoprotein A-1, heat shock 70 kDa protein, glutathione peroxidase 3, cathelicidins, alpha-enolase, tripeptidyl-peptidase 1, zinc-alpha-2-glycoprotein, plasma serine protease inhibitor, beta 2-microglobulin, proteasome subunit beta type-4, actin, cathepsins, nucleobinding-1, protein S100-A9, hemoglobin subunit alpha, cadherin-1, angiogenin-1, fibrinogen alpha and beta chain, ephirin-A1, protein DJ-1, serpin A3-7, alpha-2-macroglobulin, annexin A1, complement factor B, polymeric immunoglobulin receptor, seminal ribonuclease, ribonuclease-4, prostaglandin-H2 d-isomerase, platelet-activating factor acetylhydrolase, and phosphoglycerate kinase 1. In conclusion, this work uniquely portrays the Bos indicus seminal fluid proteome, based on samples from a large set of animals representing the Brahman cattle of the tropical Northern Australia. Based on putative biochemical attributes, seminal proteins act during sperm maturation, protection, capacitation and fertilization. PMID:24889044

  1. Genetic polymorphism of milk proteins in some Bos genus populations

    OpenAIRE

    A. M. Guastella; G. D'Urso; G. Tirella; Budelli, E; S. Bordonaro; Marletta, D

    2011-01-01

    In cattle the analysis of the genetic polymorphism of milk proteins provides an effective tool both to characterize the genetic diversity and to improve the efficiency of selection for specific production traits. Four genes, αS1-casein (CSN1S1), β-casein (CSN2), κ-casein (CSN3) and β-lactoglobulin (BLG) have showed a high level of genetic polymorphism and are candidate to play a role in selection programmes in order to improve milk production. In this work three Bos genu...

  2. NCBI nr-aa BLAST: CBRC-RMAC-01-0084 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-01-0084 ref|XP_594146.3| PREDICTED: Toll-like receptor 5 [Bos taurus] gb|...ABC68311.1| toll-like receptor 5 [Bos taurus] gb|ABU86924.1| Toll-like receptor 5 [Bos taurus x Bos indicus]... gb|ABU86926.1| Toll-like receptor 5 [Bos taurus] gb|ABU86927.1| Toll-like receptor 5 [Bos taurus] gb|ABU869...28.1| Toll-like receptor 5 [Bos taurus] gb|ABU86929.1| Toll-like receptor 5 [Bos tau...rus] gb|ABU86931.1| Toll-like receptor 5 [Bos taurus x Bos indicus] gb|ABU86932.1| Toll-like receptor 5 [Bos taurus x Bos indicus] XP_594146.3 0.0 78% ...

  3. NCBI nr-aa BLAST: CBRC-TNIG-22-0261 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TNIG-22-0261 ref|XP_594146.3| PREDICTED: Toll-like receptor 5 [Bos taurus] gb|...ABC68311.1| toll-like receptor 5 [Bos taurus] gb|ABU86924.1| Toll-like receptor 5 [Bos taurus x Bos indicus]... gb|ABU86926.1| Toll-like receptor 5 [Bos taurus] gb|ABU86927.1| Toll-like receptor 5 [Bos taurus] gb|ABU869...28.1| Toll-like receptor 5 [Bos taurus] gb|ABU86929.1| Toll-like receptor 5 [Bos tau...rus] gb|ABU86931.1| Toll-like receptor 5 [Bos taurus x Bos indicus] gb|ABU86932.1| Toll-like receptor 5 [Bos taurus x Bos indicus] XP_594146.3 9e-85 39% ...

  4. Random Regression Models for Estimation of Covariance Functions, Genetic Parameters and Prediction of Breeding Values for Rib Eye Area in a Colombian Bos indicus-Bos taurus Multibreed Cattle Population

    Directory of Open Access Journals (Sweden)

    CARLOS ALBERTO MARTÍNEZ

    2012-06-01

    Full Text Available In this paper we present an application of random regression models (RRM to obtain restricted maximum likelihood estimates of covariance functions and predictions of breeding values for longitudinal records of rib eye area measured by ultrasound (REA in a Colombian multibreed cattle population. The dataset contained 708 records from 340 calves progeny of 37 sires from nine breeds mated to Gray Brahman Cows. The mixed model was a RRM that used Legendre polynomials (LP of order 1 to 3. Fixed effects were age of animal, dam parity, contemporary group (herd*year*season*sex, breed additive genetic and heterosis, whereas direct and maternal additive genetic and maternal permanent environment were random effects. Residual variances were modeled either as constant or changing across the growth trajectory. Models were compared with two Information Criteria, the corrected Akaikes and the Schwartzs Bayesian. According to these criteria the best model was the one with first order LP and constant residual variance. Given that with this model estimated maternal additive genetic and permanent environment covariance functions showed that these effects were not accurately disentangled, a parsimonious model without maternal additive genetic effects was used to obtain genetic parameters and breeding values. Direct additive genetic variance decreased until 150 days and then increased. Maternal permanent environment variance increased with age. Direct heritability estimates for REA at 4 months, weaning, 12 and 15 months (considered as target ages, were 0.003, 0.007, 0.034 and 0.058, respectively. Direct additive correlations ranged from -0.7 to 1. Maternal permanent environmental correlations were close to unity across the entire range of ages. Estimates of (covariance components showed the need to validate results with larger multigenerational multibreed populations before implement RRM in regional or national genetic evaluation procedures in Colombia.

  5. A novel analytical method, Birth Date Selection Mapping, detects response of the Angus (Bos taurus genome to selection on complex traits

    Directory of Open Access Journals (Sweden)

    Decker Jared E

    2012-11-01

    Full Text Available Abstract Background Several methods have recently been developed to identify regions of the genome that have been exposed to strong selection. However, recent theoretical and empirical work suggests that polygenic models are required to identify the genomic regions that are more moderately responding to ongoing selection on complex traits. We examine the effects of multi-trait selection on the genome of a population of US registered Angus beef cattle born over a 50-year period representing approximately 10 generations of selection. We present results from the application of a quantitative genetic model, called Birth Date Selection Mapping, to identify signatures of recent ongoing selection. Results We show that US Angus cattle have been systematically selected to alter their mean additive genetic merit for most of the 16 production traits routinely recorded by breeders. Using Birth Date Selection Mapping, we estimate the time-dependency of allele frequency for 44,817 SNP loci using genomic best linear unbiased prediction, generalized least squares, and BayesCπ analyses. Finally, we reconstruct the primary phenotypes that have historically been exposed to selection from a genome-wide analysis of the 16 production traits and gene ontology enrichment analysis. Conclusions We demonstrate that Birth Date Selection Mapping utilizing mixed models corrects for time-dependent pedigree sampling effects that lead to spurious SNP associations and reveals genomic signatures of ongoing selection on complex traits. Because multiple traits have historically been selected in concert and most quantitative trait loci have small effects, selection has incrementally altered allele frequencies throughout the genome. Two quantitative trait loci of large effect were not the most strongly selected of the loci due to their antagonistic pleiotropic effects on strongly selected phenotypes. Birth Date Selection Mapping may readily be extended to temporally-stratified human or model organism populations.

  6. Molecular differentiation of Sarcocystis buffalonis and Sarcocystis levinei in water buffaloes (Bubalus bubalis) from Sarcocystis hirsuta and Sarcocystis cruzi in cattle (Bos taurus).

    Science.gov (United States)

    Gjerde, Bjørn; Hilali, Mosaad; Abbas, Ibrahim E

    2016-06-01

    The purpose of the present study was to obtain sarcocysts of Sarcocystis buffalonis and Sarcocystis levinei from water buffaloes and characterize the isolates by molecular methods in order to determine whether the two species were genetically different from Sarcocystis hirsuta and Sarcocystis cruzi, respectively, from cattle, which had been characterized before. About 35 macroscopically visible (3-4 × 1-2 mm) and 20 barely visible (1-3 × 0.2 mm) sarcocysts were excised from the esophagus of 18 naturally infected and freshly slaughtered adult water buffaloes at three slaughterhouses in Egypt. Genomic DNA was extracted from the sarcocysts, and all isolates were first characterized at the mitochondrial cytochrome c oxidase subunit I gene (cox1) gene through PCR amplification and direct sequencing. Selected isolates were subsequently further characterized at the 18S and 28S ribosomal (r) RNA genes and the internal transcribed spacer 1 (ITS1) region of the nuclear rDNA unit by direct sequencing or cloning. Only six of the isolated macroscopic sarcocysts belonged to S. buffalonis, whereas the others belonged to Sarcocystis fusiformis. Twelve of the smaller cysts belonged to S. levinei and seven to Sarcocystis sinensis. The characterization of the sarcocysts of S. sinensis and some of the sarcocysts of S. fusiformis have been reported before. Fifteen additional sarcocyst isolates of S. fusiformis were characterized at cox1 in the present study and found to be identical or closely similar to previous isolates. At cox1, the sequence identity between the six isolates of S. buffalonis was 99.8-100 % (two haplotypes), whereas the identity between the 12 isolates of S. levinei was 99.0-100 % (10 haplotypes). The identity between cox1 sequences of S. buffalonis and S. hirsuta (n = 56) was 92.9-93.6 % (on average 93.4 %), and the identity between cox1 sequences of S. levinei and S. cruzi (n = 22) was 92.9-94.0 % (on average 93.5 %). The phylogenetic analyses placed with high support the cox1 sequences of S. buffalonis and S. hirsuta into two monophyletic sister groups, and the same was true for the cox1 sequences of S. levinei and S. cruzi. Hence, the study established that S. buffalonis and S. levinei are distinct species different from S. hirsuta and S. cruzi, respectively. Nucleotide sequences of S. buffalonis could be distinguished from those of S. hirsuta also at the 28S rRNA gene (clearly different) and the ITS1 region (small and uncertain difference) but not at the 18S rRNA gene. Sequences of S. levinei could be distinguished from those of S. cruzi both at the 18S and 28S rRNA genes (ITS1 region not examined). However, the cox1 gene was superior to the 18S and 28S rRNA genes as regards the ability to unambiguously delimit the species within each species pair, since at the latter markers, the number of consistent nucleotide differences between the species was low and there was a slight overlap between the intraspecific and interspecific sequence divergence. Comparison of the newly generated 18S rRNA gene sequences of S. levinei from water buffaloes with similar sequences deposited in GenBank suggested that S. levinei and S. cruzi are not strictly intermediate host specific but might occasionally infect cattle and water buffaloes, respectively. PMID:26979729

  7. Morfologia e grânulos citoplasmáticos do corpo lúteo de vacas aneloradas (Bos taurus indicus) gestantes e não gestantes

    OpenAIRE

    L.R. Vargas; P.R. Xavier; C.A. Rezende; M.M. Neves; A.P. Marques Júnior

    2015-01-01

    Avaliaram-se a proporção volumétrica dos constituintes do corpo lúteo e a distribuição de células lúteas com grânulos citoplasmáticos no corpo lúteo de animais Nelore ao longo da gestação e em animais não gestantes. Foram coletados ovários com corpos lúteos de 24 animais abatidos em frigorífico. Os animais foram distribuídos em dois grupos: gestantes e não gestantes. A idade gestacional foi determinada pela medição do comprimento apicocaudal do feto. Os ovários foram distribuídos segundo o tr...

  8. Studies on the food and feeding habits of Gaur Bos taurus H. Smith (Mammalia: Artiodactyla: Bovidae) in two protected areas of Goa

    OpenAIRE

    S.D. Gad; S.K. Shyama

    2009-01-01

    Feeding habits and diet composition of gaur were studied at Bhagvan Mahaveer Wildlife Sanctuary and Mollem National Park, Goa. Altogether, 32 species of plants belonging to 17 families constitute the gaur diet. The fruits, leaves, young shoots, bark and flowers are consumed, with a preference for leaves (87%). In summer gaur also consumed the bark of cashew (Anacardium occidentale) and teak (Tectona grandis) trees. Strong association was observed between food preference and season (chi-square...

  9. Studies on the food and feeding habits of Gaur Bos taurus H. Smith (Mammalia: Artiodactyla: Bovidae in two protected areas of Goa

    Directory of Open Access Journals (Sweden)

    S.D. Gad

    2009-02-01

    Full Text Available Feeding habits and diet composition of gaur were studied at Bhagvan Mahaveer Wildlife Sanctuary and Mollem National Park, Goa. Altogether, 32 species of plants belonging to 17 families constitute the gaur diet. The fruits, leaves, young shoots, bark and flowers are consumed, with a preference for leaves (87%. In summer gaur also consumed the bark of cashew (Anacardium occidentale and teak (Tectona grandis trees. Strong association was observed between food preference and season (chi-square=12.94; p=0.001. Peak feeding activity was observed early in the morning (0630 to 0830 hr and in the evening (1730 to 1845 hr. During hot hours of the day (1330 to 1530 hr, animals were found resting in the shade of large trees.

  10. Digital infrared thermography of the scrotum, semen quality, serum testosterone levels in Nellore bulls (Bos taurus indicus) and their correlation with climatic factors

    OpenAIRE

    Felipe Rydygier de Ruediger; Marcelo George Mungai Chacur; Francisco Carlos Platzeck Estrella Alves; Eunice Oba; Alcides de Amorim Ramos

    2016-01-01

    The objective was to study the relationship of climatic conditions with the temperature of the scrotum surface and sperm quality through digital infrared thermography in Nellore bulls, raised extensively. In six bulls held with scrotal thermography Flir E40® cameras, blood samples for serum testosterone and semen collection were taken by electroejaculation every 10 days, with six replications. Climatic factors: ambient temperature, relative humidity, dry globe temperature and temperature of t...

  11. Digital infrared thermography of the scrotum, semen quality, serum testosterone levels in Nellore bulls (Bos taurus indicus and their correlation with climatic factors

    Directory of Open Access Journals (Sweden)

    Felipe Rydygier de Ruediger

    2016-02-01

    Full Text Available The objective was to study the relationship of climatic conditions with the temperature of the scrotum surface and sperm quality through digital infrared thermography in Nellore bulls, raised extensively. In six bulls held with scrotal thermography Flir E40® cameras, blood samples for serum testosterone and semen collection were taken by electroejaculation every 10 days, with six replications. Climatic factors: ambient temperature, relative humidity, dry globe temperature and temperature of the wet globe were recorded using a globe thermometer (InstruTemp®, ITWTG-2000. Thermal images of the scrotum were analyzed with the Flir Tools® software for the temperatures of scrotal surface, the right and left sides of the scrotum lap thirds: dorsal, middle and ventral testicles; and tails of the epididymis. The semen data and thermograms were submitted to ANOVA and Tukey’s test at 5%. Pearson correlation was used for the surface temperatures of the scrotum, rectal temperature, quantitative and qualitative characteristics of semen and climatic factors. There was a positive correlation (P<0.05 for sperm motility x scrotal temperatures; sperm concentration x scrotal temperatures; climatic factors x rectal temperature. There was a negative correlation (P<0.05 between ambient temperature x sperm concentration. It was concluded that the temperature of the scrotum surface and climatic factors, temperature and humidity, influence the quality of semen. Thermography is recommended as a supplementary examination for reproductive evaluation of bulls.

  12. Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle

    DEFF Research Database (Denmark)

    Ali, A.; O'Neill, C.J.; Thomson, P.C.;

    2012-01-01

    Background: Infectious bovine keratoconjunctivitis (IBK) or 'pinkeye' is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified...... recorded for tick counts, helminth eggs counts as an indicator of intestinal parasites and live weights at several ages including 18 months. Results: Negative genetic correlations were estimated between IBK incidence and weight traits for animals in pre-weaning and post-weaning datasets. Genetic...... correlations among weight measurements were positive, with moderate to high values. Genetic correlations of IBK incidence with tick counts were positive for the pre-weaning and negative for the post-weaning datasets but negative with helminth eggs counts for the pre-weaning dataset and slightly positive for...

  13. Postweaning substitution of grazed forage with a high-energy concentrate has variable long-term effects on subcutaneous fat and marbling in Bos taurus genotypes.

    Science.gov (United States)

    Greenwood, P L; Siddell, J P; Walmsley, B J; Geesink, G H; Pethick, D W; McPhee, M J

    2015-08-01

    The objective of this study was to quantify the effects and interactions of stage of growth and genotype on commercial carcass traits and intramuscular fat (IMF) content in 5 muscles of steers ( = 165) and to test the hypothesis that substituting pasture with a high-energy concentrate during the immediate postweaning period increases IMF. Cattle of 3 genotypes (Angus, Hereford, and Wagyu × Angus; = 55/genotype) were selected at weaning from commercial herds, targeting genotypic differences in marbling and subcutaneous fatness. Following weaning, steers were fed for 168 d within 2 different improved, temperate pasture-based nutritional systems: a forage-only system (FS) and forage with high-energy supplemented system (SS), with 2 replicates per system. The supplement was fed at a level of 1% of average BW adjusted every 2 wk to provide an estimated 50% of energy requirements for 168 d from weaning. Pasture on offer in both systems was managed to match the BW of the FS and SS steers during the postweaning treatment period to avoid confounding due to differences in growth rate during this period. Steers were then regrouped into 2 replicates and backgrounded on improved, temperate pasture for 158 d and then grain fed within 1 group for 105 d (short fed) or 259 d (long fed). Groups were slaughtered at commencement (d 0) and end of postweaning nutritional treatments (d 168), end of backgrounding (d 326), and after short (d 431) or long feedlotting (d 585). Serial slaughter stage had an effect on all traits assessed ( < 0.01). The FS steers had more rib fat ( < 0.01) and higher Meat Standards Australia marbling score ( < 0.05) and a tendency ( < 0.10) to have greater eye muscle area than the SS steers throughout the study. Genotypic differences were evident ( < 0.05) for all traits assessed except HCW, dressing percentage, rib fat depth, ossification score, ultimate pH, and IMF in the semitendinosus muscle. The results for marbling and IMF do not support the use of a high-energy feed as a substitute for an equivalent amount of energy from pasture during the immediate postweaning period to enhance development of marbling. PMID:26440193

  14. Molecular characterisation of Sarcocystis bovifelis, Sarcocystis bovini n. sp., Sarcocystis hirsuta and Sarcocystis cruzi from cattle (Bos taurus) and Sarcocystis sinensis from water buffaloes (Bubalus bubalis).

    Science.gov (United States)

    Gjerde, Bjørn

    2016-04-01

    About 200 individual sarcocysts were excised from 12 samples of cattle beef from five countries (Argentina, Brazil, Germany, New Zealand, Uruguay) and tentatively identified to species or cyst type on the basis of their size and shape and cyst wall morphology. Genomic DNA was extracted from 147 of these sarcocysts and used initially for PCR amplification and sequencing of the partial mitochondrial cytochrome c oxidase subunit I gene (cox1) in order to identify the sarcocysts to species and/or sequence type. In addition, seven Sarcocystis sinensis-like sarcocysts collected from the oesophagus of water buffaloes in Egypt were examined at cox1 for comparative purposes. Based on the results from the cox1 marker, selected sarcocyst isolates from both hosts were further characterised at one to three regions of the nuclear ribosomal (r) DNA unit, i.e. the complete 18S rRNA gene, the complete internal transcribed spacer 1 (ITS1) region and the partial 28S rRNA gene. This was done in order to compare the results with previous molecular identifications based on 18S rRNA gene sequences and to evaluate the utility of these regions for species delimitations and phylogenetic inferences. On the basis of sarcocyst morphology and molecular data, primarily the cox1 sequences, four Sarcocystis spp. were identified in the samples of cattle beef. Twenty-two microscopic sarcocysts (1 × 0.1 mm) with hair-like protrusions were assigned to Sarcocystis cruzi, 56 macroscopic sarcocysts (3-8 × 0.5 mm) with finger-like protrusions were assigned to Sarcocystis hirsuta and 45 and 24 microscopic sarcocysts (1-3 × 0.1-0.2 mm) with finger-like protrusions were assigned to Sarcocystis bovifelis and Sarcocystis bovini n. sp., respectively. Sarcocysts of S. cruzi were identified in samples of beef from Argentina and Uruguay; sarcocysts of S. hirsuta in samples from Argentina, Brazil, Germany and New Zealand; sarcocysts of S. bovifelis in samples from Argentina and Germany; and sarcocysts of S. bovini in samples from Argentina and New Zealand. The microscopic sarcocysts from water buffaloes were confirmed to belong to S. sinensis. The cox1 sequences of S. bovifelis and S. bovini, respectively, shared an identity of 93-94 % with each other, and these sequences shared an identity of 89-90 % with cox1 of S. sinensis. In contrast, the intraspecific sequence identity was 98.4-100 % (n = 45), 99.3-100 % (n = 24) and 99.5-100 % (n = 7) for sequences of S. bovifelis, S. bovini and S. sinensis, respectively. In each of the latter three species, an aberrant type of cox1 sequences was also identified, which was only 91-92 % identical with the predominant cox1 type of the same species and about 98 % identical with the aberrant types of the two other species. These aberrant cox1 sequences are believed to represent non-functional nuclear copies of the mitochondrial genes (numts or pseudogenes). They might be used as additional markers to separate the three species from each other. Sequencing of a considerable number of clones of S. bovifelis, S. bovini and S. sinensis from each of the three regions of the rDNA unit revealed intraspecific sequence variation in all loci in all species and particularly in the ITS1 locus (78-100 % identity). As regards the 18S rRNA gene, it was possible to separate the three species from each other on the basis of a few consistent nucleotide differences in the less variable 3' end half of the gene. A comparison of the new sequences with GenBank sequences obtained from S. sinensis-like sarcocysts in cattle in other studies indicated that previous sequences derived from cattle in Germany and Austria belonged to S. bovifelis, whereas those derived from cattle in China belonged to S. bovini. On the basis of the new 28S rRNA sequences, it was possible to separate S. sinensis from S. bovifelis and S. bovini, whereas the latter two species could not be separated from each other. Based on ITS1 sequences, the three species were indistinguishable. Phylogenetic analysis using maximum parsimony placed with fairly high support cox1 sequences of S. bovifelis, S. bovini and S. sinensis, respectively, into three monophyletic clusters, with S. bovifelis and S. bovini being a sister group to S. sinensis. In contrast, phylogenies based on each of the three regions of the rDNA unit did not separate sequences of the three species completely from each other. Characterisation of cox1 of 56 isolates of S. hirsuta from four countries revealed only 13 haplotypes and an intraspecific sequence identity of 99.3-100 %. In the three regions of the rDNA unit, there was more extensive sequence variation, particularly in the ITS1 region. The 22 cox1 sequences of S. cruzi displayed a moderate intraspecific variation (98.6-100 %), whereas there was no variation at the 18S rRNA gene among 10 sequenced isolates. Sequencing of 16 clones of the partial 28S rRNA gene of S. cruzi yielded two markedly different sequence types, having an overall sequence identity of 95-100 %. PMID:26677095

  15. The first identification of a blood-sucking abomasal nematode Ashworthius sidemi in cattle (Bos taurus) using simple polymerase chain reaction (PCR).

    Science.gov (United States)

    Moskwa, Bożena; Bień, Justyna; Cybulska, Aleksandra; Kornacka, Aleksandra; Krzysiak, Michał; Cencek, Tomasz; Cabaj, Władysław

    2015-06-30

    A simple polymerase chain reaction (PCR) test was used to identify Ashworthius sidemi, a blood-sucking gastrointestinal nematode that commonly infects bison, red and roe deer, and moose in Poland. The present study uses this technique to confirm the possibility of transmission of A. sidemi infection from wildlife to domestic animals, such as cattle and sheep, grazing on the same natural pastures. A 406 bp fragment of genomic A. sidemi DNA was actually detected in DNA isolated from larval cultures derived from feces from cattle. A. sidemi DNA has been detected in cattle which represent a new host for this parasite. This is the first evidence of A. sidemi in cattle. The results reveal that a PCR test based on DNA from L3 larvae can be used for in vivo detection of A. sidemi invasions in breeding animals. In conclusion, the transfer of A. sidemi infection from wildlife to the farm animals sharing the same pastures appears possible. PMID:25981105

  16. An original SERPINA3 gene cluster: Elucidation of genomic organization and gene expression in the Bos taurus 21q24 region

    Directory of Open Access Journals (Sweden)

    Ouali Ahmed

    2008-04-01

    Full Text Available Abstract Background The superfamily of serine proteinase inhibitors (serpins is involved in numerous fundamental biological processes as inflammation, blood coagulation and apoptosis. Our interest is focused on the SERPINA3 sub-family. The major human plasma protease inhibitor, α1-antichymotrypsin, encoded by the SERPINA3 gene, is homologous to genes organized in clusters in several mammalian species. However, although there is a similar genic organization with a high degree of sequence conservation, the reactive-centre-loop domains, which are responsible for the protease specificity, show significant divergences. Results We provide additional information by analyzing the situation of SERPINA3 in the bovine genome. A cluster of eight genes and one pseudogene sharing a high degree of identity and the same structural organization was characterized. Bovine SERPINA3 genes were localized by radiation hybrid mapping on 21q24 and only spanned over 235 Kilobases. For all these genes, we propose a new nomenclature from SERPINA3-1 to SERPINA3-8. They share approximately 70% of identity with the human SERPINA3 homologue. In the cluster, we described an original sub-group of six members with an unexpected high degree of conservation for the reactive-centre-loop domain, suggesting a similar peptidase inhibitory pattern. Preliminary expression analyses of these bovSERPINA3s showed different tissue-specific patterns and diverse states of glycosylation and phosphorylation. Finally, in the context of phylogenetic analyses, we improved our knowledge on mammalian SERPINAs evolution. Conclusion Our experimental results update data of the bovine genome sequencing, substantially increase the bovSERPINA3 sub-family and enrich the phylogenetic tree of serpins. We provide new opportunities for future investigations to approach the biological functions of this unusual subset of serine proteinase inhibitors.

  17. The prey pathway: a regional history of cattle (Bos taurus and pig (Sus scrofa domestication in the northern Jordan Valley, Israel.

    Directory of Open Access Journals (Sweden)

    Nimrod Marom

    Full Text Available The faunal assemblage from the 9(th-8(th millennium BP site at Sha'ar Hagolan, Israel, is used to study human interaction with wild suids and cattle in a time period just before the appearance of domesticated animals of these species in the Jordan Valley. Our results, based on demographic and osteometric data, indicate that full domestication of both cattle and suids occurred at the site during the 8(th millennium. Importantly, domestication was preceded in both taxa by demographic and metric population parameters indicating severe overhunting. The possible role of overhunting in shaping the characteristics of domesticated animals and the social infrastructure to ownership of herds is then explored.

  18. Fluorescent in-situ hybridization of cattle and sheep chromosomes with cloned human fragile-X DNA

    DEFF Research Database (Denmark)

    Ali, Ahmd; Thomsen, Preben Dybdahl; Babar, M.E.

    2009-01-01

    An extensive study on spontaneous and 5-Fluorodeoxyuridine induced fragile sites identified Xq31 in cattle (Bos taurus) and (Xq24, Xq26) in sheep (Ovis aries) in addition to several autosomal fragile sites (under publication). A ZOO-FISH study using three cloned human fragile-X probes with CCG...

  19. Unigene BLAST: CBRC-BTAU-01-2452 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2452 gnl|UG|Bt#S27556675 PREDICTED: Bos taurus similar to spinocerebellar ataxia... 1 (olivopontocerebellar ataxia 1, autosomal dominant, ataxin 1) (LOC616399), mRNA /cds=p(1,2286) /gb=XM_868412 /gi=119915826 /ug=Bt.38423 /len=2817 3.2 44% ...

  20. Autosomal recessive osteopetrosis in Arab children.

    Science.gov (United States)

    Abdel-Al, Y K; Shabani, I S; Lubani, M M; al-Ghawabi, M A; Ibrahim, M D; al-Mohtaseb, S; Duodin, K I

    1994-01-01

    Nineteen Arab children including six boys and 13 girls in ten sibships were diagnosed as having osteopetrosis over a 5-year period in various hospitals in Kuwait. Eighteen patients had an isolated autosomal recessive form and one had autosomal recessive osteopetrosis associated with renal tubular acidosis. The mean age of diagnosis was 24 months. Parental consanguinity was high amongst them (68%). Anaemia, hepatosplenomegaly, failure to thrive, recurrent infections and neurological manifestations were common. Associated congenital abnormalities were found in 26%. Deafness, hydrocephalus and dental caries were relatively less common. A high mortality (37%) owing to infection was noted. The medical management and recommendations for patient care are discussed briefly. PMID:7516136

  1. Taxonomy Icon Data: cattle [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available rus_L.png Bos_taurus_NL.png Bos_taurus_S.png Bos_taurus_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cg...i?i=Bos+taurus&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Bos+taurus&t=NL http://biosciencedbc.jp/taxonomy..._icon/icon.cgi?i=Bos+taurus&t=S http://biosciencedbc.jp/taxonomy_icon/ico...n.cgi?i=Bos+taurus&t=NS http://togodb.biosciencedbc.jp/togodb/view/taxonomy_icon_comment_en?species_id=28 ...

  2. Autosomal Dominant Transmission of Accessory Navicular

    OpenAIRE

    Dobbs, Matthew B.; Walton, Tim

    2004-01-01

    The accessory navicular bone is one of the most symptomatic bones of the foot. Although it has been reported to be present in various members of the same family, there is a lack of knowledge about its inheritance pattern. We report two large pedigrees in which accessory navicular is inherited in an autosomal dominant fashion with incomplete penetrance.

  3. Genetics Home Reference: autosomal dominant congenital stationary night blindness

    Science.gov (United States)

    ... stationary night blindness autosomal dominant congenital stationary night blindness Enable Javascript to view the expand/collapse boxes. ... Close All Description Autosomal dominant congenital stationary night blindness is a disorder of the retina , which is ...

  4. Genetics Home Reference: autosomal recessive cerebellar ataxia type 1

    Science.gov (United States)

    ... Genetics Home Health Conditions ARCA1 autosomal recessive cerebellar ataxia type 1 Enable Javascript to view the expand/ ... Open All Close All Description Autosomal recessive cerebellar ataxia type 1 ( ARCA1 ) is a condition characterized by ...

  5. A randomised controlled trial of azithromycin therapy in bronchiolitis obliterans syndrome (BOS) post lung transplantation

    OpenAIRE

    Corris, Paul A; Ryan, Victoria A; Small, Therese; Lordan, James; Fisher, Andrew J.; Meachery, Gerard; Johnson, Gail; Ward, Chris

    2015-01-01

    Background We conducted a placebo-controlled trial of azithromycin therapy in bronchiolitis obliterans syndrome (BOS) post lung transplantation. Methods We compared azithromycin (250 mg alternate days, 12 weeks) with placebo. Primary outcome was FEV1 change at 12 weeks. Results 48 patients were randomised; (25 azithromycin, 23 placebo). It was established, post randomisation that two did not have BOS. 46 patients were analysed as intention to treat (ITT) with 33 ‘Completers’. ITT analysis inc...

  6. Autosomal dominant rolandic epilepsy with speech dyspraxia.

    Science.gov (United States)

    Scheffer, I E

    2000-01-01

    Autosomal Dominant Rolandic Epilepsy with Speech Dyspraxia (ADRESD) is a rare disorder which highlights the relationship between Benign Rolandic Epilepsy (BRE) and speech and language disorders. Subtle speech and language disorders have recently been well characterised in BRE. ADRESD is associated with long term, more severe speech and language difficulties. The time course of rolandic epilepsy in ADRESD is typical of that of BRE. ADRESD is inherited in an autosomal dominant manner with anticipation. It is postulated that the anticipation may be due to an, as yet unidentified, triplet repeat expansion in a gene for rolandic epilepsy. BRE follows complex inheritance but it is possible that ADRESD may hold some valuable clues to the pathogenesis of BRE. PMID:11231219

  7. Autosomal recessive diseases among Palestinian Arabs.

    OpenAIRE

    Zlotogora, J

    1997-01-01

    As a consequence of the high consanguinity rate among the Palestinian Arabs, many recessive disorders are present with a relatively high frequency. In a survey of 2000 different Palestinian Arab families who visited our genetic clinic, in 601 an autosomal recessive disease was diagnosed or strongly suspected. The distribution of these disorders was not uniform and some disorders, such as Krabbe disease, were found at high frequency in only a small part of the population. For some other disord...

  8. Cleidocranial Dysplasia with Autosomal Dominant Inheritance Pattern

    OpenAIRE

    Bhargava, P.; Khan, S; Sharma, R.; Bhargava, S.

    2014-01-01

    Cleidocranial dysplasia (CCD) is an autosomal dominant disease with a wide range of expression, characterized by clavicular hypoplasia, retarded cranial ossification, delayed bone and teeth development, supernumerary teeth, stomatognathic, craniofacial and skeletal abnormalities. This paper presents a case of CCD in a female with brachycephalic skull, depressed frontal bone and nasal bridge, hypoplastic middle one-third of face with mandibular prognathism and hyper mobility of both shoulders ...

  9. Associations between STR autosomal markers and longevity.

    Science.gov (United States)

    Bediaga, N G; Aznar, J M; Elcoroaristizabal, X; Albóniga, O; Gómez-Busto, F; Artaza Artabe, I; Rocandio, Ana; de Pancorbo, M M

    2015-10-01

    Life span is a complex and multifactorial trait, which is shaped by genetic, epigenetic, environmental, and stochastic factors. The possibility that highly hypervariable short tandem repeats (STRs) associated with longevity has been largely explored by comparing the genotypic pools of long lived and younger individuals, but results so far have been contradictory. In view of these contradictory findings, the present study aims to investigate whether HUMTHO1 and HUMCSF1PO STRs, previously associated with longevity, exert a role as a modulator of life expectancy, as well as to assess the extent to which other autosomal STR markers are associated with human longevity in population from northern Spain. To that end, 21 autosomal microsatellite markers have been studied in 304 nonagenarian individuals (more than 90 years old) and 516 younger controls of European descent. Our results do not confirm the association found in previous studies between longevity and THO1 and CSF1PO loci. However, significant association between longevity and autosomal STR markers D12S391, D22S1045, and DS441 was observed. Even more, when we compared allelic frequency distribution of the 21 STR markers between cases and controls, we found that 6 out of the 21 STRs studied showed different allelic frequencies, thus suggesting that the genomic portrait of the human longevity is far complex and probably shaped by a high number of genomic loci. PMID:26335621

  10. C18O Depletion in Starless Cores in Taurus

    CERN Document Server

    Ford, Amanda Brady

    2011-01-01

    We present here findings for C18O depletion in eight starless cores in Taurus: TMC-2, L1498, L1512, L1489, L1517B, L1521E, L1495A-S, and L1544. We compare observations of the C18O J=2-1 transition taken with the ALMA prototype receiver on the Heinrich Hertz Submillimeter Telescope to results of radiative transfer modeling using RATRAN. We use temperature and density profiles calculated from dust continuum radiative transfer models to model the C18O emission. We present modeling of three cores, TMC-2, L1489, and L1495A-S, which have not been modeled before and compare our results for the five cores with published models. We find that all of the cores but one, L1521E, are substantially depleted. We also find that varying the temperature profiles of these model cores has a discernable effect, and varying the central density has an even larger effect. We find no trends with depletion radius or depletion fraction with the density or temperature of these cores, suggesting that the physical structure alone is insuff...

  11. Demographics of Transition Discs in Ophiuchus and Taurus

    CERN Document Server

    Najita, Joan R; Muzerolle, James

    2015-01-01

    Transition disc systems are young stars that appear to be on the verge of dispersing their protoplanetary discs. We explore the nature of these systems by comparing the stellar accretion rates and disc masses of transition discs and normal T Tauri stars in Taurus and Ophiuchus. After controlling for the known dependencies of stellar accretion rate and disc mass and on age, stellar accretion rate on stellar mass, and disc mass on the presence of stellar or sub-stellar companions, we find that the normal T Tauri stars show a trend of stellar accretion rate increasing with disc mass. The transition discs tend to have higher average disc masses than normal T Tauri stars as well as lower accretion rates than normal T Tauri stars of the same disc mass. These results are most consistent with the interpretation that the transition discs have formed objects massive enough to alter the accretion flow, i.e., single or multiple giant planets. Several Ophiuchus T Tauri stars that are not known transition disc systems also...

  12. B- and A-Type Stars in the Taurus-Auriga Star-Forming Region

    Science.gov (United States)

    Mooley, Kunal; Hillenbrand, Lynne; Rebull, Luisa; Padgett, Deborah; Knapp, Gillian

    2013-01-01

    We describe the results of a search for early-type stars associated with the Taurus-Auriga molecular cloud complex, a diffuse nearby star-forming region noted as lacking young stars of intermediate and high mass. We investigate several sets of possible O, B, and early A spectral class members. The first is a group of stars for which mid-infrared images show bright nebulae, all of which can be associated with stars of spectral-type B. The second group consists of early-type stars compiled from (1) literature listings in SIMBAD, (2) B stars with infrared excesses selected from the Spitzer Space Telescope survey of the Taurus cloud, (3) magnitude- and color-selected point sources from the Two Micron All Sky Survey, and (4) spectroscopically identified early-type stars from the Sloan Digital Sky Survey coverage of the Taurus region. We evaluated stars for membership in the Taurus-Auriga star formation region based on criteria involving: spectroscopic and parallactic distances, proper motions and radial velocities, and infrared excesses or line emission indicative of stellar youth. For selected objects, we also model the scattered and emitted radiation from reflection nebulosity and compare the results with the observed spectral energy distributions to further test the plausibility of physical association of the B stars with the Taurus cloud. This investigation newly identifies as probable Taurus members three B-type stars: HR 1445 (HD 28929), t Tau (HD 29763), 72 Tau (HD 28149), and two A-type stars: HD 31305 and HD 26212, thus doubling the number of stars A5 or earlier associated with the Taurus clouds. Several additional early-type sources including HD 29659 and HD 283815 meet some, but not all, of the membership criteria and therefore are plausible, though not secure, members.

  13. New Brown Dwarfs and an Updated Initial Mass Function in Taurus

    CERN Document Server

    Luhman, K L

    2004-01-01

    I have performed a search for young low-mass stars and brown dwarfs (BDs) in 2 regions encompassing a total area of 4 deg^2 in the Taurus star-forming region, discovering 15 new members of Taurus. In addition, I present 7 new members outside of these areas from the initial stage of a survey of all of Taurus. These 22 objects exhibit spectral types of M4.5-M9.25 and masses of 0.3-0.015 M_sun according to the theoretical evolutionary models of Baraffe and Chabrier, 7 of which are likely to be BDs. Emission in H(alpha), He I, Ca II, [O I], and [S II] and excess emission in optical and near-IR bands among some of these objects suggest the presence of accretion, outflows, and circumstellar disks. The results from the 4 deg^2 survey have been combined with previous studies of Taurus to arrive at an IMF for a total area of 12.4 deg^2. As in the previous IMFs for Taurus, the updated IMF peaks at a higher mass (0.8 M_sun) than the mass functions in IC 348 and Orion (0.1-0.2 M_sun). Meanwhile, the deficit of BDs in Tau...

  14. On the mass segregation of stars and brown dwarfs in Taurus

    CERN Document Server

    Parker, Richard J; Goodwin, Simon P; Moraux, Estelle; Allison, Richard J; Guieu, Sylvain; Guedel, Manuel

    2010-01-01

    We use the new minimum spanning tree (MST) method to look for mass segregation in the Taurus association. The method computes the ratio of MST lengths of any chosen subset of objects, including the most massive stars and brown dwarfs, to the MST lengths of random sets of stars and brown dwarfs in the cluster. This mass segregation ratio (Lambda_MSR) enables a quantitative measure of the spatial distribution of high-mass and low-mass stars, and brown dwarfs to be made in Taurus. We find that the most massive stars in Taurus are inversely mass segregated, with Lambda_MSR = 0.70 +/- 0.10 (Lambda_MSR = 1 corresponds to no mass segregation), which differs from the strong mass segregation signatures found in more dense and massive clusters such as Orion. The brown dwarfs in Taurus are not mass segregated, although we find evidence that some low-mass stars are, with an Lambda_MSR = 1.25 +/- 0.15. Finally, we compare our results to previous measures of the spatial distribution of stars and brown dwarfs in Taurus, and...

  15. Genome wide association study on early puberty in Bos indicus.

    Science.gov (United States)

    Nascimento, A V; Matos, M C; Seno, L O; Romero, A R S; Garcia, J F; Grisolia, A B

    2016-01-01

    The aim of this study was to evaluate a genome wide association study (GWAS) approach to identify single nucleotide polymorphisms (SNPs) associated with fertility traits (early puberty) in Nellore cattle (Bos indicus). Fifty-five Nellore cows were selected from a herd monitored for early puberty onset (positive pregnancy at 18 months of age). Extremes of this phenotype were selected; 30 and 25 individuals were pregnant and non-pregnant, respectively, at that age. DNA samples were genotyped using a high-density SNP chip (>777.000 SNP). GWAS using a case-control strategy highlighted a number of significant markers based on their proximity with the Bonferroni correction line. Results indicated that chromosomes 5, 6, 9, 10, and 22 were associated with the traits of interest. The most significant SNPs on these chromosomes were rs133039577, rs110013280, rs134702839, rs109551605, and rs41639155. Candidate genes, as well as quantitative trait loci (QTL) previously reported in the Ensembl and Cattle QTLdb databases, were further investigated. Analysis of the regions close to the SNP on chromosomes 9 and 10 revealed that four QTL had been previously classified under the reproduction category. In conclusion, we have identified SNPs in close proximity to genes associated with reproductive traits. Moreover, U6 spliceosomal RNA was present on three different chromosomes, which is possibly associated with age at first calving, suggesting that it might be a strong candidate for future studies. PMID:26909970

  16. Estimulação hormonal, punção folicular transvaginal e avaliação ovocitária em bezerras pré-púberes da raça Nelore (Bos taurus indicus Hormonal stimulation and ultrasound guided transvaginal follicle aspiration and oocyte recovery in Nelore (Bos taurus indicus prepubertal calves

    Directory of Open Access Journals (Sweden)

    Marilia Viviane Snel-Oliveira

    2003-02-01

    Full Text Available O uso de bezerras pré-púberes como doadoras de ovócitos oferece um considerável potencial para acelerar o ganho genético através da diminuição do intervalo de gerações, além de incrementar o aproveitamento de fêmeas bovinas de alto valor genético. Os objetivos deste estudo foram analisar o efeito da idade e do tratamento estimulatório com gonadotrofinas sobre a resposta folicular, a taxa de recuperação, a produção e a avaliação morfológica de ovócitos colhidos em bezerras da raça nelore (B. t. indicus a partir de 10 meses de idade. As bezerras foram distribuídas aleatoriamente em três grupos (n=4 e receberam tratamentos hormonais distintos, repetidos nos mesmos animais nos três períodos, aos 10, 11 e 12 meses de idade. No dia zero (D0, todas as bezerras receberam um implante intravaginal de progesterona e, em D1, 2 mg de benzoato de estradiol intramuscular (im. Em D6, deu-se início à diferenciação dos tratamentos (T: T1- 120 UI de FSH, divididos em quatro aplicações im a cada 12 horas; T2 - 120 UI de FSH, em uma única aplicação subcutânea (sc, mais 300 UI de eCG sc, T3 - sem tratamento estimulatório. No D8, o implante de progesterona foi retirado e a punção folicular transvaginal, guiada por ultra-som (PFTV, foi realizada no D9. Dos 402 ovócitos coletados, 53 foram desnudados e medidos, incluindo a zona pelúcida, encontrando-se um diâmetro médio de 153,38 (8,06 mm. Não houve diferença significativa entre os tratamentos e entre as idades para quantidade de folículos > 3 mm, de ovócitos recuperados e de ovócitos viáveis. A média de ovócitos recuperados e ovócitos viáveis para cada tratamento foi: T1- 11,08 (6,20 e 59,58% (25,80, T2- 12,75 (8,04 e 66,02% (36,71, T3 - 9,66 (8,15 e 51,51% (30,69, respectivamente. O valor médio da taxa de recuperação foi de 78,70%. O uso de FSH e FSH + eCG não aumentou significantemente a quantidade de folículos > 3 mm no momento da PFTV, assim como dos ovócitos recuperados e viáveis aos 10, 11 e 12 meses de idade.The use of pre-pubertal calves as oocyte donors offers a considerable potential to increase the genetic gain lowering the generations interval, as well as increase the usage of bovine females with high genetic value. The objectives of this study were to analyze the effect of age and of the stimulatory treatment with gonadotropins in the follicular response, the recovery rate, quantity and quality of oocytes of the prepubertal Nelore (B. t. indicus calves. Twelve Nelore prepubertal females were stimulated with gonadotrophin hormone and were submitted to ultrasound guided transvaginal oocyte recovery (OPU at 10, 11 and 12 months of age. Before OPU the females were randomly distributed into three treatment groups (n=4, which consist of different protocols of ovarian super stimulation. For all treatments the animals on day zero (D0 received one intravaginal progesterone implant (CIDR-G® and on D1, 2 mg of estradiol benzoate im (Estrogin®. The stimulatory treatment began on D6 according to the following treatments: T1-120 IU of FSH (Foltropin®, divided in 4 im injections with 12 hours interval; T2-120 IU of FSH in one sc application plus 300 IU of eCG (Folligon® on D6; T3 - without stimulatory treatment (control. At D8 the CIDR-G®was removed and OPU was performed on D9. Among the 402 oocytes retrieved, 53 were denuded and measured (including the pellucid zone where a mean diameter of 153.38 ± 8.06 mm was obtained. No significant difference was detected among treatments and among ages for the quantity of follicles > 3 mm, quantity of oocytes recovery and quantity of oocytes morphologically viable. The mean of recovery oocytes and viable oocytes for each treatment was T1- 11.08 (6.20 and 59.58% (25.80, T2 - 12.75 (8.04 and 66.02% (36.71, T3 - 9.66 (8.15 and 51.51% (30.69, respectively. The mean value of recovery rate was 78.70%. The use of FSH or FSH + eCG does not increase significantly the amount of follicles > 3 mm at the OPU moment, as well as the total and viable oocytes by 10, 11 and 12 months of age.

  17. Estimación del comportamiento productivo y parámetros genéticos de características predestete en bovinos de carne (Bos taurus y sus cruzas, VIII Región, Chile Estimation of pre-weaning productive performance and genetic parameters in beef cattle (Bos taurus and crosses, VIII Region of Chile

    Directory of Open Access Journals (Sweden)

    E G Cienfuegos-Rivas

    2006-01-01

    Full Text Available El objetivo del presente estudio fue determinar el comportamiento productivo al nacimiento y destete de los terneros hijos de toros Angus, Hereford y Polled Hereford con vacas Clavel, Hereford, Holstein, Polled Hereford e Híbridas (cruzas de Holstein con combinaciones de Hereford en un rebaño bovino de carne en la provincia de Ñuble, VIII Región de Chile. Los animales fueron clasificados de acuerdo a sus características fenotípicas. El comportamiento productivo se evaluó analizando 1.119 registros productivos, desde 1999 al 2000, para las variables peso al nacimiento (PN, N=1.119, peso al destete ajustado (PD205, N=660 y ganancia predestete (GDP, N=660 utilizando el método de mínimos cuadrados para determinar el efecto de la raza del toro (GRT, la raza de la vaca (GRV, el grupo contemporáneo (GC y edad de la vaca (EDV como covariable sobre las variables PN, PD205 y GDP. Los parámetros genéticos y ambientales fueron estimados usando un modelo animal con la metodología MTDFREML, empleándose análisis univariados y bivariados para la estimación de los componentes de varianza. El efecto de GRT y GC fue significativo (PThe objective was to determine the productive performance in body weight change from birth until weaning, of calves sired by Angus, Hereford and Polled Hereford with Clavel, Hereford, Holstein, Polled Hereford, and Hybrid (different Holstein and Hereford combinations cows in a beef cattle herd in the dry area of the Ñuble, province of the VIII Region in Chile. The sires and cows were classified according to their phenotypic characteristics. The productive performance was evaluated by analyzing 1,119 production records from year 1990 to 2000 for the variables: birth weight (PN, N=1,119, adjusted weaning weight (PD205, N=660 and preweaning daily gain (GDP; N=660 using the least squares method to determine the effects of breed group of the sire (GRT, breed group of the dam (GRV, and contemporary groups (GC, with age of dam (EDV as a covariable, on PN, PD205 and GDP. Genetic and environmental parameters were estimated using an animal model with MTDFREML methodology, through univariable and bivariable analyses to estimate variance and covariance components. GRT and the GC had a significant effect (P<0.05 on PN and PD205 but did not affect GDP (P•0.05. Calves sired by Hereford bulls were 7.5, 12.5 y 14.0 % above the herd average for PN, PD205 and GDP, respectively. The GRV did not have an effect (P•0.05 on PN, PD205 and GDP. Heritabilities (h² calculated were 0.49 for PN, 0.15 for PD205 and 0.35 for GDP. Genetic correlation between PN and PD205 was 0.23. Within the GRT the h2 for PN and PD205 were 0.69 and 0.21 for Angus and 0.47 and 0.23 for Polled Hereford, respectively.

  18. EFEITO DE UM PROBIÓTICO NO PERÍMETRO ESCROTAL E ESPERMIOGRAMA EM TOUROS JOVENS TABAPUÃ (Bos taurus indicus) (Nota Científica) EFFECT OF ONE PROBIOTIC ON SCROTAL PERIMETER AND SPERMIOGRAM IN YOUNG TABAPUA BULLS (Bos taurus indicus)

    OpenAIRE

    Valéria da Silva Gandolfo; Gabriella Biondi de Godoy; Andrea Novoa Castillo Oliveira; Marcelo George Mungai Chacur; Sérgio do Nascimento Kronka

    2009-01-01

    Neste experimento avaliou-se o efeito do probiótico Proenzime® no perímetro escrotal e espermiograma em touros jovens Tabapuã. Duas colheitas de sêmen de 21 touros Tabapuã, com trinta meses de idade, foram realizadas nos dias zero (D0) e 120 (D120) por eletroejaculação, totalizando 42 amostras. Dividiram-se os touros em grupo-controle (GC) com dez animais e grupo tratado (GT) com onze animais. Os to...

  19. EFEITO DE UM PROBIÓTICO NO PERÍMETRO ESCROTAL E ESPERMIOGRAMA EM TOUROS JOVENS TABAPUÃ (Bos taurus indicus (Nota Científica EFFECT OF ONE PROBIOTIC ON SCROTAL PERIMETER AND SPERMIOGRAM IN YOUNG TABAPUA BULLS (Bos taurus indicus

    Directory of Open Access Journals (Sweden)

    Valéria da Silva Gandolfo

    2009-04-01

    Full Text Available

    Neste experimento avaliou-se o efeito do probiótico Proenzime® no perímetro escrotal e espermiograma em touros jovens Tabapuã. Duas colheitas de sêmen de 21 touros Tabapuã, com trinta meses de idade, foram realizadas nos dias zero (D0 e 120 (D120 por eletroejaculação, totalizando 42 amostras. Dividiram-se os touros em grupo-controle (GC com dez animais e grupo tratado (GT com onze animais. Os touros do GT receberam 4g de probiótico/animal/dia, durante 120 dias. Houve diferença (p<0,01 entre as colheitas (D0 e D120 nos grupos GC e GT para o perímetro escrotal (GC – D0: 30,50 cm e D120: 33,55 cm; GT – D0: 29,90 cm e D120: 34,30 cm. Houve diferença (p<0,05 entre colheitas (D0 e D120 nos grupos GC e GT, respectivamente, para: defeitos menores (GC – D0: 13,84 % e D120: 21,79%; GT – D0: 14,99% e D120: 20,84% e defeitos totais (GC – D0: 22,29% e D120: 29,24%; GT – D0: 25,14% e D120: 32,81%. Os resultados demonstram que, entre grupos, não houve alteração significativa das características seminais e perímetro escrotal.
       
    PALAVRAS-CHAVES: Aditivo, nutrição, sêmen, touro.

    PALAVRAS-CHAVE: Touro, sêmen, nutrição, aditivo.    The objective of this experiment was to evaluate the effect of the probiotic Proenzime® on scrotal perimeter and spermiogram in young Tabapua bulls. Two samples of semen from 21 Tabapua bulls, aging 30 months, were collected in day zero (D0 and 120 (D120 by electroejaculation, totalizing 42 samples. The bulls were divided in control group (CG with 10 animals and trated group (TG with 11 animals. The bulls of TG received 4g of probiotic/animal/day, during 120 days. There was difference (p<0.01 between collects (D0 and D120 in the groups CG and TG for scrotal perimeter (CG – D0: 30.50 cm and D120: 33.55 cm; TG – D0: 29.90 cm and D120: 34.30 cm. There was difference (p<0.05 between collects (D0 and D120 in the groups CG and TG, respectively. Minor defects (CG – D0: 13.84% and D120: 21.79%; TG – D0: 14.99% and D120: 20.84% and total defects (CG – D0: 22.29% and D120: 29.24%; TG – D0: 25.14% and D120: 32.81%. The results exposed allow concluding that significant alterations were not observed between groups for the seminal characteristics and scrotal perimeter.   

    KEY WORDS: Aditive, bull, nutrition, semen.

  20. Another Look at Taurus Littrow: An Interactive Geographic Information System DataBase

    Science.gov (United States)

    Coombs, Cassandra R.; Meisburger, J. L.; Nettles, J. W.

    1998-01-01

    A variety of data has been amassed for the Apollo 17 landing site, including topography, sample locations, and imagery. These data were compiled into a Geographic Information System (GIS) to analyze their interrelationships more easily. The database will allow the evaluation of the resource potential of the Taurus Littrow region pyroclastic deposits. The database also serves as a catalog for the returned lunar samples. This catalog includes rock type, size, and location. While this project specifically targets the Taurus Littrow region, it is applicable to other regions as well.

  1. A high dynamic radiation measurements instrument: the Bolometric Oscillation Sensor (BOS

    Directory of Open Access Journals (Sweden)

    P. Zhu

    2014-12-01

    Full Text Available The bolometric oscillation sensor (BOS is a broadband radiation measurement instrument onboard the PICARD satellite that has been active between 2010 and 2014. The main detector is a thermistor attached black coated surface, which was permanently exposed to space without any optical and aperture accessories. The temperature measurements are used within a transfer function to determine variations in incoming solar irradiance as well as the terrestrial radiation. In the present article, the measurement principle of BOS and its transfer function are presented. The performance of the instrument is discussed based on laboratory experiments and space observations from the PICARD satellite. The comparison of the short term variation of Total Solar Irradiance (TSI with absolute radiometers such as VIRGO/SOHO and TIM/SORCE over the same period of time, suggests that BOS is a relatively much simpler but very effective sensor to monitor electromagnetic radiation variations from visible to infrared wavelengths.

  2. Frontometaphyseal dysplasia: evidence for autosomal dominant inheritance.

    Science.gov (United States)

    Kassner, E G; Haller, J O; Reddy, V H; Mitarotundo, A; Katz, I

    1976-12-01

    Frontometaphyseal dysplasia is a syndrome that encompasses cranial hyperostosis, abnormal tubulation of cylindrical bones, and other skeletal and extraskeletal abnormalities. The most striking features are overgrowth of the supraorbital ridges which results in a Mephistophelian facial appearance and a radiographic configuration of the skull that has been likened to a soldier's helmet. Most patients have severe hearing loss, defective dentition, poorly developed musculature, and joint contractures. Dominant inheritance has been suggested in previous reports, but an appropriate pedigree has been documented in only one family. This paper describes three additional patients in two unrelated families: (1) an 8-year-old boy whose mother has mild metaphyseal dysplasia and several minor skeletal abnormalities that have occurred in patients with the syndrome; and (2) two maternal half-brothers. These cases provide additional evidence that frontometaphyseal dysplasia is an autosomal dominant trait with variable penetrance. PMID:998829

  3. MRI of autosomal dominant pure spastic paraplegia

    DEFF Research Database (Denmark)

    Krabbe, K; Nielsen, J E; Fallentin, E;

    1997-01-01

    callosum on one midsagittal slice and the area of the brain on one axial slice were measured and a "corpus-callosum index" expressing the size of the corpus callosum relative to that of the brain was calculated. Cross-sectional areas and anteroposterior and transverse diameters of the spinal cord at the...... levels of C 2, C 5, T 3, T 6, T 9 and T 11 were measured. No significant differences between patients and controls were found on qualitative evaluation of the images. The patients had a significantly smaller corpus callosum and "corpus-callosum index" than controls. This finding, not reported previously......We examined 16 patients with autosomal dominant pure spastic paraplegia (HSP) and 15 normal controls matched for age and sex using MRI of the brain and spinal cord. Images were assessed qualitatively by two independent radiologists, blinded to the clinical diagnosis. Areas of the brain and corpus...

  4. Cleidocranial dysplasia with autosomal dominant inheritance pattern.

    Science.gov (United States)

    Bhargava, P; Khan, S; Sharma, R; Bhargava, S

    2014-07-01

    Cleidocranial dysplasia (CCD) is an autosomal dominant disease with a wide range of expression, characterized by clavicular hypoplasia, retarded cranial ossification, delayed bone and teeth development, supernumerary teeth, stomatognathic, craniofacial and skeletal abnormalities. This paper presents a case of CCD in a female with brachycephalic skull, depressed frontal bone and nasal bridge, hypoplastic middle one-third of face with mandibular prognathism and hyper mobility of both shoulders with associated radiographic features. Odontologist is often the first professional who patient of CCD approaches, since there is a delay in the eruption or absence of permanent teeth. The premature diagnosis allows a scope for proper treatment modalities, offering a better life quality for patient. PMID:25184084

  5. Background Oriented Schlieren (BOS) and other Flow Visualization Developments and Applications at GRC

    Science.gov (United States)

    Clem, Michelle; Woike, Mark

    2013-01-01

    This is a presentation to be given at an internal NASA Advanced Schlieren Working Group Meeting. The presentation will cover the recent developments and applications of flow visualization methods at GRC. The topics being discussed will include the use of Background Oriented Schlieren (BOS) in the study of screech and its associated shock spacing as well as in the investigation of broadband shock noise reduction in the Jet-Surface Interaction Tests. In addition, other flow visualiztion methods will be discussed in an on-going study comparing schlieren, shadowgraph, BOS, and focusing schlieren.

  6. On identification problems requiring linked autosomal markers.

    Science.gov (United States)

    Egeland, Thore; Sheehan, Nuala

    2008-06-01

    This paper considers identification problems based on DNA marker data. The topics we discuss are general, but we will exemplify them in a simple context. There is DNA available from two persons. There is uncertainty about the relationship between the two individuals and a number of hypotheses describing the possible relationship is available. The task is to determine the most likely pedigree. This problem is fairly standard. However, there are some problems that cannot be solved using DNA from independently segregating loci. For example, the likelihoods for (i) grandparent-grandchild, (ii) uncle-niece and (iii) half-sibs coincide for such DNA data and so these relations cannot be distinguished on the basis of markers normally used for forensic identification problems: the likelihood ratio comparing any pair of hypotheses will be unity. Sometimes, but not in the examples we consider, other sources of DNA like mtDNA or sex chromosomes can help to distinguish between such equally likely possibilities. Prior information can likewise be of use. For instance, age information can exclude alternative (i) above and also indicate that alternative (iii) is apriori more likely than alternative (ii). More generally, the above problems can be solved using linked autosomal markers. To study the problem in detail and understand how linkage works in this regard, we derive an explicit formula for a pair of linked markers. The formula extends to independent pairs of linked markers. While this approach adds to the understanding of the problem, more markers are required to obtain satisfactory results and then the Lander-Green algorithm is needed. Simulation experiments are presented based on a range of scenarios and we conclude that useful results can be obtained using available freeware (MERLIN and R). The main message of this paper is that linked autosomal markers deserve greater attention in forensic genetics and that the required laboratory and statistical analyses can be performed

  7. Bilateral symmetric autosomal dominant sector chorioretinopathy with late maculopathy

    DEFF Research Database (Denmark)

    Fledelius, Hans C; Rosenberg, Thomas

    2012-01-01

    To describe the long-term course of bilateral symmetric autosomal dominant sector chorioretinopathy in a 79-year-old man who was diagnosed at age 31.......To describe the long-term course of bilateral symmetric autosomal dominant sector chorioretinopathy in a 79-year-old man who was diagnosed at age 31....

  8. NCBI nr-aa BLAST: CBRC-TTRU-01-1041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1041 gb|ABU86942.1| Toll-like receptor 10 [Bos taurus x Bos indicus] g...b|ABU86944.1| Toll-like receptor 10 [Bos taurus] gb|ABU86945.1| Toll-like receptor 10 [Bos taurus] gb|ABU869...46.1| Toll-like receptor 10 [Bos taurus] gb|ABU86949.1| Toll-like receptor 10 [Bos taurus x Bos indicus] ABU86942.1 0.0 83% ...

  9. NCBI nr-aa BLAST: CBRC-PVAM-01-0803 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0803 gb|ABU86942.1| Toll-like receptor 10 [Bos taurus x Bos indicus] g...b|ABU86944.1| Toll-like receptor 10 [Bos taurus] gb|ABU86945.1| Toll-like receptor 10 [Bos taurus] gb|ABU869...46.1| Toll-like receptor 10 [Bos taurus] gb|ABU86949.1| Toll-like receptor 10 [Bos taurus x Bos indicus] ABU86942.1 0.0 83% ...

  10. NCBI nr-aa BLAST: CBRC-VPAC-01-1397 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1397 gb|ABU86942.1| Toll-like receptor 10 [Bos taurus x Bos indicus] g...b|ABU86944.1| Toll-like receptor 10 [Bos taurus] gb|ABU86945.1| Toll-like receptor 10 [Bos taurus] gb|ABU869...46.1| Toll-like receptor 10 [Bos taurus] gb|ABU86949.1| Toll-like receptor 10 [Bos taurus x Bos indicus] ABU86942.1 0.0 88% ...

  11. The preliminary measurements from the Bolometer Oscillation System (BOS) on board PICARD

    Science.gov (United States)

    Zhu, P.; Ruymbeke, M. V.; Meftah, M.; Clette, F.; Dewitte, S.; Chevalier, A.; van Ruymbeke, F.; Noel, J.

    2010-12-01

    The PICARD is a French CNES micro-satellite mission which was successfully launched on June 15, 2010 by the Russian DNEPR launcher. Its objectives are the study of the origin of the solar variability and the relations between the Sun and the Earth’s climate. The duration of the mission is about two years with possibility to extend to three or more years. SOVAP/BOS (SOlar Variability for Picard - Bolometer Oscillation System) is one of the key instruments in the PICARD payload. The main goal of SOVAP/BOS consists in measuring the TSI (Total Solar Irradiance) with very high precision. SOVAP is a new improved version of the DIARAD absolute solar radiometer, which has been successfully installed and operated on several previous missions designed by the Royal Meteorological Institute of Belgium. BOS is a pioneering experiment or to say, a complementary part of SOVAP. It consists of a solar bolometer that measures the incident electromagnetic radiation power by converting this radiation energy in a thermal signal. The radiation is measured using a differential thermometer placed in a thermal shunt. By design, this bolometer is able to measure radiation integrated over all wavelengths and provide a broad dynamic range, with high precision and combined with a fast measuring cadence of 10s, instead of typ. 2-3 minutes in earlier TSI (total solar irradiance) measurements. We will show the preliminary results of measurements made by BOS. For instance, the solar eclipse records during 11, July 2010.

  12. Polycyclic aromatic hydrocarbon degradation by the white rot fungus Bjerkandera sp. strain BOS55.

    NARCIS (Netherlands)

    Kotterman, M.J.J.

    1998-01-01

    Outline of this thesisIn this thesis the conditions for optimal PAH oxidation by the white rot fungus Bjerkandera sp. strain BOS55 were evaluated. In Chapter 2, culture conditions like aeration and cosubstrate concentrations, which influenced the oxidation of the PAH compound anthra

  13. NEW YOUNG STAR CANDIDATES IN THE TAURUS-AURIGA REGION AS SELECTED FROM THE WIDE-FIELD INFRARED SURVEY EXPLORER

    International Nuclear Information System (INIS)

    The Taurus Molecular Cloud subtends a large solid angle on the sky, in excess of 250 deg2. The search for legitimate Taurus members to date has been limited by sky coverage as well as the challenge of distinguishing members from field interlopers. The Wide-field Infrared Survey Explorer has recently observed the entire sky, and we take advantage of the opportunity to search for young stellar object (YSO) candidate Taurus members from a ∼260 deg2 region designed to encompass previously identified Taurus members. We use near- and mid-infrared colors to select objects with apparent infrared excesses and incorporate other catalogs of ancillary data to present a list of rediscovered Taurus YSOs with infrared excesses (taken to be due to circumstellar disks), a list of rejected YSO candidates (largely galaxies), and a list of 94 surviving candidate new YSO-like Taurus members. There is likely to be contamination lingering in this candidate list, and follow-up spectra are warranted.

  14. Genetics Home Reference: autosomal dominant partial epilepsy with auditory features

    Science.gov (United States)

    ... Genetics Home Health Conditions ADPEAF autosomal dominant partial epilepsy with auditory features Enable Javascript to view the ... Accessibility FOIA Viewers & Players U.S. Department of Health & Human Services National Institutes of Health National Library of ...

  15. Spectrum of Autosomal Recessive Congenital Ichthyosis in Scandinavia

    DEFF Research Database (Denmark)

    Hellström Pigg, Maritta; Bygum, Anette; Gånemo, Agneta; Virtanen, Marie; Brandrup, Flemming; Zimmer, Andreas D; Hotz, Alrun; Vahlquist, Anders; Fischer, Judith

    2016-01-01

    Autosomal recessive congenital ichthyosis (ARCI) represents a heterogeneous group of rare disorders of cornification with 3 major subtypes: harlequin ichthyosis (HI), lamellar ichthyosis (LI) and congenital ichthyosiform erythroderma (CIE). A 4th subtype has also been proposed: pleomorphic...

  16. X Chromosome and Autosome Dosage Responses in Drosophila melanogaster Heads.

    Science.gov (United States)

    Chen, Zhen-Xia; Oliver, Brian

    2015-06-01

    X chromosome dosage compensation is required for male viability in Drosophila. Dosage compensation relative to autosomes is two-fold, but this is likely to be due to a combination of homeostatic gene-by-gene regulation and chromosome-wide regulation. We have baseline values for gene-by-gene dosage compensation on autosomes, but not for the X chromosome. Given the evolutionary history of sex chromosomes, these baseline values could differ. We used a series of deficiencies on the X and autosomes, along with mutations in the sex-determination gene transformer-2, to carefully measure the sex-independent X-chromosome response to gene dosage in adult heads by RNA sequencing. We observed modest and indistinguishable dosage compensation for both X chromosome and autosome genes, suggesting that the X chromosome is neither inherently more robust nor sensitive to dosage change. PMID:25850426

  17. Evaluation of Nephrolithiasis in Autosomal Dominant Polycystic Kidney Disease Patients

    OpenAIRE

    Nishiura, José L.; Neves, Rodrigo F.C.A.; Eloi, Samara R.M.; Cintra, Susan M.L.F.; Ajzen, Sergio A.; Heilberg, Ita P.

    2009-01-01

    Background and objectives: Nephrolithiasis (LIT) is more prevalent in patients with autosomal dominant polycystic kidney disease (ADPKD) than in the general population. Renal ultrasonography may underdetect renal stones because of difficulties imposed by parenchymal and/or cyst wall calcifications.

  18. TAURUS observations of the emission-line velocity field of Centaurus A (NGC 5128)

    International Nuclear Information System (INIS)

    Using TAURUS - an Imaging Fabry Perot system in conjunction with the IPCS on the AAT, the authors have studied the velocity field of the Hα emission line at a spatial resolution of 1.7'' over the dark lane structure of Centaurus A. The derived velocity field is quite symmetrical and strongly suggests that the emission line material is orbiting the elliptical component, as a warped disc. (orig.)

  19. SUB-STELLAR COMPANIONS AND STELLAR MULTIPLICITY IN THE TAURUS STAR-FORMING REGION

    Energy Technology Data Exchange (ETDEWEB)

    Daemgen, Sebastian [Department of Astronomy and Astrophysics, University of Toronto, 50 St. George Street, Toronto, ON M5H 3H4 (Canada); Bonavita, Mariangela [The University of Edinburgh, Royal Observatory, Blackford Hill, Edinburgh EH9 3HJ (United Kingdom); Jayawardhana, Ray [Physics and Astronomy, York University, Toronto, Ontario L3T 3R1 (Canada); Lafrenière, David [Department of Physics, University of Montréal, Montréal, QC (Canada); Janson, Markus, E-mail: daemgen@astro.utoronto.ca [Department of Astronomy, Stockholm University, Stockholm (Sweden)

    2015-02-01

    We present results from a large, high-spatial-resolution near-infrared imaging search for stellar and sub-stellar companions in the Taurus-Auriga star-forming region. The sample covers 64 stars with masses between those of the most massive Taurus members at ∼3 M {sub ☉} and low-mass stars at ∼0.2 M {sub ☉}. We detected 74 companion candidates, 34 of these reported for the first time. Twenty-five companions are likely physically bound, partly confirmed by follow-up observations. Four candidate companions are likely unrelated field stars. Assuming physical association with their host star, estimated companion masses are as low as ∼2 M {sub Jup}. The inferred multiplicity frequency within our sensitivity limits between ∼10-1500 AU is 26.3{sub −4.9}{sup +6.6}%. Applying a completeness correction, 62% ± 14% of all Taurus stars between 0.7 and 1.4 M {sub ☉} appear to be multiple. Higher order multiples were found in 1.8{sub −1.5}{sup +4.2}% of the cases, in agreement with previous observations of the field. We estimate a sub-stellar companion frequency of ∼3.5%-8.8% within our sensitivity limits from the discovery of two likely bound and three other tentative very low-mass companions. This frequency appears to be in agreement with what is expected from the tail of the stellar companion mass ratio distribution, suggesting that stellar and brown dwarf companions share the same dominant formation mechanism. Further, we find evidence for possible evolution of binary parameters between two identified sub-populations in Taurus with ages of ∼2 Myr and ∼20 Myr, respectively.

  20. Mutations in PDGFRB Cause Autosomal-Dominant Infantile Myofibromatosis

    OpenAIRE

    Martignetti, John A.; Tian, Lifeng; Li, Dong; Ramirez, Maria Celeste M.; Camacho-Vanegas, Olga; Camacho, Sandra Catalina; Guo, Yiran; Zand, Dina J.; Bernstein, Audrey M.; Masur, Sandra K.; Kim, Cecilia E.; Otieno, Frederick G.; Hou, Cuiping; Abdel-Magid, Nada; Tweddale, Ben

    2013-01-01

    Infantile myofibromatosis (IM) is a disorder of mesenchymal proliferation characterized by the development of nonmetastasizing tumors in the skin, muscle, bone, and viscera. Occurrence within families across multiple generations is suggestive of an autosomal-dominant (AD) inheritance pattern, but autosomal-recessive (AR) modes of inheritance have also been proposed. We performed whole-exome sequencing (WES) in members of nine unrelated families clinically diagnosed with AD IM to identify the ...

  1. Large-Scale Distribution of Herbig-Haro Objects in Taurus

    Institute of Scientific and Technical Information of China (English)

    Ke-Feng Sun; Ji Yang; Shao-Guang Luo; Min Wang; Li-Cai Deng; Xu Zhou; Jian-Sheng Chen

    2003-01-01

    We report our new results on Herbig-Haro (HH) objects in the star forming region of Taurus from a wide-field survey with the 60/90 cm Schmidt telescope of the Beijing Astronomical Observatory. This survey using CCD imaging with a narrow band [SⅡ] filter and an intermediate band [BATC10] filter covered approximately 30 square degrees in Taurus. Besides confirming the known HH Objects in the region, we discovered seven new HH candidates, and groups. Six of these are HH 701A-B, HH 702A-D, HH 703, HH 704A-D, HH 705, HH 706 and the seventh is a group, a new component of HH 319, labeled HH 319B-D. Based on the large-scale distribution of pre-main-sequence (PMS) stars in Taurus, we analyze statistically the most probable distance from the HH objects to each PMS star,from which we estimate the typical timescale of these HH objects to be between(1.3 - 2.0) × 104 yrs; and we also obtain the birth rates of HH objects: 0.447±0.198 for Class Ⅰ PMS stars, 0.360±0.222 for Class Ⅱ PMS stars, and -0.148±0.234 for Class Ⅲ PMS stars.

  2. VizieR Online Data Catalog: New young star candidates in Taurus-Auriga (Rebull+, 2011)

    Science.gov (United States)

    Rebull, L. M.; Koenig, X. P.; Padgett, D. L.; Terebey, S.; McGehee, P. M.; Hillenbrand, L. A.; Knapp, G. R.; Leisawitz, D.; Liu, W.; Noriega-Crespo, A.; Ressler, M. E.; Stapelfeldt, K. R.; Fajardo-Acosta, S.; Mainzer, A.

    2011-11-01

    In the context of Rebull et al. (2010ApJS..186..259R), we assembled a substantial multi-wavelength database, spanning Sloan u through Spitzer/MIPS 160um (with some X-rays) for point sources throughout the Taurus region. We use that catalog as the core for our analysis here, updating it with confirmed Taurus members from, e.g., Kenyon et al. (2008hsf1.book..405K) and Luhman et al. (2010ApJS..186..111L) outside of our original Spitzer map. We have also searched SIMBAD (and literature references therein) for known galaxies and other contaminants in this vicinity. Our Taurus Spitzer Survey spanned ~44deg2 (figure 1). WISE data acquisition and reduction are discussed in Wright et al. (2010AJ....140.1868W), Jarrett et al. (2011, ApJ, submitted), and in the Explanatory Supplement to the WISE Preliminary Data Release Products. There are four WISE bands, with central wavelengths at 3.4, 4.6, 12, and 22um, and a spatial resolution of 6" (12" at 22um). (3 data files).

  3. The Gould Belt Very Large Array Survey IV: The Taurus-Auriga complex

    CERN Document Server

    Dzib, Sergio A; Rodríguez, Luis F; Mioduszewski, Amy J; Ortiz-León, Gisela N; Kounkel, Marina A; Pech, Gerardo; Rivera, Juana L; Torres, Rosa M; Boden, Andrew F; Hartmann, Lee; Evans, Neal J; Briceño, Cesar; Tobin, John

    2014-01-01

    We present a multi-epoch radio study of the Taurus-Auriga star-forming complex made with the Karl G. Jansky Very Large Array at frequencies of 4.5 GHz and 7.5 GHz. We detect a total of 610 sources, 59 of which are related to young stellar objects and 18 to field stars. The properties of 56\\% of the young stars are compatible with non-thermal radio emission. We also show that the radio emission of more evolved young stellar objects tends to be more non-thermal in origin and, in general, that their radio properties are compatible with those found in other star forming regions. By comparing our results with previously reported X-ray observations, we notice that young stellar objects in Taurus-Auriga follow a G\\"{u}del-Benz relation with $\\kappa$=0.03, as we previously suggested for other regions of star formation. In general, young stellar objects in Taurus-Auriga and in all the previous studied regions seem to follow this relation with a dispersion of $\\sim1$ dex. Finally, we propose that most of the remaining ...

  4. Measurement of density in axisymmetric jets using a novel background-oriented schlieren (BOS) technique

    Science.gov (United States)

    Tan, Dominic James; Edgington-Mitchell, Daniel; Honnery, Damon

    2015-11-01

    A novel application of the adaptive Fourier-Hankel (AFH) Abel algorithm to reconstruct the radial density distribution of axisymmetric jets is presented. The fluid is imaged using the non-intrusive path-integrated background-oriented schlieren (BOS) technique. BOS images are cross-correlated to obtain background displacements that are proportional to the first derivative of the refractive index. The critical step is deconvolving the projected displacements. The AFH method is applied to simulated displacement data to validate the use of averaged turbulent fluctuations that approximate an axisymmetric field. The influence of experimental noise and variations in the flow on the accuracy of the method is discussed. The limitations of the system are demonstrated by applying it to low- and high-Reynolds ( Re) number jets. The high- Re jets are produced from a high-pressure fuel injector operating at nozzle pressure ratios of 2, 3, and 4.

  5. Recent Status of Banteng (Bos javanicus Conservation in East Java and Its Perspectives on Ecotourism Planning

    Directory of Open Access Journals (Sweden)

    Luchman Hakim

    2015-09-01

    Full Text Available The aims of this article are to examine the recent status of Banteng Bos javanicus conservation in East Java, identify the roots of conservation problems and propose the non-consumptive and sustainable uses of Banteng by implementing ecotourism. Recently, Banteng population distributes in Alas Purwo, Meru Betiri, and Baluran National Parks. The population in Alas Purwo and Meru Betiri were relatively stable yearly. Rapid population decrease found in Baluran National Park. The roots of threats may be categorized into two factors, socio-economic and ecological factors. Socio-economic problems lead to the increase of habitat disturbance, poaching, and illegal hunting. Ecological aspect was ranging from invasion of exotic plant species, competitors, predators, drought, forest fire and vegetation changes. Lack of habitat management also recognized as an important factor to drive Bos javanicus decline and extinction. Ecotourism in the national park may become one of the significant and effective stimuli to support Banteng conservation.

  6. Length and Straightness of the Tubes for the BOS Prototype Chamber

    CERN Document Server

    Lagouri, T

    1998-01-01

    We have measured length and straightness of 50 tubes of 3.8~m length, after cleaning, wiring and testing from a batch that was used in the construction of the BOS prototype chamber. The specifi ed length (aluminum tube only, without endplug) was 3800~mm with a tolerance of $\\pm$1~mm. We found a mean value of (3805$\\pm$2)~mm with a standard deviation of (0.3$\\pm$0.1)~mm. The measureme nts of the straightness of the 50 BOS MDT tubes gave a mean of the maximum deviation of 150~$\\mu$m for 10 measured points along the tubes at 0$^{\\circ}$, 90$^{\\circ}$, 180$^{\\circ}$ and 270$^{\\circ }$ around the tube diameter and a mean value of all deviations of 20~$\\mu$m with a measuring accuracy of 10~$\\mu$m.

  7. Bosreservaat Bos Ter Rijst (Heikruis): basisrapport:situering, standplaats, historiek en onderzoek

    OpenAIRE

    Baeté, Hans; Christiaens, Bart; De Keersmaeker, Luc; Esprit, Marc; Van de Kerckhove, Peter; Vandekerkhove, Kris; Walleyn, Ruben

    2006-01-01

    This report is a reference report linked to the monitoring of forest reserve Bos Ter Rijst in Heikruis/Hautecroix near Edingen/Enghien in central Belgium (bilingual region across a linguistic, regional and provincial frontier). It covers various topics:administrative situation and protective status of the reserveits location, soil characteristics and habitatshistorical ecology of the seignory Ter Rijst/Risoir, Ter Rijst/Risoir Wood and the Strijdhout/Strihoux Forestthe reserve's management hi...

  8. Magnetic Resonance Imaging of the Normal Stifle Joint in Buffaloes (Bos Bubalis): An Anatomic Study

    OpenAIRE

    Moustafa Samy Sherif; Mohammed Attia; Hatem Bahgaat; Ahmed Kassab

    2014-01-01

    The aim of the present study was to describe the normal anatomy of the stifle joint in buffaloes (Bos bubalis) on magnetic resonance images and related anatomical sectional slices to facilitate the interpretation of all these images, as well as to understand the basis for diseases diagnosis. The hind limbs of ten healthy adult buffaloes (Twenty stifle joints) were used. After slaughtering, MR images were made in sagittal, transverse, and dorsal planes. The limbs then were frozen at -20° then ...

  9. Collection, analysis and cryopreservation of semen from Malayan gaur (Bos gaurus hubbacki): A preliminary study

    OpenAIRE

    M.S. Khairiah; I. Zawawi; H. Wahid; Hajarian, H.; Fahrul, F.J.; M.D. Hafiz; Hafiz, M.M.; Z.F. Ann; M.I. Iswadi; O.A. Mazni

    2012-01-01

    The Malayan gaur (Bos gaurus hubbacki) or Seladang is classified as vulnerable by the International Union for Conservation of Nature and Natural Resources (IUCN). The Malayan gaur is mainly distributed in the tropical woodlands of Peninsular Malaysia and Southern Thailand. The aim of this study was to collect, analyze and cryopreserve the semen of wild Malayan gaur. Transrectal massage (TM) and electroejaculation (EEJ) technique was applied in semen collection of the Malayan gaur. The semen w...

  10. A high dynamic radiation measurements instrument: the Bolometric Oscillation Sensor (BOS)

    OpenAIRE

    Zhu, P.; Ruymbeke, M. Van; Ö. Karatekin; J.-P. Noël; Thuillier, G.; S. Dewitte; Chevalier, A.; C. Conscience; Janssen, E.; M. Meftah; Irbah, A.

    2014-01-01

    The bolometric oscillation sensor (BOS) is a broadband radiation measurement instrument onboard the PICARD satellite that has been active between 2010 and 2014. The main detector is a thermistor attached black coated surface, which was permanently exposed to space without any optical and aperture accessories. The temperature measurements are used within a transfer function to determine variations in incoming solar irradiance as well as the terrestrial radi...

  11. A high dynamic radiation measurements instrument : the Bolometric Oscillation Sensor (BOS)

    OpenAIRE

    Zhu, P.; Ruymbeke, M. Van; Karatekin, Ö.; Noël, J.-P.; Thuillier, G.; S. Dewitte; Chevalier, A.; C. Conscience; Janssen, E.; M. Meftah; Irbah, A.

    2015-01-01

    The Bolometric Oscillation Sensor (BOS) is a broadband radiation measurement instrument onboard the PICARD satellite that was active between 2010 and 2014. The main detector is a thermistor attached black coated surface, which was permanently exposed to space without any optical and aperture accessories. The temperature measurements are used within a transfer function to determine variations in incoming solar irradiance as well as the terrestrial radiation. In the present ar...

  12. Polycyclic aromatic hydrocarbon degradation by the white rot fungus Bjerkandera sp. strain BOS55.

    OpenAIRE

    Kotterman, M.J.J.

    1998-01-01

    Outline of this thesisIn this thesis the conditions for optimal PAH oxidation by the white rot fungus Bjerkandera sp. strain BOS55 were evaluated. In Chapter 2, culture conditions like aeration and cosubstrate concentrations, which influenced the oxidation of the PAH compound anthracene and the ligninolytic indicator dye Poly R-478 by the white rot fungus, were studied. Two parameters were identified as the most important PAH oxidation rate-limiting factors: the hydrogen peroxide production r...

  13. Application of background-oriented schlieren (BOS) technique to a laser-induced underwater shock wave

    CERN Document Server

    Yamamoto, Shota; Kameda, Masaharu

    2015-01-01

    We build an ultra-high-speed imaging system based on the background-oriented schlieren (BOS) technique in order to capture a laser-induced underwater shock wave. This BOS technique is able to provide two-dimensional density-gradient field of fluid and requires a simple setup. The imaging system consists of an ultra-high speed video camera, a laser stroboscope, and a patterned background. This system takes images every 0.2 $\\mu$s. Furthermore, since the density change of water disturbed by the shock is exceedingly small, the system has high spatial resolution $\\sim$ 10 $\\mu$m/pixel. Using this BOS system, we examine temporal position of a shock wave. The position agrees well with that measured by conventional shadowgraph, which indicates that the high-speed imaging system can successfully capture the instantaneous position of the underwater shock wave that propagates with the speed of about 1500 m/s. The local density gradient can be determined up to $O$(10$^3$ kg/m$^4$), which is confirmed by the gradient est...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-0585 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0585 ref|NP_001071387.1| hypothetical protein LOC514131 [Bos taurus] r...ef|XP_001254537.1| PREDICTED: hypothetical protein LOC514131 [Bos taurus] dbj|BAF36506.1| p97Bucentaur-2 [Bos tau...rus] gb|AAI49203.1| P97Bucentaur-2 [Bos taurus] NP_001071387.1 4e-12 32% ...

  15. Highly Ordered Structure Formation in RAFT-Synthesized PtBOS-b-P4VP Diblock Copolymers.

    Science.gov (United States)

    Faber, Martin; Hofman, Anton H; Loos, Katja; Brinke, Gerrit Ten

    2016-06-01

    Linear poly(4-tert-butoxystyrene)-b-poly(4-vinylpyridine) (PtBOS-b-P4VP) diblock copolymers are synthesized using reversible addition-fragmentation chain transfer polymerization. The self-assembly of four different PtBOS-b-P4VP diblock copolymers is studied using small-angle X-ray scattering and transmission electron microscopy and a number of interesting observations are made. A tBOS62 -b-4VP28 diblock copolymer with a weight fraction P4VP of 0.21 shows a disordered morphology of P4VP spheres with liquid-like short-range order despite an estimated value of χN of the order of 50. Increasing the length of the 4VP block to tBOS62 -b-4VP199 results in a diblock copolymer with a weight fraction P4VP of 0.66. It forms a remarkably well-ordered lamellar structure. Likewise, a tBOS146 -b-4VP120 diblock copolymer with a weight fraction P4VP of 0.33 forms an extremely well-ordered hexagonal structure of P4VP cylinders. Increasing the P4VP block of this block copolymer to tBOS146 -b-4VP190 with a weight fraction P4VP of 0.44 results in a bicontinuous gyroid morphology despite the estimated strong segregation of χN≅150. These results are discussed in terms of the architectural dissimilarity of the two monomers, characterized by the presence of the large side group of PtBOS, and the previously reported value of the interaction parameter, χ≅0.39, for this polymer pair. PMID:27079547

  16. NCBI nr-aa BLAST: CBRC-FCAT-01-0063 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-0063 ref|NP_001015581.1| chemokine binding protein 2 [Bos taurus] gb|A...AX46341.1| chemokine binding protein 2 [Bos taurus] gb|AAX46675.1| chemokine binding protein 2 [Bos taurus] NP_001015581.1 2e-49 86% ...

  17. NCBI nr-aa BLAST: CBRC-OANA-01-0052 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-0052 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-113 62% ...

  18. NCBI nr-aa BLAST: CBRC-CFAM-37-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-37-0004 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-173 82% ...

  19. NCBI nr-aa BLAST: CBRC-HSAP-03-0018 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-03-0018 ref|NP_001015581.1| chemokine binding protein 2 [Bos taurus] gb|A...AX46341.1| chemokine binding protein 2 [Bos taurus] gb|AAX46675.1| chemokine binding protein 2 [Bos taurus] NP_001015581.1 1e-169 79% ...

  20. NCBI nr-aa BLAST: CBRC-MMUS-01-0025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-01-0025 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-145 71% ...

  1. NCBI nr-aa BLAST: CBRC-MDOM-07-0080 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-07-0080 ref|NP_001094755.1| interleukin 8 receptor beta [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-148 71% ...

  2. NCBI nr-aa BLAST: CBRC-MMUR-01-0053 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0053 ref|NP_001094755.1| interleukin 8 receptor beta [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 6e-33 72% ...

  3. NCBI nr-aa BLAST: CBRC-OCUN-01-1390 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-1390 ref|NP_001015581.1| chemokine binding protein 2 [Bos taurus] gb|A...AX46341.1| chemokine binding protein 2 [Bos taurus] gb|AAX46675.1| chemokine binding protein 2 [Bos taurus] NP_001015581.1 6e-88 76% ...

  4. NCBI nr-aa BLAST: CBRC-PCAP-01-1467 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1467 ref|NP_001069804.1| solute carrier family 16, member 7 [Bos tauru...s] gb|ABD39318.1| monocarboxylate transporter 2 [Bos taurus] gb|AAI40525.1| SLC16A7 protein [Bos taurus] NP_001069804.1 1e-117 81% ...

  5. NCBI nr-aa BLAST: CBRC-ETEL-01-1472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-1472 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-121 76% ...

  6. NCBI nr-aa BLAST: CBRC-MEUG-01-2178 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2178 ref|NP_001071415.1| G protein-coupled receptor 77 [Bos taurus] gb...|AAI23494.1| G protein-coupled receptor 77 [Bos taurus] gb|ABI98946.1| C5L2 [Bos taurus] NP_001071415.1 1e-61 57% ...

  7. NCBI nr-aa BLAST: CBRC-TSYR-01-1334 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1334 ref|NP_001069804.1| solute carrier family 16, member 7 [Bos tauru...s] gb|ABD39318.1| monocarboxylate transporter 2 [Bos taurus] gb|AAI40525.1| SLC16A7 protein [Bos taurus] NP_001069804.1 1e-134 79% ...

  8. NCBI nr-aa BLAST: CBRC-ACAR-01-0816 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0816 ref|NP_001069804.1| solute carrier family 16, member 7 [Bos tauru...s] gb|ABD39318.1| monocarboxylate transporter 2 [Bos taurus] gb|AAI40525.1| SLC16A7 protein [Bos taurus] NP_001069804.1 1e-125 79% ...

  9. NCBI nr-aa BLAST: CBRC-ACAR-01-0732 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0732 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-113 59% ...

  10. NCBI nr-aa BLAST: CBRC-MLUC-01-0338 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0338 ref|NP_001071415.1| G protein-coupled receptor 77 [Bos taurus] gb...|AAI23494.1| G protein-coupled receptor 77 [Bos taurus] gb|ABI98946.1| C5L2 [Bos taurus] NP_001071415.1 1e-124 68% ...

  11. NCBI nr-aa BLAST: CBRC-MEUG-01-2252 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2252 ref|NP_001094755.1| interleukin 8 receptor beta [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 4e-70 71% ...

  12. Sensibilidade da PCR na amplificação do DNA bovino em diluição seriada e mistura de amostra macho e fêmea

    OpenAIRE

    A.S. Cruz; D.C. Silva; E.O.A. Costa; D.M. Silva; D.A. Abreu; Cruz, A D

    2011-01-01

    A mixture of bovine DNA from a male and a female Jersey (Bos taurus taurus) bred in different proportions was used to determine the sensitivity of PCR to amplify and discriminate the bovine DNA samples. Samples were obtained from the peripheral blood of a bull and a heifer and DNA was isolated using a commercial kit for extraction and purification of nucleic acids. Two primers sets were designed to flank genomic regions: one autosomal and one Y-specific. DNA samples were diluted in water to a...

  13. X-ray deficiency on strongly accreting T Tauri stars. Comparing Orion with Taurus

    Science.gov (United States)

    Bustamante, I.; Merín, B.; Bouy, H.; Manara, C. F.; Ribas, Á.; Riviere-Marichalar, P.

    2016-03-01

    Context. Depending on whether a T Tauri star accretes material from its circumstellar disk or not, different X-ray emission properties can be found. The accretion shocks produce cool heating of the plasma, contributing to the soft X-ray emission from the star. Aims: Using X-ray data from the Chandra Orion Ultra-deep Project and accretion rates that were obtained with the Hubble Space Telescope/WFPC2 photometric measurements in the Orion Nebula Cluster (ONC), we studied the relation between the accretion processes and the X-ray emissions of a coherent sample of T Tauri sources in the region. Methods: We performed regression and correlation analyses of our sample of T Tauri stars between the X-ray parameters, stellar properties, and the accretion measurements. Results: We find that a clear anti-correlation is present between the residual X-ray luminosity and the accretion rates in our samples in Orion that is consistent with that found on the XMM-Newton Extended Survey of the Taurus molecular cloud (XEST) study. A considerable number of classified non-accreting sources show accretion rates comparable to those of classical T Tauri Stars (CTTS). Our data do not allow us to confirm the classification between classical and weak-line T Tauri stars (WTTS), and the number of WTTS in this work is small compared to the complete samples. Thus, we have used the entire samples as accretors in our analysis. We provide a catalog with X-ray luminosities (corrected from distance) and accretion measurements of an ONC T Tauri stars sample. Conclusions: Although Orion and Taurus display strong differences in their properties (total gas and dust mass, star density, strong irradiation from massive stars), we find that a similar relation between the residual X-ray emission and accretion rate is present in the Taurus molecular cloud and in the accreting samples from the ONC. The spread in the data suggests dependencies of the accretion rates and the X-ray luminosities other than the

  14. Cambrian small shelly fossils from the Çal Tepe Formation, Taurus Mountains, Turkey

    OpenAIRE

    Sarmiento, Graciela N.; Fernández Remolar, David Carlos; Göncüoglu, M. Cemal

    2001-01-01

    [EN] Lower and Middle Cambrian carbonate rocks of the Çal Tepe Formation, cropping out in the western Taurus Mountains, yielded a large number of microfossil remains. Small shelly fossils from a single level in the upper Lower Cambrian represent a high diversity biota that could be related to the «Cambrian explosion». Microfossil association from the lower Middle Cambrian sediments of the Çal Tepe Formation is taxonomically very reduced and a dominant taxon is Hadimopanella GEDIK. Th...

  15. Cambrian small shelly fossils from the Çal Tepe Formation, Taurus Mountains, Turkey

    OpenAIRE

    Sarmiento, Graciela; Fernández Remolar, David Carlos; Göncüoglu, M. Cemal

    2001-01-01

    Lower and Middle Cambrian carbonate rocks of the Çal Tepe Formation, cropping out in the western Taurus Mountains, yielded a large number of microfossil remains. Small shelly fossils from a single level in the upper Lower Cambrian represent a high diversity biota that could be related to the «Cambrian explosion». Microfossil association from the lower Middle Cambrian sediments of the Çal Tepe Formation is taxonomically very reduced and a dominant taxon is Hadimopanella GEDIK. This sudden chan...

  16. Rotationally-supported disks around Class I sources in Taurus: disk formation constraints

    OpenAIRE

    Harsono, Daniel; Jorgensen, Jes K.; van Dishoeck, Ewine F.; Hogerheijde, Michiel R.; Bruderer, Simon; Persson, Magnus V.; Mottram, Joseph C.

    2014-01-01

    (Abridged) Disks are observed around pre-main sequence stars, but how and when they form is still heavily debated. While disks around young stellar objects have been identified through thermal dust emission, spatially and spectrally resolved molecular line observations are needed to determine their nature. We present subarcsecond observations of dust and gas toward four Class I low-mass young stellar objects in Taurus. The 13CO and C18O J=2-1 transitions at 220 GHz were observed with the Plat...

  17. VLBA determination of the distance to nearby star-forming regions II. Hubble 4 and HDE 283572 in Taurus

    CERN Document Server

    Torres, Rosa M; Mioduszewski, Amy J; Rodriguez, Luis F

    2007-01-01

    The non-thermal 3.6 cm radio continuum emission from the naked T Tauri stars Hubble 4 and HDE 283572 in Taurus has been observed with the Very Long Baseline Array (VLBA) at 6 epochs between September 2004 and December 2005 with a typical separation between successive observations of 3 months. Thanks to the remarkably accurate astrometry delivered by the VLBA, the trajectory described by both stars on the plane of the sky could be traced very precisely, and modeled as the superposition of their trigonometric parallax and uniform proper motion. The best fits yield distances to Hubble 4 and HDE 283572 of 132.8 +/- 0.5 and 128.5 +/- 0.6 pc, respectively. Combining these results with the other two existing VLBI distance determinations in Taurus, we estimate the mean distance to the Taurus association to be 137 pc with a dispersion (most probably reflecting the depth of the complex) of about 20 pc.

  18. Alteración diurna de la carga calórica corporal e interrelación de las temperaturas rectal y láctea en vacas cruzadas (6/8 Bos taurus x 2/8 Bos indicus, Pardo Suizo y Holstein bajo estrés calórico diurno durante la época seca en el clima tropical húmedo - Daytime alteration of body heat load and relationship between rectal and milk temperatures in crossbred (6/8 Bos taurus x 2/8 Bos indicus, Brown Swiss and Holstein lactating cows under heat stress during summer time in the humid tropical climate

    Directory of Open Access Journals (Sweden)

    Araúz, E. E.

    2010-11-01

    Full Text Available ResumenLas temperaturas rectal y de la secreción láctea y la carga calóricacorporal fueron evaluadas en 191 vacas en lactación (cruzadas 6/8Pardo Suizo x 2/8 Cebú y 6/8 Holstein x 2/8 Cebú: 27; Pardo Suizo:131; y Holstein: 33; bajo estrés calórico diurno en la época secadistribuidas entre 45 y 1064 msnm; con el objetivo de establecer laalteración diurna y su interrelación según el grupo genético y el grado de sensibilidad calórica.SummaryRectal and milk temperatures were measured in the afternoon (2 PM to4 PM in 191 lactating dairy cows (6/8 Brown Swiss x 2/8 Zebu and 6/8Holstein x 2/8 Zebu: 27, Brown Swiss: 131 and Holstein: 33 underheat stress in the tropical environment to evaluate daytime alterationof body heat load and establish the relationship between rectal andmilk temperature.

  19. Black hair follicular dysplasia, an autosomal recessive condition in dogs.

    OpenAIRE

    Schmutz, S M; Moker, J S; Clark, E.G.; Shewfelt, R

    1998-01-01

    Using histology, a coat color abnormality and the subsequent hair loss were diagnosed as black hair follicular dysplasia. A pedigree analysis of an affected litter and literature review suggests that this is inherited as an autosomal recessive trait. The melanocyte stimulating hormone receptor gene is ruled out by using linkage analysis.

  20. Autosomal recessive cerebellar ataxia with bull's-eye macular dystrophy.

    NARCIS (Netherlands)

    Cruysberg, J.R.M.; Eerola, K.U.; Vrijland, H.R.; Aandekerk, A.L.; Kremer, H.P.H.; Deutman, A.F.

    2002-01-01

    PURPOSE: In 1980, we published in the American Journal of Ophthalmology two siblings with hereditary ataxia and atrophic maculopathy. The report is cited in the literature as autosomal dominant cerebellar ataxia with retinal degeneration. The purpose of the present study is to document the progressi

  1. Molecular line study of the very young protostar IRAM 04191 in Taurus: infall, rotation, and outflow

    Science.gov (United States)

    Belloche, A.; André, P.; Despois, D.; Blinder, S.

    2002-10-01

    We present a detailed millimeter spectroscopic study of the circumstellar environment of the low-luminosity Class 0 protostar IRAM 04191+1522 in the Taurus molecular cloud. Molecular line observations with the IRAM 30 m telescope demonstrate that the ~ 14 000 AU radius protostellar envelope is undergoing both extended infall and fast, differential rotation. Radiative transfer modeling of multitransition CS and C34S maps indicate an infall velocity vinf ~0.15 km s-1 at r ~ 1500 AU and v_inf ~ 0.1 km s-1 up to r ~ 11 000 AU, as well as a rotational angular velocity Omega ~ 3.9 x 10-13 rad s-1, strongly decreasing with radius beyond 3500 AU down to a value Omega ~ 1.5-3x 10-14 rad s-1 at ~ 11 000 AU. Two distinct regions, which differ in both their infall and their rotation properties, therefore seem to stand out: the inner part of the envelope (r lower .5excentral star is being built. Comparison with the rotational properties of other objects in Taurus suggests that IRAM 04191 is at a pivotal stage between a prestellar regime of constant angular velocity enforced by magnetic braking and a dynamical, protostellar regime of nearly conserved angular momentum. The rotation velocity profile we derive for the inner IRAM 04191 envelope should thus set some constraints on the distribution of angular momentum on the scale of the outer Solar system at the onset of protostar/disk formation.

  2. Isolation and partial purification of antimicrobial peptides/proteins from dung beetle, Onthophagus taurus immune hemolymph

    International Nuclear Information System (INIS)

    Antimicrobial peptides are important in the first line of the host defense system of all insect species. In the present study antimicrobial peptide(s) were isolated from the hemolymph of the dung beetle Onthophagus taurus. Both non induced and immune induced hemolymphs were tested for their antimicrobial activity against different bacterial strains and C. albicans. Induction was done by injecting E. coli into the abdominal cavity of the O. taurus. The non induced hemolymph did not show activity against any of the tested fungal and bacterial strains where as induced hemolymph showed activity against all tested bacterial strains but no activity against C. albicans. The induced hemolymph was subjected to non reducing SDS-PAGE and UV wavelength scan was performed to detect the presence of peptides. The immune induced hemolymph was purified by gel filtration chromatography to separate the proteins responsible for the antibacterial activity. The fractions within the peak were tested against those bacteria which previously showed sensitivity to the crude immune induced hemolymph. All fractions were found to be active against all tested bacteria with difference in zone of inhibition. The peptides are active against prokaryotes and not against eukaryotes. These properties reveal its unique characteristics and therapeutic application. (author)

  3. Striations in the Taurus molecular cloud: Kelvin-Helmholtz instability or MHD waves?

    CERN Document Server

    Heyer, M; Yildiz, U A; Snell, R L; Falgarone, E; Pineda, J

    2016-01-01

    The origin of striations aligned along the local magnetic field direction in the translucent envelope of the Taurus molecular cloud is examined with new observations of 12CO and 13CO J=2-1 emission obtained with the 10~m submillimeter telescope of the Arizona Radio Observatory. These data identify a periodic pattern of excess blue and redshifted emission that is responsible for the striations. For both 12CO and 13CO, spatial variations of the J=2-1 to J=1-0 line ratio are small and are not spatially correlated with the striation locations. A medium comprised of unresolved CO emitting substructures (cells) with a beam area filling factor less than unity at any velocity is required to explain the average line ratios and brightness temperatures. We propose that the striations result from the modulation of velocities and the beam filling factor of the cells as a result of either the Kelvin-Helmholtz instability or magnetosonic waves propagating through the envelope of the Taurus molecular cloud. Both processes ar...

  4. ISOLATION AND PARTIAL PURIFICATION OF ANTIMICROBIAL PEPTIDES/PROTEINS FROM DUNG BEETLE, ONTHOPHAGUS TAURUS IMMUNE HEMOLYMPH

    Directory of Open Access Journals (Sweden)

    Vasanth Patil H.B

    2013-06-01

    Full Text Available Antimicrobial peptides are important in the first line of the host defense system of all insect species. In the present study antimicrobial peptide(s were isolated from the hemolymph of the dung beetle Onthophagus taurus. Both non induced and immune induced hemolymphs were tested for their antimicrobial activity against different bacterial strains and C. albicans. Induction was done by injecting E. coli into the abdominal cavity of the O. taurus. The non induced hemolymph did not show activity against any of the tested fungal and bacterial strains where as induced hemolymph showed activity against all tested bacterial strains but no activity against C. albicans. The induced hemolymph was subjected to non reducing SDS-PAGE and UV wavelength scan was performed to detect the presence of peptides. The immune induced hemolymph was purified by gel filtration chromatography to separate the proteins responsible for the antibacterial activity. The fractions within the peak were tested against those bacteria which previously showed sensitivity to the crude immune induced hemolymph. All fractions were found to be active against all tested bacteria with difference in zone of inhibition. The peptides are active against prokaryotes & not against eukaryotes. These properties reveal its unique characteristics and therapeutic application.

  5. A Search for Companions to Brown Dwarfs in the Taurus and Chamaeleon Star Forming Regions

    CERN Document Server

    Todorov, K O; Konopacky, Q M; McLeod, K K; Apai, D; Ghez, A M; Pascucci, I; Robberto, M

    2014-01-01

    We present the results of a search for companions to young brown dwarfs in the Taurus and Chamaeleon I star forming regions (1/2-3 Myr). We have used WFPC2 on board HST to obtain F791W and F850LP images of 47 members of these regions that have spectral types of M6-L0 (0.01-0.1 Msun). An additional late-type member of Taurus, FU Tau (M7.25+M9.25), was also observed with adaptive optics at Keck Observatory. We have applied PSF subtraction to the primaries and have searched the resulting images for objects that have colors and magnitudes that are indicative of young low-mass objects. Through this process, we have identified promising candidate companions to 2MASS J04414489+2301513 (rho=0.105"/15 AU), 2MASS J04221332+1934392 (rho=0.05"/7 AU), and ISO 217 (rho=0.03"/5 AU). We reported the discovery of the first candidate in a previous study, showing that it has a similar proper motion as the primary through a comparison of astrometry measured with WFPC2 and Gemini adaptive optics. We have collected an additional e...

  6. Ultraviolet-Selected Field and Pre-Main-Sequence Stars Towards Taurus and Upper Scorpius

    CERN Document Server

    Findeisen, Krzysztof

    2010-01-01

    We have carried out a Galaxy Evolution Explorer (GALEX) Cycle 1 guest investigator program covering 56 square degrees near the Taurus T association and 12 square degrees along the northern edge of the Upper Scorpius OB association. We combined photometry in the GALEX FUV and NUV bands with data from the Two Micron All Sky Survey to identify candidate young (<100 Myr old) stars as those with an ultraviolet excess relative to older main sequence stars. Follow-up spectroscopy of a partial sample of these candidates suggest 5 new members of Taurus, with 8-20 expected from additional observations, and 5 new members of Upper Scorpius, with 3-6 expected from additional observations. These candidate new members appear to represent a distributed, non-clustered population in either region, although our sample statistics are as of yet too poor to constrain the nature or extent of this population. Rather, our study demonstrates the ability of GALEX observations to identify young stellar populations distributed over a ...

  7. The evolution of stars in the Taurus-Auriga T association

    CERN Document Server

    Bertout, C; Cabrit, S

    2007-01-01

    In a recent study, individual parallaxes were determined for many stars of the Taurus-Auriga T association that are members of the same moving group. We use these new parallaxes to re-address the issue of the relationship between classical T Tauri stars (CTTSs) and weak-emission line T Tauri stars (WTTSs). With the available spectroscopic and photometric information for 72 individual stars or stellar systems among the Taurus-Auriga objects with known parallaxes, we derived reliable photospheric luminosities, mainly from the Ic magnitude of these objects. We then studied the mass and age distributions of the stellar sample, using pre-main sequence evolutionary models to determine the basic properties of the stellar sample. Statistical tests and Monte Carlo simulations were then applied to studying the properties of the two T Tauri subclasses. We find that the probability of CTTS and WTTS samples being drawn from the same parental age and mass distributions is low; CTTSs are, on average, younger than WTTSs. The...

  8. VizieR Online Data Catalog: Outflows and bubbles in Taurus (Li+, 2015)

    Science.gov (United States)

    Li, H.; Li, D.; Qian, L.; Xu, D.; Goldsmith, P. F.; Noriega-Crespo, A.; Wu, Y.; Song, Y.; Nan, R.

    2015-11-01

    In our study, we used the 12CO(1-0) and 13CO(1-0 with the 13.7m FCRAO telescope. The FCRAO CO survey was taken between 2003 and 2005. The FWHM beam width is 45" for 12CO and 47" for 13CO. The MIPS maps were created as part of the final products from the Spitzer Legacy Taurus I and II surveys (Padgett et al. 2007AAS...211.1206P). The data were obtained in fast scan mode in three bands, 24, 70, and 160um, over an area of 44deg2. The observations were performed in three epochs between 2005 and 2007, with integration times of 30s (24um) and 15s (70 and 160um). We also adopted the up-to-date catalog of Spitzer YSOs where 215 YSOs and 140 new YSO candidates in Taurus are reported (Rebull et al. 2010, J/ApJS/186/259). (3 data files).

  9. Foot-and-mouth disease virus carrier status in Bos grunniens yaks

    OpenAIRE

    Chang, Huiyun; Ma, Yanbin; Lin, Tong; Cong, Guozheng; Du, Junzheng; Ma, Jinling

    2013-01-01

    Background The carrier status of foot-and-mouth disease virus (FMDV) is complicated, and the role of carrier animals in virus transmission is controversial. To investigate the carrier status of FMDV in animals that live in high altitude, Bos grunniens yaks were infected experimentally with FMDV O/Akesu/58. Results All of the yaks showed clinical signs of foot-and-mouth disease (FMD). Total antibody levels against FMDV measured by liquid-phase blocking enzyme-linked immunosorbent assay (LPB-EL...

  10. Genetics Home Reference: autosomal recessive spastic ataxia of Charlevoix-Saguenay

    Science.gov (United States)

    ... Genetics Home Health Conditions ARSACS autosomal recessive spastic ataxia of Charlevoix-Saguenay Enable Javascript to view the ... Open All Close All Description Autosomal recessive spastic ataxia of Charlevoix-Saguenay , more commonly known as ARSACS , ...

  11. Large-Scale Structure of the Molecular Gas in Taurus Revealed by High Spatial Dynamic Range Spectral Line Mapping

    Science.gov (United States)

    Goldsmith, Paul F.

    2008-01-01

    Viewgraph topics include: optical image of Taurus; dust extinction in IR has provided a new tool for probing cloud morphology; observations of the gas can contribute critical information on gas temperature, gas column density and distribution, mass, and kinematics; the Taurus molecular cloud complex; average spectra in each mask region; mas 2 data; dealing with mask 1 data; behavior of mask 1 pixels; distribution of CO column densities; conversion to H2 column density; variable CO/H2 ratio with values much less than 10(exp -4) at low N indicated by UV results; histogram of N(H2) distribution; H2 column density distribution in Taurus; cumulative distribution of mass and area; lower CO fractional abundance in mask 0 and 1 regions greatly increases mass determined in the analysis; masses determined with variable X(CO) and including diffuse regions agrees well with the found from L(CO); distribution of young stars as a function of molecular column density; star formation efficiency; star formation rate and gas depletion; and enlarged images of some of the regions with numerous young stars. Additional slides examine the origin of the Taurus molecular cloud, evolution from HI gas, kinematics as a clue to its origin, and its relationship to star formation.

  12. Susceptibility to trypanosomosis of three Bos indicus cattle breeds in areas of differing tsetse fly challenge.

    Science.gov (United States)

    Mwangi, E K; Stevenson, P; Gettinby, G; Reid, S W; Murray, M

    1998-09-01

    Studies to assess the differences in susceptibility to trypanosomosis among Bos indicus cattle breeds (Maasai Zebu, Orma Boran and Galana Boran) were conducted under conditions of varying tsetse fly challenge at the Nguruman escarpment in south-western Kenya, for a period of 1 year. It was found that under tsetse challenge quantified as high, Maasai Zebu and Orma Boran were less susceptible than Galana Boran to trypanosome infections, as judged by the significantly lower incidence of infection, development of less severe anaemia, fewer requirements for trypanocidal drug treatments, higher growth rates and fewer mortalities. In the area where tsetse challenge was considered low as a result of a tsetse fly control operation using odour-baited traps, only the Maasai Zebu and Orma Boran were compared. No significant differences in the incidence of infection, degree of anaemia or growth rates were observed between the two breeds, but all were significantly different from their counterparts in the high tsetse challenge area. These results suggest that there is variation in resistance to trypanosomosis among Bos indicus cattle breeds that could be exploited as part of the integrated trypanosomosis control programmes in East Africa. PMID:9777722

  13. Autosomal-dominant Alzheimer's disease: a review and proposal for the prevention of Alzheimer's disease

    OpenAIRE

    Bateman, R.J.; Aisen, P.S.; De Strooper, B.; Fox, N C; Lemere, C. A.; Ringman, J.M.; Salloway, S; Sperling, R. A.; Windisch, M.; Xiong, C.

    2011-01-01

    Autosomal-dominant Alzheimer's disease has provided significant understanding of the pathophysiology of Alzheimer's disease. The present review summarizes clinical, pathological, imaging, biochemical, and molecular studies of autosomal-dominant Alzheimer's disease, highlighting the similarities and differences between the dominantly inherited form of Alzheimer's disease and the more common sporadic form of Alzheimer's disease. Current developments in autosomal-dominant Alzheimer's disease are...

  14. Detecção imunoistoquímica de receptores de estrógeno e progesterona no endométrio de vacas Nelore (Bos taurus indicus durante o anestro pós-parto

    Directory of Open Access Journals (Sweden)

    R.S. Lima

    2011-08-01

    Full Text Available Foram utilizadas 24 vacas Nelore P.O., em anestro pós-parto, diagnosticado pelo histórico reprodutivo, por avaliações ultrassonográficas transretais e por dosagem de progesterona plasmática, que foram submetidas à colheita de fragmento uterino via transcervical. Os animais foram divididos em dois grupos conforme o máximo diâmetro folicular: grupo 1: folículos 6mm (n=12. Para avaliar receptor de estrógeno e receptor de progesterona no epitélio glandular e no estroma, foi utilizada a técnica de imunoistoquímica. Altas contagens relativas e alta intensidade de marcação para receptor de estrógeno e progesterona no epitélio glandular e no estroma foram observadas nos dois grupos. No entanto, a intensidade de marcação para o receptor de progesterona no epitélio glandular foi mais alta no grupo 2 comparado ao grupo 1. Quando o epitélio glandular e o estroma foram comparados, o número relativo de receptor de estrógeno no grupo 1 foi mais alto no epitélio glandular comparado ao estroma, e a intensidade de marcação para o receptor de progesterona no grupo 2 foi mais alta no epitélio glandular comparado ao estroma. Os resultados sugerem que os mecanismos que controlam a expressão de receptores no anestro são semelhantes aos observados durante o ciclo estral.

  15. Parámetros protéicos del plasma seminal y su relación con la calidad del semen en toros de la raza nelore (bos taurus indicus

    Directory of Open Access Journals (Sweden)

    Ana Sánchez

    2006-10-01

    Full Text Available El propósito de este estudio fue investigar la presenciae incidencia de bandas proteicas específicas delplasma seminal en toros Nelore, completa y parcialmente aptos para la actividad reproductiva. Se utilizaron 68 ejemplares; 20 de variedad Padrón y 48 Mochos, con edad media de 4 años. En el perímetro escrotal (35,05±0,49 cm e 33,30±0,39cm, índice de masa corpórea (302,62±5,87 e 284,19±5,15Kg|m2 hubo diferencia (p<0,05 entre las variedades Padrón y Mocho, respectivamente. Con respecto al peso corpóreo (627,70±11,37 e 611,58±8,66Kg; la altura (1,44±0,01e 1,47±0,01m; el volumen del eyaculado (5,82±0,48 e 5,17±0,29 mL, la motilidad espermática progresiva (73,50±2,81% e75,62±0,97%, el vigor espermático (4,30±0,19 e4,27±0,11 y motilidad en masa (4,27±0,11 e3,33±0,23 no se presentó diferencia (p>0,05. En morfología espermática, tampoco hubo desigualdad entre las variedades Padrón y Mocho, respectivamente con 5,06 ± 8,20% e 5,32 ± 6,40% de defectos mayores; 9,91±6,74% e 8,36±6,06% para los defectos menores; e 14,76±13,20% e 13,82±12,61% para los defectos totales. La electroforesis del plasma seminal reveló bandas proteicas con pesos entre 5 a 105 KDa. En el 100% de toros aptos para la reproducción, la proteína con pesos de 13 Kda estuvo presente. De la misma forma ocurrió con las bandas de 20 KDa. El resto de las bandas proteicas mostraron presencia con diferentes porcentajes de incidencia en toros aptos o parcialmente aptos para la actividad reproductiva. Las dos variedades estudiadas hicieron evidente la adaptación reproductiva eficaz en condiciones de clima semejantes.

  16. Tipos de fibras en el músculo esquelético del toro bravo (bos taurus ibericus) : su relación con la caída durante la lídia / 2001.

    OpenAIRE

    Martínez Gomariz, Francisco

    2001-01-01

    Tesis-Universidad de Murcia. Consulte la tesis en: BCA. GENERAL. ARCHIVO UNIVERSITARIO. T.M.-2275. Consulte la tesis en: BCA. GENERAL. Fac. Veterinaria. Departamentos. E002B TESIS 95. Consulte la tesis en: BCA. GENERAL. Fac. Veterinaria. Sala de estudio. Tesis-V 153.

  17. Análisis de los tipos de fibras musculares del toro bravo (Bos Taurus ibericus): su relación con algunas enzimas de fatiga muscular y el comportamiento durante la lidia

    OpenAIRE

    Ros Sempere, Juan

    2016-01-01

    Muestras de músculo esquelético y sangre fueron tomadas a 48 toros bravos (novillos) lidiados en la plaza de toros de Calasparra (Murcia). Los músculos seleccionados, cabeza larga del tríceps braquial y semitendinoso, fueron analizados desde el punto de vista histológico, con el fin de estudiar las características morfológicas e histoquímicas de los distintos tipos de miocitos y las posibles alteraciones consecuencia de la lidia. Las técnicas histoquímicas han posibilitado reconocer tres tipo...

  18. Análisis de los tipos de fibras musculares del toro bravo (Bos Taurus ibericus): su relación con algunas enzimas de fatiga muscular y el comportamiento durante la lidia

    OpenAIRE

    Ros Sempere, Juan

    2016-01-01

    Muestras de músculo esquelético y sangre fueron tomadas a 48 toros bravos (novillos) lidiados en la plaza de toros de Calasparra (Murcia). Los músculos seleccionados, cabeza larga del tríceps braquial y semitendinoso, fueron analizados desde el punto de vista histológico, con el fin de estudiar las características morfológicas e histoquímicas de los distintos tipos de miocitos y las posibles alteraciones consecuencia de la lidia. Las técnicas histoquímicas han posibilitado reconocer tres tip...

  19. Detecção imunoistoquímica de receptores de estrógeno e progesterona no endométrio de vacas Nelore (Bos taurus indicus) durante o anestro pós-parto

    OpenAIRE

    Lima, R S; I. Martin; W.C. Marques Filho; M.M.P. Rodrigues; R Laufer-Amorim; Ferreira, J.C.P.

    2011-01-01

    Foram utilizadas 24 vacas Nelore P.O., em anestro pós-parto, diagnosticado pelo histórico reprodutivo, por avaliações ultrassonográficas transretais e por dosagem de progesterona plasmática, que foram submetidas à colheita de fragmento uterino via transcervical. Os animais foram divididos em dois grupos conforme o máximo diâmetro folicular: grupo 1: folículos 6mm (n=12). Para avaliar receptor de estrógeno e receptor de progesterona no epitélio glandular e no estroma, foi utilizada a técnica d...

  20. Parámetros protéicos del plasma seminal y su relación con la calidad del semen en toros de la raza nelore (bos taurus indicus)

    OpenAIRE

    Ana Sánchez; Marcelo Mungai; Nelson Machado

    2006-01-01

    El propósito de este estudio fue investigar la presenciae incidencia de bandas proteicas específicas delplasma seminal en toros Nelore, completa y parcialmente aptos para la actividad reproductiva. Se utilizaron 68 ejemplares; 20 de variedad Padrón y 48 Mochos, con edad media de 4 años. En el perímetro escrotal (35,05±0,49 cm e 33,30±0,39cm), índice de masa corpórea (302,62±5,87 e 284,19±5,15Kg|m2 ) hubo diferencia (p<0,05) entre las variedades Padrón y Mocho, respectivamente. Con respecto...

  1. Gastrointestinal nematodes (Nematoda: Trichostrongyloidea) in cattle (Bos taurus), moose (Alces alces) and roe deer (Capreolus capreolus) in southern Norway. The effect of anthelmintic treatment in relation to a possible cross-infection.

    OpenAIRE

    2005-01-01

    The presence of gastrointestinal nematodes is considered to be a problem in domestic cattle, and various studies have tried to present reasons for and solutions to this problem. A study was conducted in Southern Norway in order to examine whether anthelmintic treatment in cattle is adequate and to investigate if wild cervids like moose and roe deer should be considered as a reservoir for nematode parasites in cattle. The results showed that egg output from cattle was low, which together with ...

  2. Determinación de las condiciones de crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del tracto intestinal de terneros (Bos taurus

    Directory of Open Access Journals (Sweden)

    José Ávila

    2010-07-01

    Full Text Available El objetivo de este estudio fue conocer el efecto de la temperatura, pH y la concentración de inóculo sobre el crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del intestino delgado de terneros. Para ello se utilizó en el primer caso, el método de superficie de respuesta para determinar las condiciones de pH y temperatura óptimas de la cepa, y en el segundo, un diseño experimental completamente aleatorizado considerando el factor concentración de inóculo inicial a seis niveles, donde el crecimiento (en medio De Man, Rogosa y Sharpe expresado en unidades de Absorbancia, constituyó la variable respuesta; presentándose una máxima respuesta (0,806 uA para 5 % de concentración inicial de inóculo. Los valores de pH y temperatura utilizados permitieron el establecimiento de una zona óptima de crecimiento in vitro en los siguientes intervalos, pH entre 5,1 y 5,6; y temperatura entre 38,0 y 41,5 °C, donde el máximo crecimiento se obtuvo a pH 5,31 y a 39,38 °C. Por otro lado se encontraron incrementos significativos del crecimiento in vitro (p < 0,05 a medida que se utiliza menor concentración de inóculo inicial. Con la información obtenida se espera incrementar los rendimientos de la cepa y así promover la producción de productos probióticos para el consumo animal en Venezuela.

  3. Determinación de las condiciones de crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del tracto intestinal de terneros (Bos taurus

    Directory of Open Access Journals (Sweden)

    José Ávila

    2010-06-01

    Full Text Available El objetivo de este estudio fue conocer el efecto de la temperatura, pH y la concentración de inóculo sobre el crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del intestino delgado de terneros. Para ello se utilizó en el primer caso, el método de superficie de respuesta para determinar las condiciones de pH y temperatura óptimas de la cepa, y en el segundo, un diseño experimental completamente aleatorizado considerando el factor concentración de inóculo inicial a seis niveles, donde el crecimiento (en medio De Man, Rogosa y Sharpe expresado en unidades de Absorbancia, constituyó la variable respuesta; presentándose una máxima respuesta (0,806 uA para 5 % de concentración inicial de inóculo. Los valores de pH y temperatura utilizados permitieron el establecimiento de una zona óptima de crecimiento in vitroen los siguientes intervalos, pH entre 5,1 y 5,6; y temperatura entre 38,0 y 41,5 °C, donde el máximo crecimiento se obtuvo a pH 5,31 y a 39,38 °C. Por otro lado se encontraron incrementos significativos del crecimiento in vitro (p < 0,05 a medida que se utiliza menor concentración de inóculo inicial. Con la información obtenida se espera incrementar los rendimientos de la cepa y así promover la producción de productos probióticos para el consumo animal en Venezuela.

  4. Autosomal dominant arteriopathy with sub cortical infarcts and leucoencephalopathy (CADASIL)

    International Nuclear Information System (INIS)

    Cerebral autosomal dominant arteriopathy with sub cortical infarcts and leucoencephalopathy (CASADIL) is a systemic hereditary, vascular disease that involves small arteries. Recurrent ischemia, pseudo bulbar paralysis and dementia are characteristic. Other manifestations include migraine and depression. We report an Argentine family with VI generations with evidence of disease in IV. MR examinations were performed on 21 family members (both symptomatic and asymptomatic). The main findings on MR on symptomatic and asymptomatic patients were small lesions with high signal on T2 localised in periventricular white matter, brain stem, basal ganglia and thalamus, and confluent patches on white matter although with high signal on T2 images, usually symmetric. In conclusion we can assess that diffuse myelin loss and small infarcts occurring in cerebral autosomal dominant arteriopathy with subcortical infarcts and leucoencephalopathy well demonstrated with MR. In addition, some of the abnormalities in pre symptomatic patients can be identified on MR images. (author)

  5. CT in autosomal dominant and idiopathic cerebellar ataxia

    International Nuclear Information System (INIS)

    Signs of atrophy on cranial CT were investigated in 35 patients diagnosed as suffering from autosomal dominant (n=21) or idiopathic (n=14) cerebellar ataxia. Thirteen patients with a pure cerebellar syndrome were examined after at least 4 years of disease (mean duration 10.5 years) and were classified as cerebellar atrophy (CA). Twenty-two patients with additional non-cerebellar signs were classified as olivo-ponto-cerebellar atrophy (OPCA). Four (30%) of the patients with CA had atrophy of the brain stem in addition. Of the 22 patients with OPCA, 9 (40%) had atrophy of the cerebellum only. In patients with CA or OPCA correlation of clinical signs with severity of atrophy on CT was poor. Atrophy on CT often fails to differentiate autosomal dominant or idiopathic cerebellar ataxias in CA or OPCA: Patients with CA can also have atrophy of the brain stem and patients with OPCA do not necessarily show brain stem atrophy. (orig.)

  6. Autosomal Dominant Hereditary Macrothrombocytopenia in an Iranian Family

    Directory of Open Access Journals (Sweden)

    M Isadiar

    2006-06-01

    Full Text Available Objective: Thrombocytopenia is the most common hemostatic disease of the newborn. Inherited giant platelet syndromes are a heterogeneous group of rare bleeding disorders. In this paper we describe here a female neonate with autosomal dominant hereditary macrothrombocytopenia. Case report: A female neonate was referred to our center due to mucosal hemorrhage (nasal and gastrointestinal bleeding. Her mother’s platelet count was normal. However her father, paternal uncle and two paternal aunts also had severe thrombocytopenia and all of them underwent splenectomy for idiopathic thrombocytopenic purpura (ITP. Considering all clinical and laboratory findings, autosomal dominant hereditary macrothrombocytopenia was the best diagnosis. Conclusion: It is important to differentiate between congenital and acquired thrombocytopenia to avoid unneeded and potentially harmful therapy. Treatment is not usually necessary, however some patients with hereditary thrombocytopenia may benefit from bone marrow transplantation.

  7. Caroli′s syndrome with autosomal recessive polycystic kidney disease

    Directory of Open Access Journals (Sweden)

    Prithi Shenoy

    2014-01-01

    Full Text Available Caroli′s syndrome (CS is a rare congenital disorder characterized by multiple segmental cystic or saccular dilatations of the intrahepatic bile ducts and congenital hepatic fibrosis. We report a 9-year-old boy who was diagnosed with CS and autosomal recessive poly-cystic kidney disease. On screening, his 5-month-old asymptomatic sister had multiple dilated biliary radicals with multiple bilateral renal cystic lesions. Both the patient and the affected sibling have been advised regular follow-up for monitoring the progression of the disease. In conclusion, patients with CS should be screened for renal cystic lesions and vice versa even if they are asymptomatic. Also, as the disease is inherited in an autosomal recessive manner, it is important to screen family members for early diagnosis and management.

  8. Caroli's syndrome with autosomal recessive polycystic kidney disease.

    Science.gov (United States)

    Shenoy, Prithi; Zaki, Syed Ahmed; Shanbag, Preeti; Bhongade, Swapnil

    2014-07-01

    Caroli's syndrome (CS) is a rare congenital disorder characterized by multiple segmental cystic or saccular dilatations of the intrahepatic bile ducts and congenital hepatic fibrosis. We report a 9-year-old boy who was diagnosed with CS and autosomal recessive poly-cystic kidney disease. On screening, his 5-month-old asymptomatic sister had multiple dilated biliary radicals with multiple bilateral renal cystic lesions. Both the patient and the affected sibling have been advised regular follow-up for monitoring the progression of the disease. In conclusion, patients with CS should be screened for renal cystic lesions and vice versa even if they are asymptomatic. Also, as the disease is inherited in an autosomal recessive manner, it is important to screen family members for early diagnosis and management. PMID:24969198

  9. Urine proteome of autosomal dominant polycystic kidney disease patients

    OpenAIRE

    Bakun, Magda; Niemczyk, Mariusz; Domanski, Dominik; Jazwiec, Radek; Perzanowska, Anna; Niemczyk, Stanislaw; Kistowski, Michal; Fabijanska, Agnieszka; Borowiec, Agnieszka; Paczek, Leszek; Dadlez, Michal

    2012-01-01

    Background Autosomal dominant polycystic kidney disease (ADPKD) is responsible for 10% of cases of the end stage renal disease. Early diagnosis, especially of potential fast progressors would be of benefit for efficient planning of therapy. Urine excreted proteome has become a promising field of the search for marker patterns of renal diseases including ADPKD. Up to now however, only the low molecular weight fraction of ADPKD proteomic fingerprint was studied. The aim of our study was to char...

  10. Phenotypic Variation of Autosomal-Dominant Corticobasal Degeneration

    OpenAIRE

    H. Jung, Hans; Bremer, Juliane; Streffer, Johannes; Virdee, Kanwar; Grazia Spillantini, Maria; Anthony Crowther, R.; Brugger, Peter; Van Broeckhoven, Christine; Aguzzi, Adriano; Tolnay, Markus

    2012-01-01

    Neurodegenerative tauopathies may be inherited as autosomal-dominant disorders with variable clinicopathological phenotypes, and causative mutations in the microtubule-associated protein tau (MAPT) gene are not regularly seen. Herein, we describe a patient with clinically typical and autopsy-proven corticobasal degeneration (CBD). Her mother was diagnosed to have Parkinson's disease, but autopsy showed CBD pathology as in the index patient. The sister of the index patient had the clinical sym...

  11. Vestibular function in families with inherited autosomal dominant hearing loss

    OpenAIRE

    Street, Valerie A.; Kallman, Jeremy C.; Strombom, Paul D.; Bramhall, Naomi F; Phillips, James O.

    2008-01-01

    The inner ear contains the developmentally related cochlea and peripheral vestibular labyrinth. Given the similar physiology between these two organs, hearing loss and vestibular dysfunction may be expected to occur simultaneously in individuals segregating mutations in inner ear genes. Twenty-two different genes have been discovered that when mutated lead to non-syndromic autosomal dominant hearing loss. A review of the literature indicates that families segregating mutations in 13 of these ...

  12. Heterozygous Reelin Mutations Cause Autosomal-Dominant Lateral Temporal Epilepsy

    OpenAIRE

    Dazzo, Emanuela; Fanciulli, Manuela; Serioli, Elena; Minervini, Giovanni; Pulitano, Patrizia; Binelli, Simona; Di Bonaventura, Carlo; Luisi, Concetta; Pasini, Elena; Striano, Salvatore; Striano, Pasquale; Coppola, Giangennaro; Chiavegato, Angela; Radovic, Slobodanka; Spadotto, Alessandro

    2015-01-01

    Autosomal-dominant lateral temporal epilepsy (ADLTE) is a genetic epilepsy syndrome clinically characterized by focal seizures with prominent auditory symptoms. ADLTE is genetically heterogeneous, and mutations in LGI1 account for fewer than 50% of affected families. Here, we report the identification of causal mutations in reelin (RELN) in seven ADLTE-affected families without LGI1 mutations. We initially investigated 13 ADLTE-affected families by performing SNP-array linkage analysis and wh...

  13. Caroli′s syndrome with autosomal recessive polycystic kidney disease

    OpenAIRE

    Prithi Shenoy; Syed Ahmed Zaki; Preeti Shanbag; Swapnil Bhongade

    2014-01-01

    Caroli′s syndrome (CS) is a rare congenital disorder characterized by multiple segmental cystic or saccular dilatations of the intrahepatic bile ducts and congenital hepatic fibrosis. We report a 9-year-old boy who was diagnosed with CS and autosomal recessive poly-cystic kidney disease. On screening, his 5-month-old asymptomatic sister had multiple dilated biliary radicals with multiple bilateral renal cystic lesions. Both the patient and the affected sibling have been advised regular follow...

  14. A Primary Male Autosomal Linkage Map of the Horse Genome

    OpenAIRE

    Lindgren, Gabriella; Sandberg, Kaj; Persson, Helena; Marklund, Stefan,; Breen, Matthew; Sandgren, Björn; Carlstén, Johan; Ellegren, Hans

    1998-01-01

    A primary male autosomal linkage map of the domestic horse (Equus caballus) has been developed by segregation analysis of 140 genetic markers within eight half-sib families. The family material comprised four Standardbred trotters and four Icelandic horses, with a total of 263 offspring. The marker set included 121 microsatellite markers, eight protein polymorphisms, five RFLPs, three blood group polymorphisms, two PCR–RFLPs, and one single strand conformation polymorphism (SSCP). One hundred...

  15. Tolvaptan in patients with autosomal dominant polycystic kidney disease

    OpenAIRE

    Torres, Vicente E.; Chapman, Arlene B.; Devuyst, Olivier; Ron T Gansevoort; Grantham, Jared J.; Higashihara, Eiji; Perrone, Ronald D.; Krasa, Holly B.; Ouyang, John; Czerwiec, Frank S.

    2012-01-01

    BACKGROUND: The course of autosomal dominant polycystic kidney disease (ADPKD) is often associated with pain, hypertension, and kidney failure. Preclinical studies indicated that vasopressin V(2)-receptor antagonists inhibit cyst growth and slow the decline of kidney function. METHODS: In this phase 3, multicenter, double-blind, placebo-controlled, 3-year trial, we randomly assigned 1445 patients, 18 to 50 years of age, who had ADPKD with a total kidney volume of 750 ml or more and an estima...

  16. Sirolimus and kidney growth in autosomal dominant polycystic kidney disease

    OpenAIRE

    Serra, A. L.; Poster, D.; Kistler, A.D.; Krauer, F.; Raina, S; Young, J.; Rentsch, K M; Spanaus, K S; Senn, O; Kristanto, P; Scheffel, H.; Weishaupt, D; Wüthrich, R.P.

    2010-01-01

    BACKGROUND: In autosomal dominant polycystic kidney disease (ADPKD), aberrant activation of the mammalian target of rapamycin (mTOR) pathway is associated with progressive kidney enlargement. The drug sirolimus suppresses mTOR signaling. METHODS: In this 18-month, open-label, randomized, controlled trial, we sought to determine whether sirolimus halts the growth in kidney volume among patients with ADPKD. We randomly assigned 100 patients between the ages of 18 and 40 years to receive either ...

  17. Kidney volume and function in autosomal dominant polycystic kidney disease

    OpenAIRE

    Higashihara, Eiji; Nutahara, Kikuo; Okegawa, Takatsugu; Shishido, Toshihide; Tanbo, Mitsuhiro; Kobayasi, Kuninori; Nitadori, Toshiaki

    2013-01-01

    Background The significance of total kidney volume (TKV) as a biomarker of kidney function in autosomal dominant polycystic kidney disease (ADPKD) is controversial and has been reappraised. Methods Between 2007 and 2012, 64 patients were followed with a mean 39.7-month observation period. TKV measurements by magnetic resonance imaging and estimation of renal function with estimated glomerular filtration rate (eGFR) using the Modification of Diet in Renal Disease equation and 24-h urine creati...

  18. Autosomal dominant polycystic kidney disease: New insights into treatment

    OpenAIRE

    Imed Helal

    2013-01-01

    Autosomal dominant polycystic kidney disease (ADPKD) is the world′s most common inherited kidney disease. An increasing number of animal and human studies have enhanced our understanding of the molecular and cellular pathology of ADPKD. New treatment options are being tested in clinical trials in spite of the failure of mammalian target of rapamycin inhibitor therapy. The main and most effective therapy remains control of hypertension by renin-angiotensin-aldosterone system (RAAS) blockade. T...

  19. NEW BEST1 MUTATIONS IN AUTOSOMAL RECESSIVE BESTROPHINOPATHY

    Science.gov (United States)

    FUNG, ADRIAN T.; YZER, SUZANNE; GOLDBERG, NAOMI; WANG, HAO; NISSEN, MICHAEL; GIOVANNINI, ALFONSO; MERRIAM, JOANNA E.; BUKANOVA, ELENA N.; CAI, CAROLYN; YANNUZZI, LAWRENCE A.; TSANG, STEPHEN H.; ALLIKMETS, RANDO

    2015-01-01

    Purpose To report the ocular phenotype in patients with autosomal recessive bestrophinopathy and carriers, and to describe novel BEST1 mutations. Methods Patients with clinically suspected and subsequently genetically proven autosomal recessive bestrophinopathy underwent full ophthalmic examination and investigation with fundus autofluorescence imaging, spectral domain optical coherence tomography, electroretinography, and electrooculography. Mutation analysis of the BEST1 gene was performed through direct Sanger sequencing. Results Five affected patients from four families were identified. Mean age was 16 years (range, 6–42 years). All affected patients presented with reduced visual acuity and bilateral, hyperautofluorescent subretinal yellowish deposits within the posterior pole. Spectral domain optical coherence tomography demonstrated submacular fluid and subretinal vitelliform material in all patients. A cystoid maculopathy was seen in all but one patient. In 1 patient, the location of the vitelliform material was seen to change over a follow-up period of 3 years despite relatively stable vision. Visual acuity and fundus changes were unresponsive to topical and systemic carbonic anhydrase inhibitors and systemic steroids. Carriers had normal ocular examinations including normal fundus autofluorescence. Three novel mutations were detected. Conclusion Three novel BEST1 mutations are described, suggesting that many deleterious variants in BEST1 resulting in haploinsufficiency are still unknown. Mutations causing autosomal recessive bestrophinopathy are mostly located outside of the exons that usually harbor vitelliform macular dystrophy–associated dominant mutations. PMID:25545482

  20. Autosomal recessive polycystic kidney disease. A case report.

    Directory of Open Access Journals (Sweden)

    Hernando Diocaretz V

    2015-01-01

    Full Text Available INTRODUCTION: Polycystic Kidney Disease is a genetic disorder characterized by progressive cystic dilations of the renal ducts, presenting as autosomal dominant or recessive forms with an incidence of 1 in 1.000 and 1 in 20.000 births, respectively, according to international series. The autosomal recessive variety can be lethal in the neonatal period due to respiratory failure secondary to pulmonary hypoplasia and can manifest during childhood with hypertension, short stature and complications of portal hypertension. CASE REPORT: 3 years and 11 months old preschoolar with antecedent of fetal growth restriction and oligohydramnios during prenatal period, and a history of asthenia, pallor and progressive feeding difficulty with postprandial vomiting. Physical examination shows cardiac bruit, hypertension, splenomegaly, caput medusae and short stature. Laboratory tests with peripheral pancytopenia; abdominal ultrasonography showed hepatosplenomegaly, findings consistent with autosomal recessive polycystic kidney disease and periportal fibrosis; renal scintigraphy with bilateral kidney failure; a positive fecal occult blood test; an upper endoscopy that shows small esophageal varices; a hand radiography that shows bone age delayed and an echocardiography with cardiomegaly. DISCUSSION: This infrequent disease requires a high degree of suspicion by the clinician and presents with portal hypertension, with platelet count being the best predictor of severity. This condition has no cure and will progress to end-stage renal disease in any moment, so the aim is to minimize and treat renal and hepatic complications.

  1. A river based stable isotope record of orographic precipitation: Taurus Mountains, south central Turkey

    Science.gov (United States)

    Schemmel, Fabian; Mulch, Andreas; Mikes, Tamás.; Schildgen, Taylor

    2010-05-01

    Reconstructing continental precipitation and vegetation patterns has become one of the most rapidly growing fields in terrestrial paleoclimate research. Furthermore, stable isotopes in precipitation within continental plateau regions represent an increasingly important tool for reconstructing the various effects of uplift related climate change within the world's largest plateau regions. With peak elevations of more than 3,000 m the Taurus Mountains represent the southern margin of the central Anatolian plateau and must have played a pivotal role in controlling the drainage and sedimentation patterns within the plateau interior. However, their surface uplift history remains largely elusive. We sampled a series of tributaries and rivers along the Ermenek valley that crosscuts the Taurus Mountains in Southern Turkey. The aim of this study is to quantify the modern effect of orographic rainout of the Taurus Mountains on the d18O and dD values of river and spring waters and to compare these values to the d18O and dD of recent precipitation gathered by the Global Network of Isotopes in Precipitation (GNIP). Further we try to study the trends of the recent d18O and dD isotopic composition of local rivers and precipitation in the area to create a set of isotopic data that is comparable to isotopic studies on paleosoils and can therefore be used in future paleoaltimetry and paleoclimate studies. We sampled 6 individual rivers during the fall season 2008 to capture mostly groundwater runoff in the south central Taurus Mountains. All sampled rivers belong to the same local drainage system which drains into the Mediterranean Sea. The total elevation difference within the sampling area exceeds 2,000 m and we were able to collect samples over almost 1,800 m of elevation. Our measurements show that both d18O and dD values follow the same basic trend. d18O and dD values decrease systematically with increasing elevation. The lapse rate of d18O is about -2.2 per mil/km, whereas the

  2. The Five College Radio Astronomy Observatory CO Mapping Survey of the Taurus Molecular Cloud

    CERN Document Server

    Narayanan, Gopal; Brunt, Christopher; Goldsmith, Paul F; Snell, Ronald; Li, Di

    2008-01-01

    The FCRAO Survey of the Taurus Molecular Cloud observed the 12CO and 13CO J=1-0 emission from 98 square degrees of this important, nearby star forming region. This set of data with 45" resolution comprises the highest spatial dynamic range image of an individual molecular cloud constructed to date, and provides valuable insights to the molecular gas distribution, kinematics, and the star formation process. In this contribution, we describe the observations, calibration, data processing, and characteristics of the noise and line emission of the survey. The angular distribution of 12CO and 13CO emission over 1 km/s velocity intervals and the full velocity extent of the cloud are presented. These reveal a complex, dynamic medium of cold, molecular gas.

  3. Magnetically Regulated Star Formation in 3D: The Case of Taurus Molecular Cloud Complex

    CERN Document Server

    Nakamura, Fumitaka

    2008-01-01

    We carry out three-dimensional MHD simulations of star formation in turbulent, magnetized clouds, including ambipolar diffusion and feedback from protostellar outflows. The calculations focus on relatively diffuse clouds threaded by a strong magnetic field capable of resisting severe tangling by turbulent motions and retarding global gravitational contraction in the cross-field direction. They are motivated by observations of the Taurus molecular cloud complex (and, to a lesser extent, Pipe Nebula), which shows an ordered large-scale magnetic field, as well as elongated condensations that are generally perpendicular to the large-scale field. We find that stars form in earnest in such clouds when enough material has settled gravitationally along the field lines that the mass-to-flux ratios of the condensations approach the critical value. Only a small fraction (of order 1% or less) of the nearly magnetically-critical, condensed material is turned into stars per local free-fall time, however. The slow star form...

  4. IMAGING OF THE CCS 22.3 GHz EMISSION IN THE TAURUS MOLECULAR CLOUD COMPLEX

    International Nuclear Information System (INIS)

    Thioxoethenylidene (CCS) is an abundant interstellar molecule and a good tracer of high density and evolutionary stage of dense molecular clouds. It is also a suitable candidate for Zeeman splitting observations for its high splitting factor and narrow thermal line widths. We report here Expanded Very Large Array 22.3 GHz observations of three dense molecular cores TMC-1, TMC-1C, and L1521B in the Taurus molecular cloud complex to image the CCS 21-10 transition. For all three sources, the clumpy CCS emission is most likely tracing the starless cores. However, these compact structures account for only ∼1%-13% of the integrated emission detected in single-dish observations, indicating the presence of significant large-scale diffuse emission in favorable conditions for producing CCS.

  5. "Herontwerp de melkveesector" : duurzaamheid melkveehouderij gaat volgens ASG-onderzoeker Bram Bos verder dan nieuwe stal of duurzamere koe

    OpenAIRE

    Knaap, van der, J.A.; Bos, A.P.

    2008-01-01

    Bram Bos haalde dit jaar de landelijke pers met uitspraken, dat de Nederlandse koe veel te vroeg naar het slachthuis wordt afgevoerd. Ondanks de stijging van de levensproductie bij afvoer dit jaar, blijft de ASG-onderzoeker kritisch over de levensduur van de koe. ‘Stimuleren van herfstafkalven is slecht voor de levensduur van de koe.’

  6. DISK EVOLUTION IN THE THREE NEARBY STAR-FORMING REGIONS OF TAURUS, CHAMAELEON, AND OPHIUCHUS

    International Nuclear Information System (INIS)

    We analyze samples of Spitzer Infrared Spectrograph spectra of T Tauri stars in the Ophiuchus, Taurus, and Chamaeleon I star-forming regions, whose median ages lie in the <1-2 Myr range. The median mid-infrared spectra of objects in these three regions are similar in shape, suggesting, on average, similar disk structures. When normalized to the same stellar luminosity, the medians follow each other closely, implying comparable mid-infrared excess emission from the circumstellar disks. We use the spectral index between 13 and 31 μm and the equivalent width of the 10 μm silicate emission feature to identify objects whose disk configuration departs from that of a continuous, optically thick accretion disk. Transitional disks, whose steep 13-31 μm spectral slope and near-IR flux deficit reveal inner disk clearing, occur with about the same frequency of a few percent in all three regions. Objects with unusually large 10 μm equivalent widths are more common (20%-30%); they could reveal the presence of disk gaps filled with optically thin dust. Based on their medians and fraction of evolved disks, T Tauri stars in Taurus and Chamaeleon I are very alike. Disk evolution sets in early, since already the youngest region, the Ophiuchus core (L1688), has more settled disks with larger grains. Our results indicate that protoplanetary disks show clear signs of dust evolution at an age of a few Myr, even as early as ∼1 Myr, but age is not the only factor determining the degree of evolution during the first few million years of a disk's lifetime.

  7. Brood ball-mediated transmission of microbiome members in the dung beetle, Onthophagus taurus (Coleoptera: Scarabaeidae.

    Directory of Open Access Journals (Sweden)

    Anne M Estes

    Full Text Available Insects feeding on plant sap, blood, and other nutritionally incomplete diets are typically associated with mutualistic bacteria that supplement missing nutrients. Herbivorous mammal dung contains more than 86% cellulose and lacks amino acids essential for insect development and reproduction. Yet one of the most ecologically necessary and evolutionarily successful groups of beetles, the dung beetles (Scarabaeinae feeds primarily, or exclusively, on dung. These associations suggest that dung beetles may benefit from mutualistic bacteria that provide nutrients missing from dung. The nesting behaviors of the female parent and the feeding behaviors of the larvae suggest that a microbiome could be vertically transmitted from the parental female to her offspring through the brood ball. Using sterile rearing and a combination of molecular and culture-based techniques, we examine transmission of the microbiome in the bull-headed dung beetle, Onthophagus taurus. Beetles were reared on autoclaved dung and the microbiome was characterized across development. A ~1425 bp region of the 16S rRNA identified Pseudomonadaceae, Enterobacteriaceae, and Comamonadaceae as the most common bacterial families across all life stages and populations, including cultured isolates from the 3(rd instar digestive system. Finer level phylotyping analyses based on lepA and gyrB amplicons of cultured isolates placed the isolates closest to Enterobacter cloacae, Providencia stuartii, Pusillimonas sp., Pedobacter heparinus, and Lysinibacillus sphaericus. Scanning electron micrographs of brood balls constructed from sterile dung reveals secretions and microbes only in the chamber the female prepares for the egg. The use of autoclaved dung for rearing, the presence of microbes in the brood ball and offspring, and identical 16S rRNA sequences in both parent and offspring suggests that the O. taurus female parent transmits specific microbiome members to her offspring through the brood

  8. Magnetically Regulated Star Formation in Three Dimensions: The Case of the Taurus Molecular Cloud Complex

    Science.gov (United States)

    Nakamura, Fumitaka; Li, Zhi-Yun

    2008-11-01

    We carry out three-dimensional MHD simulations of star formation in turbulent, magnetized clouds, including ambipolar diffusion and feedback from protostellar outflows. The calculations focus on relatively diffuse clouds threaded by a strong magnetic field capable of resisting severe tangling by turbulent motions and retarding global gravitational contraction in the cross field direction. They are motivated by observations of the Taurus molecular cloud complex (and, to a lesser extent, Pipe Nebula), which shows an ordered large-scale magnetic field, as well as elongated condensations that are generally perpendicular to the large-scale field. We find that stars form in earnest in such clouds when enough material has settled gravitationally along the field lines that the mass-to-flux ratios of the condensations approach the critical value. Only a small fraction (of order 1% or less) of the nearly magnetically critical, condensed material is turned into stars per local free-fall time, however. The slow star formation takes place in condensations that are moderately supersonic; it is regulated primarily by magnetic fields, rather than turbulence. The quiescent condensations are surrounded by diffuse halos that are much more turbulent, as observed in the Taurus complex. Strong support for magnetic regulation of star formation in this complex comes from the extremely slow conversion of the already condensed, relatively quiescent C18O gas into stars, at a rate 2 orders of magnitude below the maximum, free-fall value. We analyze the properties of dense cores, including their mass spectrum, which resembles the stellar initial mass function.

  9. DYNA3D, INGRID, and TAURUS: an integrated, interactive software system for crashworthiness engineering

    International Nuclear Information System (INIS)

    Crashworthiness engineering has always been a high priority at Lawrence Livermore National Laboratory because of its role in the safe transport of radioactive material for the nuclear power industry and military. As a result, the authors have developed an integrated, interactive set of finite element programs for crashworthiness analysis. The heart of the system is DYNA3D, an explicit, fully vectorized, large deformation structural dynamics code. DYNA3D has the following four capabilities that are critical for the efficient and accurate analysis of crashes: (1) fully nonlinear solid, shell, and beam elements for representing a structure, (2) a broad range of constitutive models for representing the materials, (3) sophisticated contact algorithms for the impact interactions, and (4) a rigid body capability to represent the bodies away from the impact zones at a greatly reduced cost without sacrificing any accuracy in the momentum calculations. To generate the large and complex data files for DYNA3D, INGRID, a general purpose mesh generator, is used. It runs on everything from IBM PCs to CRAYS, and can generate 1000 nodes/minute on a PC. With its efficient hidden line algorithms and many options for specifying geometry, INGRID also doubles as a geometric modeller. TAURUS, an interactive post processor, is used to display DYNA3D output. In addition to the standard monochrome hidden line display, time history plotting, and contouring, TAURUS generates interactive color displays on 8 color video screens by plotting color bands superimposed on the mesh which indicate the value of the state variables. For higher quality color output, graphic output files may be sent to the DICOMED film recorders. We have found that color is every bit as important as hidden line removal in aiding the analyst in understanding his results. In this paper the basic methodologies of the programs are presented along with several crashworthiness calculations

  10. MAPPING THE SHORES OF THE BROWN DWARF DESERT. II. MULTIPLE STAR FORMATION IN TAURUS-AURIGA

    International Nuclear Information System (INIS)

    We have conducted a high-resolution imaging study of the Taurus-Auriga star-forming region in order to characterize the primordial outcome of multiple star formation and the extent of the brown dwarf desert. Our survey identified 16 new binary companions to primary stars with masses of 0.25-2.5 Msun, raising the total number of binary pairs (including components of high-order multiples) with separations of 3-5000 AU to 90. We find that ∼2/3-3/4 of all Taurus members are multiple systems of two or more stars, while the other ∼1/4-1/3 appear to have formed as single stars; the distribution of high-order multiplicity suggests that fragmentation into a wide binary has no impact on the subsequent probability that either component will fragment again. The separation distribution for solar-type stars (0.7-2.5 Msun) is nearly log-flat over separations of 3-5000 AU, but lower-mass stars (0.25-0.7 Msun) show a paucity of binary companions with separations of ∼>200 AU. Across this full mass range, companion masses are well described with a linear-flat function; all system mass ratios (q = MB /MA ) are equally probable, apparently including substellar companions. Our results are broadly consistent with the two expected modes of binary formation (free-fall fragmentation on large scales and disk fragmentation on small scales), but the distributions provide some clues as to the epochs at which the companions are likely to form.

  11. VizieR Online Data Catalog: Infrared photometry of all known members in Taurus (Esplin+, 2014)

    Science.gov (United States)

    Esplin, T. L.; Luhman, K. L.; Mamajek, E. E.

    2016-08-01

    To construct a census of the circumstellar disks in Taurus, we begin by compiling a list of all known members of the region. We adopt the 352 members from Luhman et al. 2010 (cat. J/ApJS/186/111), 4 additional stars that have good evidence of membership from previous studies (Section 5.4), 32 members found in a subsequent survey by K. Luhman (in preparation; 33 if GZ Tau A and B are counted separately), and 25 new members (26 if BS Tau A and B are counted separately) that we have confirmed with spectroscopy (Section 5.3). We also adopt as a member HD 285957, which has a proper motion consistent with that of the Taurus subgroup L1551 (Zacharias et al. 2013, cat. I/322; Luhman et al. 2009ApJ...703..399L) and exhibits evidence of youth in the form of Li absorption (Wichmann et al. 2000A&A...359..181W; Sestito et al. 2008, cat. J/A+A/488/943). We make use of mid-infrared photometry for members of Taurus measured with Spitzer's Infrared Array Camera (IRAC) and the Multiband Imaging Photometer for Spitzer (MIPS). We consider the four bands of IRAC (3.6, 4.5, 5.8, and 8.0μm) and the 24μm band of MIPS, which are denoted as [3.6], [4.5], [5.8], [8.0], and [24], respectively. IRAC produced images with a field of view of 5.2'*5.2' and FWHM of 1.6''-1.9'' for [3.6] to [8.0]. MIPS had a field of view of 5.4'*5.4' and a FWHM of 5.9'' for [24]. Photometry from most Spitzer images for most members of Taurus has been measured by Luhman et al. 2010 (cat. J/ApJS/186/111) (see also Hartmann et al. 2005ApJ...629..881H; Luhman et al. 2006, cat. J/ApJ/647/1180; Guieu et al. 2007, cat. 2007A&A...465..855G; Rebull et al. 2010, cat. J/ApJS/186/259). We have measured photometry of the members that were not considered in Luhman et al. 2010 (cat. J/ApJS/186/111) and all known members appearing in Spitzer images that have become publicly available since that study (Astronomical Observation Requests 26470912, 26471168 26477056, 26475264, 26472704, 26473216, and 23272448). These data were

  12. Enterocytozoon bieneusi genotypes in yaks (Bos grunniens) and their public health potential.

    Science.gov (United States)

    Ma, Jingbo; Cai, Jinzhong; Ma, Jiawen; Feng, Yaoyu; Xiao, Lihua

    2015-01-01

    Enterocytozoon bieneusi, the most frequently diagnosed microsporidian species in humans, is also identified in a wide range of animals. To date, few data are available on E. bieneusi in yaks (Bos grunniens). In this study, we examined the occurrence and genotype identity of E. bieneusi in yaks in four counties in Qinghai Province of China. Of 327 fecal specimens examined by nested PCR analysis of the ribosomal internal transcribed spacer, 23 (7.0%) were E. bieneusi-positive. DNA sequence analysis of the PCR products revealed the presence of five distinct genotypes: three Group 2 genotypes previously reported in cattle as well as humans (BEB4, I and J) and two novel genotypes (CHN11 and CHN12) belonging to the large zoonotic group (Group 1). Data of the study suggest that these animals could be potential reservoirs for human E. bieneusi infection. PMID:25040451

  13. Analysis of the X-Ray Tomograph Data of the BOS MDT Prototype Chamber

    CERN Document Server

    Kroha, H; Ostapchuk, A Ya

    1999-01-01

    The complete X-ray tomograph data of the BOS MDT prototype chamber for the ATLAS muon spectrometer have been analyzed. The geometrical parameters of the chamber determined from the average of all X-ray scans are in good agreement with the design values. The spread of the measured wire positions with respect to the fitted wire grid is 17.0 mu (19 mu) RMS in the z coordinate and 18.2 mu (19.3 mu) RMS in y on the readout (high voltage) side. The errors include the average measuring uncertainty of the X-ray tomograph estimated to be 4 mu RMS in z and 6 mu RMS in y from the reproducibility of repeated measurements in the same chamber position.

  14. Study of interfaces in an Axisymmetric Supersonic Jet using Background Oriented Schlieren (BOS)

    Science.gov (United States)

    Echeverría, Carlos; Porta, David; Aguayo, Alejandro; Cardoso, Hiroki; Stern, Catalina

    2014-11-01

    We have used several techniques to study a small axisymmetric supersonic jet: Rayleigh scattering, Schlieren Toepler and PIV. Each technique gives different kind of information. In this paper, a BOS set-up is used to study the structure of the shock pattern. A shadowgraph of a dot matrix is obtained with and without a flow. The displacement field of the dots is related to changes in the index of refraction, which can be related, through the Gladstone-Dale equation, to changes in density. Previous results with this technique were not conclusive because of the relative size of the dots compared to the diameter of the nozzle. Measurements have been taken for three different exit speeds. We acknowledge support from UNAM through DGAPA PAPIIT IN117712 and the Graduate Program in Mechanical Engineering.

  15. Taurus workbenchyong用于IC制造加工工艺的实验研究%The experimental research of optimize manufacturing and procesing technique for IC on the taurus workbench

    Institute of Scientific and Technical Information of China (English)

    侯国宪; 李惠军; 赵国庆

    2004-01-01

    介绍了集成电路虚拟工厂系统Taurus Workbench.并基于CMOS工艺的特点,在Tau-rus Workbench环境下进行了亚微米级n沟器件的核心参数优化实验研究,结果印证了集成电路虚拟工厂技术为工艺优化提供了便捷有效的方法.

  16. Characterization of Large Structural Genetic Mosaicism in Human Autosomes

    Science.gov (United States)

    Machiela, Mitchell J.; Zhou, Weiyin; Sampson, Joshua N.; Dean, Michael C.; Jacobs, Kevin B.; Black, Amanda; Brinton, Louise A.; Chang, I-Shou; Chen, Chu; Chen, Constance; Chen, Kexin; Cook, Linda S.; Crous Bou, Marta; De Vivo, Immaculata; Doherty, Jennifer; Friedenreich, Christine M.; Gaudet, Mia M.; Haiman, Christopher A.; Hankinson, Susan E.; Hartge, Patricia; Henderson, Brian E.; Hong, Yun-Chul; Hosgood, H. Dean; Hsiung, Chao A.; Hu, Wei; Hunter, David J.; Jessop, Lea; Kim, Hee Nam; Kim, Yeul Hong; Kim, Young Tae; Klein, Robert; Kraft, Peter; Lan, Qing; Lin, Dongxin; Liu, Jianjun; Le Marchand, Loic; Liang, Xiaolin; Lissowska, Jolanta; Lu, Lingeng; Magliocco, Anthony M.; Matsuo, Keitaro; Olson, Sara H.; Orlow, Irene; Park, Jae Yong; Pooler, Loreall; Prescott, Jennifer; Rastogi, Radhai; Risch, Harvey A.; Schumacher, Fredrick; Seow, Adeline; Setiawan, Veronica Wendy; Shen, Hongbing; Sheng, Xin; Shin, Min-Ho; Shu, Xiao-Ou; VanDen Berg, David; Wang, Jiu-Cun; Wentzensen, Nicolas; Wong, Maria Pik; Wu, Chen; Wu, Tangchun; Wu, Yi-Long; Xia, Lucy; Yang, Hannah P.; Yang, Pan-Chyr; Zheng, Wei; Zhou, Baosen; Abnet, Christian C.; Albanes, Demetrius; Aldrich, Melinda C.; Amos, Christopher; Amundadottir, Laufey T.; Berndt, Sonja I.; Blot, William J.; Bock, Cathryn H.; Bracci, Paige M.; Burdett, Laurie; Buring, Julie E.; Butler, Mary A.; Carreón, Tania; Chatterjee, Nilanjan; Chung, Charles C.; Cook, Michael B.; Cullen, Michael; Davis, Faith G.; Ding, Ti; Duell, Eric J.; Epstein, Caroline G.; Fan, Jin-Hu; Figueroa, Jonine D.; Fraumeni, Joseph F.; Freedman, Neal D.; Fuchs, Charles S.; Gao, Yu-Tang; Gapstur, Susan M.; Patiño-Garcia, Ana; Garcia-Closas, Montserrat; Gaziano, J. Michael; Giles, Graham G.; Gillanders, Elizabeth M.; Giovannucci, Edward L.; Goldin, Lynn; Goldstein, Alisa M.; Greene, Mark H.; Hallmans, Goran; Harris, Curtis C.; Henriksson, Roger; Holly, Elizabeth A.; Hoover, Robert N.; Hu, Nan; Hutchinson, Amy; Jenab, Mazda; Johansen, Christoffer; Khaw, Kay-Tee; Koh, Woon-Puay; Kolonel, Laurence N.; Kooperberg, Charles; Krogh, Vittorio; Kurtz, Robert C.; LaCroix, Andrea; Landgren, Annelie; Landi, Maria Teresa; Li, Donghui; Liao, Linda M.; Malats, Nuria; McGlynn, Katherine A.; McNeill, Lorna H.; McWilliams, Robert R.; Melin, Beatrice S.; Mirabello, Lisa; Peplonska, Beata; Peters, Ulrike; Petersen, Gloria M.; Prokunina-Olsson, Ludmila; Purdue, Mark; Qiao, You-Lin; Rabe, Kari G.; Rajaraman, Preetha; Real, Francisco X.; Riboli, Elio; Rodríguez-Santiago, Benjamín; Rothman, Nathaniel; Ruder, Avima M.; Savage, Sharon A.; Schwartz, Ann G.; Schwartz, Kendra L.; Sesso, Howard D.; Severi, Gianluca; Silverman, Debra T.; Spitz, Margaret R.; Stevens, Victoria L.; Stolzenberg-Solomon, Rachael; Stram, Daniel; Tang, Ze-Zhong; Taylor, Philip R.; Teras, Lauren R.; Tobias, Geoffrey S.; Viswanathan, Kala; Wacholder, Sholom; Wang, Zhaoming; Weinstein, Stephanie J.; Wheeler, William; White, Emily; Wiencke, John K.; Wolpin, Brian M.; Wu, Xifeng; Wunder, Jay S.; Yu, Kai; Zanetti, Krista A.; Zeleniuch-Jacquotte, Anne; Ziegler, Regina G.; de Andrade, Mariza; Barnes, Kathleen C.; Beaty, Terri H.; Bierut, Laura J.; Desch, Karl C.; Doheny, Kimberly F.; Feenstra, Bjarke; Ginsburg, David; Heit, John A.; Kang, Jae H.; Laurie, Cecilia A.; Li, Jun Z.; Lowe, William L.; Marazita, Mary L.; Melbye, Mads; Mirel, Daniel B.; Murray, Jeffrey C.; Nelson, Sarah C.; Pasquale, Louis R.; Rice, Kenneth; Wiggs, Janey L.; Wise, Anastasia; Tucker, Margaret; Pérez-Jurado, Luis A.; Laurie, Cathy C.; Caporaso, Neil E.; Yeager, Meredith; Chanock, Stephen J.

    2015-01-01

    Analyses of genome-wide association study (GWAS) data have revealed that detectable genetic mosaicism involving large (>2 Mb) structural autosomal alterations occurs in a fraction of individuals. We present results for a set of 24,849 genotyped individuals (total GWAS set II [TGSII]) in whom 341 large autosomal abnormalities were observed in 168 (0.68%) individuals. Merging data from the new TGSII set with data from two prior reports (the Gene-Environment Association Studies and the total GWAS set I) generated a large dataset of 127,179 individuals; we then conducted a meta-analysis to investigate the patterns of detectable autosomal mosaicism (n = 1,315 events in 925 [0.73%] individuals). Restricting to events >2 Mb in size, we observed an increase in event frequency as event size decreased. The combined results underscore that the rate of detectable mosaicism increases with age (p value = 5.5 × 10−31) and is higher in men (p value = 0.002) but lower in participants of African ancestry (p value = 0.003). In a subset of 47 individuals from whom serial samples were collected up to 6 years apart, complex changes were noted over time and showed an overall increase in the proportion of mosaic cells as age increased. Our large combined sample allowed for a unique ability to characterize detectable genetic mosaicism involving large structural events and strengthens the emerging evidence of non-random erosion of the genome in the aging population. PMID:25748358

  17. Autosomal dominant polycystic kidney disease: recent advances in clinical management.

    Science.gov (United States)

    Mao, Zhiguo; Chong, Jiehan; Ong, Albert C M

    2016-01-01

    The first clinical descriptions of autosomal dominant polycystic kidney disease (ADPKD) go back at least 500 years to the late 16 (th) century. Advances in understanding disease presentation and pathophysiology have mirrored the progress of clinical medicine in anatomy, pathology, physiology, cell biology, and genetics. The identification of PKD1 and PKD2, the major genes mutated in ADPKD, has stimulated major advances, which in turn have led to the first approved drug for this disorder and a fresh reassessment of patient management in the 21 (st) century. In this commentary, we consider how clinical management is likely to change in the coming decade. PMID:27594986

  18. Analysis of 49 autosomal SNPs in an Iraqi population

    DEFF Research Database (Denmark)

    Tomas Mas, Carmen; Diez, Isabel E; Moncada, Enrique;

    2013-01-01

    Forty-nine of the 52 autosomal single nucleotide polymorphisms (SNPs) in the SNPforID 52plex were typed in 101 unrelated Iraqis living in Denmark. No significant deviation from HWE was found in all but one of the 49 SNP systems and no significant pairwise linkage disequilibrium was observed for any...... SNP pair. When 18 worldwide populations were compared (including populations in Iraq, Turkey, Israel, Pakistan, India, China, Taiwan, Japan, Siberia, Algeria, Somalia, Uganda, Mozambique, Angola, Nigeria, Denmark, Portugal, Spain), a significant global F(ST) value was obtained. All but six F...

  19. STIL mutation causes autosomal recessive microcephalic lobar holoprosencephaly.

    Science.gov (United States)

    Kakar, Naseebullah; Ahmad, Jamil; Morris-Rosendahl, Deborah J; Altmüller, Janine; Friedrich, Katrin; Barbi, Gotthold; Nürnberg, Peter; Kubisch, Christian; Dobyns, William B; Borck, Guntram

    2015-01-01

    Holoprosencephaly is a clinically and genetically heterogeneous midline brain malformation associated with neurologic manifestations including developmental delay, intellectual disability and seizures. Although mutations in the sonic hedgehog gene SHH and more than 10 other genes are known to cause holoprosencephaly, many patients remain without a molecular diagnosis. Here we show that a homozygous truncating mutation of STIL not only causes severe autosomal recessive microcephaly, but also lobar holoprosencephaly in an extended consanguineous Pakistani family. STIL mutations have previously been linked to centrosomal defects in primary microcephaly at the MCPH7 locus. Our results thus expand the clinical phenotypes associated with biallellic STIL mutations to include holoprosencephaly. PMID:25218063

  20. Autosomal dominant optic nerve colobomas, vesicoureteral reflux, and renal anomalies

    Energy Technology Data Exchange (ETDEWEB)

    Schimmenti, L.A.; Pierpont, M.E.; Carpenter, B.L.M. [Univ. of Minnesota School of Medicine, MN (United States)] [and others

    1995-11-06

    We describe a father and 3 sons with optic nerve colobomas, vesicoureteral reflux, and renal anomalies. The youngest son had congenital renal failure and ultimately underwent renal transplantation. The father and one son had high frequency hearing loss. There were no other affected relatives. We conclude that the association of optic nerve colobomas, renal anomalies, and vesicoureteral reflux comprises a unique autosomal dominant syndrome. Molecular investigations have determined this disorder to be associated with a single nucleotide deletion in the PAX2 gene. 16 refs., 3 figs.

  1. Mutations of the tyrosinase gene produce autosomal recessive ocular albinism

    Energy Technology Data Exchange (ETDEWEB)

    King, R.A.; Summers, C.G.; Oetting, W.S. [Univ. of Minnesota, Minneapolis, MN (United States)] [and others

    1994-09-01

    Albinism has historically been divided into ocular (OA) and oculocutaneous (OCA) types based on the presence or absence of clinically apparent skin and hair involvement in an individual with the ocular features of albinism. The major genes for OCA include the tyrosinase gene in OCA1 and the P gene in OCA2. X-linked and autosomal recessive OA have been described and the responsible genes have not been identified. We now present six Caucasian individuals who have the phenotype of autosomal recessive OA but who have OCA1 as shown by the presence of mutations of the tyrosinase. They had white or very light hair and white skin at birth, and cutaneous pigment developed in the first decade of life. At ages ranging from 1.5-23 years, hair color was dark blond to light brown. The skin had generalized pigment and well developed tan was present on the exposed arm and face skin of four. Iris pigment was present and iris translucency varied. Molecular analysis of the tyrosinase gene, using PCR amplification and direct di-deoxy sequencing showed the following mutations: E398Z/E398Q, P406S/g346a, R402E/T373K, ?/D383N, and H211N/T373K. The homozygous individual was not from a known consanguineous mating. T373K is the most common tyrosinase gene mutation in our laboratory. Three of these mutations are associated with a total loss of tyrosinase activity (g346a splice-site, T373K, and D383N), while four are associated with residual enzyme activity (H211N, R402E, E398Q, and P406S). These studies show that mutations of the tyrosinase gene can produce the phenotype of autosomal recessive OA in an individual who has normal amounts of cutaneous pigment and the ability to tan after birth. This extends the phenotypic range of OCA1 to normal cutaneous pigment after early childhood, and suggest that mutations of the tyrosinase gene account for a significant number of individuals with autosomal recessive OA.

  2. Organic facies characteristics of the Carboniferous Pamucakyayla Formation, western Taurus, Antalya Nappes, Kemer (Antalya/Turkey)

    Science.gov (United States)

    Bertan Gulludag, Cevdet; Altunsoy, Mehmet; Ozcelik, Orhan

    2015-04-01

    The study area is located in the western part of the Taurus Belt (SW Turkey). This region exhibits a complex structure involving two autochthonous units surrounded and imbricated with three allochthonous complexes. Antalya Nappes is a complex tectonic imbricate structure including sedimantary and ultrabasic rocks. In this study, organic facies characteristics of Carboniferous coaly units in the Pamucakyayla region (Kemer, Antalya-Turkey) were examined. The Carboniferous Pamucakyayla Formation, which is characterized by sandstone, claystone, marl and coaly units. This units includes different levels of coal seams in different thicknesses. Organic matter is composed predominantly of woody and amorphous material, with a minor contribution of planty and coaly material. Kerogen in the deposits is type II/III, as indicated by organic petrographic observations and Rock-Eval data. Total organic carbon (TOC) values are generally between 0.01 and 1.44 %, but reach 5.81 % in the formation. Tmax values vary between 446 and 451 °C and indicate mature zone (Based on the value of 0.25 % TOC). Organic facies type BC, C and CD were identified in the investigated units. Organic facies BC is related sandstoneand marl lithofacies. This facis is deposited under an anoxic water column in a fine grained clastics, where rapid deposition creates anoxia in the sediments after deposition. This facies is characterized by average values of HI around 317 (equivalent to type II kerogene), TOC around 0.02 %, and an average of S2 of 0.04 mg HC/g of rock. Organic facies C is related to sandstone, marl and coal lithofacies. This facies is characterized by average values of HI around 176 (equivalent to type III kerogene), TOC around 0.19 %, and an average of S2 of 0.03 mg HC/g of rock. The organic matter is partly oxidized, and terrestrial. Organic facies C is the "gas-prone" facies. Organic facies CD is related to limestone, marl and coal lithofacies. This facies is characterized by average values

  3. Maternity exclusion with a very high autosomal STRs kinship index.

    Science.gov (United States)

    Li, Li; Ge, Jianye; Zhang, Suhua; Guo, Jianzhang; Zhao, Shumin; Li, Chengtao; Tang, Hui; Davis, Carey; Budowle, Bruce; Hou, Yiping; Liu, Yacheng

    2012-07-01

    This paper reports a maternity testing case to assess the biological relationship between a woman and the boy she was adopting. For all 46 tested autosomal STR loci, the adopting woman and the boy shared at least one allele at each locus, which supported that the woman could be the biological mother of the boy. The pairwise kinship indices (KIs) were calculated for various identity-by-descent distributions. Motherson was the most likely relationship with a very high KI (i.e., 6.91E+08) based on 35 independent autosomal STR loci, but KIs of other pairwise relationships (e.g., aunt-nephew, full sib, etc.) were also high. Further testing of X-STRs and mtDNA excluded the maternity relationship between woman and boy, in which 13 out of 20 X-STR loci were inconsistent and 18 nucleotide mismatches were observed at hypervariable regions I and II of the mtDNA. However, a more distant relationship (e.g., aunt-nephew) cannot be excluded. This case reinforces that possible false identifications can occur in kinship analysis cases yielding very high KIs. PMID:22450431

  4. LAMB3 mutations causing autosomal-dominant amelogenesis imperfecta.

    Science.gov (United States)

    Kim, J W; Seymen, F; Lee, K E; Ko, J; Yildirim, M; Tuna, E B; Gencay, K; Shin, T J; Kyun, H K; Simmer, J P; Hu, J C-C

    2013-10-01

    Amelogenesis imperfecta (AI) can be either isolated or part of a larger syndrome. Junctional epidermolysis bullosa (JEB) is a collection of autosomal-recessive disorders featuring AI associated with skin fragility and other symptoms. JEB is a recessive syndrome usually caused by mutations in both alleles of COL17A1, LAMA3, LAMB3, or LAMC2. In rare cases, heterozygous carriers in JEB kindreds display enamel malformations in the absence of skin fragility (isolated AI). We recruited two kindreds with autosomal-dominant amelogenesis imperfecta (ADAI) characterized by generalized severe enamel hypoplasia with deep linear grooves and pits. Whole-exome sequencing of both probands identified novel heterozygous mutations in the last exon of LAMB3 that likely truncated the protein. The mutations perfectly segregated with the enamel defects in both families. In Family 1, an 8-bp deletion (c.3446_3453del GACTGGAG) shifted the reading frame (p.Gly 1149Glufs*8). In Family 2, a single nucleotide substitution (c.C3431A) generated an in-frame translation termination codon (p.Ser1144*). We conclude that enamel formation is particularly sensitive to defects in hemidesmosome/basement-membrane complexes and that syndromic and non-syndromic forms of AI can be etiologically related. PMID:23958762

  5. Nutraceutical for Autosomal Dominant Polycystic Kidney Disease Therapy.

    Science.gov (United States)

    Yuajit, Chaowalit; Chatsudthipong, Varanuj

    2016-01-01

    Autosomal dominant polycystic kidney disease (ADPKD) is the most common inherited renal disorder caused by mutations of either PKD1 or PKD2 gene. Cyst formation initiates from a combination of abnormal cell proliferation along with enhanced fluid secretion. ADPKD is characterized by the progressive enlargement of cysts which destroy the renal parenchymal cells, resulting in renal failure. Currently, there is no effective treatment for this disease. Interestingly, several relevant therapeutic effects of herbal medicine relevant to pathogenic process of ADPKD have urged the researchers to search for potential candidate herb as nutraceutical for ADPKD therapy. Up to now, several natural compounds, such as triptolide, curcumin, ginkolide B, and steviol (stevia extract) have been shown to be able to retard cyst progression in ADPKD. The detailed mechanism of these compounds showed that triptolide enhanced calcium restoration, curcumin inhibited ERK & p-STAT3 pathways, ginkolide B inhibited Ras/MAPK pathway, and steviol activated AMPK, which inhibited CFTR channel and mTOR pathway in cell and mouse models of PKD. In addition, they are currently inpreclinical and clinical studies, respectively. This review focuses on the pathophysiology of ADPKD and the recent therapeutic approaches, especially a potential use of nutraceutical for the treatment of autosomal dominant polycystic kidney disease. PMID:26817244

  6. Specific transcriptional changes in human fetuses with autosomal trisomies.

    Science.gov (United States)

    Altug-Teber, O; Bonin, M; Walter, M; Mau-Holzmann, U A; Dufke, A; Stappert, H; Tekesin, I; Heilbronner, H; Nieselt, K; Riess, O

    2007-01-01

    Among full autosomal trisomies, only trisomies of chromosome 21 (Down syndrome), 18 (Edwards syndrome) and 13 (Patau syndrome) are compatible with postnatal survival. But the mechanisms, how a supernumerary chromosome disrupts the normal development and causes specific phenotypes, are still not fully explained. As an alternative to gene dosage effect due to the trisomic chromosome a genome-wide transcriptional dysregulation has been postulated. The aim of this study was to define the transcriptional changes in trisomy 13, 18, and 21 during early fetal development in order to obtain more insights into the molecular etiopathology of aneuploidy. Using oligonucleotide microarrays, we analyzed whole genome expression profiles in cultured amniocytes (AC) and chorionic villus cells (CV) from pregnancies with a normal karyotype and with trisomies of human chromosomes 13, 18 and 21. We observed a low to moderate up-regulation for a subset of genes of the trisomic chromosomes. Transcriptional levels of most of the genes on the supernumerary chromosome appeared similar to the respective chromosomal pair in normal karyotypes. A subset of chromosome 21 genes including the DSCR1 gene involved in fetal heart development was consistently up-regulated in different prenatal tissues (AC, CV) of trisomy 21 fetuses whereas only minor changes were found for genes of all other chromosomes. In contrast, in trisomy 18 vigorous downstream transcriptional changes were found. Global transcriptome analysis for autosomal trisomies 13, 18, and 21 supported a combination of the two major hypotheses. PMID:18253026

  7. Genetic Diversity in Gorkhas: an Autosomal STR Study.

    Science.gov (United States)

    Preet, Kiran; Malhotra, Seema; Shrivastava, Pankaj; Jain, Toshi; Rawat, Shweta; Varte, L Robert; Singh, Sayar; Singh, Inderjeet; Sarkar, Soma

    2016-01-01

    Genotyping of highly polymorphic autosomal short tandem repeat (STR) markers is a potent tool for elucidating genetic diversity. In the present study, fifteen autosomal STR markers were analyzed in unrelated healthy male Gorkha individuals (n = 98) serving in the Indian Army by using AmpFlSTR Identifiler Plus PCR Amplification Kit. In total, 138 alleles were observed with corresponding allele frequencies ranging from 0.005 to 0.469. The studied loci were in Hardy-Weinberg Equilibrium (HWE). Heterozygosity ranged from 0.602 to 0.867. The most polymorphic locus was Fibrinogen Alpha (FGA) chain which was also the most discriminating locus as expected. Neighbor Joining (NJ) tree and principal component analysis (PCA) plot clustered the Gorkhas with those of Nepal and other Tibeto-Burman population while lowlander Indian population formed separate cluster substantiating the closeness of the Gorkhas with the Tibeto-Burman linguistic phyla. Furthermore, the dataset of STR markers obtained in the study presents a valuable information source of STR DNA profiles from personnel for usage in disaster victim identification in military exigencies and adds to the Indian database of military soldiers and military hospital repository. PMID:27580933

  8. SMA and CARMA observations of young brown dwarfs in ρ Ophiuchi and Taurus

    Directory of Open Access Journals (Sweden)

    Lee C.-F.

    2011-07-01

    Full Text Available Molecular outflows provide vital information about the earliest stages in the birth of stars, studying the molecular outflow properties is therefore crucial for understanding how stars form. Brown dwarfs with masses between that of stars and planets are not massive enough to maintain stable hydrogen-burning fusion reactions during most of their lifetime. Their origins are subject to much debate in recent literature because their masses are far below the typical mass where core collapse is expected to occur. Based on Submillimeter Array (SMA and Combined Array for Research in Millimeter-wave Astronomy (CARMA observations, we present the first detections of bipolar molecular outflows from young brown dwarfs in ρ Ophiuchi and Taurus. Our results demonstrate that the bipolar molecular outflow operates down to brown dwarf masses, occurring in brown dwarfs as a scaled-down version of the universal process seen in young low-mass stars. This demonstrates that brown dwarfs and low-mass stars likely share the same formation mechanism.

  9. Molecular line study of the very young protostar IRAM 04191 in Taurus Infall, rotation, and outflow

    CERN Document Server

    Belloche, A; Despois, D; Blinder, S M

    2002-01-01

    We present a detailed millimeter line study of the circumstellar environment of the low-luminosity Class 0 protostar IRAM 04191+1522 in the Taurus molecular cloud. New line observations demonstrate that the ~14000 AU radius protostellar envelope is undergoing both extended infall and fast, differential rotation. Radiative transfer modeling of multitransition CS and C34S maps indicate an infall velocity v_inf ~ 0.15 km/s at r ~ 1500 AU and v_inf ~ 0.1 km/s up to r ~ 11000 AU, as well as a rotational angular velocity Omega ~ 3.9 x 10^{-13} rad/s, strongly decreasing with radius beyond 3500 AU down to a value Omega ~ 1.5-3 x 10^{-14} rad/s at ~ 11000 AU. Two distinct regions, which differ in both their infall and their rotation properties, therefore seem to stand out: the inner part of the envelope (r ~< 2000-4000 AU) is rapidly collapsing and rotating, while the outer part undergoes only moderate infall/contraction and slower rotation. These contrasted features suggest that angular momentum is conserved in t...

  10. The behavioural and genetic mating system of the sand tiger shark, Carcharias taurus, an intrauterine cannibal.

    Science.gov (United States)

    Chapman, Demian D; Wintner, Sabine P; Abercrombie, Debra L; Ashe, Jimiane; Bernard, Andrea M; Shivji, Mahmood S; Feldheim, Kevin A

    2013-06-23

    Sand tiger sharks (Carcharias taurus) have an unusual mode of reproduction, whereby the first embryos in each of the paired uteri to reach a certain size ('hatchlings') consume all of their smaller siblings during gestation ('embryonic cannibalism' or EC). If females commonly mate with multiple males ('behavioural polyandry') then litters could initially have multiple sires. It is possible, however, that EC could exclude of all but one of these sires from producing offspring thus influencing the species genetic mating system ('genetic monogamy'). Here, we use microsatellite DNA profiling of mothers and their litters (n = 15, from two to nine embryos per litter) to quantify the frequency of behavioural and genetic polyandry in this system. We conservatively estimate that nine of the females we examined (60%) were behaviourally polyandrous. The genetic mating system was characterized by assessing sibling relationships between hatchlings and revealed only 40 per cent genetic polyandry (i.e. hatchlings were full siblings in 60% of litters). The discrepancy stemmed from three females that were initially fertilized by multiple males but only produced hatchlings with one of them. This reveals that males can be excluded even after fertilizing ova and that some instances of genetic monogamy in this population arise from the reduction in litter size by EC. More research is needed on how cryptic post-copulatory and post-zygotic processes contribute to determining paternity and bridging the behavioural and genetic mating systems of viviparous species. PMID:23637391

  11. Properties of Starless and Prestellar Cores in Taurus Revealed by Herschel SPIRE/PACS Imaging

    CERN Document Server

    Marsh, K A; Palmeirim, P; André, Ph; Kirk, J; Stamatellos, D; Ward-Thompson, D; Roy, A; Bontemps, S; Di Francesco, J; Elia, D; Hill, T; Konyves, V; Motte, F; Nguyen-Luong, Q; Peretto, N; Pezzuto, S; Rivera-Ingraham, A; Schneider, N; Spinoglio, L; White, G

    2014-01-01

    The density and temperature structures of dense cores in the L1495 cloud of the Taurus star-forming region are investigated using Herschel SPIRE and PACS images in the 70 $\\mu$m, 160 $\\mu$m, 250 $\\mu$m, 350 $\\mu$m and 500 $\\mu$m continuum bands. A sample consisting of 20 cores, selected using spectral and spatial criteria, is analysed using a new maximum likelihood technique, COREFIT, which takes full account of the instrumental point spread functions. We obtain central dust temperatures, $T_0$, in the range 6-12 K and find that, in the majority of cases, the radial density falloff at large radial distances is consistent with the $r^{-2}$ variation expected for Bonnor-Ebert spheres. Two of our cores exhibit a significantly steeper falloff, however, and since both appear to be gravitationally unstable, such behaviour may have implications for collapse models. We find a strong negative correlation between $T_0$ and peak column density, as expected if the dust is heated predominantly by the interstellar radiatio...

  12. Accretion discs as regulators of stellar angular momentum evolution in the ONC and Taurus-Auriga

    CERN Document Server

    Davies, Claire L; Greaves, Jane S

    2014-01-01

    In light of recent substantial updates to spectral type estimations and newly established intrinsic colours, effective temperatures, and bolometric corrections for pre-main sequence (PMS) stars, we re-address the theory of accretion-disc regulated stellar angular momentum (AM) evolution. We report on the compilation of a consistent sample of fully convective stars within two of the most well-studied and youngest, nearby regions of star formation: the Orion Nebula Cluster (ONC) and Taurus-Auriga. We calculate the average specific stellar AM ($j_{\\star}$) assuming solid body rotation, using surface rotation periods gathered from the literature and new estimates of stellar radii and ages. We use published Spitzer IRAC fluxes to classify our stars as Class II or Class III and compare their $j_{\\star}$ evolution. Our results suggest that disc dispersal is a rapid process that occurs at a variety of ages. We find a consistent $j_{\\star}$ reduction rate between the Class II and Class III PMS stars which we interpret...

  13. VizieR Online Data Catalog: Spitzer observations of Taurus members (Luhman+, 2010)

    Science.gov (United States)

    Luhman, K. L.; Allen, P. R.; Espaillat, C.; Hartmann, L.; Calvet, N.

    2016-03-01

    For our census of the disk population in Taurus, we use images at 3.6, 4.5, 5.8, and 8.0um obtained with Spitzer's Infrared Array Camera (IRAC) and images at 24um obtained with the Multiband Imaging Photometer for Spitzer (MIPS). The cameras produced images with FWHM=1.6"-1.9" from 3.6 to 8.0um and FWHM=5.9" at 24um. The available data were obtained through Guaranteed Time Observations for PID = 6, 36, 37 (G. Fazio), 53 (G. Rieke), 94 (C. Lawrence), 30540 (G. Fazio, J. Houck), and 40302 (J. Houck), Director's Discretionary Time for PID = 462 (L. Rebull), Legacy programs for PID = 139, 173 (N. Evans), and 30816 (D. Padgett), and General Observer programs for PID = 3584 (D. Padgett), 20302 (P. Andre), 20386 (P. Myers), 20762 (J. Swift), 30384 (T. Bourke), 40844 (C. McCabe), and 50584 (D. Padgett). The IRAC and MIPS observations were performed through 180 and 137 Astronomical Observation Requests (AORs), respectively. The characteristics of the resulting images are summarized in Tables 1 and 2. (6 data files).

  14. A GMRT survey of regions towards the Taurus Molecular Cloud at 323 and 608 MHz

    CERN Document Server

    Ainsworth, Rachael E; Green, David A; Scaife, Anna M M; Ray, Tom P

    2016-01-01

    We present observations of three active sites of star formation in the Taurus Molecular Cloud complex taken at 323 and 608 MHz (90 and 50 cm, respectively) with the Giant Metrewave Radio Telescope (GMRT). Three pointings were observed as part of a pathfinder project, targeted at the young stellar objects (YSOs) L1551 IRS 5, T Tau and DG Tau (the results for these target sources were presented in a previous paper). In this paper, we search for other YSOs and present a survey comprising of all three fields; a by-product of the large instantaneous field of view of the GMRT. The resolution of the survey is of order 10 arcsec and the best rms noise at the centre of each pointing is of order $100\\,\\mu$Jy beam$^{-1}$ at 323 MHz and $50\\,\\mu$Jy beam$^{-1}$ at 608 MHz. We present a catalogue of 1815 and 687 field sources detected above $5\\,\\sigma_{\\rm rms}$ at 323 and 608 MHz, respectively. A total of 440 sources were detected at both frequencies, corresponding to a total unique source count of 2062 sources. We compar...

  15. A radio survey of weak T Tauri stars in Taurus-Auriga

    International Nuclear Information System (INIS)

    A multi-epoch 5 GHz survey of candidate or confirmed weak T Tauri stars in the Taurus-Auriga molecular cloud complex was conducted with the Very Large Array. The stars were chosen from those having detectable X-ray or chromospheric emission, and weak-emission-line pre-main-sequence stars found by other means. Snapshots of 99 VLA fields containing 119 candidate stars were obtained with a sensitivity of 0.7 mJy; most fields were observed on two or three dates. Nine radio sources coincident with cataloged stars were found. One may be an RS CVn binary system; the other eight are pre-main-sequence stars. Three of the detected stars - HD 283447, V410 Tau, and FK X-ray 1 - were previously known radio sources. Five new detections are Herbig's Anon 1, Hubble 4, HDE 283572, Elias 12, and HK Tau/c. At least five of the sources are variable, and no linear or circular polarization was found. Several lines of evidence suggest that the radio-detected weak T Tauri stars are quite young, perhaps younger on average than nondetected stars. 54 refs

  16. X-ray deficiency on strong accreting T Tauri stars - Comparing Orion with Taurus

    CERN Document Server

    Bustamante, Ignacio; Bouy, Hervé; Manara, Carlo; Ribas, Álvaro; Riviere-Marichalar, Pablo

    2015-01-01

    Depending on whether a T Tauri star accretes material from its circumstellar disk or not, different X-ray emission properties can be found. The accretion shocks produce cool heating of the plasma, contributing to the soft X-ray emission from the star. Using X-ray data from the Chandra Orion Ultra-deep Project and accretion rates that were obtained with the Hubble Space Telescope/WFPC2 photometric measurements in the Orion Nebula Cluster, we studied the relation between the accretion processes and the X-ray emissions of a coherent sample of T Tauri sources in the region. We performed regression and correlation analyses of our sample of T Tauri stars between the X-ray parameters, stellar properties, and the accretion measurements. We find that a clear anti-correlation is present between the residual X-ray luminosity and the accretion rates in our samples in Orion that is consistent with that found on the XMM-Newton Extended Survey of the Taurus molecular cloud (XEST) study. We provide a catalog with X-ray lumin...

  17. Chemistry in Disks X: The Molecular Content of Proto-planetary Disks in Taurus

    CERN Document Server

    Guilloteau, S; Dutrey, A; Chapillon, E; Wakelam, V; Piétu, V; Di Folco, E; Semenov, D; Henning, Th

    2016-01-01

    (abridged) We used the IRAM 30-m to perform a sensitive wideband survey of 30 protoplanetary disks in the Taurus Auriga region. We simultaneously observed HCO$^+$(3-2), HCN(3-2), C$_2$H(3-2), CS(5-4), and two transitions of SO. We combine the results with a previous survey which observed $^{13}$CO (2-1), CN(2-1), two o-H$_2$CO lines and one of SO. We use available interferometric data to derive excitation temperatures of CN and C$_2$H in several sources. We determine characteristic sizes of the gas disks and column densities of all molecules using a parametric power-law disk model. Our study is mostly sensitive to molecules at 200-400 au from the stars. We compare the derived column densities to the predictions of an extensive gas-grain chemical disk model, under conditions representative of T Tauri disks. This survey provides 20 new detections of HCO$^+$ in disks, 18 in HCN, 11 in C$_2$H, 8 in CS and 4 in SO. HCO$^+$ is detected in almost all sources, and its J=3-2 line is essentially optically thick, provid...

  18. The JCMT Legacy Survey of the Gould Belt: a first look at Taurus with HARP

    CERN Document Server

    Davis, C J; Hatchell, J; Wouterloot, J G A; Buckle, J V; Nutter, D; Fich, M; Brunt, C; Butner, H; Cavanagh, B; Curtis, E I; Duarte-Cabral, A; Di Francesco, J; Etxaluze, M; Friberg, P; Friesen, R; Fuller, G A; Graves, S; Greaves, J S; Hogerheijde, M R; Johnstone, D; Matthews, B; Matthews, H; Rawlings, J M C; Richer, J S; Roberts, J; Sadavoy, S; Simpson, R J; Tothill, N; Tsamis, Y; Viti, S; Ward-Thompson, D; White, Glenn J; Yates, J

    2010-01-01

    As part of a JCMT Legacy Survey of star formation in the Gould Belt, we present early science results for Taurus. CO J=3-2 maps have been secured along the north-west ridge and bowl, collectively known as L 1495, along with deep 13CO and C18O J=3-2 maps in two sub-regions. With these data we search for molecular outflows, and use the distribution of flows, HH objects and shocked H2 line emission features, together with the population of young stars, protostellar cores and starless condensations to map star formation across this extensive region. In total 21 outflows are identified. It is clear that the bowl is more evolved than the ridge, harbouring a greater population of T Tauri stars and a more diffuse, more turbulent ambient medium. By comparison, the ridge contains a much younger, less widely distributed population of protostars which, in turn, is associated with a greater number of molecular outflows. We estimate the ratio of the numbers of prestellar to protostellar cores in L 1495 to be ~ 1.3-2.3, and...

  19. A Resolved Census of Millimeter Emission from Taurus Multiple Star Systems

    CERN Document Server

    Harris, Robert J; Wilner, David J; Kraus, Adam L

    2012-01-01

    We present a high angular resolution millimeter-wave dust continuum imaging survey of circumstellar material associated with individual components of 23 multiple star systems in the Taurus-Auriga young cluster. Combined with previous measurements, these new data permit a comprehensive look at how millimeter luminosity (a tracer of disk mass) relates to the separation and mass of a stellar companion. Approximately one third (28-37%) of individual stars in multiples have detectable millimeter emission, a rate half that for single stars (~62%). There is a strong correlation between the luminosity and projected separation (a_p) of a stellar pair. Wide pairs (a_p > 300 AU) have a similar luminosity distribution as single stars, medium pairs (a_p ~ 30-300 AU) are a factor of 5 fainter, and close pairs (a_p < 30 AU) are ~ 5 times fainter yet (aside from a small population of bright circumbinary disks). In most cases, the emission is dominated by a disk around the primary (or a wide tertiary in triples), but there...

  20. Chains of dense cores in the Taurus L1495/B213 complex

    CERN Document Server

    Tafalla, M

    2014-01-01

    (Abridged) We study the kinematics of the dense gas in the Taurus L1495/B213 filamentary region to investigate the mechanism of core formation. We use observations of N2H+(1-0) and C18O(2-1) carried out with the IRAM 30m telescope. We find that the dense cores in L1495/B213 are significantly clustered in linear chain-like groups about 0.5pc long. The internal motions in these chains are mostly subsonic and the velocity is continuous, indicating that turbulence dissipation in the cloud has occurred at the scale of the chains and not at the smaller scale of the individual cores. The chains also present an approximately constant abundance of N2H+ and radial intensity profiles that can be modeled with a density law that follows a softened power law. A simple analysis of the spacing between the cores using an isothermal cylinder model indicates that the cores have likely formed by gravitational fragmentation of velocity-coherent filaments. Combining our analysis of the cores with our previous study of the large-sc...

  1. FIRST ISOLATION OF TENACIBACULUM MARITIMUM IN A CAPTIVE SAND TIGER SHARK (CARCHARIAS TAURUS).

    Science.gov (United States)

    Florio, Daniela; Gridelli, Stefano; Fioravanti, Maria Letizia; Zanoni, Renato Giulio

    2016-03-01

    This report describes a case of the first isolation of Tenacibaculum maritimum from a captive-bred adult female sand tiger shark (Carcharias taurus) housed at the Cattolica Aquarium (Italy). The animal showed, between the second dorsal fin and the precaudal pit, skin lesions characterized by the presence of abundant whitish necrotic tissue. Through routine bacteriological examination, a bacterium was isolated from a skin lesion and subsequently identified as T. maritimum by phenotypic characters and species-specific polymerase chain reaction. The antimicrobial sensitivity of the isolated strain was evaluated for 11 antimicrobial agents by disk diffusion method. Antibiotic therapy was conducted with enrofloxacin at 10 mg kg(-1) i.m. on alternate days for 10 days. One month after the end of treatment skin lesions showed complete resolution and the shark recovered completely. The case presented here represents the first report of infection by T. maritimum in a sand tiger shark and highlights the potential pathogenic role of this microorganism in elasmobranchs kept in an aquarium. PMID:27010301

  2. Classifying the embedded young stellar population in Perseus and Taurus & the LOMASS database

    CERN Document Server

    Carney, M T; Mottram, J C; van Dishoeck, E F; Ramchandani, J; Jørgensen, J K

    2016-01-01

    Context. The classification of young stellar objects (YSOs) is typically done using the infrared spectral slope or bolometric temperature, but either can result in contamination of samples. More accurate methods to determine the evolutionary stage of YSOs will improve the reliability of statistics for the embedded YSO population and provide more robust stage lifetimes. Aims. We aim to separate the truly embedded YSOs from more evolved sources. Methods. Maps of HCO+ J=4-3 and C18O J=3-2 were observed with HARP on the James Clerk Maxwell Telescope (JCMT) for a sample of 56 candidate YSOs in Perseus and Taurus in order to characterize emission from high (column) density gas. These are supplemented with archival dust continuum maps observed with SCUBA on the JCMT and Herschel PACS to compare the morphology of the gas and dust in the protostellar envelopes. The spatial concentration of HCO+ J=4-3 and 850 micron dust emission are used to classify the embedded nature of YSOs. Results. Approximately 30% of Class 0+I ...

  3. Two confirmed class I very low-mass objects in Taurus

    CERN Document Server

    Dang-Duc, C; Dao-Van, D T

    2016-01-01

    [GKH94] 41 and IRAS 04191+1523B were previously identified to be proto-brown dwarf candidates in Taurus. [GKH94] 41 was classified to be a class I object. The dereddened spectral energy distribution of the source was later found to be suggestive of a class II object. IRAS 04191+1523B is a class I object that is the secondary component of a binary. We determine the evolutionary stage of [GKH94] 41 and estimate the final masses of the two proto-brown dwarf candidates. We used archive millimeter observations to produce continuum maps and collected data from the literature to construct the spectral energy distribution of the targets. Our continuum maps revealed that both [GKH94] 41 and IRAS 04191+1523B are surrounded by envelopes. This provides direct evidence that [GKH94] 41 is a class I object, not class II, as previously classified. For IRAS 04191+1523B, our continuum map spatially resolved the binary. Our estimated final masses are below 49$^{+56}_{-27}$ $M_{\\rm J}$ and 75$^{+40}_{-26}$ $M_{\\rm J}$ for [GKH94...

  4. A detailed mass distribution of a high-density core in Taurus with ALMA

    CERN Document Server

    Tokuda, Kazuki; Matsumoto, Tomoaki; Saigo, Kazuya; Kawamura, Akiko; Fukui, Yasuo; Inutsuka, Shu-ichiro; Machida, Masahiro N; Tomida, Kengo; Tachihara, Kengo; André, Philippe

    2016-01-01

    We present the results of ALMA observations of dust continuum emission and molecular rotational lines, including the ALMA Compact Array, toward a dense core MC27 (a.k.a. L1521F) in Taurus, which is considered to be at very early stage of star formation. Detailed column density distribution with a size scale from a few tens AU to ~10000 AU scale are revealed by combining the ALMA data and the single-dish data. The high angular resolution observation at 0.87 mm reveals that a protostellar source, MMS-1, is still not spatially resolved without gas association and a starless high-density core, MMS-2, has substructures both in dust and molecular emission. The averaged radial column density distribution of the inner part (r < 3000 AU) is N_H2 ~r^-0.4, clearly flatter than that of the outer part, ~r^-1.0. We found the complex velocity/spatial structure obtained with previous ALMA observations is located inside the inner flatter region, which may reflect the dynamical status of the dense core.

  5. Determining the 3D Subsurface Density Structure of Taurus Littrow Valley Using Apollo 17 Gravity Data

    Science.gov (United States)

    Urbancic, N.; Ghent, R.; Stanley, S,; Johnson, C. L.; Carroll, K. A.; Hatch, D.; Williamson, M. C.; Garry, W. B.; Talwani, M.

    2016-01-01

    Surface gravity surveys can detect subsurface density variations that can reveal subsurface geologic features. In 1972, the Apollo 17 (A17) mission conducted the Traverse Gravimeter Experiment (TGE) using a gravimeter that measured the local gravity field near Taurus Littrow Valley (TLV), located on the south-eastern rim of the Serenitatis basin. TLV is hypothesized to be a basaltfilled radial graben resulting from the impact that formed Mare Serenitatis. It is bounded by both the North and South Massifs (NM and SM) as well as other smaller mountains to the East that are thought to be mainly composed of brecciated highland material. The TGE is the first and only successful gravity survey on the surface of the Moon. Other more recent satellite surveys, such as NASA's Gravity Recovery and Interior Laboratory (GRAIL) mission (2011- 2012), have produced the best global gravity field to date (approx. 13km resolution). However, these satellite surveys are not sensitive enough to detect fine-scale (3D modelling techniques in combination with high-resolution topographical and image datasets can reveal additional fine-scale subsurface structure in TLV.

  6. Cores, filaments, and bundles: hierarchical core formation in the L1495/B213 Taurus region

    CERN Document Server

    Hacar, A; Kauffmann, J; Kovacs, A

    2013-01-01

    (Abridged) Context. Core condensation is a critical step in the star-formation process, but is still poorly characterized observationally. Aims. We have studied the 10 pc-long L1495/B213 complex in Taurus to investigate how dense cores have condensed out of the lower-density cloud material. Results. From the N$_2$H$^+$ emission, we identify 19 dense cores, some starless and some protostellar. They are not distributed uniformly, but tend to cluster with relative separations on the order of 0.25 pc. From the C$^{18}$O emission, we identify multiple velocity components in the gas. We have characterized them by fitting gaussians to the spectra, and by studying the distribution of the fits in position-position-velocity space. In this space, the C$^{18}$O components appear as velocity-coherent structures, and we have identified them automatically using a dedicated algorithm (FIVe: Friends In Velocity). Using this algorithm, we have identified 35 filamentary components with typical lengths of 0.5 pc, sonic internal ...

  7. The XMM-Newton Optical Monitor Survey of the Taurus Molecular Cloud

    CERN Document Server

    Audard, M; Grosso, N; Güdel, M; Scelsi, L; Bouvier, J; Telleschi, A; Audard, Marc; Briggs, Kevin; Grosso, Nicolas; Guedel, Manuel; Scelsi, Luigi; Bouvier, Jerome; Telleschi, Alessandra

    2006-01-01

    The Optical Monitor (OM) on-board XMM-Newton obtained optical/ultraviolet data for the XMM-Newton Extended Survey of the Taurus Molecular Cloud (XEST), simultaneously with the X-ray detectors. With the XEST OM data, we aim to study the optical and ultraviolet properties of TMC members, and to do correlative studies between the X-ray and OM light curves. In particular, we aim to determine whether accretion plays a significant role in the optical/ultraviolet and X-ray emissions. The Neupert effect in stellar flares is also investigated. Coordinates, average count rates and magnitudes were extracted from OM images, together with light curves with low time resolution (a few kiloseconds). For a few sources, OM FAST mode data were also available, and we extracted OM light curves with high time resolution. The OM data were correlated with Two Micron All Sky Survey (2MASS) data and with the XEST catalogue in the X-rays. The XEST OM catalogue contains 2,148 entries of which 1,893 have 2MASS counterparts. However, only...

  8. Two confirmed class I very low-mass objects in Taurus

    Science.gov (United States)

    Dang-Duc, C.; Phan-Bao, N.; Dao-Van, D. T.

    2016-04-01

    Context. [GKH94] 41 and IRAS 04191+1523B were previously identified to be proto-brown dwarf candidates in Taurus. [GKH94] 41 was classified to be a class I object. The dereddened spectral energy distribution of the source was later found to be suggestive of a class II object. IRAS 04191+1523B is a class I object that is the secondary component of a binary. Aims: We determine the evolutionary stage of [GKH94] 41 and estimate the final masses of the two proto-brown dwarf candidates. Methods: We used archive millimeter observations to produce continuum maps and collected data from the literature to construct the spectral energy distribution of the targets. Results: Our continuum maps revealed that both [GKH94] 41 and IRAS 04191+1523B are surrounded by envelopes. This provides direct evidence that [GKH94] 41 is a class I object, not class II, as previously classified. For IRAS 04191+1523B, our continuum map spatially resolved the binary. Our estimated final masses are below 49-27+56 MJ and 75-26+40 MJ for [GKH94] 41 and IRAS 04191+1523B, respectively. This indicates that both sources will likely become brown dwarfs or very low-mass stars. Therefore, [GKH94] 41 and IRAS 04191+1523B are two new confirmed class I very low-mass objects. Their existence also supports the scenario that brown dwarfs have the same formation stages as low-mass stars.

  9. Far-ultraviolet Observations of the Taurus-Perseus-Auriga Complex

    CERN Document Server

    Lim, Tae-Ho; Seon, Kwang-Il

    2013-01-01

    We have constructed a far-ultraviolet (FUV) continuum map of the Taurus-Auriga-Perseus complex, one of the largest local associations of dark clouds, by merging the two data sets of GALEX and FIMS, which made observations at similar wavelengths. The FUV intensity varies significantly across the whole region, but the diffuse FUV continuum is dominated by dust scattering of stellar photons. A diffuse FUV background of $\\sim$1000 CU is observed, part of which may be attributable to the scattered photons of foreground FUV light, located in front of the thick clouds. The fluorescent emission of molecular hydrogen constitutes $\\sim$10% of the total FUV intensity throughout the region, generally proportional to the local continuum level. We have developed a Monte Carlo radiative transfer code and applied it to the present clouds complex to obtain the optical properties of dust grains and the geometrical structures of the clouds. The albedo and the phase function asymmetry factor were estimated to be $0.42^{+0.05}_{-...

  10. The relation between gas and dust in the Taurus Molecular Cloud

    CERN Document Server

    Pineda, Jorge L; Chapman, Nicholas; Snell, Ronald L; Li, Di; Cambresy, Laurent; Brunt, Chris

    2010-01-01

    (abridged) We report a study of the relation between dust and gas over a 100deg^2 area in the Taurus molecular cloud. We compare the H2 column density derived from dust extinction with the CO column density derived from the 12CO and 13CO J= 1-0 lines. We derive the visual extinction from reddening determined from 2MASS data. The comparison is done at an angular size of 200", corresponding to 0.14pc at a distance of 140pc. We find that the relation between visual extinction Av and N(CO) is linear between Av~3 and 10 mag in the region associated with the B213--L1495 filament. In other regions the linear relation is flattened for Av > 4 mag. We find that the presence of temperature gradients in the molecular gas affects the determination of N(CO) by ~30--70% with the largest difference occurring at large column densities. Adding a correction for this effect and accounting for the observed relation between the column density of CO and CO2 ices and Av, we find a linear relationship between the column of carbon mon...

  11. Mutations in PCDH21 cause autosomal recessive cone-rod dystrophy

    DEFF Research Database (Denmark)

    Østergaard, Elsebet; Batbayli, M; Dunø, Morten; Vilhelmsen, K; Rosenberg, T

    2010-01-01

    Cone-rod dystrophy is a retinal dystrophy with early loss of cone photoreceptors and a parallel or subsequent loss of rod photoreceptors. It may be syndromic, but most forms are non-syndromic with autosomal dominant, autosomal recessive or X-linked recessive inheritance.......Cone-rod dystrophy is a retinal dystrophy with early loss of cone photoreceptors and a parallel or subsequent loss of rod photoreceptors. It may be syndromic, but most forms are non-syndromic with autosomal dominant, autosomal recessive or X-linked recessive inheritance....

  12. Hvordan påvirker indvandrernes integration, ressourcer og diaspora deres bosætningspræferencer?

    DEFF Research Database (Denmark)

    Andersen, Hans Skifter

    Etniske minoriteters boligønsker må i vid udstrækning antages, at have de samme årsager, som generelt er fundet i forbindelse med studier af boligvalg i Danmark og andre europæiske lande. Men indvandreres bosætning i Danmark og andre lande afviger så meget fra den indfødte befolknings, at den ikk...

  13. An assessment of population structure in eight breeds of cattle using a whole genome SNP panel

    Directory of Open Access Journals (Sweden)

    Gao Chuan

    2008-05-01

    Full Text Available Abstract Background Analyses of population structure and breed diversity have provided insight into the origin and evolution of cattle. Previously, these studies have used a low density of microsatellite markers, however, with the large number of single nucleotide polymorphism markers that are now available, it is possible to perform genome wide population genetic analyses in cattle. In this study, we used a high-density panel of SNP markers to examine population structure and diversity among eight cattle breeds sampled from Bos indicus and Bos taurus. Results Two thousand six hundred and forty one single nucleotide polymorphisms (SNPs spanning all of the bovine autosomal genome were genotyped in Angus, Brahman, Charolais, Dutch Black and White Dairy, Holstein, Japanese Black, Limousin and Nelore cattle. Population structure was examined using the linkage model in the program STRUCTURE and Fst estimates were used to construct a neighbor-joining tree to represent the phylogenetic relationship among these breeds. Conclusion The whole-genome SNP panel identified several levels of population substructure in the set of examined cattle breeds. The greatest level of genetic differentiation was detected between the Bos taurus and Bos indicus breeds. When the Bos indicus breeds were excluded from the analysis, genetic differences among beef versus dairy and European versus Asian breeds were detected among the Bos taurus breeds. Exploration of the number of SNP loci required to differentiate between breeds showed that for 100 SNP loci, individuals could only be correctly clustered into breeds 50% of the time, thus a large number of SNP markers are required to replace the 30 microsatellite markers that are currently commonly used in genetic diversity studies.

  14. A direct approach for instantaneous 3D density field reconstruction from background-oriented schlieren (BOS) measurements

    Science.gov (United States)

    Nicolas, F.; Todoroff, V.; Plyer, A.; Le Besnerais, G.; Donjat, D.; Micheli, F.; Champagnat, F.; Cornic, P.; Le Sant, Y.

    2016-01-01

    We present a new numerical method for reconstruction of instantaneous density volume from 3D background-oriented schlieren (3DBOS) measurements, with a validation on a dedicated flexible experimental BOS bench. In contrast to previous works, we use a direct formulation where density is estimated from measured deviation fields without the intermediate step of density gradient reconstruction. Regularization techniques are implemented to deal with the ill-posed problem encountered. The resulting high-dimensional optimization is conducted by conjugate gradient techniques. A parallel algorithm, implemented on graphics processing unit, helps to speed up the calculation. The resulting software is validated on synthetic BOS images of a 3D density field issued from a numerical simulation. Then, we describe a dedicated 3DBOS experimental facility which has been built to study various BOS settings and to assess the performance of the proposed numerical reconstruction process. Results on various datasets illustrate the potential of the method for flow characterization and measurement in real-world conditions.

  15. The pathogenesis of autosomal dominant polycystic kidney disease: an update.

    Science.gov (United States)

    Somlo, S; Markowitz, G S

    2000-07-01

    The identification of PKD1 and PKD2, the two major genes responsible for autosomal dominant polycystic kidney disease, are the seminal discoveries upon which much of the current investigation into the pathogenesis of this common heritable disease is based. A major mechanistic insight was achieved with the discovery that autosomal dominant polycystic kidney disease occurs by a two-hit mechanism requiring somatic inactivation of the normal allele in individual polarized epithelial cells. Most recent advances are focused on the function of the respective protein products, polycystin-1 and polycystin-2. Indirect evidence supports an interaction between polycystin-1 and -2, albeit it is unlikely that they work in concert in all tissues and at all times. They associate in yeast two hybrid and cotransfection assays and there is a striking similarity in the renal and pancreatic cystic phenotypes of Pkd2-/- and Pkd1del34/del34 mice. Also, the respective homologues of both proteins are expressed in the same sensory neuronal cells in the nematode and the human disease phenotypes remain completely overlapping with the major difference being in relative severity. Mounting evidence supports the hypothesis that polycystin-1 is a cell surface receptor. A close homologue in the sea urchin sperm mediates the acrosome reaction in response to contact with egg-jelly, the nematode homologue functions in mechano- or chemosensation, and the solution structure of the repeated extracellular polycystic kidney disease domains reveals a beta-sandwich fold commonly found in surface receptor molecules. Indirect evidence also supports the initial hypothesis that polycystin-2 is a calcium channel subunit. Several closely related homologues retain the calcium channel signature motif but differ in their predicted interaction domains, and one of these homologues has been shown to be a calcium regulated cation channel. Several important distinctions in polcystin-1 and -2 function have also been

  16. Mitochondrial anomalies in a Swiss family with autosomal dominant myoglobinuria

    Energy Technology Data Exchange (ETDEWEB)

    Martin-du Pan, R.C. [Univ. Hospital, Geneva (Switzerland); Favre, H.; Junod, A. [Univ. Hospital, Geneva (Switzerland)] [and others

    1997-04-14

    We report on a Swiss family in which 10 individuals of both sexes in 4 successive generations suffered from myoglobinuria, precipitated by febrile illness. It is the second family described with autosomal dominant inheritance of myoglobinuria. Four individuals suffered acute renal failure, which in two was reversible only after dialysis. In a recent case, a mitochondrial disorder was suspected because of an abnormal increase in lactate levels during an exercise test and because of a subsarcolemmal accumulation of mitochondria in a muscle biopsy, associated with a lack of cytochrome C oxidase in some muscle fibers. No mutation in the mitochondrial DNA was identified. Along with the inheritance pattern, these findings suggest that the myoglobinuria in this family is caused by a nuclear-encoded mutation affecting the respiratory chain. 22 refs., 2 figs.

  17. Novel therapeutic approaches to autosomal dominant polycystic kidney disease.

    Science.gov (United States)

    LaRiviere, Wells B; Irazabal, Maria V; Torres, Vicente E

    2015-04-01

    Autosomal dominant polycystic kidney disease (ADPKD) is an inherited disorder characterized by the progressive growth of renal cysts that, over time, destroy the architecture of the renal parenchyma and typically lead to kidney failure by the sixth decade of life. ADPKD is common and represents a leading cause of renal failure worldwide. Currently, there are no Food and Drug Administration-approved treatments for the disease, and the existing standard of care is primarily supportive in nature. However, significant advances in the understanding of the molecular biology of the disease have inspired investigation into potential new therapies. Several drugs designed to slow or arrest the progression of ADPKD have shown promise in preclinical models and clinical trials, including vasopressin receptor antagonists and somatostatin analogs. This article examines the literature underlying the rationale for molecular therapies for ADPKD and reviews the existing clinical evidence for their indication for human patients with the disease. PMID:25438190

  18. Autosomal dominant inheritance Caffey-Silverman disease hyperostosis corticalis infantum

    International Nuclear Information System (INIS)

    A case of Caffey-Silverman disease is described in an infant aged 4.5 months. The case was erroneously diagnosed in the initial stage of the disease as osteitis. The correct diagnosis was established after radiological examination of the skeleton. The pathological lesions involved the mandible, both clavicles, all ribs, left shoulder blade, both radial bones and left ulna. Follow-up radiological examination after 12 months demonstrated nearly complete disappearance of the previously observed skeletal changes. At the age of 18 months the condition of the child was good and its development was normal. Radiological changes indicating past Caffey-Silverman disease were disclosed in the mother and maternal grandmother of the child. This indicates an autosomal dominant type of inheritance of the disease. (Author)

  19. Autosomal dominant polycystic kidney disease: New insights into treatment

    Directory of Open Access Journals (Sweden)

    Imed Helal

    2013-01-01

    Full Text Available Autosomal dominant polycystic kidney disease (ADPKD is the world′s most common inherited kidney disease. An increasing number of animal and human studies have enhanced our understanding of the molecular and cellular pathology of ADPKD. New treatment options are being tested in clinical trials in spite of the failure of mammalian target of rapamycin inhibitor therapy. The main and most effective therapy remains control of hypertension by renin-angiotensin-aldosterone system (RAAS blockade. This review focuses only on promising therapies, including dual inhibition of RAAS, vasopressin receptor antagonists, increased fluid intake, and blockade of certain receptors of cyclic adenosine monophosphate. Also, the paper reviews what these advances mean to patients and clinicians and elaborates on how these changes can be immediately applied to clinical practice. There is an urgent need for discovery of new therapies targeted toward ADPKD in comparison with therapeutic progress of all other renal diseases.

  20. Autism in siblings with autosomal dominant nocturnal frontal lobe epilepsy.

    Science.gov (United States)

    Miyajima, Tomoko; Kumada, Tomohiro; Saito, Keiko; Fujii, Tatsuya

    2013-02-01

    In 1999, Hirose et al. reported a Japanese family with autosomal dominant nocturnal frontal lobe epilepsy (ADNFLE) associated with a neuronal nicotinic acetylcholine receptor α4 subunit mutation (S252L). We followed the siblings of this family, and found that the elder brother had Asperger's disorder without mental retardation (MR) and the younger brother had autistic disorder with profound MR. The clinical epileptic features of the siblings were very similar, and both had deficits in socialization, but their cognitive development differed markedly. It thus seems that epilepsy is the direct phenotype of the S252L mutation, whereas other various factors modulate the cognitive and social development. No patients with ADNFLE have previously been reported to have autism spectrum disorder or profound MR. PMID:22883468

  1. Renal and extrarenal manifestations of autosomal dominant polycystic kidney disease

    Directory of Open Access Journals (Sweden)

    E.A. Romão

    2006-04-01

    Full Text Available The objective of the present study was to determine the frequency of the most common clinical features in patients with autosomal dominant polycystic kidney disease in a sample of the Brazilian population. The medical records of 92 patients with autosomal dominant polycystic kidney disease attended during the period from 1985 to 2003 were reviewed. The following data were recorded: age at diagnosis, gender, associated clinical manifestations, occurrence of stroke, age at loss of renal function (beginning of dialysis, and presence of a family history. The involvement of abdominal viscera was investigated by ultrasonography. Intracranial alterations were prospectively investigated by magnetic resonance angiography in 42 asymptomatic patients, and complemented with digital subtraction arteriography when indicated. Mean age at diagnosis was 35.1 ± 14.9 years, and mean serum creatinine at referral was 2.4 ± 2.8 mg/dL. The most frequent clinical manifestations during the disease were arterial hypertension (63.3%, lumbar pain (55.4%, an abdominal mass (47.8%, and urinary infection (35.8%. Loss of renal function occurred in 27 patients (mean age: 45.4 ± 9.5 years. The liver was the second organ most frequently affected (39.1%. Stroke occurred in 7.6% of the patients. Asymptomatic intracranial aneurysm was detected in 3 patients and arachnoid cysts in 3 other patients. In conclusion, the most common clinical features were lumbar pain, arterial hypertension, abdominal mass, and urinary infection, and the most serious complications were chronic renal failure and stroke. Both intracranial aneurysms and arachnoid cysts occurred in asymptomatic patients at a frequency of 7.14%.

  2. Connexin 26 and autosomal recessive non-syndromic hearing loss

    Directory of Open Access Journals (Sweden)

    Mukherjee Monisha

    2003-01-01

    Full Text Available Prelingual deafness occurs with a frequency of 1 in 1000 live births and is divided into syndromic and non-syndromic forms contributing 40 and 60% respectively. Autosomal recessive non-syndromic hearing loss (ARNSHL is responsible for 80% cases of childhood deafness. Nearly all genes localized for ARNSHL cause prelingual, severe to profound, sensorineural hearing impairment. ARNSHL is genetically heterogeneous and at least 39 loci have been identified. The most significant finding to date has been the discovery of mutations in GJB2 gene at the DFNB1 locus on chromosome 13q12 as the major cause of profound prelingual deafness. This was first reported in a Tunisian family in 1994 and thereafter in many different countries. GJB2 gene encodes the gap-junction protein, connexin 26 (Cx26, mutations in which have become the first genetic marker of inherited hearing loss. Allele-specific polymerase chain reaction (AS-PCR, single stranded conformation polymorphism (SSCP and sequencing methods have been developed for the detection of mutations in Cx26 gene. In India as well, the Cx26 mutations are being screened in families with hearing impaired children using these molecular methods. Therefore, in order to create awareness among the clinicians and the affected families; we have attempted to review the Cx26 gene mutations responsible for autosomal recessive type of non-syndromic hearing loss. The efficacy and utility of Cx26 gene analysis might open the path to proper counseling of families for carrier detection and prenatal diagnosis. It may even facilitate the development of strategies in future for the treatment of this common genetic disorder.

  3. Genetic linkage studies in autosomal recessive retinitis pigmentosa

    Energy Technology Data Exchange (ETDEWEB)

    Mansfield, D.C.; Teague, P.W.; Barber, A. [Western General Hospital, Edinburgh (United Kingdom)] [and others

    1994-09-01

    Autosomal recessive retinitis pigmentosa (arRP) is a severe retinal dystrophy characterized by night blindness, progressive constriction of the visual fields and loss of central vision in the fourth or fifth decades. The frequency of this form of retinitis pigmentosa (RP) varies in different populations. Mutations within the rhodopsin, cyclic GMP phosphodiesterase-{beta} subunit and cGMP-gated channel genes have been reported in some arRP families. The genetic loci responsible for the majority of cases have yet to be identified. Genetic heterogeneity is likely to be extensive. In order to minimize the amount of genetic heterogenity, a set of arRP families was ascertained within the South-Central Sardinian population, in which 81% of families with a known mode of inheritance show an autosomal recessive form of RP. The Sardinian population is an ethnic {open_quotes}outlier{close_quotes}, having remained relatively isolated from mainland and other cultures. Genetic linkage data has been obtained in a set of 11 Sardinian arRP kindreds containing 26 affected members. Under the assumption of genetic homogeneity, no evidence of linkage was found in the arRP kindreds using 195 markers, which excluded 62% of the genome (Z<-2). Positive lod scores were obtained with D14S80 which showed no recombination in a subset of 5 families. Heterogeneity testing using D14S80 and arRP showed no significant evidence of heterogeneity (p=0.18) but evidence of linkage ({chi}{sup 2}=3.64, p=0.028). We are currently screening the neural retina-specific leucine zipper gene (NRL) in 14q11 for mutations as a candidate locus.

  4. Autosomal dominant polycystic kidney disease: genetics, epidemiology, and treatment

    Directory of Open Access Journals (Sweden)

    Reed-Gitomer B

    2014-10-01

    Full Text Available Berenice Reed-Gitomer Division of Renal Diseases and Hypertension, Department of Medicine, University of Colorado Anschutz Medical Campus, Aurora, CO, USA Abstract: Autosomal dominant polycystic kidney disease (ADPKD is the most common potentially lethal genetic disorder, accounting for 2%–8% of end-stage renal disease worldwide. While development of renal cysts is the major characteristic of ADPKD, several disease-related complications contribute significantly to morbidity and mortality. Since introduction of renal replacement therapies, cardiovascular disease is the leading cause of death among ADPKD patients. Loss of renal function requiring renal replacement therapy occurs in 50% of patients by the age of 60 years. The results of recent large epidemiological studies in ADPKD have shown little progress in delaying onset of renal failure despite an improvement in patient mortality. Significant progress has been made over the past decade in elucidating the genetics of the disorder. Genetic testing is now available in most countries, and development of more reliable methods for prenatal diagnosis of ADPKD has increased the sensitivity of testing. While there are no approved drugs for treatment of ADPKD within the USA, the first agent targeting renal disease progression in this disorder was recently approved for clinical use in Japan. Furthermore, several additional drugs for treatment of ADPKD are currently under clinical investigation. Overall, this presents an optimistic future for new therapeutic interventions in this disease. This paper reviews the current knowledge related to the epidemiology, genetics, and treatment of ADPKD. Keywords: autosomal dominant polycystic kidney disease, hereditary renal disease, renal cyst, genetics

  5. The complete sequence of mitochondrial genome of polled yak (Bos grunniens).

    Science.gov (United States)

    Chu, Min; Wu, Xiaoyun; Liang, Chunnian; Pei, Jie; Ding, Xuezhi; Guo, Xian; Bao, Pengjia; Yan, Ping

    2016-05-01

    Generally speaking, the hornless trait is also known as polled. Although the POLL locus could be assigned to a 1.36-Mb interval in the centromeric region of BTA1 (Georges et al., 1993; Drögemüller et al., 2005)), and (Liu et al., 2014) reported a 147-kb segment that included three protein-coding genes was the most likely location of the POLL mutation in domestic yaks, the underlying genetic basis for the polled trait is still unknown. In this work, the complete mitochondrial genome sequence of polled yak was determined for the first time. The total length of the mitogenome is 16,324 bp long, with the base composition of 33.72% A, 27.25% T, 25.83% C, and 13.20% G. It contained 13 protein-coding genes, 22 tRNA genes, 2 rRNA genes and 1 non-coding region (D-loop region). The gene order of polled yak mitogenome is identical to that observed in most other vertebrates. The complete mitogenome sequence information of polled yak will provide useful data for further studies on protection of genetic resources and phylogenetic relationships within Bos grunniens. PMID:25347693

  6. Magnetic Resonance Imaging of the Normal Stifle Joint in Buffaloes (Bos Bubalis: An Anatomic Study

    Directory of Open Access Journals (Sweden)

    Moustafa Samy Sherif

    2014-12-01

    Full Text Available The aim of the present study was to describe the normal anatomy of the stifle joint in buffaloes (Bos bubalis on magnetic resonance images and related anatomical sectional slices to facilitate the interpretation of all these images, as well as to understand the basis for diseases diagnosis. The hind limbs of ten healthy adult buffaloes (Twenty stifle joints were used. After slaughtering, MR images were made in sagittal, transverse, and dorsal planes. The limbs then were frozen at -20° then correspondingly sectioned using an electric band saw. Clinically relevant anatomic structures were identified and labeled at each level in the corresponding images (MR and anatomic slices. MRI images were used to identify the bony and soft tissue structures of the stifle joint. The articular cartilage appeared with hyperintense signal and separated from the subcondral bone by gray line (moderate signal intensity. It is difficult to differentiate between the synovia, infrapatellar fat body and the articular cartilage because they appeared with hyperintense signal. The meniscial, femoropatellar and cruciate ligaments recognized as moderate signal intensity. However, the collateral and intermediate patellar ligaments, the common tendon of the Mm. extensor digitorum longus and peroneus tertius as well as the menisci and the medial patellar fibrocartilage appeared with hypointense signal. The knowledge of normal anatomy of the buffalo stifle joint would serve as initial reference to the evaluation of MR images in this species.

  7. Collection, analysis and cryopreservation of semen from Malayan gaur (Bos gaurus hubbacki): A preliminary study

    Science.gov (United States)

    Iswadi, M.I.; Ann, Z.F.; Hafiz, M.M.; Hafiz, M.D.; Fahrul, F.J.; Hajarian, H.; Wahid, H.; Zawawi, I.; Khairiah, M.S.; Mazni, O.A.

    2012-01-01

    The Malayan gaur (Bos gaurus hubbacki) or Seladang is classified as vulnerable by the International Union for Conservation of Nature and Natural Resources (IUCN). The Malayan gaur is mainly distributed in the tropical woodlands of Peninsular Malaysia and Southern Thailand. The aim of this study was to collect, analyze and cryopreserve the semen of wild Malayan gaur. Transrectal massage (TM) and electroejaculation (EEJ) technique was applied in semen collection of the Malayan gaur. The semen was then cryopreserved in liquid nitrogen using slow freezing technique. Makler counting chamber was used to evaluate sperm concentration and motility, while the sperm viability and morphology of fresh and post-thaw sperm was determined using eosin-nigrosin staining protocol. As a result, we have successfully collected the Malayan gaur semen using EEJ technique. Sperm motility, viability and morphological changes of the post-thaw semen of Malayan gaur were found undesirable due to the complication of the cryopreservation process. On the basis of current study it can be concluded that Malayan gaur bulls semen can be obtain by EEJ with no evidence of rectal trauma. Optimization of the process of cryopreservation for Malayan gaur sperm is needed to maintain the cryoviability of the good sperm quality. The data generated in this study would be useful in conservation of genetic diversity program for Malayan gaur. PMID:26623302

  8. DGAT1 and ABCG2 polymorphism in Indian cattle (Bos indicus and buffalo (Bubalus bubalis breeds

    Directory of Open Access Journals (Sweden)

    Mishra Bina

    2006-11-01

    Full Text Available Abstract Background Indian cattle (Bos indicus and riverine buffalo (Bubalus bubalis give a poor yield of milk but it has a high fat and protein percentage compared to taurine cattle. The identification of QTLs (Quantitative Trait Loci on BTA14 and BTA6 and its subsequent fine mapping has led to identification of two non conservative mutations affecting milk production and composition. Our objective was to estimate the frequency of K232A (DGAT1 – diacylglycerol – acyltransferase 1 and Y581S (ABCG2 – ATP binding cassette sub family G member 2 polymorphisms in diverse cattle and buffalo breeds of India having large variation in terms of milk production. Results We screened the reported missense mutations in six cattle and five buffalo breeds. The DGAT1K and ABCG2Y alleles were found to be fixed in Indian cattle and buffalo breeds studied. Conclusion This study provides an indirect evidence that all the Indian cattle and buffalo breeds have fixed alleles with respect to DGAT1 and ABCG2 genes reported to be responsible for higher milk fat yield, higher fat and protein percent.

  9. Collection, analysis and cryopreservation of semen from Malayan gaur (Bos gaurus hubbacki: A preliminary study

    Directory of Open Access Journals (Sweden)

    M.S. Khairiah

    2012-10-01

    Full Text Available The Malayan gaur (Bos gaurus hubbacki or Seladang is classified as vulnerable by the International Union for Conservation of Nature and Natural Resources (IUCN. The Malayan gaur is mainly distributed in the tropical woodlands of Peninsular Malaysia and Southern Thailand. The aim of this study was to collect, analyze and cryopreserve the semen of wild Malayan gaur. Transrectal massage (TM and electroejaculation (EEJ technique was applied in semen collection of the Malayan gaur. The semen was then cryopreserved in liquid nitrogen using slow freezing technique. Makler counting chamber was used to evaluate sperm concentration and motility, while the sperm viability and morphology of fresh and post-thaw sperm was determined using eosin-nigrosin staining protocol. As a result, we have successfully collected the Malayan gaur semen using EEJ technique. Sperm motility, viability and morphological changes of the post-thaw semen of Malayan gaur were found undesirable due to the complication of the cryopreservation process. On the basis of current study it can be concluded that Malayan gaur bulls semen can be obtain by EEJ with no evidence of rectal trauma. Optimization of the process of cryopreservation for Malayan gaur sperm is needed to maintain the cryoviability of the good sperm quality. The data generated in this study would be useful in conservation of genetic diversity program for Malayan gaur.

  10. In vivo Efficacy of Vernonia amygdalina (Compositae Against Natural Helminth Infection in Bunaji (Bos indicus Calves

    Directory of Open Access Journals (Sweden)

    C. B. I. Alawa ab*, A. M. Adamu, J. O. Gefub, O. J. Ajanusic, P. A. Abdud and N. P. Chiezeyb

    2010-10-01

    Full Text Available Fifteen Bunaji calves (Bos indicus averaging 105±12.5 Kg liveweight and approximately nine months of age with natural helminth infection were distributed into three treatment groups of five animals each. Animals were either treated orally with aqueous extract of Vernonia amygdalina at a dose concentration of 1.1g/Kg body weight, a conventional anthelmintic or left untreated. V. amygdalina treatment produced 59.5% reduction in eggs per gram (EPG of faeces which was significantly different (P<0.001 from the untreated control (-17.24%, whereas levamisol hydrochloride treatment produced 100% reduction in EPG. A total of six genera of helminths were recovered from the gastrointestinal tracts and liver of experimental animals. These were Haemonchus contortus, Trichostrongylus spp, Bunostomum spp, Oesophagostomum spp, Fasciola spp and Dicrocoelium spp. There was significant difference (P<0.001 in worm load between the different treatment groups. Except for Haemonchus spp, animals in the untreated group had significantly (P<0.001 higher worm load for all the genera of helminth recovered than those of the V. amygdalina treated group, indicating that V. amygdalina had no effect on Haemonchus contortus.

  11. Chorioretinal dysplasia-microcephaly-mental retardation syndrome : Another family with autosomal dominant inheritance

    NARCIS (Netherlands)

    Hordijk, R; VandeLogt, F; Houtman, WA; VanEssen, AJ

    1996-01-01

    We describe a boy and his father with the chorioretinal dysplasia-microcephaly-mental retardation syndrome (CDMMS). Our report extends the phenotypic spectrum of autosomal dominant CDMMS by describing microphthalmia for the first time in an autosomal dominant family. The boy was also severely mental

  12. Aicardi syndrome associated with autosomal genomic imbalance: coincidence or evidence for autosomal inheritance with sex-limited expression?

    Science.gov (United States)

    Prontera, P; Bartocci, A; Ottaviani, V; Isidori, I; Rogaia, D; Ardisia, C; Guercini, G; Mencarelli, A; Donti, E

    2013-04-01

    Aicardi syndrome (AIS), a rare neurodevelopmental disorder thought to be caused by an X-linked dominant mutation, is characterized by 3 main features: agenesis of corpus callosum, infantile spams and chorioretinal lacunae. A genome-wide study of a girl with AIS lead us to identify a 6q deletion;12q duplication, derived from a maternal 6q;12q translocation. The two intellectually impaired brothers of the proband showed the same genomic anomalies, but not the constellation of features characterizing the AIS. This could be either a coincidental observation of 2 rare conditions, but can also suggest an alternative hypothesis for the genetic etiology of AIS, indicating the existence of a subset of autosomal genes whose mutation could act in a sex-confined manner. PMID:23801936

  13. Ultrastructure of spermatozoa of Onthophagus taurus (Coleoptera, Scarabaeidae) exhibits heritable variation

    Science.gov (United States)

    Werner, Michael; Simmons, Leigh W.

    2011-03-01

    Sperm competition is thought to be an important selective pressure shaping sperm form and function. However, few studies have moved beyond gross examinations of sperm morphology. Sperm length is subject to sexual selection via sperm competition in the scarab beetle Onthophagus taurus. Here, the structure and ultrastructure of spermatozoa in this species were investigated using light and electron microscopy. Spermatozoa were found to be filiform, measuring about 1,200 mm in length. The sperm head consists of a three-layered acrosome and a nuclear region bearing the anterior extension of the centriole adjunct. Acrosome and nuclear regions are bilaterally symmetric, with their axes of symmetry being orthogonal to each other. Head and flagellar structures are connected by a well-developed centriole adjunct. The sperm heads are asymmetrically surrounded by accessory material and embedded into the cytoplasm of the spermatocyst cell. The accessory material is produced inside the spermatids and then transferred to the outside due to a new membrane formed around the sperm's organelles. The old spermatid membrane separates the accessory material from the cyst cell. The flagellum contains a 9+9+2 axoneme, two accessory bodies, and two mitochondrial derivatives of unequal size. The major mitochondrial derivative is significantly larger than the minor one. The axoneme is arranged in a sinusoidal manner parallel along the major mitochondrial derivative. The spermatozoa show no progressive motility when released in buffer solution which is likely to be the result of the flagellar arrangement and the structure of the major mitochondrial derivative. The cross-sectional area of the minor and the major mitochondrial derivatives show different patterns of genetic variation. The data provide the first estimates of genetic variation in sperm ultrastructure for any species, and give evidence for the persistence of genetic variation in ultrastructure required for the rapid and divergent

  14. Grey nurse shark (Carcharias taurus) diving tourism: Tourist compliance and shark behaviour at Fish Rock, Australia.

    Science.gov (United States)

    Smith, Kirby; Scarr, Mark; Scarpaci, Carol

    2010-11-01

    Humans can dive with critically endangered grey nurse sharks (Carcharias taurus) along the east coast of Australia. This study investigated both compliance of tourist divers to a code of conduct and legislation and the behaviour of grey nurse sharks in the presence of divers. A total of 25 data collection dives were conducted from December 2008 to January 2009. Grey nurse shark and diver behaviour were documented using 2-min scan samples and continuous observation. The proportion of time spent observing human-shark interactions was 9.4% of total field time and mean human-shark interaction time was 15.0 min. Results were used to gauge the effectiveness of current management practices for the grey nurse shark dive industry at Fish Rock in New South Wales, Australia. Grey nurse shark dive tourists were compliant to stipulations in the code of conduct and legislation (compliance ranged from 88 to 100%). The research detailed factors that may promote compliance in wildlife tourism operations such as the clarity of the stipulations, locality of the target species and diver perceptions of sharks. Results indicated that grey nurse sharks spent the majority of their time milling (85%) followed by active swimming (15%). Milling behaviour significantly decreased in the presence of more than six divers. Distance between sharks and divers, interaction time and number of sharks were not significantly correlated with grey nurse shark school behaviour. Jaw gaping, rapid withdrawal and stiff or jerky movement were the specific behaviours of grey nurse sharks that occurred most frequently and were associated with distance between divers and sharks and the presence of six or more divers. Revision of the number of divers allowed per interaction with a school of grey nurse sharks and further research on the potential impacts that shark-diving tourism may pose to grey nurse sharks is recommended. PMID:20872140

  15. Grey Nurse Shark ( Carcharias taurus) Diving Tourism: Tourist Compliance and Shark Behaviour at Fish Rock, Australia

    Science.gov (United States)

    Smith, Kirby; Scarr, Mark; Scarpaci, Carol

    2010-11-01

    Humans can dive with critically endangered grey nurse sharks ( Carcharias taurus) along the east coast of Australia. This study investigated both compliance of tourist divers to a code of conduct and legislation and the behaviour of grey nurse sharks in the presence of divers. A total of 25 data collection dives were conducted from December 2008 to January 2009. Grey nurse shark and diver behaviour were documented using 2-min scan samples and continuous observation. The proportion of time spent observing human-shark interactions was 9.4% of total field time and mean human-shark interaction time was 15.0 min. Results were used to gauge the effectiveness of current management practices for the grey nurse shark dive industry at Fish Rock in New South Wales, Australia. Grey nurse shark dive tourists were compliant to stipulations in the code of conduct and legislation (compliance ranged from 88 to 100%). The research detailed factors that may promote compliance in wildlife tourism operations such as the clarity of the stipulations, locality of the target species and diver perceptions of sharks. Results indicated that grey nurse sharks spent the majority of their time milling (85%) followed by active swimming (15%). Milling behaviour significantly decreased in the presence of more than six divers. Distance between sharks and divers, interaction time and number of sharks were not significantly correlated with grey nurse shark school behaviour. Jaw gaping, rapid withdrawal and stiff or jerky movement were the specific behaviours of grey nurse sharks that occurred most frequently and were associated with distance between divers and sharks and the presence of six or more divers. Revision of the number of divers allowed per interaction with a school of grey nurse sharks and further research on the potential impacts that shark-diving tourism may pose to grey nurse sharks is recommended.

  16. A census of dense cores in the Taurus L1495 cloud from the Herschel

    Science.gov (United States)

    Marsh, K. A.; Kirk, J. M.; André, Ph.; Griffin, M. J.; Könyves, V.; Palmeirim, P.; Men'shchikov, A.; Ward-Thompson, D.; Benedettini, M.; Bresnahan, D. W.; Francesco, J. Di; Elia, D.; Motte, F.; Peretto, N.; Pezzuto, S.; Roy, A.; Sadavoy, S.; Schneider, N.; Spinoglio, L.; White, G. J.

    2016-06-01

    We present a catalogue of dense cores in a ˜4° × 2° field of the Taurus star-forming region, inclusive of the L1495 cloud, derived from Herschel SPIRE and PACS observations in the 70 μm, 160 μm, 250 μm, 350 μm, and 500 μm continuum bands. Estimates of mean dust temperature and total mass are derived using modified blackbody fits to the spectral energy distributions. We detect 525 starless cores of which ˜10-20 per cent are gravitationally bound and therefore presumably prestellar. Our census of unbound objects is ˜85 per cent complete for M > 0.015 M⊙ in low-density regions (AV ≲ 5 mag), while the bound (prestellar) subset is ˜85 per cent complete for M > 0.1 M⊙ overall. The prestellar core mass function (CMF) is consistent with lognormal form, resembling the stellar system initial mass function, as has been reported previously. All of the inferred prestellar cores lie on filamentary structures whose column densities exceed the expected threshold for filamentary collapse, in agreement with previous reports. Unlike the prestellar CMF, the unbound starless CMF is not lognormal, but instead is consistent with a power-law form below 0.3 M⊙ and shows no evidence for a low-mass turnover. It resembles previously reported mass distributions for CO clumps at low masses (M ≲ 0.3 M⊙). The volume density PDF, however, is accurately lognormal except at high densities. It is consistent with the effects of self-gravity on magnetized supersonic turbulence. The only significant deviation from lognormality is a high-density tail which can be attributed unambiguously to prestellar cores.

  17. Taurus Littrow Pyroclastic Deposit-An Optimum Feedstock for Lunar Oxygen

    Science.gov (United States)

    Allen, Carlton C.

    2014-01-01

    Future human habitation of the Moon will likely require the use of locally derived materials because of the high cost of transportation from Earth. Oxygen, extracted from oxides and silicates, is a potentially abundant lunar resource vital for life support and spacecraft propulsion. The anticipated costs of supplying all oxygen needs for a lunar base from Earth are high enough to warrant serious study of oxygen production from local resources. Over 20 different processes have been proposed for oxygen production on the Moon. Among the simplest and best studied of these processes is the reduction of oxides in lunar minerals and glass using hydrogen gas. Oxygen can be extracted from lunar soils and pyroclastic glass beads by exposing the samples to flowing hydrogen at subsolidus temperatures (approx. 1050 C). Total oxygen yield is directly correlated to the sample's abundance of FeO, but is not correlated to the abundance of any other oxide. Oxygen is extracted predominantly from FeO, with lesser contributions from TiO2 and SiO2. Oxygen yield is independent of soil maturity. All major FeO-bearing phases contribute oxygen, with extraction from ilmenite and glass significantly more efficient than from olivine and pyroxene. This study demonstrates that the optimum location for a lunar resources demonstration mission can be identified, and that the oxygen yield can be predicted, using a combination of high-resolution imaging and thermal-infrared data. A mission to Taurus Littrow will encounter a deposit at least 10 m in depth with few landing hazards, a uniform composition, and a predicted oxygen yield of approximately 3 wt. %, among the highest values on the Moon.

  18. Performance evaluation of bolt-cutter system on first Taurus launch

    Science.gov (United States)

    Baban, F.; Williams, R.; Amimoto, S.; Hansen, W.; Bixler, T.

    1994-10-01

    In rapid response to the request of the Space Test and Experimentation Directorate in Space Launch Operations, a launch-critical experimental investigation was conducted to evaluate the performance of a particular bolt-cutter system for separating stages on the first Taurus launch. The tests were to examine the variation of tension preloading on the bolt system and to demonstrate the tolerable margin on this parameter for such launches with the new types of bolts since the preloading was known to vary as much as 12% from a preset value before launch. We planned and carried out the experiment, designed and assembled the fixture to properly simulate flight application, and developed diagnostics. Four bolt cutters were purchased from the manufacturer for these tests, and one was provided by the contractor. In addition to the obvious requirement to demonstrate the successful severing of bolts under varying preloads, ignition-wire current and timing of chisel impact on the bolt were monitored. An optical diagnostic was designed to determine the flyout velocity and kinetic energy of the broken pieces. These latter measurements will be useful in anchoring performance codes simulating and assessing the structural dynamics of the bolt-cutter function for future missions. The tests were conducted successfully and the bolts were severed successfully in all five tests. The preloads were successively lowered from 2,500 lb to 2,250, 2,000, 1,500, and 1,000 lb These tests contributed in a timely manner to the STEP launch decision and to launch mission assurance. They demonstrated important margin to the nominally set 3,200 lb. preload. The entire complicated experimental program from inception to completion was accomplished in less than three weeks.

  19. Comparison of carfentanil-xylazine and thiafentanil-medetomidine in electroejaculation of captive gaur (Bos gaurus).

    Science.gov (United States)

    Napier, Julia E; Loskutoff, Naida M; Simmons, Lee G; Armstrong, Douglas L

    2011-09-01

    Carfentanil citrate and thiafentanil oxalate have been used successfully to immobilize captive and free-ranging ungulates. The objective of this study was to compare the efficacy and certain physiologic parameters of protocols by using the 2 opioids in gaur (Bos gaurus). Eight adult gaur bulls were immobilized for electroejaculation at Omaha's Henry Doorly Zoo (Omaha, Nebraska, USA). All the animals were immobilized twice, by using each of the following protocols one time: 10 mg carfentanil combined with 100 mg xylazine (CX), reversed with 1,000 mg naltrexone and 24 mg yohimbine; and 12 mg thiafentanil combined with 20 mg medetomidine (TM), reversed with 120 mg naltrexone and 100 mg atipamezole. Immobilization drugs were delivered intramuscularly into the shoulder area via pole syringe. Electroejaculation was carried out by a standardized protocol to duplicate procedural stimulation on each animal. Induction and recovery times, initial rectal temperature, heart rate, respiratory rate, anesthetic depth, oxygen saturation, indirect blood pressure, and arterial blood gases were recorded at the time of initial handling, before ejaculation, and after ejaculation. Antagonists were administered 1/4 i.v. and 3/4 s.q. Both protocols require a small volume of drug for a large ungulate, provide smooth induction, and adequate anesthesia. Both protocols produced a significant hypoxemia, although the animals on CX showed slightly better blood gas values (based on lower partial pressure of carbon dioxide) and numerically lower blood pressure values. Animals on TM had better muscle relaxation and smoother recoveries, with no renarcotization noted. The results of the present study indicate the TM and CX protocols used for immobilizing gaur result in similar quality ejaculates that can be used for fertility examination as well as for assisted reproduction such as artificial insemination. Additional immobilizations need to take place to further compare these 2 combinations in this

  20. [Clinical diagnosis of Autosomal Dominant Polycystic Kidney Disease].

    Science.gov (United States)

    Magistroni, Riccardo; Izzi, Claudia; Scolari, Francesco

    2016-01-01

    Autosomal dominant polycystic kidney disease (ADPKD) is the most common genetic disorder related to kidney. ADPKD is usually easy to diagnose in people who have a family history of ADPKDs developing typical symptoms, including flank, abdominal pain or macroscopic hematuria. In this setting, diagnosis in adults at risk for ADPKD is commonly performed by ultrasonography, which reveals two enlarged kidneys with multiple bilateral cysts. ADPKD may be more difficult to diagnose in the absence of family history or in subjects with atypical presentation, including asymmetric or focal renal imaging findings, discordant disease within family, early onset of ADPKD and development of ESRD before 30 yr of age. The presence of a total of three or more renal cysts for at-risk subjects aged 15-39 years and two cysts or more in each kidney for at-risk subjects aged 40-59 years are sufficient for the diagnosis of ADPKD. The absence of any renal cyst is sufficient for disease exclusion only for at-risk subjects aged 40 years or older. If the family history is negative, the diagnosis of ADPKD can be made in a patient with enlarged kidneys, numerous cysts, presence of liver cysts and absence of findings suggesting a different cystic disease. If the imaging diagnosis is not clear or showing atypical manifestations in subjects, molecular genetic testing should be performed. PMID:27067212

  1. Patterns of autosomal dominant polycystic kidney diseases in black Africans

    Directory of Open Access Journals (Sweden)

    Fary Ka Elhadj

    2010-01-01

    Full Text Available Autosomal dominant polycystic kidney disease (ADPKD is not well described in black Africans while some data suggesting the disease is exceptional in this race. A retrospective study of patients with ADPKD followed in nephrology department of a teaching hospital in Dakar (January 1, 1995 to December 31, 2005 was therefore undertaken. Prevalence of ADPKD was one in 250. Mean age was 47 ± 5 years with a predominance of male (57%. High blood pressure (HBP was present in 68% of patients. Other renal manifestations were flank pain, hematuria and proteinuria. Majority of patients had impaired renal function at time of diagnosis. Extra-renal cysts were essentially found in liver (45.5%, pancreas and seminal vesicles. Main complications: ESRD (51% occurred within a 6 year mean period, urinary tract infection (13% and cerebral haemorrhage (2%. HBP control, in general needed 2 or more antihypertensive drugs. Fourteen patients died, ten patients had been on haemodialysis and four others died from uremic compli-cations. In conclusion, ADPKD in black African adults is not rare and probably underdiagnosed. Early HBP and ESRD are likely more frequent than in other races. Earlier ultrasound detection and strategies to preserve renal function should be offered to at-risk individuals to improve outcomes.

  2. Caffeine intake by patients with autosomal dominant polycystic kidney disease

    Energy Technology Data Exchange (ETDEWEB)

    Vendramini, L.C.; Nishiura, J.L.; Baxmann, A.C.; Heilberg, I.P. [Disciplina de Nefrologia, Departamento de Medicina, Universidade Federal de São Paulo, São Paulo, SP (Brazil)

    2012-07-20

    Because caffeine may induce cyst and kidney enlargement in autosomal dominant polycystic kidney disease (ADPKD), we evaluated caffeine intake and renal volume using renal ultrasound in ADPKD patients. Caffeine intake was estimated by the average of 24-h dietary recalls obtained on 3 nonconsecutive days in 102 ADPKD patients (68 females, 34 males; 39 ± 12 years) and compared to that of 102 healthy volunteers (74 females, 28 males; 38 ± 14 years). The awareness of the need for caffeine restriction was assessed. Clinical and laboratory data were obtained from the medical records of the patients. Mean caffeine intake was significantly lower in ADPKD patients versus controls (86 vs 134 mg/day), and 63% of the ADPKD patients had been previously aware of caffeine restriction. Caffeine intake did not correlate with renal volume in ADPKD patients. There were no significant differences between the renal volumes of patients in the highest and lowest tertiles of caffeine consumption. Finally, age-adjusted multiple linear regression revealed that renal volume was associated with hypertension, chronic kidney disease stage 3 and the time since diagnosis, but not with caffeine intake. The present small cross-sectional study indicated a low level of caffeine consumption by ADPKD patients when compared to healthy volunteers, which was most likely due to prior awareness of the need for caffeine restriction. Within the range of caffeine intake observed by ADPKD patients in this study (0-471 mg/day), the renal volume was not directly associated with caffeine intake.

  3. PARK1 gene mutation of autosomal dominant Parkinson's disease family

    Institute of Scientific and Technical Information of China (English)

    Ligang Jiang; Guohua Hu; Qiuhui Chen; Ying Zhang; Xinyu Hu; Jia Fan; Lifeng Liu; Rui Guo; Yajuan Sun; Yixhi Zhang

    2011-01-01

    Studies have shown that PARK1 gene is associated with the autosomal dominant inheritance of Parkinson's disease.PARK1 gene contains two mutation sites, namely Ala30Pro and AIa53Thr, which are located on exons 3 and 4, respectively.However, the genetic loci of the pathogenic genes remain unclear.In this study, blood samples were collected from 11 members of a family with high prevalence of Parkinson's disease, including four affected cases, five suspected cases,and two non-affected cases.Point mutation screening of common mutation sites on PARK1 gene exon 4 was conducted using PCR, to determine the genetic loci of the causative gene for Parkinson's disease.Gene identification and sequencing results showed that a T base deletion mutation was observed in the PARK1 gene exon 4 of all 11 collected samples.It was confirmed that the PARKf gene exon 4 gene mutation is an important pathogenic mutation for Parkinson's disease.

  4. Caffeine intake by patients with autosomal dominant polycystic kidney disease

    Directory of Open Access Journals (Sweden)

    L.C. Vendramini

    2012-09-01

    Full Text Available Because caffeine may induce cyst and kidney enlargement in autosomal dominant polycystic kidney disease (ADPKD, we evaluated caffeine intake and renal volume using renal ultrasound in ADPKD patients. Caffeine intake was estimated by the average of 24-h dietary recalls obtained on 3 nonconsecutive days in 102 ADPKD patients (68 females, 34 males; 39 ± 12 years and compared to that of 102 healthy volunteers (74 females, 28 males; 38 ± 14 years. The awareness of the need for caffeine restriction was assessed. Clinical and laboratory data were obtained from the medical records of the patients. Mean caffeine intake was significantly lower in ADPKD patients versus controls (86 vs 134 mg/day, and 63% of the ADPKD patients had been previously aware of caffeine restriction. Caffeine intake did not correlate with renal volume in ADPKD patients. There were no significant differences between the renal volumes of patients in the highest and lowest tertiles of caffeine consumption. Finally, age-adjusted multiple linear regression revealed that renal volume was associated with hypertension, chronic kidney disease stage 3 and the time since diagnosis, but not with caffeine intake. The present small cross-sectional study indicated a low level of caffeine consumption by ADPKD patients when compared to healthy volunteers, which was most likely due to prior awareness of the need for caffeine restriction. Within the range of caffeine intake observed by ADPKD patients in this study (0-471 mg/day, the renal volume was not directly associated with caffeine intake.

  5. Why kidneys fail in autosomal dominant polycystic kidney disease.

    Science.gov (United States)

    Grantham, Jared J; Mulamalla, Sumanth; Swenson-Fields, Katherine I

    2011-10-01

    The weight of evidence gathered from studies in humans with hereditary polycystic kidney disease (PKD)1 and PKD2 disorders, as well as from experimental animal models, indicates that cysts are primarily responsible for the decline in glomerular filtration rate that occurs fairly late in the course of the disease. The processes underlying this decline include anatomic disruption of glomerular filtration and urinary concentration mechanisms on a massive scale, coupled with compression and obstruction by cysts of adjacent nephrons in the cortex, medulla and papilla. Cysts prevent the drainage of urine from upstream tributaries, which leads to tubule atrophy and loss of functioning kidney parenchyma by mechanisms similar to those found in ureteral obstruction. Cyst-derived chemokines, cytokines and growth factors result in a progression to fibrosis that is comparable with the development of other progressive end-stage renal diseases. Treatment of renal cystic disorders early enough to prevent or reduce cyst formation or slow cyst growth, before the secondary changes become widespread, is a reasonable strategy to prolong the useful function of kidneys in patients with autosomal dominant polycystic kidney disease. PMID:21862990

  6. Imaging for the prognosis of autosomal dominant polycystic kidney disease.

    Science.gov (United States)

    Bae, Kyongtae T; Grantham, Jared J

    2010-02-01

    Autosomal dominant polycystic kidney disease (ADPKD) is characterized by the unrelenting enlargement of innumerable cysts derived from renal tubules. This cystic growth often leads to a grotesque renal enlargement. Relatively early in life, the cysts trigger secondary complications including pain, hypertension and gross hematuria; renal insufficiency is usually not detected until the fifth or sixth decade of life. Therapies targeted to molecular and pathophysiological abnormalities slow cyst growth and protect renal function in animal models of the disease. Unfortunately, the translation of these treatments into clinical trials is hampered since glomerular filtration rate, the usual biomarker of renal disease progression, does not decrease substantially until extensive and irreversible damage to noncystic parenchyma occurs. Ultrasonography, CT and MRI have been used for many years to quantify the increase in renal volume in patients with ADPKD. Imaging with these techniques has also been used to accurately quantify the rate of increased kidney and total cyst volume in patients. In this Review we discuss the overwhelming evidence in support of the view that imaging is an invaluable tool to monitor the onset and progression of ADPKD and is well-suited to gauge the response of this disease to targeted therapy before renal function begins to decline. PMID:20111050

  7. Reproductive issues for adults with autosomal dominant polycystic kidney disease.

    Science.gov (United States)

    Vora, Neeta; Perrone, Ronald; Bianchi, Diana W

    2008-02-01

    Autosomal dominant polycystic kidney disease (ADPKD) is a common disorder. However, the consequences of ADPKD on male and female reproductive health are not widely known. Several abnormalities are found in men with ADPKD, including necrospermia, immotile sperm, seminal vesicle cysts, and ejaculatory duct cysts. Female fertility is not affected. Affected women with ADPKD and normal renal function have a high rate of successful uncomplicated pregnancies. Pregnant women with ADPKD with compromised kidney function should be monitored carefully for the development of hypertension and preeclampsia. Their fetuses should be examined sonographically for signs of uteroplacental insufficiency, such as intrauterine growth restriction and oligohydramnios. The diagnosis of ADPKD should always be considered when prenatal sonographic findings of hyperechogenic enlarged kidneys are found. In this setting, a family history and renal sonogram of both parents is indicated. Sequencing of the PKD1 and PKD2 genes is available and can be used for both prenatal and preimplantation genetic diagnosis. We review in detail these topics to familiarize physicians taking care of patients with ADPKD with the reproductive issues that confront affected individuals. PMID:18215709

  8. Autosomal dominant cyclic hematopoiesis: Genetics, phenotype, and natural history

    Energy Technology Data Exchange (ETDEWEB)

    Palmer, S.E.; Stephens, K.; Dale, D.C. [Univ. of Washington, Seattle, WA (United States)

    1994-09-01

    Autosomal dominant cyclic hematopoiesis (ADCH; cyclic neutropenia) is a rare disorder manifested by transient neutropenia that recurs every three weeks. To facilitate mapping the ADCH gene by genetic linkage analysis, we studied 9 ADCH families with 42 affected individuals. Pedigrees revealed AD inheritance with no evidence for decreased penetrance. Similar intra- and interfamilial variable expression was observed, with no evidence to support heterogeneity. At least 3 families displayed apparent new mutations. Many adults developed chronic neutropenia, while offspring always cycled during childhood. Children displayed recurrent oral ulcers, gingivitis, lymphadenopathy, fever, and skin and other infections with additional symptoms. Interestingly, there were no cases of neonatal infection. Some children required multiple hospitalizations for treatment. Four males under age 18 died of Clostridium sepsis following necrotizing enterocolitis; all had affected mothers. No other deaths due to ADCH were found; most had improvement of symptoms and infections as adults. Adults experienced increased tooth loss prior to age 30 (16 out of 27 adults, with 9 edentulous). No increase in myelodysplasia, malignancy, or congenital anomalies was observed. Recombinant G-CSF treatment resulted in dramatic improvement of symptoms and infections. The results suggest that ADCH is not a benign disorder, especially in childhood, and abdominal pain requires immediate evaluation. Diagnosis of ADCH requires serial blood counts in the proband and at least one CBC in relatives to exclude similar disorders. Genetic counseling requires specific histories as well as CBCs of each family member at risk to determine status regardless of symptom history, especially to assess apparent new mutations.

  9. MR cholangiography in children with autosomal recessive polycystic kidney disease

    International Nuclear Information System (INIS)

    Background. Magnetic resonance cholangiography (MRC) is a relatively new, non-invasive imaging technique of the biliary tree that has shown good correlation with endoscopic retrograde cholangiopancreatography. The liver manifestation of autosomal recessive polycystic kidney disease (ARPKD) is congenital hepatic fibrosis (CHF). CHF may be accompanied by Caroli's disease, which is characterised by a non-obstructive dilation of the intrahepatic bile ducts. Objective. A prospective study was conducted to determine the presence and extent of Caroli's disease in children with ARPKD. Materials and methods. Seven children with ARPKD aged from 3.0 to 10.1 years were examined. CHF was confirmed in all biopsied cases (5 of 7). All children had been followed by repeated abdominal US examinations for many years. The MR examination included a morphological imaging study using a T2-weighted turbo spin-echo sequence and a heavily T2-weighted inversion-recovery turbo spin-echo sequence with three-dimensional maximum intensity projection (MIP) reconstructions for MRC. Results. The diagnosis of Caroli's disease could be made in one case by US; in two other children Caroli's disease was suspected, but the differentiation from hepatic cysts was not possible. By MRC, Caroli's disease could be diagnosed in three of seven children. Furthermore, MRC with MIP reconstructions demonstrated the extent of the disease by showing the entire biliary tree from different angles. Conclusions. MRC is a valuable method to establish the diagnosis and demonstrate the extent of Caroli's disease. (orig.)

  10. Evaluation of Nephrolithiasis in Autosomal Dominant Polycystic Kidney Disease Patients

    Science.gov (United States)

    Nishiura, José L.; Neves, Rodrigo F.C.A.; Eloi, Samara R.M.; Cintra, Susan M.L.F.; Ajzen, Sergio A.; Heilberg, Ita P.

    2009-01-01

    Background and objectives: Nephrolithiasis (LIT) is more prevalent in patients with autosomal dominant polycystic kidney disease (ADPKD) than in the general population. Renal ultrasonography may underdetect renal stones because of difficulties imposed by parenchymal and/or cyst wall calcifications. Design, setting, participants, & measurements: A total of 125 patients with ADPKD underwent ultrasonography and unenhanced computed tomography (CT) scan, routine blood chemistry, and spot and 24-h urine collections. Results: CT scan detected calculi in 32 patients, including 20 whose previous ultrasonography revealed no calculi. The percentage of hypocitraturia was high but not statistically different between patients with ADPKD+LIT or ADPKD. Hyperuricosuria and distal renal tubular acidosis were less prevalent but also did not differ between groups, whereas hyperoxaluria was significantly higher in the former. Hypercalciuria was not detected. Renal volume was significantly higher in patients with ADPKD+LIT versus ADPKD, and a stepwise multivariate logistic regression analysis showed that a renal volume ≥500 ml was a significant predictor of LIT in patients with ADPKD and normal renal function, after adjustments for age and hypertension. Conclusions: CT scan was better than ultrasonography to detect LIT in patients with ADPKD. Larger kidneys from patients with ADPKD were more prone to develop stones, irrespective of the presence of metabolic disturbances. PMID:19339428

  11. Autosomal dominant Parkinson's disease caused by SNCA duplications.

    Science.gov (United States)

    Konno, Takuya; Ross, Owen A; Puschmann, Andreas; Dickson, Dennis W; Wszolek, Zbigniew K

    2016-01-01

    The discovery in 1997 that mutations in the SNCA gene cause Parkinson's disease (PD) greatly advanced our understanding of this illness. There are pathogenic missense mutations and multiplication mutations in SNCA. Thus, not only a mutant protein, but also an increased dose of wild-type protein can produce autosomal dominant parkinsonism. We review the literature on SNCA duplications and focus on pathologically-confirmed cases. We also report a newly-identified American family with SNCA duplication whose proband was autopsied. We found that over half of the reported cases with SNCA duplication had early-onset parkinsonism and non-motor features, such as dysautonomia, rapid eye movement sleep behavior disorder (RBD), hallucinations (usually visual) and cognitive deficits leading to dementia. Only a few cases have presented with typical features of PD. Our case presented with depression and RBD that preceded parkinsonism, and dysautonomia that led to an initial diagnosis of multiple system atrophy. Dementia and visual hallucinations followed. Our patient and the other reported cases with SNCA duplications had widespread cortical Lewy pathology. Neuronal loss in the hippocampal cornu ammonis 2/3 regions were seen in about half of the autopsied SNCA duplication cases. Similar pathology was also observed in SNCA missense mutation and triplication carriers. PMID:26350119

  12. Autosomal recessive multiple pterygium syndrome: a new variant?

    Science.gov (United States)

    Aslan, Y; Erduran, E; Kutlu, N

    2000-07-31

    Multiple pterygium syndromes include at least 15 different entities characterized by multiple pterygia or webs of the skin and multiple congenital anomalies. We describe a female infant who presented with a distinct constellation of multiple anomalies consisting of pterygia of the inguinal, intercrural and popliteal areas, flexion contractures and arthrogryposis of some joints, craniofacial anomalies including ectropion, medial canthal web, blepharophimosis, hypoplasia of nose, oral and nasopharyngeal cavities, vocal cords and tongue, micrognathia, orolabial synechiae secondary to pterygia, low set ears, alopecia, sad and expressionless face, short neck, asymmetric nipples, anal stenosis, rectal polyp, hypoplastic labia majora, complete syndactyly of all fingers and toes, pes equinovarus, bandlike web between feet, and absence of the nails and phalangeal-palmar creases. Radiological examination showed synostosis, absence or hypoplasia of metacarpal, metatarsal and phalangeal bones on feet and hands, and hypoplasia of pelvic bones and scapulae. This pattern of anomalies does not fit entirely any of the known multiple pterygium syndromes. Autosomal recessive inheritance is most likely due to the presence of three similarly affected siblings and normal parents. PMID:10925380

  13. Research on autosomal dominant polycystic kidney disease in China

    Institute of Scientific and Technical Information of China (English)

    DAI Bing; MEI Chang-lin

    2006-01-01

    Objective To review the history and recent development of research on autosomal dominant polycystic kidney disease (ADPKD) in China.Data sources Both Chinese and English literatures were searched in MEDLINE/CD ROM (1979 - 2006) and the Chinese Biomedical Literature Disk (1979 - 2006).Study selection Published articles about ADPKD from mainland of China were selected. Data were mainly extracted from 58 articles which are listed in the reference section of this review.Results Some preliminary reports on cyst decompression surgeries and mutation analysis represent the contribution to the ADPKD research from China in the history. A serial of basic research and clinical studies on ADPKD in recent years also have been summarized. A technique platform for ADPKD research was firstly established. The genomics/proteomics/bioinformatics approach was introduced, which provide a lot of valuable information for understanding the pathogenesis. By denature high performance liquid chromatography (DHPLC)technique the entire PKD1 and PKD2 gene sequence screening system for Chinese Han population has been successfully established. Based on the characteristic data of Chinese patients, an integrated therapy protocol was put forward and won an advantage over the traditional therapy. Some novel experimental studies on therapy also were encouraging. Conclusions Remarkable progress of ADPKD research in China have been made recently. Still many works, including the government support, international collaboration and active participation of more Chinese nephrologists, should be enhanced to advance this process in the near future.

  14. EVIDENCE FOR DUST EVOLUTION WITHIN THE TAURUS COMPLEX FROM SPITZER IMAGES

    International Nuclear Information System (INIS)

    We present Spitzer images of the Taurus Complex (TC). We take advantage of the sensitivity and the spatial resolution of the observations to characterize the diffuse infrared (IR) emission across the cloud. This work highlights evidence of dust evolution within the translucent sections of the archetype reference for studies of quiescent molecular clouds. We combine the Spitzer 160 μm and IRAS 100 μm observations to produce a dust temperature map and a far-IR (FIR) dust opacity map at 5' resolution. The average dust temperature is about 14.5 K with a dispersion of ±1 K across the cloud. The FIR dust opacity is tightly correlated with the extinction derived from Two Micron All Sky Survey stellar colors and is a factor of 2 larger than the average value for the diffuse interstellar medium. This opacity increase and the attenuation of the radiation field both contribute to account for the lower emission temperature of the large grains. The structure of the TC significantly changes in the mid-IR (MIR) images that trace emission from polycyclic aromatic hydrocarbons (PAHs) and very small grains (VSGs). We focus our analysis of the MIR emission to a range of ecliptic latitudes away from the zodiacal bands and where the zodiacal light residuals are small. Within this cloud area, there are no 8 and 24 μm counterparts to the brightest 160 μm emission features. Conversely, the 8 and 24 μm images reveal filamentary structure that is strikingly inconspicuous in the 160 μm and extinction maps. The IR colors vary over subparsec distances across this filamentary structure. We compare the observed colors with model calculations quantifying the impact of the radiation field intensity and the abundance of stochastically heated particles on the dust spectral energy distribution. To match the range of observed colors, we have to invoke variations by a factor of a few of both the interstellar radiation field and the abundance of PAHs and VSGs. We conclude that within this

  15. Searching for gas emission lines in Spitzer Infrared Spectrograph (IRS) spectra of young stars in Taurus

    Science.gov (United States)

    Baldovin-Saavedra, C.; Audard, M.; Güdel, M.; Rebull, L. M.; Padgett, D. L.; Skinner, S. L.; Carmona, A.; Glauser, A. M.; Fajardo-Acosta, S. B.

    2011-04-01

    Context. Our knowledge of circumstellar disks has traditionally been based on studies of dust. However, gas dominates the disk mass and its study is key to our understanding of accretion, outflows, and ultimately planet formation. The Spitzer Space Telescope provides access to gas emission lines in the mid-infrared, providing crucial new diagnostics of the physical conditions in accretion disks and outflows. Aims: We seek to identify gas emission lines in mid-infrared spectra of 64 pre-main-sequence stars in Taurus. Using line luminosities and other known star-disk-outflow parameters, we aim to identify correlations that will help to constrain gas heating, excitation mechanisms, and the line formation. Methods: We have based our study on Spitzer observations using the Infrared Spectrograph (IRS), mainly with the high-resolution modules. Line luminosities (or 3σ upper limits) have been obtained by fitting Gaussian profiles to the lines. We have further searched for correlations between the line luminosities and different parameters related to the star-disk system. Results: We have detected H2 (17.03, 28.22 μm) emission in 6 objects, [Ne II] (12.81 μm) emission in 18 objects, and [Fe II] (17.93, 25.99 μm) emission in 7 objects. [Ne II] detections are found primarily in Class II objects. The luminosity of the [Ne II] line (LNeII) is in general higher for objects known to drive jets than for those without known jets, but the two groups are not statistically distinguishable. LNeII is correlated with X-ray luminosity, but for Class II objects only. LNeII is also correlated with disk mass and accretion rate when the sample is divided into high and low accretors. Furthermore, we find correlations of LNeII with mid-IR continuum luminosity and with luminosity of the [O I] (6300 Å) line, the latter being an outflow tracer. L [FeII] correlates with Ṁacc. No correlations were found between LH2 and several tested parameters. Conclusions: Our study reveals a general trend

  16. Chemistry in disks. X. The molecular content of protoplanetary disks in Taurus

    Science.gov (United States)

    Guilloteau, S.; Reboussin, L.; Dutrey, A.; Chapillon, E.; Wakelam, V.; Piétu, V.; Di Folco, E.; Semenov, D.; Henning, Th.

    2016-08-01

    Aims: We attempt to determine the molecular composition of disks around young low-mass stars. Methods: We used the IRAM 30 m radio telescope to perform a sensitive wideband survey of 30 stars in the Taurus Auriga region known to be surrounded by gaseous circumstellar disks. We simultaneously observed HCO+(3-2), HCN(3-2), C2H(3-2), CS(5-4), and two transitions of SO. We combined the results with a previous survey that observed 13CO (2-1), CN(2-1), two o-H2CO lines, and another transition of SO. We used available interferometric data to derive excitation temperatures of CN and C2H in several sources. We determined characteristic sizes of the gas disks and column densities of all molecules using a parametric power-law disk model. Our study is mostly sensitive to molecules at 200-400 au from the stars. We compared the derived column densities to the predictions of an extensive gas-grain chemical disk model under conditions representative of T Tauri disks. Results: This survey provides 20 new detections of HCO+ in disks, 18 in HCN, 11 in C2H, 8 in CS, and 4 in SO. HCO+ is detected in almost all sources and its J = 3-2 line is essentially optically thick, providing good estimates of the disk radii. The other transitions are (at least partially) optically thin. Large variations of the column density ratios are observed, but do not correlate with any specific property of the star or disk. Disks around Herbig Ae stars appear less rich in molecules than those around T Tauri stars, although the sample remains small. SO is only found in the (presumably younger) embedded objects, perhaps reflecting an evolution of the S chemistry due to increasing depletion with time. Overall, the molecular column densities, and in particular the CN/HCN and CN/C2H ratios, are well reproduced by gas-grain chemistry in cold disks. Conclusions: This study provides a comprehensive census of simple molecules in disks of radii >200-300 au. Extending that to smaller disks, or searching for less

  17. Dicty_cDB: Contig-U16181-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dren's ... 48 0.79 1 ( AC231868 ) Bos taurus BAC CH240-211C14 (Children's Hospital...aurus BAC CH240-242E2 (Children's Hospital ... 48 0.79 1 ( AC231833 ) Bos taurus NOVECTOR CH240-254C23 (Chil...dren's Hos... 48 0.79 1 ( AC231397 ) Bos taurus BAC CH240-464P17 (Children's Hospital...... 48 0.79 1 ( AC229882 ) Bos taurus BAC CH240-237N14 (Children's Hospital... 48 0.79 1 ( AC229870 ) Bo...s taurus NOVECTOR CH240-367D19 (Children's Hos... 48 0.79 1 ( AC229801 ) Bos taurus BAC CH240-431E22 (Children's Hospital

  18. Equivalencia entre modelos fermiónicos y bosónicos bidimensionales: el método funcional

    OpenAIRE

    Naón, Carlos María

    1986-01-01

    El objetivo de esta tesis es el de aplicar el método funcional al estudio sistemático de la equivalencia entre modelos fermiónicos y bosónicos en dos dimensiones del espacio-tiempo. En el Capítulo 2 se presentan los resultados ya conocidos sobre el procedimiento de bosonización mediante el método operacional. Se reseñan los resultados fundamentales de Lowenstein y Swieca sobre el modelo de Schwinger ( sin masa ); se estudia el problema de la rotura espontánea de la simetría quiral global, ...

  19. A GALEX based search for the sparse young stellar population in the Taurus-Aurigae star forming region

    CERN Document Server

    de Castro, Ana I Gomez; López-Martínez, Fátima; Sánchez, Néstor; Sestito, Paola; de Castro, Elisa; Cornide, Manuel; Gestoso, Javier Yañez

    2014-01-01

    In this work, we identify 63 bona fide new candidates to T Tauri stars (TTSs) in the Taurus-Auriga region using as baseline its ultraviolet excess. The initial data set has been defined from the GALEX all sky survey (AIS). The GALEX satellite obtained images in the near ultraviolet (NUV) and far ultraviolet (FUV) bands where the TTSs show a prominent excess, compared with main sequence or giants stars. GALEX AIS surveyed the Taurus-Auriga molecular complex, as well as, a fraction of the California Nebula and the Perseus complex; bright sources and the dark clouds themselves are avoided. The properties of the TTSs in the ultraviolet (GALEX), optical (UCAC4) and infrared (2MASS) have been defined using as qualification sample the TTSs observed with the International Ultraviolet Explorer. The candidates have been identified by means of a mixed ultraviolet-optical-infrared excess set of colors; it is found that the color-color diagram FUV-NUV versus J-K is ideally suited for this purpose. From an initial sample o...

  20. Variation of the ultraviolet extinction law across the Taurus-Auriga star forming complex. A GALEX based study

    CERN Document Server

    de Castro, Ana I Gomez; Lopez-Martinez, Fatima; Sanchez, Nestor; de Castro, Elisa; Cornide, Manuel

    2015-01-01

    The Taurus-Auriga molecular complex (TMC) is the main laboratory for the study of low mass star formation. The density and properties of interstellar dust are expected to vary across the TMC. These variations trace important processes such as dust nucleation or the magnetic field coupling with the cloud. In this article, we show how the combination of near ultraviolet (NUV) and infrared (IR) photometry can be used to derive the strength of the 2175 \\AA\\ bump and thus any enhancement in the abundance of small dust grains and PAHs in the dust grains size distribution. This technique is applied to the envelope of the TMC, mapped by the GALEX All Sky Survey (AIS). UV and IR photometric data have been retrieved from the GALEX-AIS and the 2MASS catalogues. NUV and K-band star counts have been used to identify the areas in the cloud envelope where the 2175 \\AA\\ bump is weaker than in the diffuse ISM namely, the low column density extensions of L1495, L1498 and L1524 in Taurus, L1545, L1548, L1519, L1513 in Auriga an...

  1. Isotretinoin treatment of autosomal recessive congenital ichthyosis complicated by coexisting dysferlinopathy.

    Science.gov (United States)

    Mashiah, J; Harel, A; Bitterman, O; Sagi, L; Gat, A; Fellig, Y; Ben-Shachar, S; Sprecher, E

    2016-06-01

    Consanguinity is known to be associated with an increase in the prevalence of autosomal recessive disorders such as autosomal recessive congenital ichthyosis (ARCI). ARCI often responds well to retinoid treatment. We describe a patient with ARCI who improved under isotretinoin treatment. The patient subsequently developed elevated levels of serum creatinine phosphokinase (CPK), which led to the diagnosis of a second autosomal recessive disorder, dysferlinopathy, a rare myopathy characterized by muscle weakness, decreased tendon reflexes and marked elevation of CPK levels. This report demonstrates the need for physicians to remain alert to the possible coexistence of rare and mutually relevant disorders in populations with a high rate of consanguinity. PMID:26620441

  2. A CENSUS OF ROTATION AND VARIABILITY IN L1495: A UNIFORM ANALYSIS OF TRANS-ATLANTIC EXOPLANET SURVEY LIGHT CURVES FOR PRE-MAIN-SEQUENCE STARS IN TAURUS

    Energy Technology Data Exchange (ETDEWEB)

    Xiao Hongyu; Covey, Kevin R.; Lloyd, James P. [Department of Astronomy, Cornell University, 226 Space Sciences Building, Ithaca, NY 14853 (United States); Rebull, Luisa [Spitzer Science Center/Caltech, M/S 220-6, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Charbonneau, David [Department of Astronomy, Harvard University, 60 Garden Street, Cambridge, MA 02138 (United States); Mandushev, Georgi [Lowell Observatory, 1400 West Mars Hill Road, Flagstaff, AZ 86001 (United States); O' Donovan, Francis; Slesnick, Catherine [Astronomy Department, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States)

    2012-09-15

    We analyze light curves obtained by the Trans-atlantic Exoplanet Survey (TrES) for a field centered on the L1495 dark cloud in Taurus. The Spitzer Taurus Legacy Survey catalog identifies 179 bona fide Taurus members within the TrES field; 48 of the known Taurus members are detected by TrES, as well as 26 candidate members identified by the Spitzer Legacy team. We quantify the variability of each star in our sample using the ratio of the standard deviation of the original light curve ({sigma}{sub orig.}) to the standard deviation of a light curve that has been smoothed by 9 or 1001 epochs ({sigma}{sub 9} and {sigma}{sub 1001}, respectively). Known Taurus members typically demonstrate ({sigma}{sub orig.}/{sigma}{sub 9}) < 2.0, and ({sigma}{sub orig.}/{sigma}{sub 1001}) < 5, while field stars reveal ({sigma}{sub orig.}/{sigma}{sub 9}) {approx} 3.0 and ({sigma}{sub orig.}/{sigma}{sub 1001}) {approx} 10, as expected for light curves dominated by unstructured white noise. Of the 74 Taurus members/candidates with TrES light curves, we detect significant variability in 49 sources. Adapting a quantitative metric originally developed to assess the reliability of transit detections, we measure the amount of red and white noise in each light curve and identify 18 known or candidate Taurus members with highly significant period measurements. These appear to be the first periods measured for four of these sources (HD 282276, CX Tau, FP Tau, TrES J042423+265008), and in two other cases, the first non-aliased periods (LkCa 21 and DK Tau AB). For the remainder, the TrES measurements typically agree very well ({delta}P < 1%) with previously reported values. Including periods measured at lower confidence for 15 additional sources, we report periods for 11 objects where no previous periods were found, including 8 confirmed Taurus members. We also identify 10 of the 26 candidate Taurus members that demonstrate variability levels consistent with being bona fide T Tauri stars. A

  3. A hidden deformation zone withing the Cilician Taurus Mountains: Analysis of the GPS data using a novel approcah

    Science.gov (United States)

    Sinan Özeren, Mehmet; Dimitrova, Lada; Haines, Alan John

    2014-05-01

    Tectonics within the Anatolian peninsula is shaped mainly by the northward motion of Arabia that collides with the East Anatolian High Plateau in the east and the extension in western Turkey and the Aegean Sea due to the roll-back of the Hellenic Trench in the west. The zone between these tectonically active regions is the central Anatolian block that rotates counterclockwise with respect to the stable Eurasia, hitherto thought to have been undergoing little internal deformation. However, the stalled subduction of the Cyprus Arc exerts compression on the overriding Anatolia, thereby creating compressive stresses all along the Turkish southern coast. The immediate consequence of this tectonic setting along with the east-west extension creates a strike-slip dominated central Anatolian block. Neverthless along the southern coast (southern margin of the Taurus mountains) there is scarse evidence of active faulting. Two exceptions are the Ecemis fault and its antithetic Tuzgolu fault, both strike-slip faults, the former bounding the Cilician Taurus from the west. Very little information exists on the ongoing deformation within the Cilician Taurus Mountains that form a quasi-elliptic structure with the major axis that is almost parallel to the Ecemis fault. Since Turkey is planning to build a nuclear power plant 15 km to the south the Ecemis fault, the hazard community has been giving the major attention to the Ecemis fault itself. Recent studies by Dimitrova et al. (2012) revealed that the subsurface sources of the laterally widespread deformation fields can be located very efficiently if one works with the vertical derivatives of horizontal stress (VDoHS) rates. The alternative approach is to directly calculate the GPS strain rates using kinematic algorithms, but they are much less efficient than working with VDoHS in determining zones of deformation, especially along faults without slip rate information mapped from palaeo-seismicity or along completely hidden faults

  4. NCBI nr-aa BLAST: CBRC-VPAC-01-1445 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1445 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predi...cted) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-116 76% ...

  5. NCBI nr-aa BLAST: CBRC-OPRI-01-0130 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0130 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predi...cted) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-149 83% ...

  6. NCBI nr-aa BLAST: CBRC-MEUG-01-0695 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0695 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predi...cted) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 2e-85 72% ...

  7. NCBI nr-aa BLAST: CBRC-MLUC-01-0520 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0520 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predi...cted) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 6e-62 69% ...

  8. NCBI nr-aa BLAST: CBRC-PVAM-01-1099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1099 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predi...cted) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 9e-88 57% ...

  9. NCBI nr-aa BLAST: CBRC-STRI-01-2166 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2166 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predi...cted) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-140 84% ...

  10. NCBI nr-aa BLAST: CBRC-MMUR-01-1320 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1320 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predi...cted) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-131 73% ...

  11. NCBI nr-aa BLAST: CBRC-MMUR-01-0605 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0605 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predi...cted) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-135 74% ...

  12. NCBI nr-aa BLAST: CBRC-STRI-01-2300 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2300 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predi...cted) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 8e-44 81% ...

  13. NCBI nr-aa BLAST: CBRC-MMUR-01-1132 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1132 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predi...cted) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 3e-53 70% ...

  14. NCBI nr-aa BLAST: CBRC-MDOM-04-0282 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-04-0282 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predi...cted) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-125 69% ...

  15. NCBI nr-aa BLAST: CBRC-PVAM-01-0460 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0460 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predi...cted) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-149 84% ...

  16. NCBI nr-aa BLAST: CBRC-PCAP-01-0607 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0607 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predi...cted) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-108 65% ...

  17. NCBI nr-aa BLAST: CBRC-GGOR-01-0397 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0397 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predi...cted) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-151 85% ...

  18. NCBI nr-aa BLAST: CBRC-PCAP-01-0275 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0275 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predi...cted) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-101 71% ...

  19. NCBI nr-aa BLAST: CBRC-PHAM-01-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0010 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predi...cted) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 6e-65 81% ...

  20. NCBI nr-aa BLAST: CBRC-STRI-01-2372 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2372 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predi...cted) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-127 71% ...

  1. Molecular and cellular pathogenesis of autosomal dominant polycystic kidney disease

    Directory of Open Access Journals (Sweden)

    A.P. Bastos

    2011-07-01

    Full Text Available Autosomal dominant polycystic kidney disease (ADPKD is one of the most common human life-threatening monogenic disorders. The disease is characterized by bilateral, progressive renal cystogenesis and cyst and kidney enlargement, often leading to end-stage renal disease, and may include extrarenal manifestations. ADPKD is caused by mutation in one of two genes, PKD1 and PKD2, which encode polycystin-1 (PC1 and polycystin-2 (PC2, respectively. PC2 is a non-selective cation channel permeable to Ca2+, while PC1 is thought to function as a membrane receptor. The cyst cell phenotype includes increased proliferation and apoptosis, dedifferentiation, defective planar polarity, and a secretory pattern associated with extracellular matrix remodeling. The two-hit model for cyst formation has been recently extended by the demonstration that early gene inactivation leads to rapid and diffuse development of renal cysts, while inactivation in adult life is followed by focal and late cyst formation. Renal ischemia/reperfusion, however, can function as a third hit, triggering rapid cyst development in kidneys with Pkd1 inactivation induced in adult life. The PC1-PC2 complex behaves as a sensor in the primary cilium, mediating signal transduction via Ca2+ signaling. The intracellular Ca2+ homeostasis is impaired in ADPKD, being apparently responsible for the cAMP accumulation and abnormal cell proliferative response to cAMP. Activated mammalian target for rapamycin (mTOR and cell cycle dysregulation are also significant features of PKD. Based on the identification of pathways altered in PKD, a large number of preclinical studies have been performed and are underway, providing a basis for clinical trials in ADPKD and helping the design of future trials.

  2. Heterozygous Reelin Mutations Cause Autosomal-Dominant Lateral Temporal Epilepsy

    Science.gov (United States)

    Dazzo, Emanuela; Fanciulli, Manuela; Serioli, Elena; Minervini, Giovanni; Pulitano, Patrizia; Binelli, Simona; Di Bonaventura, Carlo; Luisi, Concetta; Pasini, Elena; Striano, Salvatore; Striano, Pasquale; Coppola, Giangennaro; Chiavegato, Angela; Radovic, Slobodanka; Spadotto, Alessandro; Uzzau, Sergio; La Neve, Angela; Giallonardo, Anna Teresa; Mecarelli, Oriano; Tosatto, Silvio C.E.; Ottman, Ruth; Michelucci, Roberto; Nobile, Carlo

    2015-01-01

    Autosomal-dominant lateral temporal epilepsy (ADLTE) is a genetic epilepsy syndrome clinically characterized by focal seizures with prominent auditory symptoms. ADLTE is genetically heterogeneous, and mutations in LGI1 account for fewer than 50% of affected families. Here, we report the identification of causal mutations in reelin (RELN) in seven ADLTE-affected families without LGI1 mutations. We initially investigated 13 ADLTE-affected families by performing SNP-array linkage analysis and whole-exome sequencing and identified three heterozygous missense mutations co-segregating with the syndrome. Subsequent analysis of 15 small ADLTE-affected families revealed four additional missense mutations. 3D modeling predicted that all mutations have structural effects on protein-domain folding. Overall, RELN mutations occurred in 7/40 (17.5%) ADLTE-affected families. RELN encodes a secreted protein, Reelin, which has important functions in both the developing and adult brain and is also found in the blood serum. We show that ADLTE-related mutations significantly decrease serum levels of Reelin, suggesting an inhibitory effect of mutations on protein secretion. We also show that Reelin and LGI1 co-localize in a subset of rat brain neurons, supporting an involvement of both proteins in a common molecular pathway underlying ADLTE. Homozygous RELN mutations are known to cause lissencephaly with cerebellar hypoplasia. Our findings extend the spectrum of neurological disorders associated with RELN mutations and establish a link between RELN and LGI1, which play key regulatory roles in both the developing and adult brain. PMID:26046367

  3. Heterozygous reelin mutations cause autosomal-dominant lateral temporal epilepsy.

    Science.gov (United States)

    Dazzo, Emanuela; Fanciulli, Manuela; Serioli, Elena; Minervini, Giovanni; Pulitano, Patrizia; Binelli, Simona; Di Bonaventura, Carlo; Luisi, Concetta; Pasini, Elena; Striano, Salvatore; Striano, Pasquale; Coppola, Giangennaro; Chiavegato, Angela; Radovic, Slobodanka; Spadotto, Alessandro; Uzzau, Sergio; La Neve, Angela; Giallonardo, Anna Teresa; Mecarelli, Oriano; Tosatto, Silvio C E; Ottman, Ruth; Michelucci, Roberto; Nobile, Carlo

    2015-06-01

    Autosomal-dominant lateral temporal epilepsy (ADLTE) is a genetic epilepsy syndrome clinically characterized by focal seizures with prominent auditory symptoms. ADLTE is genetically heterogeneous, and mutations in LGI1 account for fewer than 50% of affected families. Here, we report the identification of causal mutations in reelin (RELN) in seven ADLTE-affected families without LGI1 mutations. We initially investigated 13 ADLTE-affected families by performing SNP-array linkage analysis and whole-exome sequencing and identified three heterozygous missense mutations co-segregating with the syndrome. Subsequent analysis of 15 small ADLTE-affected families revealed four additional missense mutations. 3D modeling predicted that all mutations have structural effects on protein-domain folding. Overall, RELN mutations occurred in 7/40 (17.5%) ADLTE-affected families. RELN encodes a secreted protein, Reelin, which has important functions in both the developing and adult brain and is also found in the blood serum. We show that ADLTE-related mutations significantly decrease serum levels of Reelin, suggesting an inhibitory effect of mutations on protein secretion. We also show that Reelin and LGI1 co-localize in a subset of rat brain neurons, supporting an involvement of both proteins in a common molecular pathway underlying ADLTE. Homozygous RELN mutations are known to cause lissencephaly with cerebellar hypoplasia. Our findings extend the spectrum of neurological disorders associated with RELN mutations and establish a link between RELN and LGI1, which play key regulatory roles in both the developing and adult brain. PMID:26046367

  4. Fibrosis and progression of autosomal dominant polycystic kidney disease (ADPKD).

    Science.gov (United States)

    Norman, Jill

    2011-10-01

    The age on onset of decline in renal function and end-stage renal disease (ESRD) in autosomal polycystic kidney disease (ADPKD) is highly variable and there are currently no prognostic tools to identify patients who will progress rapidly to ESRD. In ADPKD, expansion of cysts and loss of renal function are associated with progressive fibrosis. Similar to the correlation between tubulointerstitial fibrosis and progression of chronic kidney disease (CKD), in ADPKD, fibrosis has been identified as the most significant manifestation associated with an increased rate of progression to ESRD. Fibrosis in CKD has been studied extensively. In contrast, little is known about the mechanisms underlying progressive scarring in ADPKD although some commonality may be anticipated. Current data suggest that fibrosis associated with ADPKD shares at least some of the "classical" features of fibrosis in CKD (increased interstitial collagens, changes in matrix metalloproteinases (MMPs), over-expression of tissue inhibitor of metalloproteinase-1 (TIMP-1), over-expression of plasminogen activator inhibitor-1 (PAI-1) and increased transforming growth factor beta (TGFβ) but that there are also some unique and stage-specific features. Epithelial changes appear to precede and to drive interstitial changes leading to the proposal that development of fibrosis in ADPKD is biphasic with alterations in cystic epithelia precipitating changes in interstitial fibroblasts and that reciprocal interactions between these cell types drives progressive accumulation of extracellular matrix (ECM). Since fibrosis is a major component of ADPKD it follows that preventing or slowing fibrosis should retard disease progression with obvious therapeutic benefits. The development of effective anti-fibrotic strategies in ADPKD is dependent on understanding the precise mechanisms underlying initiation and progression of fibrosis in ADPKD and the role of the intrinsic genetic defect in these processes. This article is

  5. MR cholangiography in children with autosomal recessive polycystic kidney disease

    Energy Technology Data Exchange (ETDEWEB)

    Jung, G. [Department of Radiology, University of Cologne, Cologne (Germany)]|[Institut fuer Diagnostische Radiologie, Heinrich Heine Univ., Duesseldorf (Germany); Benz-Bohm, G.; Kugel, H. [Department of Radiology, University of Cologne, Cologne (Germany); Keller, K.M. [Department of Pediatrics, University of Bonn, Bonn (Germany); Querfeld, U. [Department of Pediatrics, University of Cologne, Cologne (Germany)

    1999-06-01

    Background. Magnetic resonance cholangiography (MRC) is a relatively new, non-invasive imaging technique of the biliary tree that has shown good correlation with endoscopic retrograde cholangiopancreatography. The liver manifestation of autosomal recessive polycystic kidney disease (ARPKD) is congenital hepatic fibrosis (CHF). CHF may be accompanied by Caroli`s disease, which is characterised by a non-obstructive dilation of the intrahepatic bile ducts. Objective. A prospective study was conducted to determine the presence and extent of Caroli`s disease in children with ARPKD. Materials and methods. Seven children with ARPKD aged from 3.0 to 10.1 years were examined. CHF was confirmed in all biopsied cases (5 of 7). All children had been followed by repeated abdominal US examinations for many years. The MR examination included a morphological imaging study using a T2-weighted turbo spin-echo sequence and a heavily T2-weighted inversion-recovery turbo spin-echo sequence with three-dimensional maximum intensity projection (MIP) reconstructions for MRC. Results. The diagnosis of Caroli`s disease could be made in one case by US; in two other children Caroli`s disease was suspected, but the differentiation from hepatic cysts was not possible. By MRC, Caroli`s disease could be diagnosed in three of seven children. Furthermore, MRC with MIP reconstructions demonstrated the extent of the disease by showing the entire biliary tree from different angles. Conclusions. MRC is a valuable method to establish the diagnosis and demonstrate the extent of Caroli`s disease. (orig.) With 1 fig., 1 tab., 18 refs.

  6. Imaging of the Macula Indicates Early Completion of Structural Deficit in Autosomal-Dominant Optic Atrophy

    DEFF Research Database (Denmark)

    Rönnbäck, Cecilia; Milea, Dan; Larsen, Michael

    2013-01-01

    Optical coherence tomography (OCT) enables 3-dimensional imaging of the retina, including the layer of ganglion cells that supplies the optic nerve with its axons. We tested OCT as means of diagnosing and phenotyping autosomal-dominant optic atrophy (ADOA)....

  7. Molecular diagnosis of autosomal dominant early onset Alzheimer's disease: an update

    OpenAIRE

    Raux, G; Guyant-Marechal, L; Martin, C.; BOU, J.; Penet, C; Brice, A; Hannequin, D.; Frebourg, T; Campion, D

    2005-01-01

    Background: Autosomal dominant early onset Alzheimer's disease (ADEOAD) is genetically heterogeneous. Mutations of the amyloid precursor protein (APP), presenilin 1 (PSEN1), and presenilin 2 (PSEN2) genes have been identified.

  8. Molecular Diagnostics in Autosomal Dominant Polycystic Kidney Disease: Utility and Limitations

    OpenAIRE

    Zhao, Xiao; Paterson, Andrew D.; Zahirieh, Alireza; He, Ning; Wang, Kairong; Pei, York

    2008-01-01

    Background and objectives: Gene-based mutation screening is now available and has the potential to provide diagnostic confirmation or exclusion of autosomal dominant polycystic kidney disease. This study illustrates its utility and limitations in the clinical setting.

  9. Genetics Home Reference: cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy

    Science.gov (United States)

    Skip to main content Your Guide to Understanding Genetic Conditions Enable Javascript for addthis links to activate. ... Conditions Genes Chromosomes & mtDNA Resources Help Me Understand Genetics Home Health Conditions CADASIL cerebral autosomal dominant arteriopathy ...

  10. Mitochondriales Maltargeting eines peroxisomalen Proteins als Ursache eines autosomal-dominant vererbten renalen Fanconi-Syndroms

    OpenAIRE

    Peindl, Dominika Elisabeth

    2012-01-01

    Das renale Fanconi-Syndrom beschreibt generell eine Funktionsstörung des proximalen Nierentubulus mit charakteristischen Symptomen wie Glukosurie, Aminoazidurie und Proteinurie. Klinisch kommt es bei den Patienten zu Rachitis, metabolischer Azidose, Elektrolytstörungen und Dehydratation. Die Erkrankung kann autosomal-dominant, autosomal-rezessiv oder x-chromosomal auftreten, wobei auch mitochondriale Funktionsstörungen in der Pathogenese eine wichtige Rolle spielen, da der proximale Tubulus i...

  11. An 11-Year-Old Child with Autosomal Dominant Polycystic Kidney Disease Who Presented with Nephrolithiasis

    Directory of Open Access Journals (Sweden)

    Fatih Firinci

    2012-01-01

    Full Text Available Patients with autosomal dominant polycystic kidney disease become symptomatic and are diagnosed usually at adulthood. The rate of nephrolithiasis in these patients is 5–10 times the rate in the general population, and both anatomic and metabolic abnormalities play role in the formation of renal stones. However, nephrolithiasis is rare in childhood age group. In this paper, an 11-year-old child with autosomal dominant polycystic kidney disease presenting with nephrolithiasis is discussed.

  12. Gene : CBRC-PCAP-01-0209 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available SSEHCNISDWLRLEAAVKASVYAVAFSFATFITVVITSVVLQNWKLRKEARYILLCHHLLCISSYCGLGIVFQGMRALVANSPLLICWVVFGVQLSVGEGILFTLALMALNSY...LAICWPLRSPALVNSVKYKILAGTWTIIVFKNVCLFLIEGTNPTLVNVLKSEPLCPVILNGIPARVVGMVFIFLLLSVILISYS...1| PREDICTED: similar to putative G-protein coupled receptor [Bos taurus] 1e-116 77% MYSEENLTTESIIVLIVEPRKAVKSMNS

  13. Gene : CBRC-PHAM-01-1469 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ED: similar to chromosome 8 open reading frame 1 isoform 1 [Bos taurus] 7e-85 40% MAERKILFERRERKQIPSRLSLPPYIPSPV...YPFPRISLSSYVPSPIYTFPCVSQPLYIPSPVYPVSRISLPLYIPSPVYSFPCISLPLDILSPVYPIPCLSLLLCITSPVYPFPCISCPPYIPFPIYPFPCISHPPYIPSPV...YPIPCISRPPCIPSLVYPFPCISLPLDILSPIYPIPCLSLPLCITSSVYPFPRISHPPYIPSPVYHSPCISHPLYIPSSVYPFPCLSLPQSILSPV...YPIPHISLPPYIPPPVYPVPCISHPLCIPSPVYPFPCLSLPLYIISRVYPVPRISHPLYILSPVYPFPCLSLPLYTPSPVYPIPCISLPLSIPSPV...YPFPYVSHPPYIPSPIYPFPRISRPLYIPSPVYHFPCISCPLYILSPVCPFPCVSHSPYIPFPVYPFPCLSLPLSILSPVYPFPCLSLPVSILSPVYPFFCLSLPLSIPSPVYPFPCISLPLHIYLFLSVSLPLYIPSPVYLQLDKLQFESWL ...

  14. Gene : CBRC-TTRU-01-1304 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1| PREDICTED: similar to vomeronasal 1 receptor, K1 [Bos taurus] 2e-45 50% MILMHLTLANIMTILFRGIQDAMSSFGIWPIMG...DIGCKSLLYIHRVTQGISLCTISVLNTFQAIRISPRNSKRAWLKPQISTCILPSFLFFWVINMLIYFWIITNNKAVTNASAAQPGYSLAYCTTKQGGYRVSAVFQSAMLI*NFLCINLMIWTSGYMVMLLYNHHKTVQNLRGNNFSPRLSPETKLPTPFCS ...

  15. Genome scan for parent-of-origin QTL effects on bovine growth and carcass traits

    OpenAIRE

    Ikhide G. Imumorin; Eun-Hee eKim; Yun-Mi eLee; Dirk-Jan eDe Koning; Johan eVan Arendonk; Marcos eDe Donato; Jeremy Francis Taylor; Jong-Joo eKim

    2011-01-01

    Parent-of-origin effects (POE) such as genomic imprinting influence growth and body composition in livestock, rodents and humans. Here, we report the results of a genome scan to detect quantitative trait loci (QTL) with POE on growth and carcass traits in Angus x Brahman cattle crossbreds. We identified 24 POE-QTL on 15 Bos taurus autosomes (BTAs) of which 6 were significant at 5% genome-wide level and 18 at the 5% chromosome-wide significance level. Six QTL were paternally expressed while 15...

  16. Verantwoordelijkheden bij risico- en crisisbeheersing van bos- en natuurbranden : taken en bevoegdheden bij risicoberheersing, bestrijding, nazorg en herstel en een overzicht van de hiaten in regelgeving en taakverdeling

    NARCIS (Netherlands)

    Raffe, van J.K.

    2011-01-01

    In 2007/2008 is gekeken welke partijen een rol spelen bij de risico- en crisisbeheersing van (grote) bos- en natuurbranden, wat hun rol precies is en welke taken en bevoegdheden ze hebben. Ook is geïnventariseerd welke hiaten er zijn in de bestaande taakverdeling en regelgeving. Hiaten die de oorzaa

  17. Analysis of MOST light curves of five young stars in Taurus-Auriga and Lupus~3 Star Forming Regions

    CERN Document Server

    Siwak, Michal; Matthews, Jaymie M; Kuschnig, Rainer; Guenther, David B; Moffat, Anthony F J; Sasselov, Dimitar; Weiss, Werner W

    2011-01-01

    Continuous photometric observations of five young stars obtained by the MOST satellite in 2009 and 2010 in the Taurus and Lupus star formation regions are presented. Using light curve modelling under the assumption of internal invariability of spots, we obtained small values of the solar-type differential-rotation parameter (k=0.0005-0.009) for three spotted weak-line T Tau stars, V410 Tau, V987 Tau and Lupus 3-14; for another spotted WTTS, Lupus 3-48, the data are consistent with a rigidly rotating surface (k=0). Three flares of similar rise (4 min 30 sec) and decay (1 h 45 min) times were detected in the light curve of Lupus 3-14. The brightness of the classical T Tau star RY Tau continuously decreased over 3 weeks of its observations with a variable modulation not showing any obvious periodic signal.

  18. A GALEX-BASED SEARCH FOR THE SPARSE YOUNG STELLAR POPULATION IN THE TAURUS-AURIGAE STAR FORMING REGION

    Energy Technology Data Exchange (ETDEWEB)

    Gómez de Castro, Ana I.; Lopez-Santiago, Javier; López-Martínez, Fatima; Sánchez, Néstor; Sestito, Paola; Gestoso, Javier Yañez [AEGORA Research Group, Universidad Complutense de Madrid, Plaza de Ciencias 3, E-28040 Madrid (Spain); De Castro, Elisa; Cornide, Manuel [Fac. de CC. Físicas, Universidad Complutense de Madrid, Plaza de Ciencias 1, E-28040 Madrid (Spain)

    2015-02-01

    In this work, we identify 63 bona fide new candidates to T Tauri stars (TTSs) in the Taurus-Auriga region, using its ultraviolet excess as our baseline. The initial data set was defined from the GALEX all sky survey (AIS). The GALEX satellite obtained images in the near-ultraviolet (NUV) and far-ultraviolet (FUV) bands where TTSs show a prominent excess compared with main-sequence or giants stars. GALEX AIS surveyed the Taurus-Auriga molecular complex, as well as a fraction of the California Nebula and the Perseus complex; bright sources and dark clouds were avoided. The properties of TTSs in the ultraviolet (GALEX), optical (UCAC4), and infrared (2MASS) have been defined using the TTSs observed with the International Ultraviolet Explorer reference sample. The candidates were identified by means of a mixed ultraviolet-optical-infrared excess set of colors; we found that the FUV-NUV versus J–K color-color diagram is ideally suited for this purpose. From an initial sample of 163,313 bona fide NUV sources, a final list of 63 new candidates to TTSs in the region was produced. The search procedure has been validated by its ability to detect all known TTSs in the area surveyed: 31 TTSs. Also, we show that the weak-lined TTSs are located in a well-defined stripe in the FUV-NUV versus J–K diagram. Moreover, in this work, we provide a list of TTSs photometric standards for future GALEX-based studies of the young stellar population in star forming regions.

  19. Comparison of proximate chemical composition and texture of cupim, Rhomboideus m. and lombo, Longissimus dorsi m. of Nelore (Bos indicus

    Directory of Open Access Journals (Sweden)

    Mayka Reghiany Pedrão

    2009-06-01

    Full Text Available The proximate chemical composition of hump, known in Brazil as cupim, Rhomboideus m. (RB, of Nelore (Bos indicus aged 24 months revealed it to be a unique beef muscle. It presents a lipid fraction 14-fold as high as that of Longissimus dorsi m. (LD taken from the same animal (pA composição química percentual aproximada do cupim m. Rhomboideus (RB derivado de Nelore (Bos indicus de 24 meses de idade mostrou ser um músculo diferenciado. Há uma maior fração de material lipídico em RB chegando a ser 14 vezes proporcionalmente maior em comparação ao m. Longissimus dorsi (LD (p<0,05 a maior quantidade de gordura relatada em amostras de carne em literatura científica. Esse fato foi também observado pela avaliação histológica. Há proporcionalmente maior concentração da fração protéica e menor quantidade de umidade em RB. O teor de colágeno foi de 22,9% mais concentrado em RB enquanto que a quantidade da sua ligação cruzada, hidroxilisilpiridinolina (HP foi 14 vezes maior indicando que cupim seria mais rígido. Contrariando essa expectativa, a maciez da carne crua avaliada pelo texturômetro mostrou valores de 8.05 e 5.81 kg/F para LD e RB, respectivamente (p<0.05. Tais resultados mostram que em músculo contendo abundante gordura esta funciona como lubrificante para a lamina penetrar sem muita resistência através do cupim a despeito dar quantidade e qualidade das fibras de colágeno.

  20. Evidence for autosomal recessive inheritance in SPG3A caused by homozygosity for a novel ATL1 missense mutation

    OpenAIRE

    Khan, Tahir Naeem; Klar, Joakim; Tariq, Muhammad; Anjum Baig, Shehla; Malik, Naveed Altaf; Yousaf, Raja; Baig, Shahid Mahmood; Dahl, Niklas

    2014-01-01

    Hereditary spastic paraplegias (HSPs) comprise a heterogeneous group of disorders characterized by progressive spasticity and weakness of the lower limbs. Autosomal dominant and ‘pure' forms of HSP account for ∼80% of cases in Western societies of whom 10% carry atlastin-1 (ATL1) gene mutations. We report on a large consanguineous family segregating six members with early onset HSP. The pedigree was compatible with both autosomal dominant and autosomal recessive inheritance. Whole-exome seque...

  1. Molecular and cytogenetic characterization of two patients with recurrent miscarriages and X-autosome translocation

    Directory of Open Access Journals (Sweden)

    Usha R Dutta

    2012-01-01

    Full Text Available Aim: To report two patients with recurrent miscarriages and unique reciprocal X-autosomal translocation. Materials and Methods: Cytogenetic analysis was performed using G-banding and Molecular cytogenetic analysis by Fluorescence in situ hybridization to confirm the breakpoint regions. Results: The chromosomal analysis of the two cases revealed a karyotype of 46,X,t(X;22(p11.21;q13.3 in the first patient and 46,X,t(X;2(q22;q13 in second patient. Both the cases were confirmed by using whole chromosome paint probes. Conclusions: This is the rare report of X-autosomal translocations with unique breakpoint regions and their association with recurrent miscarriages. The translocation breakpoint in case 2 on Xq22 and on Xp11.21 in case 1 might be a risk factor for recurrent miscarriages. Here the impact of the X-autosomal translocations is discussed.

  2. Oculodentodigital dysplasia: study of ophthalmological and clinical manifestations in three boys with probably autosomal recessive inheritance.

    Science.gov (United States)

    Frasson, Maria; Calixto, Nassim; Cronemberger, Sebastião; de Aguiar, Regina Amélia Lopes Pessoa; Leão, Letícia Lima; de Aguiar, Marcos José Burle

    2004-09-01

    Oculodentodigital dysplasia (ODDD) is a rare inherited disorder affecting the development of the face, eyes, teeth, and limbs. The majority of cases of ODDD are inherited as an autosomal dominant condition. There are few reports of probable autosomal recessive transmission. Affected patients exhibit a distinctive physiognomy with a narrow nose, hypoplastic alae nasi, and anteverted nostrils, bilateral microphthalmos, and microcornea. Sometimes iris anomalies and secondary glaucoma are present. There are malformations of the distal extremities such as syndactyly. In addition, there are defects in the dental enamel with hypoplasia and yellow discoloration of the teeth. Less common features include hypotrichosis, intracranial calcifications, and conductive deafness secondary to recurrent otitis media. We describe three brothers with ODDD. Their parents are first cousins and present no features of ODDD. These data are in favor of autosomal recessive inheritance and suggest genetic heterogeneity for this entity. PMID:15512999

  3. Reinvestigations of six unusual paternity cases by typing of autosomal single-nucleotide polymorphisms

    DEFF Research Database (Denmark)

    Børsting, Claus; Morling, Niels

    2012-01-01

    BACKGROUND: In some relationship cases, the initial investigations of autosomal short tandem repeats (STRs) lead to an ambiguous conclusion and supplementary investigations become necessary. STUDY DESIGN AND METHODS: Six unusual paternity cases were previously investigated by other researchers and....... In two cases, the SNP results supported the conclusions based on STRs. In the last case, the SNP results spoke in favor of paternity, and the combined paternity index based on autosomal STRs and SNPs was 12.3 billion. Nevertheless, the alleged father was excluded by X-chromosome typing. CONCLUSION...

  4. A new novel mutation in FBN1 causes autosomal dominant Marfan syndrome in a Chinese family

    OpenAIRE

    Dong, Jiamei; Bu, Juan; Du, Wei; Li, Yuan; Jia, Yanlei; Li, Jianchang; Meng, Xiaoli; Minghui YUAN; Peng, Xiaojuan; Zhou, Aimin; Wang, Lejin

    2012-01-01

    Purpose Screening of mutations in the fibrillin-1 (FBN1) gene in a Chinese family with autosomal dominant Marfan syndrome (MFS). Methods It has been reported that FBN1 mutations account for approximately 90% of Autosomal Dominant MFS. FBN1 mutations were analyzed in a Chinese family of 36 members including 13 MFS patients. The genomic DNAs from blood leukocytes of the patients and their relatives were isolated and the entire coding region of FBN1 was amplified by PCR. The sequence of FBN1 was...

  5. Orofacial Manifestations of Autosomal Recessive Robinow’s Syndrome: A Rare Case Report

    Science.gov (United States)

    Mali, Santosh; Dhokar, Amol; Yadav, Monica

    2016-01-01

    Robinow’s syndrome is a very rare genetic disorder which bears a resemblance to a foetal face. It is characterized by short-limbed dwarfism, defects in vertebral segmentation and abnormalities in the head, face and external genitalia. It has a genetic heterogeneity with autosomal dominant and recessive forms which relates to the severity of phenotype presentation. A rare case of an autosomal recessive form of Robinow’s syndrome is presented with emphasis on, characteristic craniofacial and intraoral manifestations to aid in diagnosis and dental management of this patient.

  6. Lethal osteochondrodysplasia and de novo autosomal translocation involving the long arm of chromosome 4

    Energy Technology Data Exchange (ETDEWEB)

    Fryns, J.P.; Legius, E.; Van den Berghe, H.; Moerman, P. [Center for Human Genetics, Leuven (Belgium); Vandenberghe, K. [Univ. of Leuven (Belgium); Maroteaux, P. [Hopital des Enfants Malades, Paris (France)

    1994-06-01

    Recently, we diagnosed a de noco t(4q;11q) with apparent breakpoints at 4q23 and 11q13 [karyotype: 46,XX,t(4;11)(q23;q13)] in a first trimester female fetus with a lethal chondrodysplasia. After the observation reported by Urioste et al. (1994) the presena finding of a de novo autosomal translocation with one breakpoint in the proximal part of 4q in another fetus with lethal osteochondrodysplasia may be a further indication toward the possible location of a gene cluster in this autosomal region. 1 ref.

  7. Autopsy Report with Clinical and Pathophysiologic Discussion of Autosomal Dominant Adult Polycystic Kidney Disease

    Directory of Open Access Journals (Sweden)

    Anup Hazra

    2014-01-01

    Full Text Available The average weight of a kidney is approximately 135 gm, measuring on average 10 × 6 × 4 cm. In hereditary conditions, autosomal dominant and autosomal recessive polycystic kidney disease, the shape, size, and the weight can be significantly abnormal, causing progressive renal failure, often necessitating dialysis or renal transplant for survival. We report a case of adult polycystic kidney disease in a 50-year-old female without a family history, who died of complications of the disease which included accelerated hypertension, and renal and cardiac failure.

  8. Conservation of the Critically Endangered Eastern Australian Population of the Grey Nurse Shark ( Carcharias taurus) Through Cross-Jurisdictional Management of a Network of Marine-Protected Areas

    Science.gov (United States)

    Lynch, Tim P.; Harcourt, Robert; Edgar, Graham; Barrett, Neville

    2013-12-01

    Between 2001 and 2009, 26 marine-protected areas (MPA) were established on the east Australian seaboard, at least in part, to manage human interactions with a critically endangered population of grey nurse shark, Carcharias taurus. This network is spread across six MPA systems and includes all 19 sites outlined in the National Recovery Plan for C. taurus, though five sites remain open to some forms of fishing. The reserve network has complex cross-jurisdictional management, as the sharks occur in waters controlled by the Australian states of New South Wales (NSW) and Queensland, as well as by the Commonwealth (Federal) government. Jurisdiction is further complicated by fisheries and conservation departments both engaging in management activities within each state. This has resulted in protected area types that include IUCN category II equivalent zones in NSW, Queensland, and Commonwealth marine parks that either overlay or complement another large scaled network of protected sites called critical habitats. Across the network, seven and eight rule permutations for diving and fishing, respectively, are applied to this population of sharks. Besides sites identified by the recovery plan, additional sites have been protected as part of the general development of MPA networks. A case study at one of these sites, which historically was known to be occupied by C. taurus but had been abandoned, appears to shows re-establishment of an aggregation of juvenile and sub-adult sharks. Concurrent with the re-establishment of the aggregation, a local dive operator increased seasonal dive visitation rates at the site fourfold. As a precautionary measure, protection of abandoned sites, which includes nursery and gestating female habitats are options that may assist recovery of the east coast population of C. taurus.

  9. Conservation of the critically endangered eastern Australian population of the grey nurse shark (Carcharias taurus) through cross-jurisdictional management of a network of marine-protected areas.

    Science.gov (United States)

    Lynch, Tim P; Harcourt, Robert; Edgar, Graham; Barrett, Neville

    2013-12-01

    Between 2001 and 2009, 26 marine-protected areas (MPA) were established on the east Australian seaboard, at least in part, to manage human interactions with a critically endangered population of grey nurse shark, Carcharias taurus. This network is spread across six MPA systems and includes all 19 sites outlined in the National Recovery Plan for C. taurus, though five sites remain open to some forms of fishing. The reserve network has complex cross-jurisdictional management, as the sharks occur in waters controlled by the Australian states of New South Wales (NSW) and Queensland, as well as by the Commonwealth (Federal) government. Jurisdiction is further complicated by fisheries and conservation departments both engaging in management activities within each state. This has resulted in protected area types that include IUCN category II equivalent zones in NSW, Queensland, and Commonwealth marine parks that either overlay or complement another large scaled network of protected sites called critical habitats. Across the network, seven and eight rule permutations for diving and fishing, respectively, are applied to this population of sharks. Besides sites identified by the recovery plan, additional sites have been protected as part of the general development of MPA networks. A case study at one of these sites, which historically was known to be occupied by C. taurus but had been abandoned, appears to shows re-establishment of an aggregation of juvenile and sub-adult sharks. Concurrent with the re-establishment of the aggregation, a local dive operator increased seasonal dive visitation rates at the site fourfold. As a precautionary measure, protection of abandoned sites, which includes nursery and gestating female habitats are options that may assist recovery of the east coast population of C. taurus. PMID:24213854

  10. VLBA determination of the distance to nearby star-forming regions III. HP Tau/G2 and the three-dimensional structure of Taurus

    CERN Document Server

    Torres, Rosa M; Mioduszewski, Amy J; Rodriguez, Luis F

    2009-01-01

    Using multi-epoch Very Long Baseline Array observations, we have measured the trigonometric parallax of the weak-line T Tauri star HP Tau/G2 in Taurus. The best fit yields a distance of 161.2 $\\pm$ 0.9 pc, suggesting that the eastern portion of Taurus (where HP Tau/G2 is located) corresponds to the far side of the complex. Previous VLBA observations have shown that T Tau, to the South of the complex, is at an intermediate distance of about 147 pc, whereas the region around L1495 corresponds to the near side at roughly 130 pc. Our observations of only four sources are still too coarse to enable a reliable determination of the three-dimensional structure of the entire Taurus star-forming complex. They do demonstrate, however, that VLBA observations of multiple sources in a given star-forming region have the potential not only to provide a very accurate estimate of its mean distance, but also to reveal its internal structure. The proper motion measurements obtained simultaneously with the parallax allowed us to ...

  11. An Overview of the Antecedents and Consequences of Abandoned Residential Housing Projects in Malaysia – A solution from Blue Ocean Strategy (BOS) Perspective

    OpenAIRE

    Mohd Hasyim Hj. Mumin; Fakhrul Anwar Zainol

    2015-01-01

    The issue of abandoned residential housing projects in Malaysia is a matter that should be given more importance in the country. This study aims to identify what are the causes, examine how it affects affected home buyers, and to suggest the solutions from Blue Ocean Strategy (BOS) Perspective. To achieve the goals, this study focused on reviewing relevant literatures and observing the site of abandoned housing projects. From the review of the literatures, the main objective is to find out wh...

  12. Park7, a novel locus for autosomal recessive early-onset parkinsonism, on chromosome 1p36

    NARCIS (Netherlands)

    C.M. van Duijn (Cock); G.J. Breedveld (Guido); M. Horstink (Marten); L.A. Sandkuijl (Lodewijk); B.A. Oostra (Ben); J.C. van Swieten; V. Bonifati (Vincenzo); R-J.H. Galjaard (Robert-Jan); J.J. Houwing-Duistermaat (Jeanine); L. Testers; M.C.J. Dekker (Marieke); P.J.L.M. Snijders (Pieter); P. Heutink (Peter)

    2001-01-01

    textabstractAlthough the role of genetic factors in the origin of Parkinson disease has long been disputed, several genes involved in autosomal dominant and recessive forms of the disease have been localized. Mutations associated with early-onset autosomal recessive parkinsonism have been identified

  13. Park7, a novel locus for autosomal recessive early-onset parkinsonism, on chromosome 1p36.

    NARCIS (Netherlands)

    Duijn, C.M. van; Dekker, M.C.J.; Bonifati, V.; Galjaard, R.J.; Houwing-Duistermaat, J.J.; Snijders, P.J.L.M.; Testers, L.; Breedveld, G.J.; Horstink, M.W.I.M.; Sandkuijl, L.A.; Swieten, J. van; Oostra, B.A.; Heutink, P.

    2001-01-01

    Although the role of genetic factors in the origin of Parkinson disease has long been disputed, several genes involved in autosomal dominant and recessive forms of the disease have been localized. Mutations associated with early-onset autosomal recessive parkinsonism have been identified in the Park

  14. Autosomal recessive Stickler syndrome in two families is caused by mutations in the COL9A1 gene

    NARCIS (Netherlands)

    K. Nikopoulos (Konstantinos); I. Schrauwen (Isabelle); M.E.H. Simon (Marleen); R.W.J. Collin (Rob); M.A.H. Veckeneer (Marc); K. Keymolen (Kathelijn); G. van Camp (Guy); F.P.M. Cremers (Frans); L. Ingeborgh van den Born

    2011-01-01

    textabstractPurpose. To investigate COL9A1 in two families suggestive of autosomal recessive Stickler syndrome and to delineate the associated phenotype. Methods. The probands of two consanguineous autosomal recessive Stickler families were evaluated for homozygosity using SNP microarray in one and

  15. Autosomal recessive Stickler syndrome in two families is caused by mutations in the COL9A1 gene

    NARCIS (Netherlands)

    Nikopoulos, K.; Schrauwen, I.; Simon, M.; Collin, R.W.J.; Veckeneer, M.; Keymolen, K.; Camp, G. van; Cremers, F.P.M.; Born, L.I. van den

    2011-01-01

    PURPOSE: To investigate COL9A1 in two families suggestive of autosomal recessive Stickler syndrome and to delineate the associated phenotype. METHODS: The probands of two consanguineous autosomal recessive Stickler families were evaluated for homozygosity using SNP microarray in one and haplotype an

  16. An autosomal recessive syndrome of cleft palate, cardiac defect, genital anomalies, and ectrodactyly (CCGE).

    OpenAIRE

    Giannotti, A; Digilio, M C; Mingarelli, R; Dallapiccola, B.

    1995-01-01

    We report a brother and sister affected by a constellation of malformations, including cleft palate, cardiac defect, genital anomalies, and ectrodactyly (CCGE). A similar association has been reported previously by Richieri-Costa and Orquizas in a male patient born to consanguineous parents. An autosomal recessive pattern of inheritance is proposed for this syndrome.

  17. Asynchronous replication and autosome-pair non-equivalence in human embryonic stem cells.

    Directory of Open Access Journals (Sweden)

    Devkanya Dutta

    Full Text Available A number of mammalian genes exhibit the unusual properties of random monoallelic expression and random asynchronous replication. Such exceptional genes include genes subject to X inactivation and autosomal genes including odorant receptors, immunoglobulins, interleukins, pheromone receptors, and p120 catenin. In differentiated cells, random asynchronous replication of interspersed autosomal genes is coordinated at the whole chromosome level, indicative of chromosome-pair non-equivalence. Here we have investigated the replication pattern of the random asynchronously replicating genes in undifferentiated human embryonic stem cells, using fluorescence in situ hybridization based assay. We show that allele-specific replication of X-linked genes and random monoallelic autosomal genes occur in human embryonic stem cells. The direction of replication is coordinated at the whole chromosome level and can cross the centromere, indicating the existence of autosome-pair non-equivalence in human embryonic stem cells. These results suggest that epigenetic mechanism(s that randomly distinguish between two parental alleles are emerging in the cells of the inner cell mass, the source of human embryonic stem cells.

  18. Early-onset autosomal dominant Alzheimer disease: prevalence, genetic heterogeneity, and mutation spectrum.

    OpenAIRE

    Campion, D; Dumanchin, C; Hannequin, D.; Dubois, B.; Belliard, S; Puel, M; Thomas-Anterion, C.; Michon, A.; Martin, C.; Charbonnier, F; Raux, G; Camuzat, A; Penet, C; Mesnage, V; Martinez, M.

    1999-01-01

    To determine the prevalence of early-onset Alzheimer disease (EOAD) and of autosomal dominant forms of EOAD (ADEOAD), we performed a population-based study in the city of Rouen (426,710 residents). EOAD was defined as onset of disease at age

  19. Prenatal diagnosis by ultrasound in pregnancies at risk for autosomal recessive polycystic kidney disease

    NARCIS (Netherlands)

    A. Reuss (Annette); J.W. Wladimiroff (Juriy); P.A. Stewart (Patricia); M.F. Niermeijer (Martinus)

    1990-01-01

    markdownabstractAbstract In 15 pregnancies at risk of the autosomal recessive type of polycystic kidney disease (ARPKD), there were six recurrences (40%), five of which were diagnosed prenatally between 17 and 26 weeks (mean, 22 weeks). In the remaining affected case, normal kidney size and echoge

  20. Spectrum of mutations in the renin-angiotensin system genes in autosomal recessive renal tubular dysgenesis

    DEFF Research Database (Denmark)

    Gribouval, Olivier; Morinière, Vincent; Pawtowski, Audrey;

    2012-01-01

    Autosomal recessive renal tubular dysgenesis (RTD) is a severe disorder of renal tubular development characterized by early onset and persistent fetal anuria leading to oligohydramnios and the Potter sequence, associated with skull ossification defects. Early death occurs in most cases from anuri...

  1. Familial Paroxysmal Exercise-Induced Dystonia: Atypical Presentation of Autosomal Dominant GTP-Cyclohydrolase 1 Deficiency

    Science.gov (United States)

    Dale, Russell C.; Melchers, Anna; Fung, Victor S. C.; Grattan-Smith, Padraic; Houlden, Henry; Earl, John

    2010-01-01

    Paroxysmal exercise-induced dystonia (PED) is one of the rarer forms of paroxysmal dyskinesia, and can occur in sporadic or familial forms. We report a family (male index case, mother and maternal grandfather) with autosomal dominant inheritance of paroxysmal exercise-induced dystonia. The dystonia began in childhood and was only ever induced…

  2. An autosomal glucose-6-phosphate dehydrogenase (hexose-6-phosphate dehydrogenase) polymorphism in human saliva.

    Science.gov (United States)

    Tan, S G; Ashton, G C

    1976-01-01

    Glucose-6-phosphate dehydrogenase (hexose-6-phosphate dehydrogenase) from human saliva has been demonstrated by the zymogram technique. Three phenotypes were found. Family and population studies suggested that these phenotypes are the products of an autosomal locus with two alleles Sgd-1 and Sgd-2. PMID:950237

  3. Caroli's Syndrome with Autosomal Recessive Polycystic Kidney Disease in a Two Month Old Infant

    OpenAIRE

    Kim, Jeong Tae; Hur, Yoon Jeong; Park, Jee Min; Kim, Myung Joon; Park, Young Nyun; Lee, Jae Seung

    2006-01-01

    Caroli's syndrome is a rare congenital disorder that involves intrahepatic bile duct ectasia and congenital hepatic fibrosis, frequently seen with concomitant autosomal recessive polycystic kidney disease (ARPKD). Literature on infants with ARPKD is rare. Here, we present a case of a two month old boy who was diagnosed with Caroli's syndrome and ARPKD.

  4. DJ-1( PARK7), a novel gene for autosomal recessive, early onset parkinsonism

    NARCIS (Netherlands)

    V. Bonifati (Vincenzo); F. Squitieri (Ferdinando); E. Krieger (Elmar); N. Vanacore (Nicola); J.C. van Swieten; A. Brice; C.M. van Duijn (Cock); G. Meco (Giuseppe); P. Heutink (Peter); B.A. Oostra (Ben); P. Rizzu (Patrizia)

    2003-01-01

    textabstractFour chromosomal loci ( PARK2, PARK6, PARK7, and PARK9) associated with autosomal recessive, early onset parkinsonism are known. We mapped the PARK7 locus to chromosome 1p36 in a large family from a genetically isolated population in the Netherlands, and confirmed this linkage in an Ital

  5. Mutations in KIF11 cause autosomal-dominant microcephaly variably associated with congenital lymphedema and chorioretinopathy

    NARCIS (Netherlands)

    Ostergaard, P.; Simpson, M.A.; Mendola, A.; Vasudevan, P.; Connell, F.C.; van Impel, A.; Moore, A.T.; Loeys, B.L.; Ghalamkarpour, A.; Onoufriadis, A.; Martinez-Corral, I.; Devery, S.; Leroy, J.G.; van Laer, L.; Singer, A.; Bialer, M.G.; McEntagart, M.; Quarrell, O.; Brice, G.; Trembath, R.C.; Schulte-Merker, S.; Makinen, T.; Vikkula, M.; Mortimer, P.S.; Mansour, S.; Jeffery, S.

    2012-01-01

    We have identified KIF11 mutations in individuals with syndromic autosomal-dominant microcephaly associated with lymphedema and/or chorioretinopathy. Initial whole-exome sequencing revealed heterozygous KIF11 mutations in three individuals with a combination of microcephaly and lymphedema from a mic

  6. Herschel/PACS Survey of protoplanetary disks in Taurus/Auriga -- Observations of [OI] and [CII], and far infrared continuum

    CERN Document Server

    Howard, Christian D; Vacca, William D; Duchêne, Gaspard; Mathews, Geoffrey; Augereau, Jean-Charles; Barrado, David; Dent, William R F; Eiroa, Carlos; Grady, Carol; Kamp, Inga; Meeus, Gwendolyn; Ménard, Francois; Pinte, Christophe; Podio, Linda; Riviere-Marichalar, Pablo; Roberge, Aki; Thi, Wing-Fai; Vicente, Silvia; Williams, Jonathan P

    2013-01-01

    The Herschel Space Observatory was used to observe ~ 120 pre-main-sequence stars in Taurus as part of the GASPS Open Time Key project. PACS was used to measure the continuum as well as several gas tracers such as [OI] 63 \\mu m, [OI] 145 \\mu m, [CII] 158 \\mu m, OH, H2O and CO. The strongest line seen is [OI] at 63 \\mu m. We find a clear correlation between the strength of the [OI] 63 \\mu m line and the 63 \\mu m continuum for disk sources. In outflow sources, the line emission can be up to 20 times stronger than in disk sources, suggesting that the line emission is dominated by the outflow. The tight correlation seen for disk sources suggests that the emission arises from the inner disk ($<$ 50 AU) and lower surface layers of the disk where the gas and dust are coupled. The [OI] 63 \\mu m is fainter in transitional stars than in normal Class II disks. Simple SED models indicate that the dust responsible for the continuum emission is colder in these disks, leading to weaker line emission. [CII] 158 \\mu m emiss...

  7. Evolution of OH and CO-dark Molecular Gas Fraction Across a Molecular Cloud Boundary In Taurus

    CERN Document Server

    Xu, Duo; Yue, Nannan; Goldsmith, Paul F

    2016-01-01

    We present observations of 12CO J=1-0, 13CO J=1-0, HI, and all four ground-state transitions of the hydroxyl (OH) radical toward a sharp boundary region of the Taurus molecular cloud. Based on a PDR model that reproduces CO and [CI] emission from the same region, we modeled the three OH transitions, 1612, 1665, 1667 MHz successfully through escape probability non-LTE radiative transfer model calculations. We could not reproduce the 1720 MHz observations, due to un-modeled pumping mechanisms, of which the most likely candidate is a C-shock. The abundance of OH and CO-dark molecular gas (DMG) are well constrained. The OH abundance [OH]/[H2] decreases from 8*10-7 to 1*10-7 as Av increases from 0.4 to 2.7 mag, following an empirical law [OH]/[H2]= 1.5 * 10^{-7} + 9.0 * 10^{-7} * exp(-Av/0.81), which is higher than PDR model predictions for low extinction regions by a factor of 80. The overabundance of OH at extinctions at or below 1 mag is likely the result of a C-shock. The dark gas fraction (DGF, defined as fra...

  8. SPITZER INFRARED SPECTROGRAPH OBSERVATIONS OF CLASS I/II OBJECTS IN TAURUS: COMPOSITION AND THERMAL HISTORY OF THE CIRCUMSTELLAR ICES

    International Nuclear Information System (INIS)

    We present observations of Taurus-Auriga Class I/II protostars obtained with the Spitzer InfraRed Spectrograph. Detailed spectral fits to the 6 and 15.2 micron ice features are made, using publicly available laboratory data, to constrain the molecular composition, abundances, and levels of thermal processing along the lines of sight. We provide an inventory of the molecular environments observed, which have an average composition dominated by water-ice with ∼12% CO2 (abundance relative to H2O), ∼>2%-9% CH3OH, ∼14% NH3, ∼3% CH4, ∼2% H2CO, ∼0.6% HCOOH, and ∼0.5% SO2. We find CO2/H2O ratios nearly equivalent to those observed in cold clouds and lines of sight toward the galactic center. The unidentified 6.8 micron profiles vary from source to source, and it is shown to be likely that even combinations of the most common candidates (NH+4 and CH3OH) are inadequate to explain the feature fully. We discuss correlations among SED spectral indices, abundance ratios, and thermally processed ice fractions and their implications for CO2 formation and evolution. Comparison of our spectral fits with cold molecular cloud sight lines indicates abundant prestellar ice environments made even richer by the radiative effects of protostars. Our results add additional constraints and a finer level of detail to current full-scale models of protostellar and protoplanetary systems.

  9. Spitzer IRS Observations of Class I/II Objects in Taurus: Composition, Temperature and Thermal History of the Circumstellar Ices

    CERN Document Server

    Zasowski, G; Watson, Dan M; Furlan, E; Bohac, C J; Hull, C; Green, J D

    2007-01-01

    We present observations of Taurus-Auriga Class I/II protostars obtained with the Spitzer InfraRed Spectrograph. Detailed spectral fits to the 6 and 15 micron features are made, using publicly-available laboratory data, to constrain the molecular composition, abundances, and levels of thermal processing along the lines of sight. We provide an inventory of the molecular environments observed, which have an average composition dominated by water ice with ~12% CO_2 (abundance relative to H_2O), >~2-9% CH_3OH, <~14% NH_3, ~4% CH_4, ~2% H_2CO, ~0.6% HCOOH, and ~0.5% SO_2. We find CO_2/H_2O ratios nearly equivalent to those observed in cold clouds and lines of sight toward the galactic center. The unidentified 6.8 micron profile shapes vary from source to source, and it is shown to be likely that even combinations of the most common candidates (NH_4+ and CH_3OH) are inadequate to explain the feature fully. We discuss correlations among SED spectral indices, abundance ratios, and thermally-processed ice fractions ...

  10. A census of dense cores in the Taurus L1495 cloud from the Herschel Gould Belt Survey

    CERN Document Server

    Marsh, K A; Andre, Ph; Griffin, M J; Konyves, V; Palmeirim, P; Men'shchikov, A; Ward-Thompson, D; Benedettini, M; Bresnahan, D W; Di Francesco, J; Elia, D; Peretto, N; Pezzuto, S; Roy, A; Sadavoy, S; Schneider, N; Spinoglio, L; White, G J

    2016-01-01

    We present a catalogue of dense cores in a $\\sim 4^\\circ\\times2^\\circ$ field of the Taurus star-forming region, inclusive of the L1495 cloud, derived from Herschel SPIRE and PACS observations in the 70 $\\mu$m, 160 $\\mu$m, 250 $\\mu$m, 350 $\\mu$m, and 500 $\\mu$m continuum bands. Estimates of mean dust temperature and total mass are derived using modified blackbody fits to the spectral energy distributions. We detect 528 starless cores of which $\\sim10$-20% are gravitationally bound and therefore presumably prestellar. Our census of unbound objects is $\\sim85$% complete for $M>0.015\\,M_\\odot$ in low density regions ($A_V\\stackrel{0.1\\,M_\\odot$ overall. The prestellar core mass function (CMF) is consistent with lognormal form, resembling the stellar system initial mass function, as has been reported previously. All of the inferred prestellar cores lie on filamentary structures whose column densities exceed the expected threshold for filamentary collapse, in agreement with previous reports. Unlike the prestellar C...

  11. The genetics of maternal care: direct and indirect genetic effects on phenotype in the dung beetle Onthophagus taurus.

    Science.gov (United States)

    Hunt, John; Simmons, Leigh W

    2002-05-14

    While theoretical models of the evolution of parental care are based on the assumption of underlying genetic variance, surprisingly few quantitative genetic studies of this life-history trait exist. Estimation of the degree of genetic variance in parental care is important because it can be a significant source of maternal effects, which, if genetically based, represent indirect genetic effects. A major prediction of indirect genetic effect theory is that traits without heritable variation can evolve because of the heritable environmental variation that indirect genetic effects provide. In the dung beetle, Onthophagus taurus, females provide care to offspring by provisioning a brood mass. The size of the brood mass has pronounced effects on offspring phenotype. Using a half-sib breeding design we show that the weight of the brood mass females produce exhibits significant levels of additive genetic variance due to sires. However, variance caused by dams is considerably larger, demonstrating that maternal effects are also important. Body size exhibited low additive genetic variance. However, body size exerts a strong maternal influence on the weight of brood masses produced, accounting for 22% of the nongenetic variance in offspring body size. Maternal body size also influenced the number of offspring produced but there was no genetic variance for this trait. Offspring body size and brood mass weight exhibited positive genetic and phenotypic correlations. We conclude that both indirect genetic effects, via maternal care, and nongenetic maternal effects, via female size, play important roles in the evolution of phenotype in this species. PMID:11983863

  12. A Combined Spitzer IRAC/MIPS/IRS and XMM-Newton Survey of the Taurus Molecular Cloud

    Science.gov (United States)

    Audard, Marc; Briggs, Kevin; Fajardo-Acosta, Sergio; Glauser, Adrian; Guedel, Manuel; Morris, Patrick; Padgett, Deborah; Rebull, Luisa; Skinner, Stephen; Stapelfedlt, Karl; Wolf, Sebastian

    2005-06-01

    We propose to mine the Spitzer IRS data archive to complement our Spitzer IRAC/MIPS and XMM-Newton X-ray surveys of the Taurus Molecular Cloud (TMC). We will combine the Spitzer data with those obtained in the X-ray regime with XMM-Newton. Our goals are i) to reconstruct the detailed spectral energy distributions of young stellar objects in TMC. Our disk models will provide a comprehensive description of the circumstellar disks in young stars; ii) to combine infrared dust and gas modeling with X-ray spectroscopy. We will derive estimates of the total gas masses, of gas-to-dust ratios, and of disk surface ionization; iii) to determine the role of X-ray irradiation for heating, ionization, and disk chemistry. The Spitzer IRAC, MIPS, and IRS data in combination with the XMM-Newton data provide a unique opportunity to study in detail the structure and composition of circumstellar disks and envelopes in stars from the deeply embedded stage to the accretion-free stage of weak-lined T Tauri stars, and to determine the role of X-rays in these systems.

  13. De novo origin of VCY2 from autosome to Y-transposed amplicon.

    Directory of Open Access Journals (Sweden)

    Peng-Rong Cao

    Full Text Available The formation of new genes is a primary driving force of evolution in all organisms. The de novo evolution of new genes from non-protein-coding genomic regions is emerging as an important additional mechanism for novel gene creation. Y chromosomes underlie sex determination in mammals and contain genes that are required for male-specific functions. In this study, a search was undertaken for Y chromosome de novo genes derived from non-protein-coding sequences. The Y chromosome orphan gene variable charge, Y-linked (VCY2, is an autosome-derived gene that has sequence similarity to large autosomal fragments but lacks an autosomal protein-coding homolog. VCY2 locates in the amplicon containing long DNA fragments that were transposed from autosomes to the Y chromosome before the ape-monkey split. We confirmed that VCY2 cannot be encoded by autosomes due to the presence of multiple disablers that disrupt the open reading frame, such as the absence of start or stop codons and the presence of premature stop codons. Similar observations have been made for homologs in the autosomes of the chimpanzee, gorilla, rhesus macaque, baboon and out-group marmoset, which suggests that there was a non-protein-coding ancestral VCY2 that was common to apes and monkeys that predated the transposition event. Furthermore, while protein-coding orthologs are absent, a putative non-protein-coding VCY2 with conserved disablers was identified in the rhesus macaque Y chromosome male-specific region. This finding implies that VCY2 might have not acquired its protein-coding ability before the ape-monkey split. VCY2 encodes a testis-specific expressed protein and is involved in the pathologic process of male infertility, and the acquisition of this gene might improve male fertility. This is the first evidence that de novo genes can be generated from transposed autosomal non-protein-coding segments, and this evidence provides novel insights into the evolutionary history of the Y

  14. De novo origin of VCY2 from autosome to Y-transposed amplicon.

    Science.gov (United States)

    Cao, Peng-Rong; Wang, Lei; Jiang, Yu-Chao; Yi, Yin-Sha; Qu, Fang; Liu, Tao-Cheng; Lv, Yuan

    2015-01-01

    The formation of new genes is a primary driving force of evolution in all organisms. The de novo evolution of new genes from non-protein-coding genomic regions is emerging as an important additional mechanism for novel gene creation. Y chromosomes underlie sex determination in mammals and contain genes that are required for male-specific functions. In this study, a search was undertaken for Y chromosome de novo genes derived from non-protein-coding sequences. The Y chromosome orphan gene variable charge, Y-linked (VCY)2, is an autosome-derived gene that has sequence similarity to large autosomal fragments but lacks an autosomal protein-coding homolog. VCY2 locates in the amplicon containing long DNA fragments that were transposed from autosomes to the Y chromosome before the ape-monkey split. We confirmed that VCY2 cannot be encoded by autosomes due to the presence of multiple disablers that disrupt the open reading frame, such as the absence of start or stop codons and the presence of premature stop codons. Similar observations have been made for homologs in the autosomes of the chimpanzee, gorilla, rhesus macaque, baboon and out-group marmoset, which suggests that there was a non-protein-coding ancestral VCY2 that was common to apes and monkeys that predated the transposition event. Furthermore, while protein-coding orthologs are absent, a putative non-protein-coding VCY2 with conserved disablers was identified in the rhesus macaque Y chromosome male-specific region. This finding implies that VCY2 might have not acquired its protein-coding ability before the ape-monkey split. VCY2 encodes a testis-specific expressed protein and is involved in the pathologic process of male infertility, and the acquisition of this gene might improve male fertility. This is the first evidence that de novo genes can be generated from transposed autosomal non-protein-coding segments, and this evidence provides novel insights into the evolutionary history of the Y chromosome. PMID

  15. 牦牛HSP27基因的克隆及其在雌性生殖器官中的表达%Cloning of Bos Grunniens HSP27 Gene and Its Expression in the Female Yak Reproductive Organs

    Institute of Scientific and Technical Information of China (English)

    何翃闳; 崔燕; 潘阳阳; 樊江峰; 胡威; 张译夫; 刘鹏刚; 李秦; 余四九

    2015-01-01

    determined that the atom number, molecular formula, calculated molecular weight and theoretical isoelectric point of the encoded protein were 2366, C747H1189N205O220S5, 16.722 kD, and 5.33 respectively. The HSP27 encoded protein of HSP27 was predicted to be a type of soluble and non-transmembrane protein. Nucleotide sequence analysis revealed that the HSP27 gene nucleotide sequence of yak was similar to those ofBos taurus(99.8%),Bubalus bubalis(98.4%),Ovis aries(97.8%),Pantholops hodgsonii(97.6%),Orcinus orca(90.3%),Camelus ferus(89.7%),Sus scrofa(89.7%),Equus caballus (86.7%),Canis lupus(86.7%),Homo sapiens(85.5%) andGorilla gorilla(85.3%). The similarity of resulting amino acid sequence of HSP27 gene between yak andbos taurus, bubalus bubalis, ovis aries pantholops hodgsonii, orcinus orca, camelus ferus sus scrofa, equus caballus, canis lupus, homo sapiensand gorilla gorilla were 100%、100%、100%、100%、96.3%、100%、96.8%、100%、100%、96.3% and 96.3%, respectively. The phylogenetic tree indicated that HSP27 gene of yak was close to bos taurus, bubalus bubalis, ovis aries and pantholops hodgsonii, but far from canis lupus, gorilla gorillaand homo sapiens. Moreover, the RT-qPCR indicated that HSP27 gene expressed universally in ovary, oviduct and uterus tissues during all reproductive periods, including follicular, luteal and pregnancy phases. The gene had its highest expression level in the follicle at follicle phase and its lowest expression in uterus in the luteal phase. In addition, the expression level of HSP27 gene in ovary was significantly higher than in the uterus during each of the different stages of the reproductive cycle. Its expression in ovaries, fallopian tubes and uterus changed dramatically because of pregnancy.[Conclusion]It is concluded from the present study that HSP27 gene in the yak is highly conservative in mammalian evolution according to the comparative nucleotide sequence analysis.. Analyzing HSP27 gene expression in central reproductive

  16. NCBI nr-aa BLAST: CBRC-STRI-01-2431 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2431 ref|NP_001030220.1| neuromedin U receptor 2 [Bos taurus] sp|Q58CW...4|NMUR2_BOVIN RecName: Full=Neuromedin-U receptor 2; Short=NMU-R2 gb|AAX46680.1| neuromedin U receptor 2 [Bos taurus] NP_001030220.1 0.0 84% ...

  17. NCBI nr-aa BLAST: CBRC-TTRU-01-1168 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1168 ref|NP_001030220.1| neuromedin U receptor 2 [Bos taurus] sp|Q58CW...4|NMUR2_BOVIN RecName: Full=Neuromedin-U receptor 2; Short=NMU-R2 gb|AAX46680.1| neuromedin U receptor 2 [Bos taurus] NP_001030220.1 1e-163 90% ...

  18. NCBI nr-aa BLAST: CBRC-PVAM-01-0659 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0659 ref|NP_001030220.1| neuromedin U receptor 2 [Bos taurus] sp|Q58CW...4|NMUR2_BOVIN RecName: Full=Neuromedin-U receptor 2; Short=NMU-R2 gb|AAX46680.1| neuromedin U receptor 2 [Bos taurus] NP_001030220.1 0.0 84% ...

  19. Dicty_cDB: SSI876 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI876 (Link to dictyBase) - - - Contig-U15499-1 SSI876F (Link to Original ... 6 AF451177 |AF451177.1 AF451177 Bos taurus retinal pigment ... epithelium Bos taurus cDNA, mRNA sequence. 36 0.40 ...

  20. NCBI nr-aa BLAST: CBRC-ETEL-01-0844 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0844 ref|NP_776631.1| thyroid stimulating hormone receptor [Bos taurus] sp|Q27987|TSH ... SHR_BOVIN Thyrotropin receptor precursor (TSH -R) (Thyroid-stimulating hormone receptor) gb|AAC18 ... 639.1| thyrotropin (TSH ) receptor [Bos taurus] NP_776631.1 0.0 88% ...

  1. NCBI nr-aa BLAST: CBRC-ACAR-01-1166 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1166 ref|NP_776631.1| thyroid stimulating hormone receptor [Bos taurus] sp|Q27987|TSH ... SHR_BOVIN Thyrotropin receptor precursor (TSH -R) (Thyroid-stimulating hormone receptor) gb|AAC18 ... 639.1| thyrotropin (TSH ) receptor [Bos taurus] NP_776631.1 0.0 68% ...

  2. NCBI nr-aa BLAST: CBRC-GGAL-05-0029 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-05-0029 ref|NP_776631.1| thyroid stimulating hormone receptor [Bos taurus] sp|Q27987|TSH ... SHR_BOVIN Thyrotropin receptor precursor (TSH -R) (Thyroid-stimulating hormone receptor) gb|AAC18 ... 639.1| thyrotropin (TSH ) receptor [Bos taurus] NP_776631.1 0.0 75% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-0850 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0850 ref|NP_776631.1| thyroid stimulating hormone receptor [Bos taurus] sp|Q27987|TSH ... SHR_BOVIN Thyrotropin receptor precursor (TSH -R) (Thyroid-stimulating hormone receptor) gb|AAC18 ... 639.1| thyrotropin (TSH ) receptor [Bos taurus] NP_776631.1 1e-159 92% ...

  4. NCBI nr-aa BLAST: CBRC-BTAU-01-2842 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2842 ref|NP_776631.1| thyroid stimulating hormone receptor [Bos taurus] sp|Q27987|TSH ... SHR_BOVIN Thyrotropin receptor precursor (TSH -R) (Thyroid-stimulating hormone receptor) gb|AAC18 ... 639.1| thyrotropin (TSH ) receptor [Bos taurus] NP_776631.1 0.0 99% ...

  5. NCBI nr-aa BLAST: CBRC-FCAT-01-0577 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-0577 ref|NP_776631.1| thyroid stimulating hormone receptor [Bos taurus] sp|Q27987|TSH ... SHR_BOVIN Thyrotropin receptor precursor (TSH -R) (Thyroid-stimulating hormone receptor) gb|AAC18 ... 639.1| thyrotropin (TSH ) receptor [Bos taurus] NP_776631.1 1e-156 77% ...

  6. NCBI nr-aa BLAST: CBRC-TGUT-08-0024 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-08-0024 ref|NP_776631.1| thyroid stimulating hormone receptor [Bos taurus] sp|Q27987|TSH ... SHR_BOVIN Thyrotropin receptor precursor (TSH -R) (Thyroid-stimulating hormone receptor) gb|AAC18 ... 639.1| thyrotropin (TSH ) receptor [Bos taurus] NP_776631.1 0.0 72% ...

  7. NCBI nr-aa BLAST: CBRC-CFAM-08-0025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-08-0025 ref|NP_776631.1| thyroid stimulating hormone receptor [Bos taurus] sp|Q27987|TSH ... SHR_BOVIN Thyrotropin receptor precursor (TSH -R) (Thyroid-stimulating hormone receptor) gb|AAC18 ... 639.1| thyrotropin (TSH ) receptor [Bos taurus] NP_776631.1 0.0 90% ...

  8. NCBI nr-aa BLAST: CBRC-PMAR-01-0572 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0572 ref|NP_776631.1| thyroid stimulating hormone receptor [Bos taurus] sp|Q27987|TSH ... SHR_BOVIN Thyrotropin receptor precursor (TSH -R) (Thyroid-stimulating hormone receptor) gb|AAC18 ... 639.1| thyrotropin (TSH ) receptor [Bos taurus] NP_776631.1 0.0 52% ...

  9. NCBI nr-aa BLAST: CBRC-OLAT-15-0022 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-15-0022 ref|NP_001073692.1| solute carrier family 29 (nucleoside transporters...), member 3 [Bos taurus] gb|AAI26742.1| Solute carrier family 29 (nucleoside transporters), member 3 [Bos taurus] NP_001073692.1 9e-68 49% ...

  10. NCBI nr-aa BLAST: CBRC-FRUB-02-0631 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0631 ref|NP_776543.2| myocilin, trabecular meshwork inducible glucocor...ticoid response [Bos taurus] gb|AAI04572.1| Myocilin, trabecular meshwork inducible glucocorticoid response [Bos taurus] NP_776543.2 1e-102 53% ...

  11. NCBI nr-aa BLAST: CBRC-OLAT-17-0016 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-17-0016 ref|NP_776543.2| myocilin, trabecular meshwork inducible glucocor...ticoid response [Bos taurus] gb|AAI04572.1| Myocilin, trabecular meshwork inducible glucocorticoid response [Bos taurus] NP_776543.2 1e-99 58% ...

  12. NCBI nr-aa BLAST: CBRC-GACU-03-0016 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-03-0016 ref|NP_776543.2| myocilin, trabecular meshwork inducible glucocor...ticoid response [Bos taurus] gb|AAI04572.1| Myocilin, trabecular meshwork inducible glucocorticoid response [Bos taurus] NP_776543.2 1e-115 50% ...

  13. NCBI nr-aa BLAST: CBRC-TTRU-01-0439 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0439 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 91% ...

  14. NCBI nr-aa BLAST: CBRC-PTRO-13-0056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-13-0056 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  15. NCBI nr-aa BLAST: CBRC-HSAP-12-0048 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-12-0048 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  16. NCBI nr-aa BLAST: CBRC-PHAM-01-1399 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1399 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 86% ...

  17. NCBI nr-aa BLAST: CBRC-RNOR-07-0387 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-07-0387 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 82% ...

  18. NCBI nr-aa BLAST: CBRC-RMAC-11-0047 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-11-0047 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 86% ...

  19. NCBI nr-aa BLAST: CBRC-TBEL-01-1351 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-1351 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 85% ...

  20. NCBI nr-aa BLAST: CBRC-PVAM-01-1419 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1419 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-156 73% ...

  1. NCBI nr-aa BLAST: CBRC-ACAR-01-1013 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1013 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-129 59% ...

  2. NCBI nr-aa BLAST: CBRC-OCUN-01-1169 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-1169 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-167 79% ...

  3. NCBI nr-aa BLAST: CBRC-GACU-23-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-23-0004 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-108 51% ...

  4. NCBI nr-aa BLAST: CBRC-CFAM-27-0019 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-27-0019 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 83% ...

  5. NCBI nr-aa BLAST: CBRC-FRUB-02-0486 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0486 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-105 52% ...

  6. NCBI nr-aa BLAST: CBRC-MMUS-15-0051 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-15-0051 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 82% ...

  7. NCBI nr-aa BLAST: CBRC-ETEL-01-0242 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0242 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 85% ...

  8. NCBI nr-aa BLAST: CBRC-GGOR-01-0838 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0838 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-92 84% ...

  9. NCBI nr-aa BLAST: CBRC-PABE-13-0047 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-13-0047 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  10. NCBI nr-aa BLAST: CBRC-BTAU-01-1883 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-1883 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 99% ...

  11. NCBI nr-aa BLAST: CBRC-STRI-01-2762 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2762 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-110 85% ...

  12. NCBI nr-aa BLAST: CBRC-EEUR-01-1395 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-1395 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-132 85% ...

  13. NCBI nr-aa BLAST: CBRC-CJAC-01-1501 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1501 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  14. NCBI nr-aa BLAST: CBRC-MLUC-01-0607 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0607 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 86% ...

  15. NCBI nr-aa BLAST: CBRC-MEUG-01-0121 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0121 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-131 72% ...

  16. NCBI nr-aa BLAST: CBRC-OGAR-01-1283 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-1283 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  17. NCBI nr-aa BLAST: CBRC-MMUR-01-1175 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1175 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  18. NCBI nr-aa BLAST: CBRC-PCAP-01-1579 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1579 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 84% ...

  19. NCBI nr-aa BLAST: CBRC-OPRI-01-0778 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0778 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 8e-63 89% ...

  20. NCBI nr-aa BLAST: CBRC-OANA-01-0848 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-0848 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-135 64% ...