Revisiting AFLP fingerprinting for an unbiased assessment of genetic structure and differentiation of taurine and zebu cattle

NARCIS (Netherlands)

Utsunomiya, Yuri T.; Bomba, Lorenzo; Lucente, Giordana; Colli, Licia; Negrini, Riccardo; Lenstra, Johannes A.; Erhardt, Georg; Garcia, José F.; Ajmone-Marsan, Paolo; Moazami-Goudarzi, K.; Williams, J.; Wiener, P.; Olsaker, I.; Kantanen, J.; Dunner, S.; Cañón, J.; Rodellar, C.; Martín-Burriel, I.; Valentini, A.; Zanotti, M.; Holm, L. E.; Eythorsdottir, E.; Mommens, G.; Polygen, Van Haeringen; Nijman, I. J.; Dolf, G.; Bradley, D. G.

2014-01-01

Background: Descendants from the extinct aurochs (Bos primigenius), taurine (Bos taurus) and zebu cattle (Bos indicus) were domesticated 10,000 years ago in Southwestern and Southern Asia, respectively, and colonized the world undergoing complex events of admixture and selection. Molecular data, in

Genome-Enabled Prediction of Breeding Values for Feedlot Average Daily Weight Gain in Nelore Cattle

Directory of Open Access Journals (Sweden)

Adriana L. Somavilla

2017-06-01

Full Text Available Nelore is the most economically important cattle breed in Brazil, and the use of genetically improved animals has contributed to increased beef production efficiency. The Brazilian beef feedlot industry has grown considerably in the last decade, so the selection of animals with higher growth rates on feedlot has become quite important. Genomic selection (GS could be used to reduce generation intervals and improve the rate of genetic gains. The aim of this study was to evaluate the prediction of genomic-estimated breeding values (GEBV for average daily weight gain (ADG in 718 feedlot-finished Nelore steers. Analyses of three Bayesian model specifications [Bayesian GBLUP (BGBLUP, BayesA, and BayesCπ] were performed with four genotype panels [Illumina BovineHD BeadChip, TagSNPs, and GeneSeek High- and Low-density indicus (HDi and LDi, respectively]. Estimates of Pearson correlations, regression coefficients, and mean squared errors were used to assess accuracy and bias of predictions. Overall, the BayesCπ model resulted in less biased predictions. Accuracies ranged from 0.18 to 0.27, which are reasonable values given the heritability estimates (from 0.40 to 0.44 and sample size (568 animals in the training population. Furthermore, results from Bos taurus indicus panels were as informative as those from Illumina BovineHD, indicating that they could be used to implement GS at lower costs.

BREEDING SOUNDNESS EVALUATION OF TWO AND THREE YEAR OLD NELORE (BOS TAURUS INDICUS BULLS, RAISED UNDER PASTURE CONDITION CLASSIFICAÇÃO ANDROLÓGICA POR PONTOS (CAP DE TOUROS NELORE (Bos taurus indicus DE DOIS E TRÊS ANOS DE IDADE, CRIADOS SOB PASTEJO

Directory of Open Access Journals (Sweden)

Juliano Cesar Dias

2009-12-01

Full Text Available

Aurochs and potential crossbreeding with domestic cattle in Central Europe in the Eneolithic period. A metric analysis of bones from the archaeological site of Kutná Hora–Denemark (Czech Republic)

Czech Academy of Sciences Publication Activity Database

Kyselý, René

2008-01-01

Roč. 43, č. 2 (2008), s. 7-37 ISSN 0761-3032 Institutional research plan: CEZ:AV0Z80020508 Keywords : Bos primigenius * local domestic ation * crossbreeding * cattle * Eneolithic * osteometry Subject RIV: AC - Archeology, Anthropology, Ethnology

Fatores etários no leucograma de fêmeas zebuínas sadias da raça Nelore (Bos indicus Influence of age on the leukogram values for healthy Nelore (Zebu cattle

Directory of Open Access Journals (Sweden)

Joselito Nunes Costa

2000-06-01

Full Text Available Para avaliar-se a influência dos fatores etários sobre o leucograma de fêmeas zebuínas da raça Nelore, examinaram-se amostras de sangue de 158 animais, distribuídos por sete grupos etários ( até 3 meses; 3 a 6 meses; 6 a 12 meses; 12 a 24 meses; 24 a 48 meses; 48 a 72 meses e maior que 72 meses. Os resultados expressos em valores médios (± desvios padrões máximo (máx. e mínimo (mín. em milhares de células por mm³ para os diferentes componentes do leucograma foram os seguintes: leucócitos total máx. - 16992 ± 4104 ( 6 a 12 meses e min. -10353 ± 2397 (48 a 72 meses ; neutrófilos total máx. - 3931 ± 1578 (até 3 meses e min. - 2416 ± 1118 ( 6 a 12 meses ; eosinófilos máx. - 999 ± 499 (24 a 48 meses e min. - 265 ± 276 ( 3 a 6 meses ; basófilos máx. - 67 ± 88 (> 72 meses e min. - 39 ± 78 (6 a 12 meses; linfócitos típicos máx. - 12758 ± 3608 (6 a 12 meses e min. - 5906 ± 1883 (48 a 72 meses; linfócitos atípicos máx. - 1310 ± 603 (3 a 6 meses e min. - 760 ± 419 ( 48 a 72 meses ; linfócitos total máx. - 14079 ± 4027 (6 a 12 meses e min. - 6666 ± 2059 ( 48 a 72 meses ; monócitos máx. -27 ± 62 ( até 3 meses e min.- 0 ( 6 a 12 meses. A existência de diferenças (p > 0,05 entre grupos demonstrando diminuição dos neutrófilos e aumento dos linfócitos no primeiro ano de vida; a diminuição dos valores do total de leucócitos a partir de um ano de idade, como reflexo de comportamento similar dos números de linfócitos (típicos e atípicos e o aumento dos eosinófilos entre 24 e 48 meses de vida, caracterizaram a influência dos fatores etários sobre a variação dos valores dos componentes do leucograma de fêmeas zebuínas da raça Nelore criadas em São Paulo - Brasil.In order to evaluate the influence of the age on the white blood cell counts of Nelore (Zebu cattle, 158 blood samples from seven groups of different ages (group I-up to three months; group II-three to six months; group III-six to 12

MtDNA haplotype identification of aurochs remains originating from the Czech Republic (Central Europe)

Czech Academy of Sciences Publication Activity Database

Kyselý, René; Hájek, M.

2012-01-01

Roč. 17, č. 2 (2012), s. 118-125 ISSN 1461-4103 Institutional research plan: CEZ:AV0Z80020508 Institutional support: RVO:67985912 Keywords : wild cattle (Bos primigenius) * aDNA * haplotype P * domestication Subject RIV: AC - Archeology, Anthropology, Ethnology

Estimulação elétrica de alta voltagem e maturação na qualidade da carne de machos não cadastrados nelore e cruzado ½ ANGUS + ½ NELORE

OpenAIRE

Marina Avena Tarsitano

2015-01-01

Experimento 1: Objetivou-se avaliar o a estimulação elétrica de alta voltagem na qualidade da carne de bovinos da raça Nelore e cruzados (½ Angus + ½ Nelore). Foram selecionadas 200 carcaças para realizar as mensurações de pH e destas 64 para as análises de carcaça e carne. As carcaças foram provenientes de animais Nelore e cruzados (½ Angus + ½ Nelore), machos inteiros, com peso médio de 300 kg de carcaça e idade aproximada de 24 meses. As carcaças foram submetidas à estimulação el...

Assessment of DGAT1 and LEP gene polymorphisms in three Nelore (Bos indicus) lines selected for growth and their relationship with growth and carcass traits.

Science.gov (United States)

Souza, F R P; Mercadante, M E Z; Fonseca, L F S; Ferreira, L M S; Regatieri, I C; Ayres, D R; Tonhati, H; Silva, S L; Razook, A G; Albuquerque, L G

2010-02-01

The aim of this study was to analyze LEP and DGAT1 gene polymorphisms in 3 Nelore lines selected for growth and to evaluate their effects on growth and carcass traits. Traits analyzed were birth, weaning, and yearling weight, rump height, LM area, backfat thickness, and rump fat thickness obtained by ultrasound. Two SNP in the LEP gene [LEP 1620(A/G) and LEP 305(T/C)] and the K232A mutation in the DGAT1 gene were analyzed. The sample consisted of 357 Nelore heifers from 2 lines selected for yearling weight and a control line, established in 1980, at the Estação Experimental de Zootecnia de Sertãozinho (Sertãozinho, Brazil). Three genotypes were obtained for each marker. Differences in allele frequencies among the 3 lines were only observed for the DGAT1 K232A polymorphism, with the frequency of the A allele being greater in the control line than in the selected lines. The DGAT1 K232A mutation was associated only with rump height, whereas LEP 1620(A/G) was associated with weaning weight and LEP 305(T/C) with birth weight and backfat thickness. However, more studies, with larger data sets, are necessary before these makers can be used for marker-assisted selection.

Erythrocyte diameter of zebu Nelore cattle: influence of age factors, sex factors and Nelore breed lines Diâmetro eritrocitário de zebuínos da raça Nelore: influência de fatores etários, sexual e do tipo racial

Directory of Open Access Journals (Sweden)

Ivan Roque de Barros Filho

2007-08-01

Full Text Available The erythrocyte diameter of zebu Nelore cattle raised in the State of São Paulo were determined with aim of the analyzing the influence of age factors, sex factors and breed lines factors. In order to get up the subject, blood samples from 170 healthy animals free of blood parasites were collected and submitted to standard hematological techniques and mensuration of the erythrocyte diameter by blood smears glass with Rosenfeld color. To evaluate the influence of age, 140 Nelore Standard were divided into seven age groups, from birth to over 72 month, including 20 animals for each groups. The influence of sex factors, were evaluated using 80 adult animals: 40 male and 40 female. The influence of the breed lines factors, were evaluated using 60 zebus, 15 animals of different varieties or strain, the Nelore: Standard, Lemgruber, “Mocho” and Kuleia. The results demonstrated significant differences (p< 0,05 into the age group: the erythrocyte diameter increase, from the group of calves neonates up to three months (4,72 ± 0,29µm to the group formed by adult animal above of 72 months (5,45 ± 0,17µm. No had influence of the sex and breed lines factors in this study. The average standard values of the erythrocyte diameter of the Nelore cattle were 5,24 ± 0,62µm and the range from 3,5 to 7,5µm. The results demonstrated the influence of age on the erythrocyte diameter of zebu Nelore cattle.O diâmetro eritrocitário (DME de zebuínos da raça Nelore, criados no Estado de São Paulo, foi determinado avaliando-se a influência de fatores relacionados à idade, ao sexo e ao tipo racial. Foram colhidas amostras de sangue de 170 animais sadios, livre de hemoparasitas, realizando-se o eritrograma e os esfregaços corados com o corante Rosenfeld. A influência de fatores etários foi realizada utilizando-se 140 esfregaços de Nelore do tipo Padrão, distribuídos em sete grupos etários, compostos cada um deles por 20 animais, incluindo-se esfrega

INFLUÊNCIA DO GENÓTIPO BOS INDICUS NA ATIVIDADE DE CALPASTATINA E NA TEXTURA DA CARNE DE NOVILHOS ABATIDOS NO SUL DO BRASIL EFFECTS OF THE BOS INDICUS GENOTYPE ON CALPASTATIN ACTIVITIY AND TEXTURE OF BEEF FROM STEERS SLAUGHTERED IN THE SOUTH OF BRAZIL

Directory of Open Access Journals (Sweden)

Jane M. RUBENSAM

1998-10-01

Full Text Available Amostras de contrafilé (músculo L. dorsi provenientes de 26 bovinos, sendo 14 Polled Hereford (HH, sete 3/4Hereford 1/4Nelore (3/4H1/4N e cinco 5/8Hereford 3/8Nelore (5/8H3/8N, machos castrados, abatidos aos dois anos de idade, foram coletadas 24 h após o abate e analisadas quanto à atividade de calpastatina e textura, tanto no 1o dia post mortem quanto após um período de maturação de 10 dias a 2o C. A atividade de calpastatina foi determinada pelo ensaio de inibição da m-calpaína e a textura através da força de cisalhamento (Warner-Bratzler. A carne de novilhos 5/8H3/8N apresentou, no 1o dia, maiores (p0,05 entre os grupos HH e 3/4H1/4N para as mesmas características. Após 10 dias, houve uma diferença na atividade de calpastatina, porém não significativa (p>0,05, entre o grupo 5/8H3/8N (1,57U/g e os demais (HH=1,23U/g; 3/4H1/4N=1,35U/g, e diferença significativa entre os grupos HH e 5/8H3/8N para força de cisalhamento (3,67 e 5,00kg, respectivamente. Conclui-se que a atividade de calpastatina determinada 24 h post mortem pode ser útil para a previsão da textura da carne, maturada ou não, em programas de melhoramento genético, e que a participação crescente do genótipo Bos indicus nos rebanhos da Região Sul, a par das conhecidas vantagens zootécnicas, poderá resultar em carne de pior textura.Boneless rib steaks (L. dorsi muscle from 26 two years old steers, 14 Polled Hereford, seven 3/4Hereford 1/4Nelore (3/4H1/4N and five 5/8Hereford 3/8Nelore (5/8H3/8N, were collected 24 hs after slaughter and analysed for calpastatin activity and texture at the 1st day post mortem and at the 10th day of aging at 2o C. Calpastatin activity was determined by m-calpain inhibition assay and texture by shear force (Warner-Bratzler. Beef from 5/8H3/8N steers showed higher (p0.05 were detected in the same traits between groups HH and 3/4H1/4N. After 10 days of aging, there was a difference in calpastatin activity, although non

Genomic Variants Revealed by Invariably Missing Genotypes in Nelore Cattle.

Directory of Open Access Journals (Sweden)

Joaquim Manoel da Silva

Full Text Available High density genotyping panels have been used in a wide range of applications. From population genetics to genome-wide association studies, this technology still offers the lowest cost and the most consistent solution for generating SNP data. However, in spite of the application, part of the generated data is always discarded from final datasets based on quality control criteria used to remove unreliable markers. Some discarded data consists of markers that failed to generate genotypes, labeled as missing genotypes. A subset of missing genotypes that occur in the whole population under study may be caused by technical issues but can also be explained by the presence of genomic variations that are in the vicinity of the assayed SNP and that prevent genotyping probes from annealing. The latter case may contain relevant information because these missing genotypes might be used to identify population-specific genomic variants. In order to assess which case is more prevalent, we used Illumina HD Bovine chip genotypes from 1,709 Nelore (Bos indicus samples. We found 3,200 missing genotypes among the whole population. NGS re-sequencing data from 8 sires were used to verify the presence of genomic variations within their flanking regions in 81.56% of these missing genotypes. Furthermore, we discovered 3,300 novel SNPs/Indels, 31% of which are located in genes that may affect traits of importance for the genetic improvement of cattle production.

Genomic divergence of zebu and taurine cattle identified through high-density SNP genotyping

Science.gov (United States)

Natural selection has molded the evolution across all taxa. At an arguable date of around 330,000 years ago there were already at least two different types of cattle that became ancestors of nearly all modern cattle, the Bos primigenius taurus more adapted to temperate climates and the tropically ad...

Antral follicles population in heifers and cows of Nelore and Girolando breeds

Directory of Open Access Journals (Sweden)

Jair Sábio de Oliveira Junior

2015-12-01

Full Text Available The aim of this study was to evaluate ovarian antral follicle populations (OAFP of Nelore and Girolando breed heifers (12–18 months old and cows (24–60 months old. Animals were assigned to four groups: (1 Nelore cows (n = 18, (2 Girolando cows (n = 20, (3 Nelore heifers (n = 7, and (4 Girolando heifers (n = 7. Cows were treated to synchronize follicular wave emergence by implantation of an intravaginal device containing 1.9 g of progesterone, as well as intramuscular administration of 2 mg of estradiol benzoate and 25 mg of dinoprost. This synchronization treatment was administered at a random day of the estrous cycle of each cow, designated D0. Intravaginal devices were removed on D7, and on D11, OAFP counts were performed by transvaginal ovarian ultrasound. For each cow, all follicles ?3 mm in diameter were counted in both ovaries and counts were performed three times at 35-day intervals. Counts were also obtained from heifers, but these animals were not treated for synchronization of follicular wave emergence. Analysis of variance (ANOVA with Tukey’s test and Pearson’s correlation test were used to compare mean OAFPs between counts as well as mean OAFPs between breed and age groups. No differences were observed in mean OAFPs between Nelore and Girolando cows (30.9 vs. 26.7, respectively; P > 0.05 or heifers (16.2 vs. 18.1, respectively; P > 0.05. However, within each breed, there were differences in mean OAFPs between heifers and cows (for Nelore cattle: 16.2 and 30.9, respectively; for Girolando cattle: 18.1 and 26.7, respectively; both P < 0.05. In conclusion, OAFPs were similar between Nelore and Girolando breeds and were influenced by age. Furthermore, we observed a high correlation for individual animals between the mean numbers of follicles counted in both ovaries and total number of follicles counted in either the right or left ovary, indicating that the evaluation of a single ovary is sufficient to estimate the OAFP of an

Uros, genética, indígenas y colonos. A propósito de la Neolitización de Europa

OpenAIRE

Alday, Alfonso .; Carretero, José Miguel; Anderung, Cecilia .; Götherström, Anders .

2012-01-01

Las analíticas genéticas realizadas sobre los uros (Bos primigenius) del yacimiento de Mendandia (Treviño), han ofrecido un resultado sorprendente: uno de los individuos pertenece al haplotypo T3, generalmente asociado a animales domésticos (Bos taurus). La datación de la muestra (7265 ± 70 BP; Ua 34366) es acorde con las otras conocidas de su nivel, el III-superior, incidiendo en la antigüedad de su Neolítico. El dato es la excusa para reflexionar sobre el proceso neolitizador y adentrarnos ...

Incidence and transplacental transmission of Neospora caninum in primiparous females from Bos indicus slaughtered in Presidente Prudente, São Paulo, Brazil / Incidência e transmissão transplacentária de Neospora caninum em fêmeas primíparas da raça Bos indicus abatidos em Presidente Prudente, São Paulo, Brasil

Directory of Open Access Journals (Sweden)

Sergio do Nascimento Kronka

2008-08-01

Full Text Available To produce an epidemiological map of neosporosis in Brazil and identify the types of transmission of this disease, the present study evaluated the occurrence of Neospora caninum in Nelore cattle (Bos indicus in Presidente Prudent, west region of Sao Paulo state; its vertical transmission; and the early stage in which fetuses are infected. To achieve this, serum samples from 518 slaughtered pregnant heifers and their fetuses were tested by ELISA technique and fetal brain tissues subjected to PCR. One hundred and three heifers (19.88% had antibodies to N. caninum, as well as 38 (36.8% of fetuses from 4 months of gestation. The conventional PCR failed to detect N. caninum DNA. These findings show that neosporosis occurs in the area studied and that it may be transmitted the transplacental route, althought N. caninum had not detected in brain tissue from non-aborted fetuses. The use of nested PCR it would be applied to increase the sensitivy of test.Para produzir um mapa epidemiológico da neosporose no Brasil e identificar os tipos de transmissão dessa doença, o presente estudo avaliou a ocorrência de Neospora caninum em fêmea Nelore (Bos Indicus em Presidente Prudente, região oeste do Estado de São Paulo e o risco de infecção fetal nos estágios iniciais da gestação. Para a realização deste estudo, amostras de soro de 518 novilhas prenhas abatidas e seus fetos foram testadas pela técnica de ELISA e para avaliação de transmissão vertical, tecido cerebral fetal foi submetido à reação da polimerase em cadeia (PCR. Dessas novilhas, 103 (19,88% tinham anticorpos para N. caninum dos quais 38 (36,8% estavam no 4 mês de gestação. Esses achados mostram que a Neosporose ocorre na área estudada e que pode ser transmitido pela via placentária, embora o N. caninum não tenha sido detectado em tecido cerebral de fetos não abortado. O uso de nested PCR poderia ser aplicado como forma de aumentar a sensibilidade do teste.

Ancient DNA extracted from Danish aurochs (Bos primigenius)

DEFF Research Database (Denmark)

Nielsen, Peter Gravlund; Aaris-Sørensen, Kim; Hofreiter, Michael

2012-01-01

study of genetic variation of Danish aurochs. In addition, for all specimens we address correlations between the ability to obtain DNA sequences and various parameters such as the age of the sample, the collagen content, the museum storage period, Danish geography and whether the specimens were found...... in an archeological or geological context. We find that aurochs from southern Scandinavia display a star-shaped population genetic structure, that is indicative of a local and relatively recent diversification from a few ancestral haplotypes that may have originated in the ancestral Western European population before...... migration northwards during the retreat of the glaciers. Scenarios suggesting several invasions of genetically distinct aurochs are not supported by these analyses. Rather, our results suggest that a single continuous migration northward occurred. Our findings also suggest, although with only limited...

Fatores que influenciam a textura da carne de novilhos Nelore e cruzados Limousin-Nelore Factors affecting meat texture from Nellore and crossbreed Limousin-Nellore steers

Directory of Open Access Journals (Sweden)

Riana Jordão Barrozo Heinemann

2003-08-01

Full Text Available O objetivo deste trabalho foi avaliar fatores que influenciam a textura da carne de novilhos Nelore e cruzados Limousin-Nelore. Cinqüenta novilhos, 25 Nelore e 25 Limousin-Nelore, foram aleatoriamente divididos em cinco grupos de 10 animais (cinco de cada grupo genético, para o abate seriado, até 204 dias. Os valores de temperatura e pH muscular foram monitorados durante 24 horas após o abate. Em seguida, foram medidas a espessura de cobertura de gordura e a área de olho de lombo. O músculo longissimus dorsi retirado foi dividido para avaliação qualitativa do músculo sem maturação e submetido à maturação por 14 dias. A área de olho de lombo foi maior em animais cruzados. Os valores de cobertura de gordura e gordura intramuscular foram semelhantes entre os grupos genéticos. Peso ao abate e teor de gordura afetaram as quedas de pH e temperatura, mas não resultaram em diferenças na força de cisalhamento. Os animais cruzados apresentaram carne mais macia que os animais Nelore. A maturação causou redução de 30% na força de cisalhamento e foi, com o fator genético, o parâmetro que mais influenciou a textura da carne.The objective of this work was to evaluate factors affecting meat texture from Nellore and crossbreed Limousin-Nellore steers. Fifty steers, 25 Nellore and 25 Limousin-Nellore, were randomly divided in five groups of 10 animals (five from each genetic group and serially slaughtered during 204 days. Meat temperature and pH data were monitored during 24 hours post mortem. After this, fat thickness and rib area were measured. Longissimus dorsi muscle was removed to quality evaluation before and after 14 days ageing period. Crossbreed animals rib areas were higher. Fat thickness and marbling values from both genetic groups were similar. Live slaughter weight and fat content affected decrease of pH and temperature, but didn't result in difference in shear force. Crossbreed animals the most tender meat. Ageing process

Época de nascimento, genótipo e sexo de terneiros cruzas taurinos e zebuínos sobre o peso ao nascer, à desmama e eficiência individual de primíparas Hereford

OpenAIRE

Mendonça,Gilson de; Pimentel,Marcelo Alves; Cardellino,Ricardo Alberto; Osório,José Carlos da Silveira

2003-01-01

O objetivo deste trabalho foi avaliar o efeito da época de nascimento, genótipo e sexo do terneiro sobre a eficiência individual das vacas à desmama (relação percentual entre o peso do terneiro à desmama e o peso da vaca), peso ao nascer e peso à desmama dos terneiros. Foram utilizadas 48 vacas da raça Hereford (Bos taurus), com idade de três anos, manejadas sobre campo natural, 16 inseminadas com um touro da raça Red Angus (Bos taurus) e 32 com Nelore (Bos indicus). Os fatores estudados fora...

Efeitos da injeção de cloreto de cálcio pós-morte e tempo de maturação no amaciamento e nas perdas por cozimento do músculo Longissimus dorsi de animais Bos indicus e Bos taurus selecionados para ganho de peso Effects of postmortem calcium chloride injection and aging time on tenderness and cooking losses of Longissimus dorsi muscle from Bos indicus and Bos taurus animals selected for weight gain

Directory of Open Access Journals (Sweden)

Aparecida Carla de Moura

1999-01-01

Full Text Available O objetivo deste estudo foi avaliar o efeito da injeção pós-morte de cloreto de cálcio (CaCl2 e o tempo de maturação no amaciamento e nas perdas por cozimento do músculo longissimus dorsi de animais Bos indicus e Bos taurus selecionados para ganho de peso. Foram usados 64 machos inteiros (16 Caracu, 16 Guzerá, 16 Nelore Controle e 16 Nelore Seleção. Vinte quatro horas após o abate, foi retirada uma amostra do músculo Longissiumus dorsi (contra-filé entre a 6ª e 9ª vértebras lombares e dividida em nove subamostras. Em cada grupo de três subamostras escolhidas ao acaso, foi injetada, na quantia correspondente a 10% do seu peso, uma das seguintes soluções: a água (controle, b 200 mM de CaCl2 e c 300 mM de CaCl2. Cada subamostra foi, então, embalada a vácuo, congelada (- 2ºC e maturada por 1,7 ou 14 dias até a realização de testes de força de cisalhamento e perdas por cozimento (evaporação, gotejamento e perdas totais. Foi usado delineamento experimental completamente casualizado com parcelas subdivididas, em que a parcela correspondia à raça e a sub-parcela, à combinação entre três níveis de CaCl2 e três tempos de maturação. A raça influenciou a força de cisalhamento, mas não influiu nas perdas por cozimento A maturação por um período de sete dias reduziu os valores de força de cisalhamento e as perdas por evaporação, gotejamento e totais. Maiores concentrações de CaCl2 resultaram em menor força de cisalhamento e maiores perdas por evaporação, embora não tenham influenciado as perdas por gotejamento e totais. A concentração de 200 mM CaCl2 apresentou a melhor redução para a força de cisalhamento. A injeção pós-morte de uma solução de CaCl2 aumentou o processo de amaciamento, sem influir nas perdas por cozimento.ABSTRACT - The objective of this study was to evaluate the effect of postmortem calcium chloride (CaCl2 injection and aging time on tenderness and cooking losses of Longissimus

Effects of a high-energy diet on oocyte quality and in vitro embryo production in Bos indicus and Bos taurus cows.

Science.gov (United States)

Sales, J N S; Iguma, L T; Batista, R I T P; Quintão, C C R; Gama, M A S; Freitas, C; Pereira, M M; Camargo, L S A; Viana, J H M; Souza, J C; Baruselli, P S

2015-05-01

The effects of different dietary energy levels [100 and 170% for maintenance (M) and high energy (1.7M), respectively] on metabolic, endocrine, and reproductive parameters were evaluated in nonlactating Bos indicus (Gir; n=14) and Bos taurus (Holstein; n=14) cows submitted to ultrasound-guided ovum pick-up followed by in vitro embryo production. The oocyte donor cows were housed in a tiestall system and fed twice daily (0800 and 1600 h). Twenty-one days before the beginning of the experiment, the animals were fed with a maintenance diet for adaptation followed by the experimental diets (M and 1.7M), and each cow underwent 9 ovum pick-up procedures 14 d apart. The recovered oocytes were cultured in vitro for 7 d. We measured glucose and insulin concentrations and performed glucose tolerance tests and the relative quantification of transcripts (PRDX1, HSP70.1, GLUT1, GLUT5, IGF1R, and IGF2R) from the oocytes recovered at the end of the experimental period. No interactions were observed between the effects of genetic groups and dietary energy level on the qualitative (viable oocytes, quality grade, and oocyte quality index) and quantitative (oocytes recovered) oocyte variables. There were no effects of dietary energy level on the qualitative and quantitative oocyte variables. However, Bos indicus cows had greater numbers of recovered structures, viable oocytes, and A and B oocyte grades as well as better oocyte quality index scores and lower DNA fragmentation rates compared with Bos taurus donors. In vitro embryo production (cleavage and blastocyst rates and number of embryos) was similar between diets, but the 1.7M diet reduced in vitro embryo production in Bos indicus cows after 60 d of treatment. Moreover, Bos indicus cows on the 1.7M diet showed lower transcript abundance for the HSP70.1, GLUT1, IGF1R, and IGF2R genes. All cows fed 1.7M diets had greater glucose and insulin concentrations and greater insulin resistance according to the glucose tolerance test. In

Effect of shadow availability at pasture on reproductive traits of Nelore bulls (Bos indicus raised in southeastern Brazil

Directory of Open Access Journals (Sweden)

Octavio Fabián Bao Tarragó

2013-12-01

Full Text Available Solar radiation is responsible for bull body temperature elevation. An alternative to minimize heat stress is to use artificial shade. Thus, this study aimed to evaluate the effect of thermal stress reduction, through shade availability, on reproductive characteristics of Nellore bulls (Bos indicus. For this, ten bulls were divided in: Available artificial shade (AS, n = 5 and Unavailable shade (US, n = 5. Each group was kept in two hectare paddocks, in which shade availability for group AS was artificially created. Animals were submitted to a clinical-reproductive evaluation and seminal analyses. No interaction was observed between treatments (AS and US and time (8 collections for all analyzed variables (P>0.05. No significant effect (P > 0.05 of treatment was observed for all parameters analyzed. So, it can be concluded that the absence of shaded areas during summer does not negatively affect reproductive characteristics such as: scrotal circumference, testicular consistency, progressive motility, percentage of rapidly moving cells (Computer Assisted Semen Analysis - CASA, morphology or sperm viability in Nellore bulls raised in southeastern Brazil, considering that results could be different in other regions of the country where average temperature is higher.

Background-Oriented Schlieren (BOS) for Scramjet Inlet-isolator Investigation

Science.gov (United States)

Che Idris, Azam; Rashdan Saad, Mohd; Hing Lo, Kin; Kontis, Konstantinos

2018-05-01

Background-oriented Schlieren (BOS) technique is a recently invented non-intrusive flow diagnostic method which has yet to be fully explored in its capabilities. In this paper, BOS technique has been applied for investigating the general flow field characteristics inside a generic scramjet inlet-isolator with Mach 5 flow. The difficulty in finding the delicate balance between measurement sensitivity and measurement area image focusing has been demonstrated. The differences between direct cross-correlation (DCC) and Fast Fourier Transform (FFT) raw data processing algorithm have also been demonstrated. As an exploratory study of BOS capability, this paper found that BOS is simple yet robust enough to be used to visualize complex flow in a scramjet inlet in hypersonic flow. However, in this case its quantitative data can be strongly affected by 3-dimensionality thus obscuring the density value with significant errors.

Correlation between hypoosmotic swelling test and breeding soundness evaluation of adult Nelore bulls

Directory of Open Access Journals (Sweden)

Tamires Miranda Neto

2011-07-01

Full Text Available This study aimed at evaluating the relationship between physical and morphological semen features with the hypoosmotic swelling (HOS test in raw semen of adult Nelore bulls classified as sound and unsound for breeding. Two hundred and six Nelore bulls aging from 3-10 years old were subjected to breeding soundness examination. After physical and morphological semen examination, HOS test was done. After the breeding soundness examination, 94.2% of the bulls were classified as sound for breeding. There was no difference between the average scrotal circumference of bulls classified as sound and unsound for breeding (P>0.05, but there was difference between all semen physical and morphological aspects of bulls classified as sound and unsound for breeding (P>0.05, but there was no difference in the mean percentage of reactive spermatozoa to HOS test results both for sound (38.4±17.9 and unsound animals (39.5±16.4; P>0.05, with no Pearson correlation between the HOS test and variables. According to these results HOS test can not be used alone to predict the reproductive potential of adult Nelore bulls.

Hemograma de bovinos (Bos indicus sadios da raça nelore no primeiro mês de vida, criados no estado de São Paulo Hemogram of healthy nelore breed (Bos indicus calf at the first month of life, raised in São Paulo state, Brazil

Directory of Open Access Journals (Sweden)

Alexander Welker Biondo

1998-06-01

Full Text Available Avaliou-se as mudanças nos constituintes do hemograma de bovinos da raça Nelore, 71 machos e 56 fêmeas, no primeiro mês de vida, criados no Estado de São Paulo. Foram utilizadas 127 amostras de sangue de bezerros criados a pasto, divididos em cinco grupos: de 0-3, 3-7, 7-14 , 14-21 e 21-30 dias de idade. Os valores médios encontrados foram: número de hemácias 8,31 ± l,84 x 10(6/ mi l; Volume globular 39 ± 6%; taxa de hemoglobina 12,89 ± 2,04g/dl; Volume Corpuscular Médio 48,19 ± 5,68fl; Concentração de Hemoglobina Corpuscular Média 32,81 ± 1,84; reticulócitos 0,27 ± 0,54% e eritroblastos 214 ± 594/mil; número de leucócitos/mil 10593 ± 3008, neutrófilos bastonetes 97 ± 165; neutrófilos segmentados 4837 ± 2201; linfócitos 5222 ± 1909; eosinófilos 86 ± 139; monócitos 346 ± 221; basófilos 4 ± 24. Os fatores sexuais não apresentaram influência significativa sobre o hemograma, com exceção dos reticulócitos e eritroblastos. Os fatores etários apresentaram influência significativa (p≤0,03 sobre as curvas de regressão do hemograma, com o volume globular, hemácias e hemoglobina diminuindo e o CHCM e reticulócitos aumentando até os 3 a 7 dias, havendo uma inversão desta variação dos sete até os 30 dias. A curva de regressão do percentual de linfócitos aumentou e de neutrófilos diminuiu gradativamente após o nascimento. O encontro destas curvas ocorreu entre o sétimo e o décimo quarto dia de vida.Changes on the hemogram parameters were evaluated for healthy Nelore purebreed bovines at the first month age, with 71 male and 56 female, and raised in São Paulo State, Brazil. For this purpose, 127 samples of blood were collected, and divided in five groups ; 0-3 , 3-7 . 7-14 , 14-21 and 21-30 days of age. The mean values were: erithrocyte counts 8.31± 1.84 x 10(6/ mu l; Package Cell Volume 39 ± 6%: hemoglobin 12.89 ± 2.04g/dl; Mean Corpuscular Volume 48.19 ± 5.68fl; Mean Corpuscular Hemoglobin

Independent mitochondrial origin and historical genetic differentiation in North Eastern Asian cattle.

Science.gov (United States)

Mannen, H; Kohno, M; Nagata, Y; Tsuji, S; Bradley, D G; Yeo, J S; Nyamsamba, D; Zagdsuren, Y; Yokohama, M; Nomura, K; Amano, T

2004-08-01

In order to clarify the origin and genetic diversity of cattle in North Eastern Asia, this study examined mitochondrial displacement loop sequence variation and frequencies of Bos taurus and Bos indicus Y chromosome haplotypes in Japanese, Mongolian, and Korean native cattle. In mitochondrial analyses, 20% of Mongolian cattle carried B. indicus mitochondrial haplotypes, but Japanese and Korean cattle carried only B. taurus haplotypes. In contrast, all samples revealed B. taurus Y chromosome haplotypes. This may be due to the import of zebu and other cattle during the Mongol Empire era with subsequent crossing with native taurine cattle. B. taurus mtDNA sequences fall into several geographically distributed haplogroups and one of these, termed here T4, is described in each of the test samples, but has not been observed in Near Eastern, European or African cattle. This may have been locally domesticated from an East Eurasian strain of Bos primigenius.

Effect of heat stress on the expression profile of Hsp90 among Sahiwal (Bos indicus) and Frieswal (Bos indicus × Bos taurus) breed of cattle: a comparative study.

Science.gov (United States)

Deb, Rajib; Sajjanar, Basavaraj; Singh, Umesh; Kumar, Sushil; Singh, Rani; Sengar, G; Sharma, Arjava

2014-02-25

We evaluated the effect of thermal challenge on the expression profile of heat shock protein 90 (Hsp90) among Sahiwal (Bos indicus) and Frieswal (Bos indicus × Bos taurus) breeds of cattle. The present investigation was focused on the comparative studies on Hsp90 expression among Frieswal and Sahiwal under in vitro and environmental heat stress. Measured immediately after the in vitro heat shock to the peripheral blood mononuclear cells (PBMCs), the relative expression of Hsp90 mRNA was significantly (Pcows consistently recorded higher rectal temperatures than the Sahiwal breed. Further during this peak summer stress, Sahiwal showed significantly higher levels of mRNA transcripts as well as protein concentration compared to the Frieswal breed. Our findings also interestingly showed that, the cell viability of PBMC are significantly higher among the Sahiwal than Frieswal. Taken together, the experiments of both induced in vitro and environmental stress conditions indicate that, Sahiwal may express higher levels of Hsp90 then Frieswal to regulate their body temperature and increase cell survivality under heat stressed conditions. Copyright © 2013 Elsevier B.V. All rights reserved.

Le Flaubert de Charles Du Bos

Directory of Open Access Journals (Sweden)

Jacques Neefs

2009-01-01

Full Text Available Charles Du Bos a porté une attention constante à l’œuvre de Flaubert (à l’exclusion de Bouvard et Pécuchet qui semble ne pas exister pour lui, à Madame Bovary et à L’Éducation sentimentale en particulier. La mise en relation de son étude : « Sur le milieu intérieur chez Flaubert », écrite en 1921, avec des textes du Journal de 1923 et de 1937, les rapprochements avec Gogol, Thomas Hardy, Tolstoï, Baudelaire, Henry James qui traversent les écrits de Du Bos, permettent de suivre ce que celui-ci décrit comme « l’expérience spirituelle » d’une matérialité comprise dans la conquête de la triple exigence du Beau, du Vivant et du Vrai. Du Bos décèle la force de l’œuvre de Flaubert dans la « disproportion » du style, et dans la puissance d’absorption qui fait la densité de cette prose, et qui désigne un extraordinaire travail de conversion. L’obscure expérience spirituelle ainsi poursuivie est celle d’un absolu de l’art, expérience paradoxale d’un « mystique qui ne croit à rien » (comme se désignait Flaubert lui-même, que le critique lie à une interrogation sur sa propre conversion.Charles Du Bos devoted an unflagging attention to Flaubert’s work (except for Bouvard et Pécuchet, which, apparently, according to him did not exist, to Madame Bovary and in particular L’Éducation sentimentale. The connection between his essay “Sur le milieu intérieur chez Flaubert”, written in 1921, and extracts from his Journal, from 1923 to 1937, the comparisons with Gogol, Thomas Hardy, Tolstoy, Baudelaire, and Henry James that run through the writings of Du Bos, allow us to follow what he terms “the spiritual experience” of a materiality encompassed in the conquest of the triple demand of the Beautiful, the Living, the Truth. Du Bos detects the power of Flaubert’s work in the “disproportion” of his style, and the power of absorption that forms the density of his prose, showing an

Physical composition, primary cuts and meat cuts of carcasses from Zebu and Bos taurus X Bos indicus crossbred cattle Composição física, cortes primários e cortes cárneos da carcaça de bovinos Zebu e de mestiços Bos taurus X Bos indicus

Directory of Open Access Journals (Sweden)

Daniel Perotto

2009-09-01

Full Text Available Data on hot carcass weight, hot carcass yield, hindquarter weights and physical components, forequarter and spare ribs, and the weights of the main commercial cuts from the hindquarters of twenty young intact bulls were assessed. The animals, belonging to four genetic groups (Nellore, ½ Guzerath + ½ Nellore (½ G + ½ N, ½ Red Angus + ½ Nellore (½ R + ½ N and ½ Marchigiana + ½ Nellore (½ M + ½ N, were raised on pastures, finished in dry lot and slaughtered at live weights ranging from 445 to 517 kg, and at ages ranging from 679 to 863 days. During the dry lot period, which lasted 114 days, animals were fed sorghum silage offered ad libitum, and a concentrate (13.5 MJ of ME, 18% CP in the DM at 1% live weight per day. Genetic group influenced hot carcass weight, forequarter weight, meat weight in the spare ribs, as well as meat and bone weights in the forequarter. Animals in the ½ M + ½ N group were superior both to those in the Nellore and in the ½ G + ½ N groups for hot carcass weight, forequarter weight and meat weight in the spare ribs. The ½ M + ½ N group also differed from the ½ R + ½ N and from the ½ G + ½ N groups in terms of forequarter weight and meat weight in the forequarter, respectively. Conversely, forequarter bone weight of ½ M + ½ N animals was higher than in animals from the Nellore and the ½ R + ½ N groups, respectively. There was no effect of genetic group on hindquarter cuts, except for higher shank and knuckle weights in the ½ M + ½ N group compared to the ½ G + ½ N and Nellore groups, respectively.Foram avaliados o peso e o rendimento de carcaça quente, os pesos dos cortes primários, os pesos dos componentes físicos dos cortes primários e os pesos dos principais cortes comerciais do traseiro especial de 20 bovinos machos não-castrados dos grupos genéticos Nelore, ½ Guzerá + ½ Nelore (½ G + ½ N, ½ Red Angus + ½ Nelore (½ R + ½ N e ½ Marchigiana + ½ Nelore (½ M + ½ N terminados

Effect of monensin withdrawal on intake, digestion, and ruminal fermentation parameters by Bos taurus indicus and Bos taurus taurus steers consuming bermudagrass hay

Science.gov (United States)

Effects of monensin withdrawal and cattle subspecies on the utilization of bermudagrass hay (14.3% CP, 72.3% NDF, and 36.9% ADF) were evaluated using ruminally cannulated steers (5 Bos Taurus indicus [BI] and 5 Bos taurus taurus [BT]). Subspecies were concurrently subjected to a 2-period, 2-treatme...

Effect of monensin inclusion on intake, digestion, and ruminal fermentation parameters by Bos taurus indicus and Bos taurus taurus steers consuming bermudagrass hay

Science.gov (United States)

Effects of monensin inclusion and cattle subspecies on utilization of bermudagrass hay (13.7% CP, 77.3% NDF, and 38.8% ADF) were evaluated using ruminally cannulated steers (5 Bos taurus indicus [BI] and 5 Bos taurus taurus [BT]; 398 kg BW). Subspecies were concurrently subjected to a 2-period, 2-t...

A eficiência do sistema superprecoce com bovinos de diferentes proporções do genótipo Bos indicus

OpenAIRE

Cucki, Thalita Oliveira [UNESP

2006-01-01

O objetivo deste trabalho foi avaliar os efeitos da proporção de sangue zebuíno no desempenho animal em confinamento, mensuração do crescimento animal, bem como as características de carcaça ao abate de bovinos jovens. Foram utilizados 96 novilhos não castrados, sendo, 24 da raça Nelore (N), 24 three cross Angus x Nelore x Brahman (TBH), 24 da raça Brangus (BG) e 24 three cross Angus x Nelore x Pardo - Suíço (TPS). Maior peso ao abate foi apresentado pelo grupo TPS (

Características de carcaça e qualidade de carne em linhagens da raça Nelore

Directory of Open Access Journals (Sweden)

Marina de Nadai Bonin

2014-10-01

Full Text Available O objetivo deste estudo foi avaliar diferenças entre linhagens da raça Nelore para características de carcaça e qualidade de carne. Foram avaliadas treze linhagens da raça Nelore para as características de peso de carcaça quente, área de olho de lombo, espessura de gordura subcutânea, marmoreio e força de cisalhamento aos 7,14 e 21 dias de maturação. Para isso, foram utilizadas informações fenotípicas de 516 animais da raça Nelore e estimadas as diferenças esperadas na progênie para comparação entre as linhagens. Dentre os genearcas estudados, Golias obteve os melhores valores das diferenças esperadas na progênie para peso de carcaça quente (+1,20kg, área de olho de lombo (+0,88cm, marmoreio (+3,47un e força de cisalhamento média (-0,09kg e Akasamu para espessura de gordura subcutânea (+0,05mm. As diferenças entre linhagens da raça Nelore encontradas neste estudo podem ser utilizadas na escolha de touros para melhoria genética de características de carcaça e carne em rebanhos de gado de corte brasileiros.

Colostral immunoglobulins absorption in Canchim and Nelore calves Absorção de imunoglobulinas do colostro em bezerros das raças Canchim e Nelore

Directory of Open Access Journals (Sweden)

Raul Machado Neto

2004-12-01

Full Text Available The efficiency of absorption of colostral immunoglobulins was evaluated in five Canchim and seven Nelore calves. They received colostrum pools with concentration of 70.20 ± 6.14 mg/mL through esofageal feeder at 2, 12, 24 and 36 hours after birth. The immunoglobulins concentrations of the pools were estimated through specific gravity and measured by radial immunodifusion. In the blood collection at birth and during the first 70 days of life, the total protein was assayed by biuret method and the immunoglobulins were assayed by radial immunodifusion. Data were analysed as a randomized split-plot statistical model. The highest concentrations of serum immunoglobulins and total protein were observed at 24 hours of age. No significant differences (P>0.5484 were observed for immunoglobulins concentration at 24 hours, with concentrations of 28.80 ± 7.24 mg/mL for Canchim and 27.32 ± 9.54 mg/mL for Nelore. The efficiency for immunoglobulins absorption was not significantly different (P>0.8715 between breeds, 64.04 ± 7.74% for Canchim and 62.30 ± 6.93% for Nelore. The lack of statistical significance persisted until the fourtieth day of life, period of maternal immunoglobulin predominance in the calves blood circulation. In the following period, from 40 to 70 days of age, phase of establishment of the endogenous production of immunoglobulin, differences in the IgG concentrations between the two groups were detected refflecting a possible breed effect difference. The process of colostral IgG absorption by the newborn calves was not affected by breed. The differences between breeds in the calves serum IgG were related to the phase of endogenous production of antibodies.A eficiência de absorção de imunoglobulinas do colostro foi avaliada em cinco bezerros da raça Canchim e sete bezerros da raça Nelore. Os bezerros receberam colostro de "pools" com concentração média de 70,20 ± 6,14 mg/mL, por sonda esofagiana, às 2, 12, 24 e 36 horas após o

Induction of the acrosome reaction test to in vitro estimate embryo production in Nelore cattle

Directory of Open Access Journals (Sweden)

M.Z. Costa

2010-08-01

Full Text Available The effectiveness of induction of the acrosome reaction (AR test as a parameter to in vitro estimate embryo production (IVP in Nelore breed and the AR pattern by the Trypan Blue/Giemsa (TB stain were evaluated. Frozen semen samples from ten Nelore bulls were submitted to AR induction and were also evaluated for cleavage and blastocyst rates. The treatments utilized for AR induction were: control (TALP medium, TH (TALP medium + 10μg heparin, TL (TALP medium + 100μg lysophosphatidylcholine and THL (TALP medium + 10μg heparin + 100μg lysophosphatidylcholine. Sperm acrosomal status and viability were evaluated by TB staining at 0 and after 4h incubation at 38°C. The results obtained for AR presented a significant difference (P<0.05 in the percentage of acrosome reacted live sperm after 4h of incubation in the treatments that received heparin. The cleavage and blastocyst rates were 60% and 38% respectively and a significant difference was observed among bulls (P<0.05. It was founded a satisfactory model to estimate the cleavage and blastocyst rates by AR induction test. Therefore, it can be concluded that the induction of the AR test is a valuable tool to predict the IVP in Nelore breed.

Impact of Balance Of System (BOS) costs on photovoltaic power systems

Science.gov (United States)

Hein, G. F.; Cusick, J. P.; Poley, W. A.

1978-01-01

The Department of Energy has developed a program to effect a large reduction in the price of photovoltaic modules, with significant progress already achieved toward the 1986 goal of 50 cents/watt (1975 dollars). Remaining elements of a P/V power system (structure, battery storage, regulation, control, and wiring) are also significant cost items. The costs of these remaining elements are commonly referred to as Balance-of-System (BOS) costs. The BOS costs are less well defined and documented than module costs. The Lewis Research Center (LeRC) in 1976/77 and with two village power experiments that will be installed in 1978. The costs were divided into five categories and analyzed. A regression analysis was performed to determine correlations of BOS Costs per peak watt, with power size for these photovoltaic systems. The statistical relationship may be used for flat-plate, DC systems ranging from 100 to 4,000 peak watts. A survey of suppliers was conducted for comparison with the predicted BOS cost relationship.

Dermatophilosis in Nelore calves in Mato Grosso do Sul

Directory of Open Access Journals (Sweden)

Flávia Barbieri Bacha

2014-09-01

Full Text Available The objective of this study was to describe two outbreaks of dermatophilosis in Nelore calves in the State of Mato Grosso do Sul with epidemiological characteristics peculiar to the Midwest. Morbidity and mortality rates were 50% and 0.0025% in the outbreak 1, and 12.5% and 10% in the outbreak 2, respectively. Only Nelore calves aging between 5 and 60 days were affected. Most cases occurred on pastures of Brachiaria brizantha during the rainy season. In both outbreaks, the signs started with skin thickening followed by weeping and crusting around the eyes and muzzle. In more severe cases, lesions disseminated throughout the face and the body, evolving to generalized marked thickening of the skin and wrinkling. Histology of skin lesions showed suppurative dermatitis and hyperkeratosis. The diagnosis was confirmed by viewing basophilic filamentous structures morphologically consistent with Dermatophilus congolensis in Gram stained smears. The treatment with streptomycin, oxytetracycline or penicillin associated with streptomycin used in calves demonstrated to be effective. The disease has been misdiagnosed, by the farmers, with hepatic photosensitization caused by Brachiaria spp. ingestion. This article discusses these results with the aim to help in the correct diagnosis of dermatophilosis, which is important to achieve the adequate treatment and effective control measures to minimize the losses caused by this disease.

GENERAL ASPECTS OF BODY MEASURES, WEIGHT AND SCORE CONDITION FEMALE NELORE BREED (Bos taurus indicus ON THE PERIOD OF 12 MONTHS ESTUDIO DE MEDIDAS CORPORALES, PESO VIVO Y CONDICIÓN CORPORAL DE BOVINOS HEMBRAS DE LA RAZA NELORE (Bos taurus indicus POR 12 MESES ESTUDO DE MEDIDAS CORPORAIS, PESO VIVO E CONDIÇÃO CORPORAL DE FÊMEAS DA RAÇA NELORE (Bos taurus indicus AO LONGO DE 12 MESES

Directory of Open Access Journals (Sweden)

Arcádio de Los Reys Borjas

2008-04-01

Full Text Available Four hundred and eighty cattle were used to verify alterations and correlations among corporal measures in Nelore zebu herd with cows and heifers. Body weight and length, corporal condition, heart girth, withers height and hip measures were evaluated. Eight collections were accomplished along the months of October of 2002 and October of 2003. In heifers there was increase of the averages of corporal measures with significant difference (p <0,05 among collections only the heart girth was different (p <0,05 in cows. The relationship between the body weight and body condition with the time were quadratic parallel curves (p <0,001. There were correlations among lineal measures body with hip measures (p<0,001 except for heart girth with hip length. The correlations of body weight and body condition among body measures were significant (p<0,001 except body condition with hip length in cows. It could be concluded that there was a growing variation of the body measures in heifers in the experimental period. The body weight, the body condition and heart girth were related with different periods of the year that the evaluation was accomplished. In cows the variations along the year were of 14,79%, 31,53% and 6,74%, respectively. The isquiun – iliun external measures, as height and width were correlated with size measures and weight. The body weight and body condition in heifers behave in way similar to cows. Further researches in relationship among body measures, body weight and body condition with productive and reproductive aspect are necessary. Con el objetivo de verificar alteraciones y correlaciones entre medidas corporales en un rebaño bovino de vaquillonas y vacas de la raza Nelore. Evaluaron-se 487 hembras en peso vivo, condición corporal, perímetro toráxico, largura corporal, altura de la cruz y medidas da anca. Fueron realizadas ocho coletas a lo largo de los meses de octubre de 2002 y octubre de 2003. En las vaquillonas hubo un aumento de

Ácidos graxos no desempenho e nas respostas imunológicas de bovinos Nelore confinados

Directory of Open Access Journals (Sweden)

Robson Sfaciotti Barducci

2015-06-01

Full Text Available O objetivo deste trabalho foi avaliar os efeitos da adição de fontes de lipídeos naturais e protegidos no desempenho e nas respostas imunológicas de bovinos Nelore em confinamento. Utilizou-se o delineamento experimental inteiramente casualizado com medidas repetidas no tempo e três tratamentos, que foram: sem fonte adicional de lipídeo (CONTR; com fonte de lipídeo natural (torta de algodão (GDESP; e com fonte de lipídeo protegido e rico em ácidos graxos poli-insaturados (GPROT. O estudo foi dividido em duas fases: pré-condicionamento e confinamento de 120 bovinos Nelore inteiros (24 baias, 5 animais por baia e 8 repetições por tratamento. O tratamento GDESP proporcionou maior ganho de peso na fase de pré-condicionamento, e, durante o período de confinamento, não houve diferenças entre os tratamentos quanto ao desempenho, às características de carcaça e ao acometimento de enfermidades. As concentrações plasmáticas de TNFα, IL-1β, haptoglobina e ceruloplasmina foram superiores no tratamento CONTR. A adição de lipídeos à dieta, independentemente da fonte, promove melhora no desempenho e nos parâmetros imunológicos de bovinos Nelore confinados.

Evaluation of two progestogen-based estrous synchronization protocols in yearling heifers of Bos indicus × Bos taurus breeding.

Science.gov (United States)

McKinniss, E N; Esterman, R D; Woodall, S A; Austin, B R; Hersom, M J; Thatcher, W W; Yelich, J V

2011-06-01

Yearling Bos indicus × Bos taurus heifers (n = 410) from three locations, were synchronized with either the Select Synch/CIDR+timed-AI (SSC+TAI) or 7-11+timed-AI (7-11+TAI) treatments. On Day 0 of the experiment, within each location, heifers were equally distributed to treatments by reproductive tract score (RTS; Scale 1-5: 1 = immature, 5 = estrous cycling) and body condition score. The 7-11+TAI treatment consisted of melengestrol acetate (0.5 mg/head/d) from Days 0 to 7, with PGF(2α) (25 mg im) on Day 7, GnRH (100 μg im) on Day 11, and PGF(2α) (25 mg im) on Day 18. The SSC+TAI heifers received the same carrier supplement (without MGA) from Days 0 to 7, and on Day 11 they were given 100 μg GnRH and an intravaginal CIDR (containing 1.38 g progesterone). The CIDR were removed on Day 18, concurrent with 25 mg PGF(2α) im For both treatments, estrus was visually detected for 1 h twice daily (0700 and 1600 h) for 72 h after PGF(2α), with AI done 6 to 12 h after a detected estrus. Non-responders were timed-AI and received GnRH (100 μg im) 72 to 76 h post PGF(2α). The 7-11+TAI heifers had a greater (P conception rate (47.0 vs 31.3%), and synchronized pregnancy rate (33.5 vs 24.8%) compared to SSC+TAI heifers, respectively. Heifers exhibiting estrus at 60 h (61.7%) had a greater (P conception rate compared to heifers that exhibited estrus at ≤ 36 (35.3%), 48 (31.6%), and 72 h (36.2%), which were similar (P > 0.05) to each other. As RTS increased from ≤ 2 to ≥ 3, estrous response, conception rate, synchronized pregnancy rate, and 30 d pregnancy rate all increased (P rates compared to SSC+TAI treatment in yearling Bos indicus × Bos taurus heifers. Copyright © 2011 Elsevier Inc. All rights reserved.

Levels of taurine introgression in the current Brazilian Nelore and Gir indicine cattle populations

Science.gov (United States)

A high density panel of more than 777000 genome-wide single nucleotide polymorphisms (SNPs) were used to investigate the population structure of Nelore and Gir, compared to seven other populations worldwide. Principal Component Analysis and model-based ancestry estimation clearly separate the indici...

BoS: a large and diverse family of short interspersed elements (SINEs) in Brassica oleracea.

Science.gov (United States)

Zhang, Xiaoyu; Wessler, Susan R

2005-05-01

Short interspersed elements (SINEs) are nonautonomous non-LTR retrotransposons that populate eukaryotic genomes. Numerous SINE families have been identified in animals, whereas only a few have been described in plants. Here we describe a new family of SINEs, named BoS, that is widespread in Brassicaceae and present at approximately 2000 copies in Brassica oleracea. In addition to sharing a modular structure and target site preference with previously described SINEs, BoS elements have several unusual features. First, the head regions of BoS RNAs can adopt a distinct hairpin-like secondary structure. Second, with 15 distinct subfamilies, BoS represents one of the most diverse SINE families described to date. Third, several of the subfamilies have a mosaic structure that has arisen through the exchange of sequences between existing subfamilies, possibly during retrotransposition. Analysis of BoS subfamilies indicate that they were active during various time periods through the evolution of Brassicaceae and that active elements may still reside in some Brassica species. As such, BoS elements may be a valuable tool as phylogenetic makers for resolving outstanding issues in the evolution of species in the Brassicaceae family.

Carcass and meet characteristics of very young Angus x Nelore steers in the Agreste Potiguar region

Directory of Open Access Journals (Sweden)

Debora Andréa Evangelista Façanha

Full Text Available This work aimed to evaluate the quantitative and qualitative characteristics of the carcass and meat of very young steers, ½ Red Angus x Nelore (NEL and ¾ Red Angus x Nelore (RED. Fifty males were used, 25 from each genetic group, fed in feedlots from weaning (7 months until reaching the age for slaughter (15 months. A difference was observed between the genetic groups for gains at weaning (158.57 kg NEL and 181.60 kg RED but the weight at slaughter showed no statistical differences (412.33 kg NEL and 426.53 kg RED. Cold and hot carcass yield was not affected by the genetic group, with NEL bovines showing a yield of 50.49% and 52.55% and the RED of 50.91% and 52.89% respectively. The percentage of muscle (55% NEL and 53% RED, fat (26% NEL and 27% RED, bone (18% NEL and 18% RED, and thickness of subcutaneous fat (4.1 mm NEL and 4.0 mm RED were similar for both genetic groups. The ¾ Angus x Nelore animals showed a higher loss when thawing (9.05%. There was no difference in such sensory characteristics as overall impression, tenderness, juiciness and shear force in the evaluated genotypes. The genetic groups showed a similarity of characteristics for meat as well as carcass.

Is the American Zebu really Bos indicus?

Directory of Open Access Journals (Sweden)

Meirelles Flávio V.

1999-01-01

Full Text Available The American continent was colonized in the 16th century by Europeans who first introduced cattle of Bos taurus origin. Accounts register introduction of Bos indicus cattle into South America in the 19th and continuing through the 20th century, and most reported imports were males derived from the Indian subcontinent. In the present study we show, by using mitochondrial DNA (mtDNA polymorphism, major participation of matrilineages of taurus origin in the American Zebu purebred origin, i.e., 79, 73 and 100% for the Nellore, Gyr and Brahman breeds, respectively. Moreover, we have created a restriction map identifying polymorphism among B. taurus and B. indicus mtDNA using three restriction enzymes. Results are discussed concerning American Zebu origins and potential use of this information for investigating the contribution of cytoplasmic genes in cattle production traits.

Desempenho de novilhos nelore suplementados em pasto durante época das águas Performance of crossbreed nelore bullock grazing supplemented during the raining seazon

Directory of Open Access Journals (Sweden)

Wilker Dias Lima

2004-02-01

Full Text Available A procura por alimentos e derivados que não sejam utilizados na dieta humana ou na alimentação de animais monogástricos, juntamente com formas de suplementação, são aspectos importantes na busca de fontes alternativas para alimentação de ruminantes e redução no tempo de abate. Com este trabalho teve-se como objetivo avaliar o efeito de níveis crescentes de concentrado na engorda de novilhos nelore suplementados em pasto durante o período das águas. O experimento foi realizado na Fazenda Vitorinha, de propriedade da Fundação de Apoio ao Ensino, Pesquisa e Extensão/FAEPE, ligada à Universidade Federal de Lavras/UFLA, em Lavras, região sul do Estado de Minas Gerais, entre os meses de janeiro a maio de 2001. Foram utilizados 24 animais mestiços nelores, machos, inteiros, com idade média de 17 meses e peso vivo médio de 308,0 kg. Durante o período experimental, os animais foram alojados em uma pastagem de Brachiaria decumbens, com área de 11,2 ha, com disponibilidade média de 5400 kg MS/ha no início do período. Os tratamentos constituíram-se de níveis crescentes de concentrado, calculados como percentual do peso vivo: T1- 0%; T2- 0,15%; T3- 0,30%; T4- 0,45%. O experimento foi delineado em blocos casualizados, com peso vivo inicial como fator de blocagem, sendo 6 blocos e 4 tratamentos, totalizando 24 parcelas experimentais. Para análise dos dados, utilizou-se o software estatístico SISVAR (Sistema de Análise de Variância de Dados Balanceados. Não houve diferença significativa para ganho de peso diário (PThe demand for foods and its derivates that would not be used in the human diet or in the monogastric animals diet in addition with supplement forms are important aspects in the search for alternative sources for ruminant nutrition and reduction in the slaughtered time. This work had as objective to evaluate growing levels of concentrate in the fattening of nelore bullock gazing supplemented during the raining

AVALIAÇÃO DAS VÍSCERAS DE NOVILHOS NELORE E F1 NELORE X SINDI AOS 36 E 48 MESES DE IDADE VISCERA EVALUATION OF NELLORE AND F1 NELLORE X SIND STEERS WITH 36 AND 48 MONTHS OLD AGE

Directory of Open Access Journals (Sweden)

Otavio Cabral Neto

2007-04-01

Full Text Available Objetivou-se com esta pesquisa avaliar o peso das vísceras de novilhos de dois grupos genéticos. Utilizaramse dezesseis machos castrados, sendo oito bovinos Nelore e oito F1 Nelore x Sindi com 36 e 48 meses de idade, confinados em baias separadas. Os animais receberam a mesma dieta e foram abatidos com peso médio de 460,0 (±10,1 kg. O delineamento experimental foi o inteiramente casualizado em esquema fatorial 2 (dois grupos genéticos x 2 (duas idades. Não houve interação entre grupo genético e idade. O fator idade também não apresentou diferença para as características estudadas. Não houve influência do grupo genético para os pesos do trato digestivo, rins, fígado e pulmões. Animais Nelore apresentaram maior peso do coração (1,6 vs 1,2 Kg e do baço (1,1 vs 0,9 Kg do que bovinos F1 Nelore x Sindi. Conclui-se que o produto do cruzamento Nelore x Sindi promoveu redução no peso do coração e baço, mas as idades estudadas não exercem influência no peso das vísceras. PALAVRAS-CHAVE: Baço, coração, fígado, pulmão, rim The objective of the experiment was to evaluate the viscera weight of steers from two genetic groups. Sixteen castrated males were utilized, being eight Nellore and eight F1 Nellore x Sind steers with 36 and 48 month of age, confined in separated boxes. Animals received the same diet and were slaughtered at average weight of 460,0 (±10,1 kg. The experimental design was completely randomized in factorial arrangement 2 (two genetic groups x 2 (two ages. There was no interaction between genetic group and age. The age factor didn’t present difference for the characteristics studied. There was no influence of the genetic group for the weight of the digestive tract, kidneys, liver and lungs. Nellore animals presented higher weight of hearth (1,6 vs 1,2 kg and spleen (1,1 vs 0,9 kg than F1 Nellore x Sind cattle. It was concluded that Nellore x Sind bred product promoted reduction on hearth and spleen weight

Desenvolvimento morfológico dos ovários em embriões e fetos bovinos da raça Nelore Morphological development of the ovaries in embryos and fetuses of Nelore breed

Directory of Open Access Journals (Sweden)

E.G. Diniz

2005-02-01

Full Text Available Investigaram-se os eventos morfológicos relacionados ao desenvolvimento pré-natal de ovários de 81 embriões e fetos da raça Nelore, coletados em frigoríficos, com idades variando de 26 a 240 dias pós-fecundação. Observou-se formação da crista gonádica e presença de células germinativas em seu interior aos 29 e 34 dias, respectivamente. As oogônias e folículos primordiais, ao contrário dos folículos em crescimento, apresentaram diferenças significativas de diâmetro nos vários períodos estudados. Verificou-se correlação positiva (PThe morphologic events related to the prenatal development of the ovaries in 81 Nelore breed embryos and fetuses gathered in a local slaughterhouse, with age range from 26 to 240 days following fecundation were studied. The age of fetuses was estimated from measures taken in the cranium-caudal direction. The sex was identified from macroscopic observations and using Polymerase Chain Reaction (PCR technique. For histology the gonads were fixed in Bouin’s fluid for 24 hours and 5 µm thick section’s were stained with hematoxylin-eosin. Formation of gonadal ridge and presence of germinal cells were found within it at 29 and 34 days, respectively. Oogonia and primordial follicles, unlike the growing follicles, exhibited significant differences in diameter in the various periods studied. Positive correlation (P<0.05 was found between the diameter of oogonia and their nucleus as well as between primordial and growing follicles with their oocytes and respective nuclei. The gonad was fully formed at 40 days. Primordial follicles, in the growing stage, and antral follicles first appeared, approximately at 95, 140, and 180 days, respectively. Despite the onset and duration of oogenesis being similar to that of taurine breeds, folliculogenesis initiates at an early stages in the Nelore breed.

Diversidade genética e eficiência de DNA microssatélites para o controle genealógico da raça Nelore Genetic diversity and efficiency of DNA microsatellites for genealogic control in Nelore breed

Directory of Open Access Journals (Sweden)

T.X. Carneiro

2007-10-01

Full Text Available Foram estimados na raça Nelore a variabilidade genética e os valores de determinação de paternidade usando-se 11 marcadores microssatélites do painel ISAG/FAO. Estes foram organizados em quatro conjuntos de amplificação para genotipagem semi-automática por fluorescência. Todos os marcadores apresentaram-se altamente polimórficos, com média de 8,2 alelos por loco. A heterozigosidade observada, com média de 0,48, foi menor que a esperada em 10 locos. Foram observadas deficiências de heterozigotos em nove locos, o que resultou no desequilíbrio de Hardy-Weinberg para a população estudada. O conteúdo polimórfico informativo foi superior a 0,5 em 10 locos. O poder de discriminação foi >0,999 e as probabilidades de exclusão de paternidade quando são conhecidos os genótipos de um bezerro, sua mãe e um pai alegado, ou quando um ou outro genótipo parental não está disponível, para o conjunto de marcadores foram >0,999 e >0,989, respectivamente. O conjunto de 11 marcadores constitui método eficiente para a determinação de paternidade na raça Nelore.The genetic variability and paternity testing values in Nelore breed were estimated using 11 ISAG/FAO microsatellites. The markers were organized into 4 amplification groups for semi-automated fluorescence genotyping. All markers were highly polymorphic, with an average of 8.2 alleles per locus. With a mean value of 0.48, the observed heterozygosity was lower than the expected for 10 of the loci. A significant deficit of heterozygotes was observed for 9 loci, resulting in a lack of Hardy-Weinberg equilibrium in the studied population. Polymorphism information content values exceeded 0.5 for 10 loci. The power of discrimination was >0.999 and paternity exclusion probabilities when a mother, her offspring and a putative sire are compared or when one or other parental genotype is unavailable for the combined set of markers were, respectively, >0.999 and >0.989. The set of 11

Polymorphism and Mobilization of Rransposons in Bos taurus

DEFF Research Database (Denmark)

Guldbrandtsen, Bernt; Sahana, Goutam; Lund, Mogens Sandø

The bovine genome assembly was explored to detect putative retrotransposon sequences. In total 87,310 such sites were detected. Four breeds of dairy cattle (Bos taurus) were examined with respect to the presence, segregation or complete absence of the putative retrotransposon. A total of 10...

Heat Tolerance in Curraleiro Pe-Duro, Pantaneiro and Nelore Cattle Using Thermographic Images

Directory of Open Access Journals (Sweden)

Caio Cesar Cardoso

2016-01-01

Full Text Available The objective of this study was to compare physiological and thermographic responses to heat stress in three breeds of cattle. Fifteen animals of each of the Nelore, Pantaneiro and Curraleiro Pe-Duro breeds, of approximately two years of age, were evaluated. Heart and respiratory rates, rectal and surface temperature of animals as well as soil temperature were recorded at 8:30 and 15:30 on six days. Variance, correlation, principal factors and canonical analyses were carried out. There were significant differences in the rectal temperature, heart and respiratory rate between breeds (p < 0.001. Nelore and Pantaneiro breeds had the highest rectal temperatures and the lowest respiratory rate (p < 0.001. Breed was also significant for surface temperatures (p < 0.05 showing that this factor significantly affected the response of the animal to heat tolerance in different ways. The Curraleiro Pe-Duro breed had the lowest surface temperatures independent of the period evaluated, with fewer animals that suffered with the climatic conditions, so this may be considered the best adapted when heat challenged under the experimental conditions. Thermography data showed a good correlation with the physiological indexes, and body area, neck and rump were the main points.

Avaliação genética de características de escores visuais de bovinos da raça Nelore da desmama até a maturidade Genetic evaluation of visual scores traits of Nelore cattle from weaning to maturity

Directory of Open Access Journals (Sweden)

Carina Ubirajara de Faria

2009-07-01

Full Text Available Os objetivos neste estudo foram estimar parâmetros genéticos das características categóricas musculosidade, estrutura física, aspectos raciais, conformação, ônfalo, pigmentação e sacro e predizer os valores genéticos utilizando-se a estatística bayesiana sob modelo animal de limiar, considerando diferentes idades de bovinos da raça Nelore. As informações de escores visuais foram obtidas nos anos de 2000 a 2005 de bovinos provenientes de 13 fazendas participantes do Programa Nelore Brasil. Nas análises bicaracterísticas, foram utilizados 500.000 até 1.100.000 ciclos para alcançar a convergência da cadeia de Gibbs. O descarte inicial e o intervalo amostral foram de 100.000 e 1.000 ciclos, respectivamente. As características de escores visuais avaliadas aos 8 e 22 meses de idade apresentaram estimativas de herdabilidades moderadas, indicando resposta rápida à seleção direta. Os escores visuais indicaram possibilidade de resposta rápida à seleção direta e, portanto, devem ser incorporados em programas de melhoramento genético como critérios de seleção. As estimativas de correlações genéticas entre musculosidade, estrutura física e conformação também indicam que a seleção direta para uma destas características trará progresso genético às outras. Recomenda-se utilizar os escores visuais como critérios de seleção em pelo menos duas fases de vida do animal, na desmama e ao sobreano.The objectives of this study were to estimate the genetic parameters of the following categorical traits: musculature, physical structure, racial breed aspects, conformation, navel, pigmentation and sacrum, and predict breeding values, using bayesian statistics under threshold animal models, considering different ages of cattle of the Nelore breed. The information concerning visual scores were obtained from 2000 to 2005 from cattle of the Nelore breed from thirteen participant farms of the Brazilian Nelore Program. In the two

Precocidade sexual em bovinos Nelore avaliada por ultrassonografia testicular

Directory of Open Access Journals (Sweden)

D.J. Cardilli

2014-08-01

Full Text Available The present study aimed to evaluate if there are differences in testicular parenchyma echogenicity between pre-pubescent and pubescent animals at the same age. Ultrasound examinations were performed in longitudinal and transversal planes of the testicles of 111 healthy Nelore bovines, at the ages of nine, 13 and 15 months. The EIV software calculated the echogenicity of the testicular parenchyma, which ranged from 0 (anechoic to 100% (hyperechoic. Animals that had reached puberty at 15 months of age presented higher testicular echogenicity than the animals that had not reached puberty at the same age. These results suggest that testicular ultrasonography can be used as a predictor of sexual precocity.

Adrenergic system participation on LH secretion in pre-pubertal Nelore heifers Participação do sistema adrenérgico na secreção de LH, em novilhas nelores

Directory of Open Access Journals (Sweden)

Guilherme Paula Nogueira

2008-12-01

Full Text Available The aim of this study was to evaluate the response of clonidine administration (alfa-adrenoceptor agonist, 10g/kg body weight, i.v. and blood collected every 15 min for 4 h thereafter on luteinizing hormone (LH secretion in B. indicus pre-pubertal heifers at 8, 12 e 15 months of age. LH was quantified by RIA, sensitivity (0.05 ng/mL and coefficient of variation (20.39%. Alfa-adrenoceptor action (clonidine reduced (P<0,05 basal LH and time to greatest peak occurrence at 15 months-old and increased (P>0,05 peak total area and area of highest peak of LH secretion to 8 months-old. The results suggest reduced hypothalamic sensibility by gonadal steroid in pre-pubertal Nelore heifer maturation sexual and clonidine neurotransmitter participation, either stimulating or inhibiting LH secretion.Objetivou-se com este trabalho investigar a variação na secreção do hormônio luteinizante (LH em resposta ao tratamento com clonidina (agonista alfa-adrenérgico, 10µg/kg, i.v., amostras 15 min por 4h, em novilhas da raça Nelore pré-púberes aos 8, 12 e 15 meses de idade. A concentração de LH foi quantificada por radioimunoensaio, sensibilidade de 0,05 ng/mL e coeficiente de variação de 20,39%. A ativação de receptores alfa-adrenérgicos por intermédio da clonidina diminuiu (P<0,05 a concentração de LH e o tempo necessário para o aparecimento do maior pico de LH aos 15 meses de idade e aumentou (P>0,05 a área total e área do maior pico de secreção de LH aos 8 meses de idade. Os resultados indicam diminuição da sensibilidade do hipotálamo aos esteróides gonadais durante o processo de maturação sexual nas novilhas da raça Nelore e a participação da clonidina como neurotransmissora.

Eficiência Bionutricional de Animais da Raça Nelore e seus Mestiços com Caracu, Angus e Simental

Directory of Open Access Journals (Sweden)

Euclides Filho Kepler

2002-01-01

Full Text Available Foram avaliados 23 machos inteiros de três grupos genéticos, sete da raça Nelore (N, oito ½ Caracu + ¼ Angus + ¼ Nelore (CCAN e oito ½ Caracu + ¼ Simental + ¼ Nelore (CCSN. Esses animais pertenciam a um projeto em desenvolvimento na Embrapa Gado de Corte, com o objetivo de identificar um grupo genético que, além de ser adaptado às condições tropicais e subtropicais, produza carne de qualidade de forma eficiente e competitiva (Projeto composto Indo-Euro. O presente experimento teve como objetivo específico avaliar a eficiência bionutricional desses animais. Para tanto, as variáveis ganho de peso e consumo de matéria seca foram consideradas simultaneamente em uma análise bivariada. Utilizando o maior autovalor, estabeleceu-se a primeira função discriminante canônica que foi usada para a obtenção da eficiência bionutricional. A análise estatística revelou efeito significativo de grupo genético sobre essa eficiência. As médias foram comparadas por meio dos seguintes contrastes: C1 CCAN versus CCSN; e C2 média dos animais CCAN e CCSN versus N. Como os dois contrastes foram significativos, concluiu-se haver diferenças entre os desempenhos nutricionais dos animais mestiços, e que os animais CCANs apresentaram melhor EBN do que os CCSNs (60,72 versus 48,63, respectivamente. Os mestiços apresentaram melhor eficiência do que os nelores (54,67 versus 16,70. As médias de quadrados mínimos para consumo de matéria seca diário e para ganho de peso médio diário, durante o período de avaliação, foram, respectivamente: 7,62 kg e 1 kg; 7,19 kg e 1,23 kg e 7,57 kg e 1,15 kg para os animais N, CCAN e CCSN.

De prijsvorming van hout uit het Nederlandse bos

NARCIS (Netherlands)

Slangen, L.H.G.

1984-01-01

De prijsvorming van hout op stam en hout geveld uit het Nederlandse bos op het niveau van het bosbedrijf staat centraal in deze publikatie. Na een schets van een aantal facetten die invloed hebben op de prijsvorming wordt nader ingegaan op de prijsvorming zelf. Onderzocht wordt of er verschil in

Anticorpos em bovinos (Bos indicus e Bos taurus e bubalinos (Bubalus bubalis inoculados com oocistos de Toxoplasma gondii. Estudo comparativo

Directory of Open Access Journals (Sweden)

Oliveira F.C.R.

2000-01-01

Full Text Available Três animais de cada espécie (Bos indicus, Bos taurus e Bubalus bubalis foram inoculados, via oral, com 2×10(5 oocistos de Toxoplasma gondii. Seis outros animais, dois de cada espécie, foram mantidos como testemunhas. A resposta de anticorpos avaliada por meio da reação de imunofluorescência indireta iniciou-se a partir do quinto dia pós-inoculação (DPI nos zebuínos e bubalinos, e no sétimo DPI nos taurinos. Os títulos sorológicos nos taurinos permaneceram elevados até o final do experimento (70º DPI, alcançando níveis máximos (1:16.384 entre o 42º e 49º DPI. Nos zebuínos e bubalinos o maior título de anticorpos anti-Toxoplasma foi de 1:256. A resposta de anticorpos mais ou menos acentuada não está necessariamente relacionada à sensibilidade ao T. gondii.

Differential abundances of four forms of Binder of SPerm 1 in the seminal plasma of Bos taurus indicus bulls with different patterns of semen freezability.

Science.gov (United States)

Magalhães, Marcos Jorge; Martins, Leonardo Franco; Senra, Renato Lima; Santos, Thaís Ferreira Dos; Okano, Denise Silva; Pereira, Paulo Roberto Gomes; Faria-Campos, Alessandra; Campos, Sérgio Vale Aguiar; Guimarães, José Domingos; Baracat-Pereira, Maria Cristina

2016-08-01

The Binder of SPerm 1 (BSP1) protein is involved in the fertilization and semen cryopreservation processes and is described to be both beneficial and detrimental to sperm. Previously, the relationship of BSP1 with freezability events has not been completely understood. The objective of this work was to determine the differential abundance of the forms of the BSP1 protein in cryopreserved seminal plasma of Bos taurus indicus bulls with different patterns of semen freezability using proteomics. A wide cohort of adult bulls with high genetic value from an artificial insemination center was used as donors of high quality, fresh semen. Nine bulls presenting different patterns of semen freezability were selected. Two-dimensional gel electrophoresis showed differential abundance in a group of seven protein spots in the frozen/thawed seminal plasma from the bulls, ranging from 15 to 17 kDa, with pI values from 4.6 to 5.8. Four of these spots were confirmed to be BSP1 using mass spectrometry, proteomics, biochemical, and computational analysis (Tukey's test at P semen freezability and its absence in bulls presenting high semen freezability. This is the first report showing that more than two forms of BSP1 are found in the seminal plasma of Nelore adult bulls and not all animals have a similar abundance of each BSP1 form. Different BSP1 forms may be involved in different events of fertilization and the cryopreservation process. Copyright © 2016 Elsevier Inc. All rights reserved.

Estimativas de parâmetros genéticos de características reprodutivas de touros Nelore, de dois e três anos de idade Genetic parameter estimates for reproductive traits in young Nelore bulls

Directory of Open Access Journals (Sweden)

J.C. Dias

2006-06-01

Full Text Available Estimaram-se a herdabilidade e a correlação genética entre características ponderais e reprodutivas de 579 touros da raça Nelore, de 19 a 39 meses de idade. As características reprodutivas avaliadas foram: circunferência escrotal (CE; consistência, volume, forma, comprimento e largura dos testículos; motilidade e vigor dos espermatozóides; defeitos espermáticos maiores, menores e totais; e classificação andrológica por pontos (CAP. As características foram analisadas pelo método de máxima verossimilhança restrita, com algoritmos livres de derivadas, sob modelo animal, com inclusão da matriz de numeradores dos coeficientes de parentesco entre os animais e seus ascendentes, utilizando o programa MTDFREML. As estimativas de herdabilidade para consistência testicular, motilidade e vigor espermáticos e defeitos espermáticos maiores, menores e totais e CAP foram, respectivamente, 0,46; 0,10; 0,08; 0,16; 0,09; 0,11 e 0,10. As correlações genéticas entre CE e: peso, volume testicular, motilidade e vigor espermáticos, defeitos espermáticos menores, defeitos totais e CAP foram, respectivamente, 0,72; 0,99; 0,72; 0,60; -0,67; -0,12 e 0,64. As correlações genéticas entre CAP e: peso, volume testicular, defeitos espermáticos maiores e defeitos totais foram, respectivamente, 0,19; 0,71; -0,47 e -0,58. Os resultados sugerem compatibilidade de crescimento corporal e fertilidade nos programas de seleção de reprodutores Nelore.Heritabilities and genetic correlations between performance and reproductive traits were estimated using Multiple Trait Derivative-Free Restricted Maximum Likelihood methodology in 579 pasture-raised Nelore bulls that were 19 to 39 months of age. Traits were breeding soundness evaluation (BSE, scrotal circumference (SC, testicular consistency (TC, testicular volume (TV, testicular shape (TS, length and width of right and left testicles, and semen traits including motility (Mot, vigor (Vig, major (MD sperm

Evidence of Bos javanicus x Bos indicus hybridization and major QTLs for birth weight in Indonesian Peranakan Ongole cattle.

Science.gov (United States)

Hartati, Hartati; Utsunomiya, Yuri Tani; Sonstegard, Tad Stewart; Garcia, José Fernando; Jakaria, Jakaria; Muladno, Muladno

2015-07-04

Peranakan Ongole (PO) is a major Indonesian Bos indicus breed that derives from animals imported from India in the late 19(th) century. Early imports were followed by hybridization with the Bos javanicus subspecies of cattle. Here, we used genomic data to partition the ancestry components of PO cattle and map loci implicated in birth weight. We found that B. javanicus contributes about 6-7% to the average breed composition of PO cattle. Only two nearly fixed B. javanicus haplotypes were identified, suggesting that most of the B. javanicus variants are segregating under drift or by the action of balancing selection. The zebu component of the PO genome was estimated to derive from at least two distinct ancestral pools. Additionally, well-known loci underlying body size in other beef cattle breeds, such as the PLAG1 region on chromosome 14, were found to also affect birth weight in PO cattle. This study is the first attempt to characterize PO at the genome level, and contributes evidence of successful, stabilized B. indicus x B. javanicus hybridization. Additionally, previously described loci implicated in body size in worldwide beef cattle breeds also affect birth weight in PO cattle.

Phylogenetic relationships of Malayan gaur with other species of the genus Bos based on cytochrome b gene DNA sequences.

Science.gov (United States)

Rosli, M K A; Zakaria, S S; Syed-Shabthar, S M F; Zainal, Z Z; Shukor, M N; Mahani, M C; Abas-Mazni, O; Md-Zain, B M

2011-03-22

The Malayan gaur (Bos gaurus hubbacki) is one of the three subspecies of gaurs that can be found in Malaysia. We examined the phylogenetic relationships of this subspecies with other species of the genus Bos (B. javanicus, B. indicus, B. taurus, and B. grunniens). The sequence of a key gene, cytochrome b, was compared among 20 Bos species and the bongo antelope, used as an outgroup. Phylogenetic reconstruction was employed using neighbor joining and maximum parsimony in PAUP and Bayesian inference in MrBayes 3.1. All tree topologies indicated that the Malayan gaur is in its own monophyletic clade, distinct from other species of the genus Bos. We also found significant branching differences in the tree topologies between wild and domestic cattle.

The multifaceted origin of taurine cattle reflected by the mitochondrial genome.

Directory of Open Access Journals (Sweden)

Alessandro Achilli

Full Text Available A Neolithic domestication of taurine cattle in the Fertile Crescent from local aurochsen (Bos primigenius is generally accepted, but a genetic contribution from European aurochsen has been proposed. Here we performed a survey of a large number of taurine cattle mitochondrial DNA (mtDNA control regions from numerous European breeds confirming the overall clustering within haplogroups (T1, T2 and T3 of Near Eastern ancestry, but also identifying eight mtDNAs (1.3% that did not fit in haplogroup T. Sequencing of the entire mitochondrial genome showed that four mtDNAs formed a novel branch (haplogroup R which, after the deep bifurcation that gave rise to the taurine and zebuine lineages, constitutes the earliest known split in the mtDNA phylogeny of B. primigenius. The remaining four mtDNAs were members of the recently discovered haplogroup Q. Phylogeographic data indicate that R mtDNAs were derived from female European aurochsen, possibly in the Italian Peninsula, and sporadically included in domestic herds. In contrast, the available data suggest that Q mtDNAs and T subclades were involved in the same Neolithic event of domestication in the Near East. Thus, the existence of novel (and rare taurine haplogroups highlights a multifaceted genetic legacy from distinct B. primigenius populations. Taking into account that the maternally transmitted mtDNA tends to underestimate the extent of gene flow from European aurochsen, the detection of the R mtDNAs in autochthonous breeds, some of which are endangered, identifies an unexpected reservoir of genetic variation that should be carefully preserved.

Dosimetric evaluation of using in-house BoS Frame Fixation Tool for the Head and Neck Cancer Patient

International Nuclear Information System (INIS)

Kim, Kwang Suk; Jo, Kwang Hyun; Choi, Byeon Ki

2016-01-01

BoS(Base of Skull) Frame, the fixation tool which is used for the proton of brain cancer increases the lateral penumbra by increasing the airgap (the distance between patient and beam jet), due to the collision of the beam of the posterior oblique direction. Thus, we manufactured the fixation tool per se for improving the limits of BoS frame, and we'd like to evaluate the utility of the manufactured fixation tool throughout this study. We've selected the 3 patients of brain cancer who have received the proton therapy from our hospital, and also selected the 6 beam angles; for this, we've selected the beam angle of the posterior oblique direction. We've measured the planned BoS frame and the distance of Snout for each beam which are planned for the treatment of the patient using the BoS frame. After this, we've proceeded with the set-up that is above the location which was recommended by the manufacturer of the BoS frame, at the same beam angle of the same patient, by using our in-house Bos frame fixation tool. The set-up was above 21 cm toward the superior direction, compared to the situation when the BoS frame was only used with the basic couch. After that, we've stacked the snout to the BoS frame as much as possible, and measured the distance of snout. We've also measured the airgap, based on the gap of that snout distance; and we've proceeded the normalization based on each dose (100% of each dose), after that, we've conducted the comparative analysis of lateral penumbra. Moreover, we've established the treatment plan according to the changed airgap which has been transformed to the Raystation 5.0 proton therapy planning system, and we've conducted the comparative analysis of DVH(Dose Volume Histogram). When comparing the result before using the in-house Bos frame fixation tool which was manufactured for each beam angle with the result after using the fixation tool, we could figure out that airgap than when not used in accordance with the use of the in-house Bos

Dosimetric evaluation of using in-house BoS Frame Fixation Tool for the Head and Neck Cancer Patient

Energy Technology Data Exchange (ETDEWEB)

Kim, Kwang Suk; Jo, Kwang Hyun; Choi, Byeon Ki [Dept. of Radiation Oncology, Samsung Seoul Hospital, Seoul (Korea, Republic of)

2016-06-15

BoS(Base of Skull) Frame, the fixation tool which is used for the proton of brain cancer increases the lateral penumbra by increasing the airgap (the distance between patient and beam jet), due to the collision of the beam of the posterior oblique direction. Thus, we manufactured the fixation tool per se for improving the limits of BoS frame, and we'd like to evaluate the utility of the manufactured fixation tool throughout this study. We've selected the 3 patients of brain cancer who have received the proton therapy from our hospital, and also selected the 6 beam angles; for this, we've selected the beam angle of the posterior oblique direction. We've measured the planned BoS frame and the distance of Snout for each beam which are planned for the treatment of the patient using the BoS frame. After this, we've proceeded with the set-up that is above the location which was recommended by the manufacturer of the BoS frame, at the same beam angle of the same patient, by using our in-house Bos frame fixation tool. The set-up was above 21 cm toward the superior direction, compared to the situation when the BoS frame was only used with the basic couch. After that, we've stacked the snout to the BoS frame as much as possible, and measured the distance of snout. We've also measured the airgap, based on the gap of that snout distance; and we've proceeded the normalization based on each dose (100% of each dose), after that, we've conducted the comparative analysis of lateral penumbra. Moreover, we've established the treatment plan according to the changed airgap which has been transformed to the Raystation 5.0 proton therapy planning system, and we've conducted the comparative analysis of DVH(Dose Volume Histogram). When comparing the result before using the in-house Bos frame fixation tool which was manufactured for each beam angle with the result after using the fixation tool, we could figure out that airgap than when

Heterosis for meat quality and fatty acid profiles in crosses among Bos indicus and Bos taurus finished on pasture or grain.

Science.gov (United States)

Gama, L T; Bressan, M C; Rodrigues, E C; Rossato, L V; Moreira, O C; Alves, S P; Bessa, R J B

2013-01-01

Physicochemical properties and fatty acid profiles of meat from Bos indicus, Bos taurus and crossbred B. taurus×B. indicus bullocks (n=216), finished on pasture or grain, were used to estimate the effects of heterosis. Meat quality and fatty acid profiles generally benefited with crossbreeding, but the advantages from heterosis differed among finishing systems. The Warner-Bratzler shear-force in fresh and aged meat was reduced due to heterosis in pasture-finishing, but the effect was minor under grain-finishing. With pasture-finishing, heterosis caused an increase of 5% in CLA concentration, but few other changes in fatty acid profiles. In grain-finishing, heterosis caused a reduction in intramuscular fat and cholesterol, increased amounts of PUFA, n-6 fatty acids and PUFA/SFA ratio, and a decline in atherogenic index. The Δ(9) desaturase estimated activity in crossbreds showed a behavior close to B. indicus, suggesting the existence of few loci and a dominance genetic effect on enzymes involved in fatty acid synthesis and metabolism. Copyright © 2012 Elsevier Ltd. All rights reserved.

Performance of Angus, Devon and crossbred Angus x Devon x Nelore young steers in feedlot/ Desempenho de novilhos superprecoces Angus, Devon e cruzas Angus x Devon x Nelore em confinamento

Directory of Open Access Journals (Sweden)

Hélio Radke Bittencourt

2007-07-01

Full Text Available The study was based on data from 129 beef steers from three genetic groups: Angus (AN, n=45, Devon (DV, n=35 and Crossbred Angus x Devon x Nelore (CB, n=49, with an average beginning weight (ABWof 277.60, 278.00 and 295.53 kg, respectively. Those animals were in a feedlot with 11 months of age, to be slaughtered at 14 months. The parameters analyzed were: days on feed (DF, average weight gain (AWG, total weight gain (TWG, average slaughter weight (SW, average carcass weight (CW, average carcass yield (CY and carcass classification (CC. The analysis were done using the ABW as a covariate because of these variable in the group CB were higher (p0.05. CB animals got a higher SW (375.04 kg than DV (359.40 (p0.05. The CW (pForam analisados dados de 129 novilhos das raças Angus (AN, n=45, Devon (DV, n=35 e cruzas Angus x Devon x Nelore (CR, n=49, com peso médio inicial (PMI de 277,60, 278,00 e 295,53 kg, respectivamente, confinados aos 11 meses de idade para abate aos 14 meses. As variáveis-resposta mensuradas foram: tempo médio de permanência (TMP; ganho de peso médio diário (GMD; ganho de peso total (GP; peso médio ao abate (PMA; peso médio de carcaça (PC; rendimento médio de carcaça (RC e classificação de carcaça (CC. As análises foram realizadas utilizando o PMI como co-variável, visto que este foi maior (p 0,05. Animais CR apresentaram maior (p 0,05 de DV e CR. O PC (p < 0,05 e o RC (p < 0,01 foram maiores para CR (191,12 kg e 50,99% em relação à AN (179,81 kg e 49,73% e DV (177,23 kg e 49,41%, respectivamente, que não apresentaram variações significativas entre si. Novilhos Angus e Devon obtiveram resultados semelhantes em todas as variáveis analisadas. Animais cruza Angus x Devon x Nelore apresentaram maior peso e rendimento de carcaça do que animais puros.

Características de carcaça e qualidade de carne de novilhos superprecoces de três grupos genéticos Carcass characteristics and beef quality of young bulls from three genetic groups

Directory of Open Access Journals (Sweden)

Patrícia Maria Ribeiro Campos Pereira

2009-11-01

Full Text Available O objetivo deste trabalho foi avaliar parâmetros de carcaça, características físico-químicas e de qualidade de carne de novilhos machos superprecoces. Foram avaliados três grupos raciais com 8 animais Nelore (N, 18 ¼ Abeerden Angus ½ Nelore (AN e 18 ½ Limousin ¼ Abeerden Angus ¼ Nelore (LAN, com idade entre 7,5 e 11,5 meses no início do experimento, abatidos após 143 dias de confinamento. Os animais AN apresentaram maior peso ao abate, ganho médio diário de peso, peso de carcaça e comprimento de carcaça; os animais LAN apresentaram maior rendimento de carcaça e área de olho de lombo. Os animais LAN apresentaram 72% de carcaças convexas, enquanto 83% das carcaças dos animais AN e 100% das carcaças dos animais N foram classificadas como subconvexas. Os grupos LAN e AN não apresentaram diferença significativa nos valores de força de cisalhamento, o que indica a possibilidade de utilização da proporção de 50% do genótipo Bos indicus sem prejuízo para a maciez da carne. As características de carcaça e carne dos animais dos grupos genéticos NA, LAN e N estão em conformidade com as especificações de consumo e adequadas para abate aos 15 meses de idade, o que viabiliza o sistema de produção de novilhos superprecoces.The objective of this work was to evaluate carcass parameters, physicochemical characteristics and quality of meat of young bulls. Three genetic groups with 8 Nelore (N, 18 ½ Abeerden Angus ½ Nelore (AN, and 18 ½ Limousin ¼ Abeerden Angus ¼ Nelore (LAN animals, with ages varying between 7.5 and 11.5 months at the beginning of the experiment, slaughtered after 143 days of confinement, were evaluated. AN animals were heavier at slaughter and showed higher average daily weight gain, higher hot carcass weight and carcass length; LAN animals had higher carcass yield and rib-eye area. LAN animals showed 72% convex carcasses, while 83% of AN and 100% of N carcasses were classified as subconvex. LAN and AN

Efeito do creep feeding sobre o desempenho de bezerros e a eficiência reprodutiva de primíparas Nelore, em pastejo Effect of creep feeding on average daily gain and weaning weight of calves and on reproductive efficiency of primiparous Nelore cows under grazing

Directory of Open Access Journals (Sweden)

E. Nogueira

2006-08-01

Full Text Available Avaliou-se o efeito da suplementação de bezerros em sistema de creep feeding, em pastagens de Brachiaria brizantha, durante o período de amamentação, sobre o ganho médio diário (GMD, peso à desmama (PD e taxa de gestação, em delineamento inteiramente ao acaso, utilizando 102 vacas Nelore (primíparas de baixa condição corporal ao início da estação de monta e seus bezerros, divididos em dois grupos: T1 (n=52, não tratado e T2 (n=50, tratado com suplemento à base de 20% de PB e 75% de NDT. O consumo médio diário estimado no período foi 0,61kg de suplemento/bezerro/dia. Observaram-se diferenças entre T1 e T2 quanto ao PD (P0,05. A suplementação em creep feeding pode aumentar o GMD e o PD de bezerros Nelore, sem alterar a taxa de gestação de primíparas que iniciam a estação de monta com baixa condição corporal.The effect of creep feeding on average daily gain (ADG and weaning weight (WW of calves and pregnancy rate of dams was evaluated in Nelore cattle on Brachiaria Brizantha pasture. In a complete randomized design, calves were divided into two treatments: T1, the control group and T2, in which calves were provided a supplemental diet containing 20% CP and 75% TDN from 92 days after birth until weaning. The 102 primiparous cows were in low body condition at beginning of breeding season. Average daily consumption of the creep ration was 0.61kg per calf. WW averaged 155.10±2.72kg and 163.80±2.53 and for T1 and T2 calves, respectively (P0.05. Thus, creep feeding can improve WW and preweaning ADG of Nelore calves but may not affect pregnancy rate of primiparous cows in low body condition at the start of the mating.

DESEMPENHO E RESPOSTAS ADAPTATIVAS DE NOVILHOS ANGUS X NELORE EM CLIMA TROPICAL

Directory of Open Access Journals (Sweden)

DÉBORA ANDRÉA EVANGELISTA FAÇANHA

2015-01-01

Full Text Available The aim of this study was to evaluate the performance and the adaptive profile of de 25 steers ¶ Angus x μ Nelore (RED and 25 steers ´ Angus x ´ Nelore (NEL, during the milking and the fattening phas-es, in an intensive system, at Rio Grande do Norte state. The body weights, anterior and posterior high, as well as the thoracic perimeter, were monthly measured to evaluate the growth pattern. As adaptive responses were registered rectal temperature and hair coat traits. The statistical analyzes were based in the minimum square method, utilized mixed models. At the beginning of the trial both of genetic groups presented the same body weight (103,03kg and from the second sampling on the animals RED were superior in comparison with the NEL and showed higher body weight at the weaning (181,60kg RED e 158,57kg NEL and the 13th months. On the other hand, there was no difference between the genetic groups for the final weight (slaughter body weight. There were differences in all the performance characteristics analyzed. The RED group was superior in relation to the NEL group. The hair coat characteristics didn't differ between the genetic groups, except the hair coat length, which was higher in the RED animals. We concluded that both of genetic groups were adapted to tropical weather conditions, nevertheless, despite the better performance showed by the animals RED during the suckling and the fattening phases, the NEL animal may be indicated because of the similar slaughter body weight.

Probability density function of the number of embryos collected from superovulated Nelore breed donors Função de densidade de probabilidade do número de embriões produzidos por doadoras da raça Nelore

Directory of Open Access Journals (Sweden)

Renato Travassos Beltrame

2009-08-01

Full Text Available Several models have been developed to evaluate reproductive status of cows through concentration of progesterone in milk, the effect of sex selection in the commercial production of herds and bioeconomic performance of the multiple ovulation and embryo transfer system in select herds. However, models describing the production of embryos in superovulated females have yet to be developed. A probability density function of the number of embryos collected by donors of the Nelore breed was determined. Records of 61,928 embryo collections from 26,767 donors from 1991 to 2005 were analyzed. Data were provided by the Brazilian Association of Creators of Zebu and Controlmax Consultoria e Sistemas Ltda. The probability density function of the number of viable embryos was modeled using exponential and gamma distributions. Parameter fitting was carried out for maximum likelihood using a non-linear gradient method. Both distributions presented similar level of precision: root mean square error (RMSE = 0.0072 and 0.0071 for the exponential and gamma distributions, respectively; both distributions are thus deemed suitable for representing the probability density function of embryo production by Nelore females.Diversos modelos têm sido desenvolvidos para avaliar o estado reprodutivo de vacas por meio da concentração de progesterona no leite, o efeito da seleção do sexo na produção comercial de rebanhos e o desempenho bioeconômico da ovulação múltipla e transferência de embriões em rebanhos selecionados. No entanto, modelos que descrevem a produção de embriões em fêmeas superovulados ainda têm de ser desenvolvidos. Uma função de densidade probabilidade para o número de embriões viáveis recuperados de doadoras da raça Nelore foi determinada. Dados de 61.928 coletas de 26.767 doadoras entre 1991 e 2005 foram analisados. Os resultados foram fornecidos pela Associação Brasileira de Criadores de Zebu (ABCZ e pela empresa Controlmax

Feed intake and weight changes in Bos indicus-Bos taurus crossbred steers following Bovine Viral Diarrhea Virus Type 1b challenge under production conditions

Science.gov (United States)

Bovine viral diarrhea virus (BVDV) has major impacts on beef cattle production worldwide, but the understanding of host animal genetic influence on illness is limited. This study evaluated rectal temperature, weight change and feed intake in Bos indicus crossbred steers (n = 366) that were challenge...

In vivo comparison of susceptibility between Bos indicus and Bos taurus cattle types to Theileria parva infection

Directory of Open Access Journals (Sweden)

S.G. Ndungu

2005-09-01

Full Text Available The objective of this study was to determine whether Bos taurus cattle differ form Bos indicus in their susceptibility to infection with the Muguga stabilate of Theileria parva and in their resistance to the resultant disease. Ten Friesians (B. taurus, ten improved Borans (B. indicus, ten unimproved Borans (B. indicus and ten Zebus (B. indicus born to dams from an East Coast fever (ECF endemic area were inoculated with an infective dose50 dilution of T. parva Muguga stabilate 147. All the animals except one Friesian and one Zebu developed schizont parasitosis. All the improved Borans, nine of the Friesians, eight of the unimproved Borans and six of the Zebus developed a febrile response. Four of the improved Borans, four of the Friesians and three of the unimproved Borans died of theileriosis. No significant difference (P > 0.05 in the prepatent period occurred between the groups, but the Zebus had a significantly shorter duration of schizont parasitosis (P > 0.05 and took a significantly shorter time to recover (P > 0.05 than the other three groups. There was no significant difference in the two parameters between the other three groups. The study showed that three B. indicus breds and a B. taurus breed are equally susceptible to T. parva infection. However, Zebus born to dams from an ECF endemic area showed a better ability to control the course of disease than cattle from ECF free areas.

Combining organic and inorganic nitrogen fertilisation reduces N₂O emissions from cereal crops

DEFF Research Database (Denmark)

Nyamadzawo, George; Shi, Yeufeng; Chirinda, Ngonidzashe

2014-01-01

maize (Zea mays L.) and winter wheat (Triticum aestivum L.) fields amended with inorganic, organic N and a combination of both sources (integrated management), in tropical (Zimbabwe) and temperate (China) climatic conditions. In Zimbabwe N2O emissions were measured from maize plots, while in China...... emissions were measured from maize and winter wheat plots. In Zimbabwe the treatments were; (i) Control, (ii) 60 kg N ha-1 ammonium nitrate (NH4NO3), (iii) 120 kg N ha-1 NH4NO3, (iv) 60 kg ha-1 cattle (Bos primigenius) manure-N, plus 60 kg N ha-1 NH4NO3, (v) 60 kg N ha-1 cattle manure-N, and (vi) 120 kg N...

Qualidade da carne maturada de bovinos Red Norte e Nelore Aged meat quality in Red Norte and Nellore cattle

Directory of Open Access Journals (Sweden)

Patrícia Lopes Andrade

2010-08-01

Full Text Available O objetivo neste trabalho foi avaliar a qualidade da carne do músculo longissimus thoracis de bovinos durante a maturação. Amostras de 22 bovinos Nelore e 22 Red Norte machos, com 24 meses de idade, foram coletadas às 24 horas post mortem, mantidas a 2oC e analisadas aos 1, 7, 14 e 21 dias. Os animais foram terminados em confinamento (112 dias com silagem de milho (50% e concentrado (50% à vontade. Os valores de pH final, perda por cocção, umidade, proteína, gordura e cinzas foram semelhantes entre as amostras de animais Nelore e Red Norte. O teor de vermelho (a* e a intensidade de amarelo (b* foram semelhantes entre as carnes dos dois grupos genéticos, porém a luminosidade (L* foi maior nas amostras de animais Red Norte. A maturação afetou significativamente a luminosidade, o teor de vermelho e amarelo, croma (C*, o ângulo de tonalidade (H* e a percepção subjetiva da cor (ΔE, de forma que as alterações de cor mais importantes ocorreram entre 7 e 14 dias. A força de cisalhamento na carne dos animais Red Norte foi cerca de 0.9 kg inferior às dos animais Nelore. A maturação influenciou a força de cisalhamento ao longo da maturação e determinou reduções de 1,09; 0,21 e 0,56 kg nos períodos de 1 a 7; 7 a 14 e 14 a 21 dias, respectivamente. O índice de fragmentação miofibrilar foi maior na carne dos animais Red Norte e nas amostras maturadas por 21 dias. A carne dos animais Red Norte apresentou maior luminosidade e maciez. A maturação melhora a maciez das carnes, por reduzir a força de cisalhamento, porém modifica a cor, cujas alterações mais importantes acontecem entre 7 e 14 dias. A escolha do tempo de maturação mais adequado para as carnes bovinas depende do atributo a ser valorizado.The objective in this study was to evaluate meat quality of longissimus thoracisi muscle during ageing. Samples from 22 Nelore bovines and 22 Red Norte males at 24 months of age were collected at 24 hours post mortem, kept at 2º

Efecto de la proporción de genes Bos indicus x Bos taurus sobre peso al destete y edad a primer parto en una población multirracial

Directory of Open Access Journals (Sweden)

Hugo O. Toledo Alvarado

2015-01-01

Full Text Available Se analizaron 1,289 registros de hembras de primer parto con diversas proporciones de genes Bos indicus y Bos taurus (Charolais, Suizo, Simmental, Holstein Friesian y Salers. Tanto animales puros y cruzados de un hato comercial, ubicado en el municipio de Hueytamalco, Puebla, nacidas entre 1966 a 2006, con el objetivo de estimar la combinación óptima de genes Cebú y la retención de heterosis (RVH sobre las características de peso al destete ajustado a 270 días (PD y edad a primer parto (EPP. A partir de modelos de regresión múltiple se identificó la proporción de Cebú con el mejor comportamiento para las dos características de acuerdo al coeficiente de determinación (R 2 y al estadístico de Mallow (CP. La mejor respuesta para PD se encontró en el rango de 42 a 70 % de genes Bos indicus ; mientras que las menores EPP se establecieron entre 27 al 40 % de proporción Cebú. La retención de heterosis que mostró mayor potencial para PD fue de 76 a 78 % y para EPP de 79 a 92 %. Estos resultados manifiestan la importancia de los efectos no aditivos en ambas características, así como la necesidad de realizar cruzamientos dirigidos.

MADURACIÓN DEL SOLOMO (Biceps femoris EN VACAS DE DESCARTE Bos indicus Y Bos taurus

Directory of Open Access Journals (Sweden)

Roger Alonso Cubero-Rojas

2013-01-01

Full Text Available El objetivo de este trabajo fue evaluar el efecto de la maduración sobre la terneza del músculo Biceps femoris en vacas de descarte Bos indicus y Bos taurus. En la planta procesadora de Montecillos R.L., ubicada en Alajuela, se realizó la escogencia y sacrificio de los animales, la maduración y empaque al vacío de la carne. La cocción, determinación de la terneza y evaluación sensorial se llevó a cabo a los 0, 14 y 28 días de maduración, en el Laboratorio de Análisis Sensorial del Centro de Investigaciones en Tecnología de Alimentos de la Universidad de Costa Rica, ubicado en San Pedro de Montes de Oca, San José, en julio del año 2011. De acuerdo con la evaluación instrumental, la especie y la cronometría dental no fueron factores significativos en la determinación de la terneza de la carne, mientras que el tiempo de maduración sí mostró cambios altamente significativos (p>0,001 sobre el mismo parámetro. Los mejores resultados se obtuvieron a los 28 días, donde B. indicus mostró 3,78 kg de fuerza al corte, mientras que para B. taurus se obtuvo 3,88 kg. En la evaluación sensorial, los animales B. indicus se calificaron como más jugosos (p=0,016 y con mejor sabor (p<0,001. Se determinó una relación inversa entre sabor y tiempo de maduración, lo cual indicó que a mayor tiempo de maduración el sabor de la carne se volvió menos agradable al paladar.

DIVERGÊNCIA MORFOMÉTRICA EM BOVINOS NELORE EM CRESCIMENTO CLASSIFICADOS PARA DIFERENTES CLASSES DE FRAME SIZE

Directory of Open Access Journals (Sweden)

LÚCIO FLÁVIO MACEDO MOTA

2015-01-01

Full Text Available This study aimed at evaluating the performance of Nelore cattle during growth classified for different classes of frame size regarding body weights and morphometric measures at different ages. Weights and morphometric measures Nelore bulls up to 1 year of age were monthly recorded. The characteristics evalu-ated were birth weight, 120, 205, 240 and 365 days of age, withers height and rump height, thoracic perimeter, distance between pin bones, distance between hip bones and chest width, depth of chest, space under sternal and hip length. Frame size scores classified as medium, large and extreme, were estimated using equations and tables according to Beef Improvement Federation (BIF. Data were subjected to analysis of variance and Tukey-Kramer test at 5% probability and analyses were performed by canonical variables and the grouping analyses of genotype by method of Tocher. The animals with larger class of frame size were heavier and morphometric measurements as well, when compared with animals classified for smaller class. The correlation between weight at different ages were higher. The weight correlates with body features positively, indicating that the weight gain of the animals increased their influence on the frame size. Cluster analysis resulted in three distinct genetic groups that have similar within the group and genetic divergence between them.

Genetic parameters for type classification of Nelore cattle on central performance tests at pasture in Brazil.

Science.gov (United States)

Lima, Paulo Ricardo Martins; Paiva, Samuel Rezende; Cobuci, Jaime Araujo; Braccini Neto, José; Machado, Carlos Henrique Cavallari; McManus, Concepta

2013-10-01

The objective of this study was to characterize Nelore cattle on central performance tests in pasture, ranked by the visual classification method EPMURAS (structure, precocity, muscle, navel, breed, posture, and sexual characteristics), and to estimate genetic and phenotypic correlations between these parameters, including visual as well as production traits (initial and final weight on test, weight gain, and weight corrected for 550 days). The information used in the study was obtained on 21,032 Nelore bulls which were participants in the central performance test at pasture of the Brazilian Association for Zebu Breeders (ABCZ). Heritabilities obtained were from 0.19 to 0.50. Phenotypic correlations were positive from 0.70 to 0.97 between the weight traits, from 0.65 to 0.74 between visual characteristics, and from 0.29 to 0.47 between visual characteristics and weight traits. The genetic correlations were positive ranging from 0.80 to 0.98 between the characteristics of structure, precocity and musculature, from 0.13 to 0.64 between the growth characteristics, and from 0.41 to 0.97 between visual scores and weight gains. Heritability and genetic correlations indicate that the use of visual scores, along with the selection for growth characteristics, can bring positive results in selection of beef cattle for rearing on pasture.

Chelated mineral supplements for Nelore: quality and early embryonic development

Directory of Open Access Journals (Sweden)

Camila Pasa

2014-01-01

Full Text Available ABSTRACT. Pasa C., Hatamoto-Zervoudakis L.K., Zervoudakis J.T. & Soares L. [Chelated mineral supplements for Nelore: quality and early embryonic development.] Suplementos minerais quelatados para vacas Nelore: qualidade e desenvolvimento embrionário inicial. Revista Brasileira de Medicina Veterinária, 36(1:29-34, 2014. Programa de Pós-Graduação em Ciência Animal, Faculdade de Agronomia e Medicina Veterinária, Universidade Federal do Mato Grosso, Av. Fernando Corrêa da Costa, 2367, Bairro Boa Esperança, Cuiabá, MT 78060-900, Brasil. E-mail: pasa_camila@hotmail.com The objective of this study was to evaluate the quality and early development of embryos produced with oocytes of cows supplemented with copper, zinc and selenium in a non-chelated and chelated. The experiment was conducted in Cuiabá-MT during the months April to July 2009. We used 24 adult Nellore multiparous, aged, average weights of the initial 36 months, 395 kg and mean body condition score 4.8, respectively randomly divided into 2 groups: control group (CG, supplemented with conventional mineral and Supplemented Group (GS, animals supplemented with zinc, copper and selenium chelated. Each group was kept in a paddock of Brachiaria brizantha cv Marandu received 1 kg of animal per day. chelated mineral supplementation (GS and conventional mineral (GC delivered via the protein supplement was given during a period of 99 days with daily average 1kg/cabeça. During the experimental period were two follicular aspirations, one to 59 days and another at 99 days of supplementation. Every two weeks the animals were weighed and ECC evaluated. oocytes viable (grades I, II and III were used for in vitro production of embryos. The experiment was completely randomized and data were analyzed by ANOVA and a significance level of 10%. There was no effect (p> 0.10 of supplementation with chelated minerals on the percentage of cleaved oocytes, total embryos produced, percentage of produced

Energy partition for maintenance and weight gain in Nellore and crossbred steers finished under grazing Partição de energia para mantença e ganho em novilhos nelores e mestiços terminados a pasto

Directory of Open Access Journals (Sweden)

N.F. Sant´Ana

2011-04-01

Full Text Available The objective of this work was to estimate net energy (NEm and metabolizable energy (MEm requirements for maintenance and efficiency of use of metabolizable energy for maintanence (k m and gain (k g of grazing Nellore and crossbred steers. It was used 24 castrated steers, 12 Nellore breed (386 kg SBW and 12 ½ Limousin-Nelore crossbred (397 kg SBW. The comparative slaughter method was used. In each genetic group, animals were grouped in three similar groups: reference; restrict feeding and ad libitum feeding. The reference group was slaughtered in the beginning of the experiment whereas the others were slaughtered at the end of it. During the 104 days of the experimental period, the group under restrict feeding had access to pastures for 3.5 hours daily whereas the group with ad libitum feeding remained on pasture full time. Forage intake was estimated in two trials by using the double-indicator method. Values of NEm, MEm, k m and k g were estimated on the basis of empty body weight (EBW through linear and non-linear model fitting. Requirements of NEm and MEm did not differ among Nellore and crossbred animals. In the linear model, the following results were obtained: Requirements of NEm = 86 kcal/kg0.75; requirements of MEm = 136 kcal/kg0.75 and k m = 0.63. Kg value was higher for Nellore animals (0.39 than for crossbred animals (k g = 0.33. Requirement of net energy of maintenance does not differ among grazing Nellores and ½ European-Nellore crossbred. For the same body weight, Nellore animals present greater fat proportion in gain composition than ½European-Nelore crossbred.Este trabalho foi conduzido com o objetivo de estimar as exigências de energia líquida (ELm e metabolizável (EMm para mantença e as eficiências de utilização da energia metabolizável para mantença (k m e ganho (k g de novilhos nelores e mestiços a pasto. Foram utilizados 24 novilhos castrados, sendo 12 da raça Nelore (386 kg PCJ e 12 mestiços ½ Limousin-Nelore

Urinary excretion of purine derivatives as an index of microbial protein supply in cross-bred (Bos indicus x Bos taurus) cattle in tropical environment

International Nuclear Information System (INIS)

Ojeda, A.; Parra, O.

1999-01-01

Four experiments were carried out to establish a response model between urinary excretion of purine derivatives (PD) and microbial production in Bos indicus x Bos taurus cross-bred cattle: LZ, MZ and HZ (3/8, 1/2 and 5/8 Bos indicus, respectively). The fasting PD excretion was considered as endogenous excretion and amounted to 268 (± 85.1), 294 (± 128.1) and 269 (± 68.4) μmol/kg W 0.75 for LZ, MZ and HZ, respectively. Urinary recovery of absorbed purine bases (PB) was calculated as the urinary recovery of a single dose of intrajugular infused uric acid (1,3- 15 N). In HZ crossbred cattle 83% (± 20.3) of infused uric acid was recovered in the urinary PD. The relationship between duodenal purine absorption (X, mmol/d) and urinary PD excretion (Y, mmol/d) was defined in HZ crossbred cattle as Y = 0.83 X + 0.269W 0.75 (± 85.1), assuming that the endogenous contribution was constant and independent of the exogenous PB supply. The activity of xanthine oxidase (EC 1.2.3.2.) was determined in HZ and MZ and was found to be higher in the liver (0.62 and 0.66 units/g, respectively) than in intestinal mucosa (0.09 and 0.03 units/g, respectively), whereas xanthine oxidase activity was practically absent in plasma of both cross breeds. The ratio PB:total N was determined in microbial extracts taken from rumen fluid of cows fed Bermuda grass (Cynodon dactylon) as the sole diet or supplemented (ratio of 80:20, grass: supplement) with gluten feed, soybean hulls or Gliricidia species and were found to range from 1.52-1.62 μmol PB/mg N. (author)

Análise genética da habilidade de permanência em fêmeas da raça Nelore Genetic analysis of stayability among Nelore females

Directory of Open Access Journals (Sweden)

Josineudson Augusto II de Vasconcelos Silva

2003-06-01

Full Text Available O objetivo deste estudo foi verificar a possibilidade da característica habilidade de permanência (HP de matrizes ser utilizada como critério de seleção na raça Nelore. A HP foi definida como a probabilidade de uma vaca parir, no rebanho, na idade de seis anos ou depois desta idade, dado que ela teve uma parição em data anterior. Foram analisadas informações de 55.682 animais. Utilizou-se a amostragem de Gibbs para estimar os componentes de variância e um modelo de limiar de máximo a posteriori para predizer os valores genéticos. A análise forneceu estimativa posterior de herdabilidade e desvio-padrão de 0,21 ± 0,00 e tendência genética, média por ano, de 0,14% para HP. A facilidade de mensuração da característica, a estimativa de herdabilidade e a tendência indicam que a utilização desta característica como critério de seleção pode contribuir para o aumento da fertilidade do rebanho.The purpose of this study was to analyse of the stayability trait (STAY of Nelore cows. Stayability was defined as the probability of calving at a specific age, or after that age, given that the cow calved at least one time prior to that age. The study focused specifically on six year old groups, and the information corresponding to 55,682 animals were analysed. The data were analysed based on an a posteriori maximum threshold model to predict the genetic values, while the Gibbs sample was used to estimate the variance components. The analyses provided heritability estimate and standard deviation of 0.21 ± 0.003 and average genetic tendency a year was of 0.14% for STAY. The estimates indicate that the use of this trait as a criterion for selection may contribute toward increased female fertility.

Fixed-time artificial insemination with estradiol and progesterone for Bos indicus cows II: strategies and factors affecting fertility.

Science.gov (United States)

Sá Filho, O G; Meneghetti, M; Peres, R F G; Lamb, G C; Vasconcelos, J L M

2009-07-15

In Experiments 1, 2, and 3, we evaluated the effects of temporary weaning (TW), equine chorionic gonadotropin (eCG), and follicle-stimulating hormone (FSH) treatments on results of a fixed-time artificial insemination (TAI) protocol in postpartum Bos indicus cows. In Experiment 1, treatment with 400 IU eCG or with TW for 48 h consistently improved pregnancy rates (PRs) at TAI, but, in Experiment 2, FSH treatment was less effective than eCG or TW. In Experiment 3, the inclusion of eCG treatment in cows subjected to TW did not improve PRs. We concluded that TW or 400 IU eCG should be included in the TAI protocol in postpartum Bos indicus cows to enhance fertility. In Experiment 4, we used records from heifers and cows treated with the proposed protocol during the 2006-2007 (n=27,195) and 2007-2008 (n=36,838) breeding seasons from multiple locations in Brazil to evaluate factors potentially affecting PRs. Overall PR at TAI was 49.6% (31,786 of 64,033). Pregnancy rate differed (Pcow group within farm, by breed (Bos indicus, 48.3% [26,123 of 54,145]; Bos taurus, 61.7% [3652 of 5922]; and crossbred Bos indicus x Bos taurus, 50.7% [2011 of 3966]), category (nulliparous, 39.6% [2095 of 5290]; suckled primiparous, 45.2% [3924 of 8677]; suckled multiparous, 51.8% [24,245 of 46,767]; and nonsuckled multiparous, 46.1% [1522 of 3299]), body condition score at TAI ( or =3.5, 52.7% [9419 of 17,881]). Days postpartum at beginning of protocol did not affect PR (30 to 60 d, 47.6% [4228 of 8881]; 61 to 90 d, 51.7% [16,325 to 31,572]; and 91 to 150 d, 50.8% [7616 to 14,991]; P>0.1). Pregnancy rate was also consistently affected (P<0.01) by sire (results ranging from 7.2% to 77.3%) and artificial insemination technician (results ranging from 15.1% to 81.8%).

Implementasi Kebijakan Pembiayaan Pendidikan pada Era Otonomi Daerah (Studi Kasus Implementasi Dana BOS dan BKM Pada Sekolah yang Terpilih di Kabupaten Kebumen

Directory of Open Access Journals (Sweden)

Panuntun Nur Karomah

2017-08-01

Full Text Available Tujuan Penelitian ini untuk mengetahui implementasi kebijakan pembiayaan pendidikan pada era otonomi daerah studi di Kabupaten Kebumen dilihat dari aspek pelaksanaan, sumber-sumber dan alokasi anggaran pendidikan. Teknik pengumpulan data yaitu observasi, wawancara, dan dokumentasi. Uji keabsahan data adalah triangulasi. Hasil penelitian ini adalah pelaksanaan BOS diimplementasikan berdasarkan RAKS dan RAPBS, dan BKM berdasarkan penjaringan dari pihak sekolah. Dana BOS bersumber dari APBN (pemerintah pusat, BKM bersumber dari APBD Kabupaten (pemerintah daerah dan sumbangan sukarela bersumber dari masyarakat. Alokasi dana BOS setiap sekolah berbeda-beda, yang mempengaruhi hal itu adalah perbedaan jenjang sekolah, banyaknya jumlah siswa yang ada di sekolah, perbedaan letak sekolah. Hal ini, karena setiap sekolah mempunyai perbedaan kebutuhan operasional sekolah dan kegiatan-kegiatan yang dilakukan sekolah. Sumbangan sukarela untuk memenuhi kekurangan biaya yang diperlukan sekolah. Alokasi dana BKM tepat sasaran, namun waktu alokasi pencairannya kurang efektif .  This research aims to determine the education funding policy implementation at the regional autonomy in Kebumen, seen from the aspect implementation, resources and the education budget allocation for education. Data collection techniques are observation, interviews, and documentation. Test the validity of the data is triangulation. The results of this study are the implementation of BOS based RAKS and RAPBS, and BKM based networking from the school. BOS funds from the state budget (central government, BKM sourced from district budget (local government and voluntary contributions provided by the community. BOS funding is in each school different, the casue of difference in levels of schooling, the amount of students in the school, the school location. This is because each school has different operational needs and the activities. Voluntary donations for meet defiency from BOS. Allocation of

Seroprevalence of antibodies to Neospora caninum in Bos javanicus ('Bali cattle') from Indonesia.

Science.gov (United States)

Damriyasa, I Made; Schares, Gereon; Bauer, Christian

2010-01-01

A cross-sectional survey was performed to obtain first information on the presence of Neospora caninum infection in Bos javanicus ('Bali cattle'), the predominant beef cattle in the Eastern Islands of Indonesia. Serum samples were collected from 438 Bali cattle of two age classes (2 years) and both genders at three slaughterhouses in the Bali island, and examined for N. caninum-specific antibodies using native NcSRS2 (p38 antigen) as an ELISA antigen. The estimated overall seroprevalence of antibodies was 5.5% (95% CI: 3.5-8.0%). The seroprevalence was not significantly associated with age class or gender of the animals. The results give first serological evidence for the presence of natural N. caninum infection in Bos javanicus and indicate its occurrence in Indonesia.

Carcass characteristics and meat evaluation of Nelore cattle subjected to different antioxidant treatments

Directory of Open Access Journals (Sweden)

Thiago de Jesus do Carmo

Full Text Available ABSTRACT Forty Nelore cattle were used to evaluate the effects of supplementation with different antioxidants on carcass characteristics and meat quality of feedlot cattle. Animals were fed Brachiaria brizantha hay and subjected to five treatments (control and four antioxidants: zinc, selenium, vitamin E, and selenium + vitamin E. After a 105-day feeding period, cattle were slaughtered. Tissue composition, as well as carcass proximate composition, color, tenderness, pH, and fatty acid profile were evaluated. Analysis of variance was carried out and means compared by Tukey test at 0.05 probability. The group fed selenium showed the lowest muscle amount (66.61 g/100 g compared with the other antioxidants evaluated. There was no difference among treatments for bone, fat, and comestible portion percentages as well as muscle:bone, muscle:fat, and comestible portion:bone ratios, with mean values of 16.85 g/100 g, 14.70 g/100 g, 82.99 g/100 g, 4.06, 4.85, and 4.95, respectively. Neither brightness, red, or yellow contents of the meat nor carcass pH were affected by treatments. For tenderness and losses during thawing and cooking, there were no differences among treatments, with averages of 6.43 kgf cm2, 3.22 g/100 g, and 21.15 g/100 g, respectively. Supplementation of Nelore cattle fed Brachiaria brizantha hay with antioxidants do not influence carcass characteristics or meat quality. However, vitamin E supplementation reduces the levels of omega 3 fatty acid, whereas supplementation with selenium + vitamin E promotes an increase in linoleic and palmitoleic acids and a decrease in myristoleic acid, making the supplementation feasible due to the beneficial effects provided by these acids.

The BOS-X approach: achieving drastic cost reduction in CPV through holistic power plant level innovation

Science.gov (United States)

Plesniak, A.; Garboushian, V.

2012-10-01

In 2011, the Amonix Advanced Technology Group was awarded DOE SunShot funding in the amount of 4.5M to design a new Balance of System (BOS) architecture utilizing Amonix MegaModules™ focused on reaching the SunShot goal of 0.06-$0.08/kWhr LCOE. The project proposal presented a comprehensive re-evaluation of the cost components of a utility scale CPV plant and identified critical areas of focus where innovation is needed to achieve cost reduction. As the world's premier manufacturer and most experienced installer of CPV power plants, Amonix is uniquely qualified to lead a rethinking of BOS architecture for CPV. The presentation will focus on the structure of the BOS-X approach, which looks for the next wave of cost reduction in CPV through evaluation of non-module subsystems and the interaction between subsystems during the lifecycle of a solar power plant. Innovation around nonmodule components is minimal to date because CPV companies are just now getting enough practice through completion of large projects to create ideas and tests on how to improve baseline designs and processes. As CPV companies increase their installed capacity, they can utilize an approach similar to the methodology of BOS-X to increase the competitiveness of their product. Through partnership with DOE, this holistic approach is expected to define a path for CPV well aligned with the goals of the SunShot Initiative.

Genetic variation in the β-lactoglobulin of Chinese yak ( Bos ...

Indian Academy of Sciences (India)

Yak (Bos grunniens) is distributed in the area of Central. Asian highlands, it thrives in conditions of extreme harsh- ness with severely cold winters, short growing seasons for herbage and no absolutely frost-free periods (Wiener et al. 2003). The total population of yak is estimated to be 14 mil- lion, about 90% of the domestic ...

Effect of body condition score and reuse of progesterone-releasing intravaginal devices on conception rate following timed artificial insemination in Nelore cows.

Science.gov (United States)

Pereira, L L; Ferreira, A P; Vale, W G; Serique, L R; Neves, Kal; Morini, A C; Monteiro, B M; Minervino, Ahh

2018-06-01

This study had the aim of investigating the efficiency of timed artificial insemination (TAI) through the progesterone-releasing intravaginal device (PRID), used in new condition and for the second and third times in Nelore cows. The effects of device reuse and body condition score (BCS) on the conception rate (CR) were evaluated in 1,122 multiparous Nelore cows (mean BCS of 2.7 ± 0.4), which were randomly distributed into three groups that received new (n = 330), once (n = 439) and twice used (n = 353) PRID. Among the 1,122 females that underwent TAI, 573 became pregnant, thus representing an overall CR of 51.06%. Cows with BCS between 2.75 and 4.0 had greater (p conditions, animals with BCS greater than 2.5 had a higher CR, and the CR decreased proportionally with the number of times that the PRID had been used. © 2018 Blackwell Verlag GmbH.

Distribución de la garrapata Amblyomma cajennense (Acari: Ixodidae sobre Bos taurus y Bos indicus en Costa Rica

Directory of Open Access Journals (Sweden)

Víctor Alvarez C.

2000-03-01

Full Text Available Se informa sobre la casuística de A. cajennense encontrada sobre B. taurus y B. indicus en Costa Rica en 532 fincas muestreadas a nivel nacional en los diferentes sistemas de producción (leche, carne y doble propósito. Existe desigual distribución Amblyomma spp. (incluidas A. cajennense, A. maculatum, A. inornatum y A. oblongoguttatum en las diferentes regiones administrativas y en las zonas ecológicas. La presencia de Amblyomma spp. fue 12 veces (X², PResistance to acaricides in the cattle tick population was surveyed in 532 farms throughout Costa Rica. Samples were collected from bovines (Bos taurus and Bos indicus, in three production systems: dairy, meat and double-purpose. There is an uneven distribution of Amblyomma spp. (including A. cajennense, A. maculatum and A. oblongoguttatum in the administrative regions in which the country is divided, as well as in ecological zones. Administratively, Amblyomma spp., was 12 times more frecuent (X², p<0.001 in the Central Pacific and Chorotega regions (Pacific coast, than elsewhere. Ecologically, ticks of this genus were more common in the Tropical Humid Forest (33 % and the Very Humid Montain Forest (18 %. There was at least one sample of Amblyomma in 41% of counties. The most frecuent Amblyomma was A. cajennense. The wide distribution of Amblyomma spp. in very warm places with a marked six months rainy season suggests a potential danger of the substitution capacity of Amblyomma spp., which can also affect public health. The paper also reviews Amblyomma literature in detail.

Genotype x environment interactions for fatty acid profiles in Bos indicus and Bos taurus finished on pasture or grain.

Science.gov (United States)

Bressan, M C; Rossato, L V; Rodrigues, E C; Alves, S P; Bessa, R J B; Ramos, E M; Gama, L T

2011-01-01

A study was conducted to characterize lipid profiles in the M. longissimus thoracis of commercial Brazilian beef and to assess how those profiles are influenced by finishing system, genetic group, and their interaction. Intramuscular fat (IMF) and fatty acid (FA) profiles were determined in 160 bulls of the Bos taurus (n = 75) and Bos indicus (n = 85) genetic groups, finished on pasture (n = 46) or with grain supplementation (n = 114) and slaughtered in a commercial abattoir. Finishing system had a major impact on the deposition of IMF, as well as on the concentration of SFA, PUFA, and their ratio, but genetic groups showed important differences in the ability to convert SFA into cis-9 MUFA and to convert 16:0 into 18:0. When compared with pasture-finished animals, those finished with grain had greater content of IMF and SFA (P 0.05), and about one-half the amount of PUFA (P 0.05). With pasture-finishing, no differences were observed among the 2 genetic groups in SFA and MUFA (P > 0.05), but PUFA were decreased in B. taurus (P genetic groups were compared in grain-finishing, B. taurus had a decreased ability for elongation and B. indicus had a decreased aptitude for desaturation of FA. On the other hand, with pasture-finishing a greater deposition of intermediate FA from ruminal biohydrogenation was observed in B. indicus than in B. taurus. Overall, FA profiles were affected more by finishing system in B. indicus than in B. taurus.

Development of Uncertainty Quantification Method for MIR-PIV Measurement using BOS Technique

International Nuclear Information System (INIS)

Seong, Jee Hyun; Song, Min Seop; Kim, Eung Soo

2014-01-01

Matching Index of Refraction (MIR) is frequently used for obtaining high quality PIV measurement data. ven small distortion by unmatched refraction index of test section can result in uncertainty problems. In this context, it is desirable to construct new concept for checking errors of MIR and following uncertainty of PIV measurement. This paper proposes a couple of experimental concept and relative results. This study developed an MIR uncertainty quantification method for PIV measurement using SBOS technique. From the reference data of the BOS, the reliable SBOS experiment procedure was constructed. Then with the combination of SBOS technique with MIR-PIV technique, velocity vector and refraction displacement vector field was measured simultaneously. MIR errors are calculated through mathematical equation, in which PIV and SBOS data are put. These errors are also verified by another BOS experiment. Finally, with the applying of calculated MIR-PIV uncertainty, correct velocity vector field can be obtained regardless of MIR errors

Differences in Beef Quality between Angus (Bos taurus taurus) and Nellore (Bos taurus indicus) Cattle through a Proteomic and Phosphoproteomic Approach.

Science.gov (United States)

Rodrigues, Rafael Torres de Souza; Chizzotti, Mario Luiz; Vital, Camilo Elber; Baracat-Pereira, Maria Cristina; Barros, Edvaldo; Busato, Karina Costa; Gomes, Rafael Aparecido; Ladeira, Márcio Machado; Martins, Taiane da Silva

2017-01-01

Proteins are the major constituents of muscle and are key molecules regulating the metabolic changes during conversion of muscle to meat. Brazil is one of the largest exporters of beef and most Brazilian cattle are composed by zebu (Nellore) genotype. Bos indicus beef is generally leaner and tougher than Bos taurus such as Angus. The aim of this study was to compare the muscle proteomic and phosphoproteomic profile of Angus and Nellore. Seven animals of each breed previously subjected the same growth management were confined for 84 days. Proteins were extracted from Longissimus lumborum samples collected immediately after slaughter and separated by two-dimensional electrophoresis. Pro-Q Diamond stain was used in phosphoproteomics. Proteins identification was performed using matrix assisted laser desorption/ionization time-of-flight mass spectrometry. Tropomyosin alpha-1 chain, troponin-T, myosin light chain-1 fragment, cytoplasmic malate dehydrogenase, alpha-enolase and 78 kDa glucose-regulated protein were more abundant in Nellore, while myosin light chain 3, prohibitin, mitochondrial stress-70 protein and heat shock 70 kDa protein 6 were more abundant in Angus (PAngus had greater phosphorylation of phosphoglucomutase-1 and troponin-T (PAngus and Nellore. Furthermore, prohibitin appears to be a potential biomarker of intramuscular fat in cattle. Additionally, differences in phosphorylation of myofilaments and glycolytic enzymes could be involved with differences in muscle contraction force, susceptibility to calpain, apoptosis and postmortem glycolysis, which might also be related to differences in beef quality among Angus and Nellore.

Consumo e digestibilidade de novilhos Nelore sob pastagem suplementados com misturas múltiplas Intake and digestibility of Nelore steers grazing pasture and supplemented with multiple mixture

Directory of Open Access Journals (Sweden)

L.O.F. Oliveira

2004-02-01

Full Text Available Estudou-se o efeito da suplementação com misturas múltiplas sobre o consumo, digestibilidade e desempenho de novilhos Nelore, em pastagens de Brachiaria brizantha Cv. Marandu, submetidos a quatro tratamentos. No tratamento um (T1, cada animal recebeu 800g/dia de suplemento contendo uréia como fonte de nitrogênio não protéico (NNP; no tratamento dois (T2, recebeu 800g/dia de mistura na qual a uréia foi substituída por amiréia como fonte de NNP; no tratamento três (T3, recebeu 1500g/dia de uma mistura com amiréia; e no tratamento quatro (T4= controle, recebeu sal mineral. Seis animais por tratamento foram utilizados para se medir o consumo pela técnica de indicador externo (óxido crômico, e 10 animais foram usados na avaliação de ganho de peso. Foram utilizados dois animais canulados no esôfago para coleta de amostra de extrusa. Os animais suplementados obtiveram ganhos de peso superiores (PThe effect of three multiple mixtures supplementation on intake, digestibility and performance of Nelore steers grazing pasture of Brachiaria decumbens CV Marandu was studied. The multiple mixtures (treatments - T were defined as: T1 - 800g of supplement with urea as crude protein source, T2 - 800g of mixture in which urea was replaced by starea, T3 - 1500g of starea, and T4 - mineral salt fed ad libitum as a control group. Six animals per treatment were given chromic oxide as a marker to measure intake and 10 animals per treatment were used to evaluate their performance. Two esophageal fistulated steers were used to collect samples of extruse. The animals fed on supplement diets showed higher weight gains (335, 419, 467g/animal than those from the control group (271g/animal. Dry matter digestibility were 56.7, 49.8, 48.9 and 45.5%, respectively, for T1, T2, T3 and T4. A positive correlation between dry matter digestibility and in vitro dry matter digestibility (P<0.05 was observed. Supplementation with multiple mixtures increased dry matter

Histology of a Woolly Mammoth (Mammuthus primigenius) Preserved in Permafrost, Yamal Peninsula, Northwest Siberia.

Science.gov (United States)

Papageorgopoulou, Christina; Link, Karl; Rühli, Frank J

2015-06-01

In 2007, the baby woolly mammoth (Mammuthus primigenius) named Lyuba was found frozen in the Siberian tundra permafrost along the Yuribey River. She was proclaimed the best-preserved mammoth discovery. As part of the endoscopic examination of Lyuba, tissue samples of hair, muscle, and internal organs were taken. The sectioned biopsies were stained using standard and special histological stains. In general, the microscopic preservation of the tissue was good although no clearly identifiable cell nuclei were found by standard staining methods. Only a few cell nuclei could be identified in some samples when fluorescence stained with DAPI. The best-preserved structures were collagen fibers and muscle tissue, which gave some structural resemblance to the organs. In the hairs, evidence of pigmentation, a scaly surface, diagonal intra-hair structures, and a medulla were seen. Fat droplets could be identified with Sudan Red in the subcutaneous fat sample and in several organs. Bacteria were seen on the lumen side of the small intestine and caecum, and in the liver and lung tissue. In addition, fungi and pollen were seen in the lung sample. In the wall of the caecum and small intestine, blood vessels and nerves were visualized. Iron was identified in the vivianite sample. Some biopsies compared well structurally with the African elephant tissue sections. The histological findings support the theory that Lyuba drowned in muddy water. The microscopic tissue preservation and cell nuclei destruction indicate that Lyuba's body underwent at least one freeze-thaw cycle. © 2015 Wiley Periodicals, Inc.

The involvement of dopaminergic system on LH secretion Nelore heifers Sistema dopaminérgico na secreção de LH de novilhas Nelore

Directory of Open Access Journals (Sweden)

Silvia Helena Venturoli Perri

2009-12-01

Full Text Available The aim of this study was to evaluate the response of sulpiride administration (dopamine D2 antagonist, 0.59 m/kg body weight, s.c. and blood collected every 15 min for 10 h thereafter on Luteinizing Hormone (LH secretion in B. indicus pre-pubertal heifers at 8, 12 and 16 month of age. LH was quantified by RIA, sensitivity (0.039 ng/ml and CV (15.51%. In heifers given sulpiride treatment didn’t differ (P≥0.05 in LH concentration, total secretion area, peak total area, number of peaks, area of highest secretion peak and time to highest peak occurrence and maximum LH secretion, from control group. The results suggest absence of dopamine D2 antagonist effect on LH secretion in pre-pubertal Nellore heifers, didn’t neurotransmitter participating on sexual maturation.O presente trabalho foi realizado com o objetivo de investigar a variação na secreção do Hormônio Luteinizante (LH em resposta ao tratamento com sulpiride, antagonista de receptor (D2 dopaminérgico, com administração de 0,59mg/kg, s.c. e colheita de amostras de sangue a cada 15min, por 10h. Foram utilizadas 10 novilhas da raça Nelore pré-púberes, aos 8, 12 e 16 meses de idade. A concentração de LH foi quantificada por radioimunoensaio, e o coeficiente de variação intra, o interensaio e a sensibilidade dos ensaios de LH foram respectivamente de: 11,86%; 15,51%; 0,039ng/mL. O tratamento com sulpiride não diferiu na concentração média de LH, área total de secreção de LH e picos, número de picos, área do maior pico, tempo necessário ao aparecimento do maior pico de secreção de LH e amplitude máxima de LH, em comparação ao grupo controle. Os resultados indicam ausência de efeito da dopamina, através de receptores D2, durante a fase pré-púbere, em novilhas da raça Nelore, o que sinaliza a não participação como neurotransmissora na secreção de LH durante o processo de maturação sexual.

Clotting of cow (Bos taurus) and goat milk ( Capra hircus ) using ...

African Journals Online (AJOL)

The ease to locally produce kid rennet contrary to that of calve has led us to compare the proteolytic and clotting activities of these two rennets depending on their action on goat (Capra hircus) milk and cow (Bos taurus) milk. The proteolysis was measured by determining the increase of non-protein nitrogen according to the ...

Causas de variação nos preços de bovinos nelore elite no Brasil Causes of variation in the prices of nelore elite cattle in Brazil

Directory of Open Access Journals (Sweden)

João Cláudio do Carmo Paneto

2009-02-01

Full Text Available Este trabalho teve por objetivo estudar as causas de variação nos preços de bovinos da raça nelore pertencentes a rebanhos de seleção, os quais foram comercializados em leilões, para verificar as influências das avaliações genéticas e dos julgamentos de exterior sobre esses preços. Para tanto, foram computados os preços de venda de 426 bovinos da referida raça em 12 leilões ocorridos em diversas localidades brasileiras (regiões Centro-Oeste, Norte e Sudeste, entre os anos de 2002 e 2005. O valor médio foi de R$ 3.325,49, sendo o mínimo de R$ 1.400,00 e o máximo de R$ 10.500,00. Esses dados foram digitados juntamente com outras informações que eram apresentadas nos catálogos dos leilões. As informações registradas incluíram o sexo de cada animal, o nome do leilão e as DEPs informadas nos catálogos. Além da avaliação da influência das informações dos catálogos, também foi avaliada a influência das informações dos reprodutores, pais dos animais vendidos nos leilões, envolvendo suas DEPs publicadas em um sumário de reprodutores da raça e as pontuações de suas progênies em julgamentos. Os métodos estatísticos aplicados foram análises de variâncias e análises de agrupamento (método K-médias. Como resultado, foi observado que animais com superioridade genética em características relacionadas a desempenho ponderal, considerando-se os efeitos diretos e maternos, foram valorizados ao serem comercializados nos leilões. Em contra-partida, a pontuação dos reprodutores nos julgamentos não teve influência significativa sobre os preços médios de venda de suas progênies nos leilões.This study aimed to understand the causes of variation in the marketing prices of elite flock nelore cattle commercialized by auction, especially to verify the influences of EPDs and visual assessment. The selling prices of 426 animals from the nelore breed commercialized during 12 auctions held in various Brazilian

Características de carcaça de bovinos Nelore e Caracu selecionados para peso aos 378 dias de idade recebendo alimentação restrita ou à vontade

Directory of Open Access Journals (Sweden)

Gesualdi Júnior Antonio

2006-01-01

Full Text Available Avaliaram-se as características de carcaça de bovinos machos não-castrados de três grupos genéticos submetidos a dois planos de alimentação, em confinamento. Utilizaram-se 56 bovinos com idade média de 18 meses. Doze animais foram abatidos no início do experimento e os demais (16 Nelore selecionados, 12 Nelore não-selecionados e 16 Caracu selecionados, com peso vivo médio inicial de 404, 345 e 434 kg, respectivamente, distribuídos em delineamento inteiramente casualizado, em esquema fatorial 2 x 3, composto por dois níveis de alimentação (restrição alimentar: fornecimento de 65 g de MS/kgPV0,75 por dia e ad libitum: oferta do alimento duas vezes ao dia e três grupos genéticos. A dieta foi formulada com silagem de milho como volumoso e apresentou relação volumoso:concentrado 50:50. O abate foi realizado quando os animais atingiram 4 mm de gordura subcutânea, medida por ultra-som. Observou-se efeito da interação nível de alimentação x grupo genético somente sobre a porcentagem de tecido ósseo. O peso e a profundidade da carcaça e os pesos dos cortes dianteiro e traseiro não diferiram entre os grupos selecionados e foram superiores aos dos animais Nelore não-selecionados. O plano ad libitum proporcionou maior rendimento do traseiro. O rendimento de carcaça não sofreu influência da alimentação e, juntamente com a porcentagem do traseiro, foram maiores para os zebuínos. A espessura de gordura subcutânea real e a porcentagem de tecido adiposo foram maiores para os Nelore não-selecionados, enquanto a área de olho-de-lombo e a porcentagem de tecido muscular foram maiores nos bovinos Caracu.

Polycyclic aromatic hydrocarbon degradation by the white rot fungus Bjerkandera sp. strain BOS55

NARCIS (Netherlands)

Kotterman, M.

1998-01-01

Outline of this thesis
In this thesis the conditions for optimal PAH oxidation by the white rot fungus Bjerkandera sp. strain BOS55 were evaluated. In Chapter 2, culture conditions like aeration and cosubstrate concentrations,

Bill E. Kunkle Interdisciplinary Beef Symposium: Temperament and acclimation to human handling influence growth, health, and reproductive responses in Bos taurus and Bos indicus cattle.

Science.gov (United States)

Cooke, R F

2014-12-01

Temperament in cattle is defined as the fear-related behavioral responses when exposed to human handling. Our group evaluates cattle temperament using 1) chute score on a 1 to 5 scale that increases according to excitable behavior during restraint in a squeeze chute, 2) exit velocity (speed of an animal exiting the squeeze chute), 3) exit score (dividing cattle according to exit velocity into quintiles using a 1 to 5 scale where 1=cattle in the slowest quintile and 5=cattle in the fastest quintile), and 4) temperament score (average of chute and exit scores). Subsequently, cattle are assigned a temperament type of adequate temperament (ADQ; temperament score≤3) or excitable temperament (EXC; temperament score>3). To assess the impacts of temperament on various beef production systems, our group associated these evaluation criteria with productive, reproductive, and health characteristics of Bos taurus and Bos indicus-influenced cattle. As expected, EXC cattle had greater plasma cortisol vs. ADQ cattle during handling, independent of breed type (B. indicus×B. taurus, Preproduction, EXC females had reduced annual pregnancy rates vs. ADQ cohorts across breed types (B. taurus, P=0.03; B. indicus, P=0.05). Moreover, B. taurus EXC cows also had decreased calving rate (P=0.04), weaning rate (P=0.09), and kilograms of calf weaned/cow exposed to breeding (P=0.08) vs. ADQ cohorts. In regards to feedlot cattle, B. indicus EXC steers had reduced ADG (P=0.02) and G:F (P=0.03) during a 109-d finishing period compared with ADQ cohorts. Bos taurus EXC cattle had reduced weaning BW (P=0.04), greater acute-phase protein response on feedlot entry (P≤0.05), impaired feedlot receiving ADG (P=0.05), and reduced carcass weight (P=0.07) vs. ADQ cohorts. Acclimating B. indicus×B. taurus or B. taurus heifers to human handling improved temperament (P≤0.02), reduced plasma cortisol (Preproductive, and health characteristics of beef cattle independent of breed type. Hence, strategies

Incorporation of aurochs into a cattle herd in Neolithic Europe: single event or breeding?

Science.gov (United States)

Schibler, Jörg; Elsner, Julia; Schlumbaum, Angela

2014-07-01

Domestication is an ongoing process continuously changing the lives of animals and humans and the environment. For the majority of European cattle (Bos taurus) genetic and archaeozoological evidence support initial domestication ca. 11'000 BP in the Near East from few founder aurochs (Bos primigenius) belonging to the mitochondrial DNA T macro-haplogroup. Gene flow between wild European aurochs of P haplogroup and domestic cattle of T haplogroup, coexisting over thousands of years, appears to have been sporadic. We report archaeozoological and ancient DNA evidence for the incorporation of wild stock into a domestic cattle herd from a Neolithic lake-dwelling in Switzerland. A complete metacarpus of a small and compact adult bovid is morphologically and genetically a female. With withers height of ca. 112 cm, it is comparable in size with small domestic cattle from contemporaneous sites in the area. The bone is directly dated to 3360-3090 cal BC and associated to the Horgen culture, a period of the secondary products revolution. The cow possessed a novel mtDNA P haplotype variant of the European aurochs. We argue this is either a single event or, based on osteological characteristics of the Horgen cattle, a rare instance of intentional breeding with female aurochs.

Performance of Angus, Devon and crossbred Angus x Devon x Nelore young steers in feedlot

OpenAIRE

Gottschall, Carlos Santos; Universidade Luterana do Brasil; Canellas, Leonardo Canali; Universidade Luterana do Brasil; Ferreira, Eduardo Tonet; Universidade Luterana do Brasil; Bittencourt, Hélio Radke; Pontifícia Universidade Católica

2007-01-01

Foram analisados dados de 129 novilhos das raças Angus (AN, n=45), Devon (DV, n=35) e cruzas Angus x Devon x Nelore (CR, n=49), com peso médio inicial (PMI) de 277,60, 278,00 e 295,53 kg, respectivamente, confinados aos 11 meses de idade para abate aos 14 meses. As variáveis-resposta mensuradas foram: tempo médio de permanência (TMP); ganho de peso médio diário (GMD); ganho de peso total (GP); peso médio ao abate (PMA); peso médio de carcaça (PC); rendimento médio de carcaça (RC) e classifica...

Desempenho até a desmama de bezerros Nelore e cruzas com Nelore

Directory of Open Access Journals (Sweden)

Cubas Antonio Carlos

2001-01-01

Full Text Available Foi analisado o desempenho ponderal pré-desmama de bezerros Nelore (N, Guzerá x N (GN, Red Angus x N (RN e Marchigiana x N (MN, oriundos de um experimento de cruzamentos realizado na Estação Experimental do IAPAR de Paranavaí, nascidos no período de 1985 a 1998, produzidos por meio de inseminação artificial, em duas estações anuais de nascimento (janeiro a abril e julho a dezembro. Foi utilizado o método dos quadrados mínimos para análise de 721 observações de pesos ao nascimento (PNT e 686 de pesos à desmama (PDS e ganho médio diário de peso do nascimento até a desmama (GMD_ND. Para PNT, o efeito de classe de datas julianas com intervalos de dez dias entre classes mostrou-se mais útil para explicar variações de épocas de nascimento do que o mês de nascimento, cuja influência foi muito grande para PDS e GMD_ND. Para as três características avaliadas, houve importante efeito (linear e quadrático da idade da vaca (dias mãe do bezerro, bem como dos efeitos fixos de raça do touro ou grupo genético, ano de nascimento do bezerro e sexo do bezerro. A interação grupo genético x sexo do bezerro foi efeito importante para PNT, PDS e GMD_ND. O efeito aleatório de touro dentro de grupo genético foi importante para PNT, PDS e GMD_ND. As médias dos quadrados mínimos e respectivos erros-padrão, sempre na seqüência N, GN, RN e MN, foram: 28,5 ± 0,38 kg, 29,0 ± 0,44 kg, 29,4 ± 0,46 kg e 31,3 ± 0,47 kg, para PNT; 141,3 ± 1,47 kg, 147,6 ± 1,61 kg, 167,5 ± 1,72 kg e 162,0 ± 1,89 kg, para PDS; 0,510 ± 0,007 kg, 0,540 ± 0,008 kg, 0,627 ± 0,008 kg e 0,583 ± 0,009 kg, para GMD_ND.

Concentração sérica de progesterona em bezerras da raça nelore e mestiças tratadas com progesterona em veículo de liberação lenta Serum progesterone concentration in Nelore and crossbreed heifers treated with long-acting progesterone

Directory of Open Access Journals (Sweden)

F.P.C. Lima

2007-06-01

Full Text Available Avaliaram-se a eliminação da progesterona em veículo de liberação lenta (P4LA em animais zebus e mestiços e sua potencial aplicabilidade em programas de sincronização de estro, utilizando-se 60 bezerras, 30 da raça Nelore e 30 mestiças (Gir x Holandês, entre 120 e 150 dias de idade e peso médio de 150kg. Em cada grupo experimental as bezerras foram divididas em três subgrupos (G de 10 animais, sendo GI = controle (tratado com 5ml de solução fisiológica por via intramuscular; GII = tratado com 450mg P4LA (3ml IM; e GIII = tratado com 750mg P4LA (5ml IM. Amostras de sangue foram coletadas no dia zero, 7 e 13 (D0, D7 e D13 e procedeu-se à análise hormonal por radioimunoensaio de fase sólida. A progesterona de ação prolongada (P4LA, administrada por via intramuscular, manteve-se por 13 dias na corrente sangüínea em concentrações superiores a 1ng/ml. As doses de 450mg e 750mg de P4LA não ocasionaram efeitos adversos sistêmicos clinicamente perceptíveis, e o metabolismo da P4LA foi mais lento nas bezerras Nelore, cuja concentração de progesterona foi maior na corrente sangüínea do que nas bezerras mestiças.The clearance of long-acting progesterone in microspheres (P4LA in zebu animals and its potential for use in estrus synchronization were evaluated using 30 Nelore and 30 crossbreed (Holstein x zebu heifers, with aging between 120 to 150-day-old and weighting 150kg in average. For each breed the animals were divided into three groups of ten animals each, GI= control group treated with saline; GII= treated with 450mg of P4LA; and GIII= treated with 750mg of long-acting progesterone (P4LA. Blood samples were colleted on days 0, 7 and 13 and analysed for progesterone using radioimmunoassay in solid phase. The serum concentration of progesterone was different on days 0, 7 and 13 in relation to the dose of P4LA given. All treated animals presented basal values for progesterone on day 0, increased on day 7 and decreased on

Granular Vulvovaginitis Syndrome in Nelore pubertal and post pubertal replacement heifers under tropical conditions: role of Mycoplasma spp., Ureaplasma diversum and BHV-1.

Science.gov (United States)

Gambarini, M L; Kunz, T L; Oliveira Filho, B D; Porto, R N G; Oliveira, C M G; Brito, W M E D; Viu, M A O

2009-10-01

In order to determine the role of Mycoplasma spp, Ureaplasma diversum and BHV-1 as causal agents of Granular Vulvovaginitis Syndrome in Nelore heifers raised under tropical conditions and based on the hypothesis that stressful conditions during puberty or breeding season would be a determinant factor for the infection, 340 heifers not vaccinated against BHV-1 were divided in Post-pubertal, in the beginning of the first breeding season, and Pubertal heifers. The vaginal lesion score (VLS) Grade 1 to 4 was giving according to lesion area and severity. Vaginal mucus was used to isolate Mycoplasma spp., Ureaplasma diversum and BHV-1. The predominant VLS was 2. No sample was positive for BHV-1; 48% were positive for Mycoplasma spp., Ureaplasma diversum, or both, with predominance of Ureaplasma diversum. Serum neutralization for BHV-1 showed more positive animals in pubertal group (23%); 3 of the paired sera demonstrated seroconversion. These data indicated that post-pubertal and pubertal Nelore heifers raised under extensive conditions are more susceptible to Mycoplasma spp. and Ureaplasma diversum. The hypothesis that the stress of pubertal period could lead to an acute vaginal infection by HBV-1 was not proofed.

CARACTERÍSTICAS DE QUALIDADE DO CONTRAFILÉ (m. L. dorsi DE TOUROS JOVENS DA RAÇA NELORE

Directory of Open Access Journals (Sweden)

Maria Lourdes S. ABULARACH

1998-05-01

Full Text Available Com o objetivo de analisar as características de qualidade da carne de touros jovens da raça Nelore e os possíveis efeitos da idade, entre os 690 e os 780 dias, nessas características, efetuou-se o abate de 113 bovinos, que haviam sido confinados por um período de 109 dias com ração à base de 20% de concentrado e 80% de volumoso. Todas as carcaças foram tipificadas pela Inspeção Federal na sala de matança do frigorífico e resfriadas por 24 h em câmara fria (Tinicial=5°C; Tfinal=2°C. Meias carcaças (lado direito, N=51, do tipo B - do Sistema B R A S I L - de animais de 23 a 26 meses foram desossadas. Dois bifes (2,5cm de espessura de contrafilé (m. L. dorsi de cada uma foram embalados à vácuo e maturados por 7 dias a 0-2°C. O pH variou entre 5,44 e 5,83 e apenas duas amostras tinham pH ³ 5,70. O valor L* (luminosidade médio foi de 34,85. As médias de umidade e gordura foram de 75,65% e 1,71%, respectivamente. A média de força de cisalhamento foi de 6,70kg e não foi influenciada pela idade do animal entre 690 e 734 dias, mas apresentou uma tendência (Teste t, p=0,22 de aumento entre 735 e 780 dias. Não se detectou influência da idade do animal nas demais características de qualidade analisadas (Teste t, p>0,20. Concluiu-se que o contrafilé de animais como esses pode ter problemas de aceitação na faixa mais exigente de mercado, e que carcaças tipificadas como B, presumivelmente o melhor tipo, não apresentam necessariamente as melhores características de qualidade da carne.Quality traits of boneless rib cut (L. dorsi muscle from Nelore young bulls. To study the meat quality traits of Nelore breed young bulls, and the effect of age (690-780 days on them, 113 animals were slaughtered after 109 days of intensive feeding with 20% concentrate and 80% roughage. All the carcasses were graded at the slaughter floor by the Federal Inspection and chilled for 24 hours (Tinitial=5°C, Tfinal=2°C. Fifty one half carcasses

Does ECG influence the conception rate Nelore cows presenting different body condition scores submitted to the same timed-AI protocol?

OpenAIRE

Erika Aline Ribeiro Dias; Rubens Paes de Arruda; Roni Aprecido Videschi; Hugo Borges Graff; Alessandra de Moraes Sousa; Fabio Morato Monteiro; Enilson Geraldo Ribeiro; Janaina Torres Carreira; Halim Atique Netto; Rogério Fonseca Guimarães Peres; Leticia Zoccolaro Oliveira

2013-01-01

The aim of this study was to evaluate the conception rate (CR) of multiparous Nelore cows presenting different body condition scores (BCS), which were submitted to the same Timed-AI protocol with equine chorionic gonadotrophin (eCG). A total of 1574 cows were inseminated, between 40 and 50 days postpartum. During insemination (timed-AI), all data regarding to bull (n=8), inseminator (n=3) and BCS (1 to 5) were recorded. The pregnancy diagnosis was performed, by ultrasonography, 40 days after ...

MUC1 gene polymorphism in three Nelore lines selected for growth and its association with growth and carcass traits.

Science.gov (United States)

de Souza, Fabio Ricardo Pablos; Maione, Sandra; Sartore, Stefano; Soglia, Dominga; Spalenza, Veronica; Cauvin, Elsa; Martelli, Lucia Regina; Mercadante, Maria Eugênia Zerlotti; Sacchi, Paola; de Albuquerque, Lucia Galvão; Rasero, Roberto

2012-02-01

The objective of this study was to describe the VNTR polymorphism of the mucin 1 gene (MUC1) in three Nelore lines selected for yearling weight to determine whether allele and genotype frequencies of this polymorphism were affected by selection for growth. In addition, the effects of the polymorphism on growth and carcass traits were evaluated. Birth, weaning and yearling weights, rump height, Longissimus muscle area, backfat thickness, and rump fat thickness, were analyzed. A total of 295 Nelore heifers from the Beef Cattle Research Center, Instituto de Zootecnia de Sertãozinho, were used, including 41 of the control line, 102 of the selection line and 152 of the traditional. The selection and traditional lines comprise animals selected for higher yearling weight, whereas control line animals are selected for yearling weight close to the average. Five alleles were identified, with allele 1 being the most frequent in the three lines, especially in the lines selected for higher means for yearling weight. Heterozygosity was significantly higher in the control line. Association analyses showed significant effects of allele 1 on birth weight and weaning weight while the allele 3 exert significant effects on yearling weight and back fat thickness. Despite these findings, application of this marker to marker-assisted selection requires more consistent results based on the genotyping of a larger number of animals in order to increase the accuracy of the statistical analyses.

When and how did Bos indicus introgress into Mongolian cattle?

Science.gov (United States)

Yue, Xiangpeng; Li, Ran; Liu, Li; Zhang, Yunsheng; Huang, Jieping; Chang, Zhenhua; Dang, Ruihua; Lan, Xianyong; Chen, Hong; Lei, Chuzhao

2014-03-10

The Mongolian cattle are one of the most widespread breeds with strictly Bos taurus morphological features in northern China. In our current study, we presented a diversity of mitochondrial DNA (mtDNA) D-loop region and Y chromosome SNP markers in 25 male and 8 female samples of Mongolian cattle from the Xinjiang Uygur autonomous region in Western China, and detected 21 B. taurus and four Bos indicus (zebu) mtDNA haplotypes. Among four B. indicus mtDNA haplotypes, two haplotypes belonged to I1 haplogroup and the remaining two haplotypes belonged to I2 haplogroup. In contrast, all 25 male Mongolian cattle samples revealed B. taurus Y chromosome haplotype and no B. indicus haplotypes were found. Historical and archeological records indicate that B. taurus was introduced to Xinjiang during the second millennium BC and B. indicus appeared in this region by the second century AD. The two types of cattle coexisted for many centuries in Xinjiang, as depicted in clay and wooden figurines unearthed in the Astana cemetery in Turfan (3rd-8th century AD). Multiple lines of evidence suggest that the earliest B. indicus introgression in the Mongolian cattle may have occurred during the 2nd-7th centuries AD through the Silk Road around the Xinjiang region. This conclusion differs from the previous hypothesis that zebu introgression to Mongolian cattle happened during the Mongol Empire era in the 13th century. Copyright © 2014 Elsevier B.V. All rights reserved.

Expressão relativa de fator semelhante a insulina (IGFI e receptor do homômonio folículo estimulante (FSHR em folículos e tecido ovariano de Bos primigenius (Nelore

Directory of Open Access Journals (Sweden)

Jorge Luís Ferreira

2002-01-01

Full Text Available O aperfeiçoamento das técnicas que objetivam a exploração do potencial reprodutivo das fêmeas requer a compreensão mais ampla dos mecanismos de controle de desenvolvimento folicular. Uma alternativa de estudo nesta esfera, é a quantificação da expressão relativa de genes envolvidos nos processos de recrutamento, seleção e desenvolvimento folicular, pelo emprego da técnica de transcrição - reversa associado a reação em cadeia pela polimerase (RT - PCR. O presente trabalho objetivou quantificar a expressão relativa dos genes insulin-like growth factor I (IGF-I e do receptor do hormônio folículo estimulante (FSHR, tendo como controle interno o gene da gliceraldeído 3-fosfato desidrogenase (GAPDH. Foram utilizados ovários bovinos de animais de matadouro em diferentes fases do ciclo estral. O RNA total dos folículos e tecido ovarianos foi purificado por TRIZOL. As reações de RT-PCR foram realizadas com o "kit" SuperScriptTM First-Strand. Os produtos de PCR foram analisados em gel de agarose e as bandas submetidas à análise densitométrica. Todos os genes foram amplificados observando-se a curva exponencial de amplificação, a validação do método foi realizada através de análise de regressão, sendo estabelecido o coeficiente de amplificação (E. A expressão relativa de mRNA para cada gene de interesse foi calculada pela fórmula estabelecida por Prelle et al.12. Em todos os tecidos analisados, todos os genes foram expressos, sobressaltando-se diferenças nos diferentes ciclos estudados. Com relação os dados referentes ao coeficiente de amplificação (E, observou-se tanto para gene controle (GAPDH, como para o gene IGF-I concordância nos valores encontrados para as diferentes classes analisadas. Quanto ao gene IGF-I, a interpretação dos achados para a expressão relativa de mRNA pode está relacionada ao caráter constitutivo dessa proteína ou devido os transcritos não serem dependentes dos níveis de FSH. Observou-se diferenças na expressão relativa de mRNA de FSHR entre as classes de tecidos analisados, o que pode ser explicado pela variação do número de receptores nas células da granulosa nas diferentes fases do ciclo estral. Pode-se perceber a partir desse estudo que a técnica de RT-PCR semi quantitativo é de grande importância biotecnológica, possibilitando auxílio na compreensão da dinâmica folicular. Entretanto esses estudos devem ser ampliados com outros genes para melhor compreensão das etapas fisiológicas envolvidas na foliculogênese.

The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

Science.gov (United States)

Ballarin, Cristina; Povinelli, Michele; Granato, Alberto; Panin, Mattia; Corain, Livio; Peruffo, Antonella; Cozzi, Bruno

2016-01-01

The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ), and Cerebellar Quotient (CQ). Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla) indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes.

Genomic study and Medical Subject Headings enrichment analysis of early pregnancy rate and antral follicle numbers in Nelore heifers

DEFF Research Database (Denmark)

Oliveira Junior, G. A.; Perez, B. C.; Cole, J. B.

2017-01-01

be considered in a functional enrichment analysis to identify biological mechanisms involved in fertility. Medical Subject Headings (MeSH) were detected using the MESHR package, allowing the extraction of broad meanings from the gene lists provided by the GWAS. The estimated heritability for HP was 0.28 +/- 0...... gains. In this study, we performed a genomewide association study (GWAS) to identify genetic variants associated with reproductive traits in Nelore beef cattle. Heifer pregnancy (HP) was recorded for 1,267 genotyped animals distributed in 12 contemporary groups (CG) with an average pregnancy rate of 0...

EFFECT OF TIMING OF ARTIFICIAL INSEMINATION ON THE FERTILITY AND SEX RATIO IN NELORE HEIFERS INFLUÊNCIA DO MOMENTO DA INSEMINAÇÃO ARTIFICIAL SOBRE A FERTILIDADE E O SEXO DA CRIA DE NOVILHAS DA RAÇA NELORE

Directory of Open Access Journals (Sweden)

José Ricardo Almeida de Andrade

2008-12-01

Full Text Available The aim of this study was to evaluate the effect of timing of artificial insemination on the fertility and calf sex ratio in Nelore heifers (n = 200 submitted a protocol of timed artificial insemination (TAI.  The heifers, distributed into five groups (GC, GT6, GT12, GT18 and GT24, presented a mean of 2.5 years old and 342 Kg of body weight. The inseminations were performed in the moments 0 (GC, 6 (GT6, 12 (GT12, 18 (GT18 and 24 (GT24 hours after the injection of GnRH. The conception rates were 87.5% (GC, 82.5% (GT6, 77.5% (GT12, 85.0% (GT18 and 77.5% (GT24. There was no statistical difference (p>0.05 in the conception rates between the five treatments. The percentage of calved males was 38.2% (GC, 48.5% (GT6, 45.2% (GT12, 55.9% (GT18 and 58.6% (GT24. The male/female ratio was 0.62 (GC, 0.94 (GT6, 0.82 (GT12, 1.27 (GT18 and 1.42 (GT24. Statistical difference was found (p<0.05 in the male/female ratio between the five treatments. The timing of artificial insemination has influence on the sex ratio, showing an increase in the proportion of calved males when the insemination is progressively delayed. Within of the measured interval of time (0-24h after GnRH, the fertility of Nelore heifers is not influenced by the moment of the artificial insemination.

KEY WORDS: Beef cattle, management, pregnancy test, ultrasound, sexing. Objetivou-se avaliar o efeito do momento da inseminação artificial (IA sobre a fertilidade e a proporção do sexo da cria de novilhas da raça Nelore (n = 200 submetidas a protocolo de IATF. As novilhas, distribuídas em cinco tratamentos (GC, GT6, GT12, GT18 e GT24, apresentavam idade média de 2,5 anos e peso médio de 342 kg. Realizaram-se as inseminações nos momentos 0 (GC, 6 (GT6, 12 (GT12, 18 (GT18 e 24 (GT24 horas após a aplicação do GnRH. As taxas de concepção foram de 87,5% (GC, 82,5% (GT6, 77,5% (GT12, 85,0% (GT18 e de 77,5% (GT24. Não houve diferença estatística (p>0,05 entre as taxas de

Características da carne de bovinos cruzados (WAGYU × Red Angus) e maturação da carne de Nelore

OpenAIRE

Carvalho, Rúbio Madureira de Souza

2015-01-01

Características da carne de bovinos cruzados (Wagyu × Red Angus) e maturação da carne de Nelore. Orientador: Orientador: Orientador: Orientador: Orientador: Cleube Andrade BoariCleube Andrade Boari Cleube Andrade BoariCleube Andrade Boari Cleube Andrade BoariCleube Andrade BoariCleube Andrade BoariCleube Andrade BoariCleube Andrade BoariCleube Andrade BoariCleube Andrade BoariCleube Andrade Boari . Dissertação (Mestrado em Zootecnia). Esta dissertação foi elaborada com o resultado de duas ...

The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

Directory of Open Access Journals (Sweden)

Cristina Ballarin

Full Text Available The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ, and Cerebellar Quotient (CQ. Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes.

Electrocardiogram of Clinically Healthy Mithun (Bos frontalis): Variation among Strains

Science.gov (United States)

Sanyal, Sagar; Das, Pradip Kumar; Ghosh, Probal Ranjan; Das, Kinsuk; Vupru, Kezha V.; Rajkhowa, Chandan; Mondal, Mohan

2010-01-01

A study was conducted to establish the normal electrocardiogram in four different genetic strains of mithun (Bos frontalis). Electrocardiography, cardiac electrical axis, heart rate, rectal temperature and respiration rate were recorded in a total of 32 adult male mithun of four strains (n = 8 each). It was found that the respiration and heart rates were higher (P electrocardiogram of mithun revealed that the amplitude and duration of P wave, QRS complex and T wave were different among four different genetic strains of mithun and the electrical axis of QRS complex for Nagamese and Mizoram mithuns are dissimilar to bovine species. PMID:20886013

Evaluation of pregnancy rates of Bos indicus cows subjected to different synchronization ovulation protocols using injectable progesterone or an intravaginal device

Directory of Open Access Journals (Sweden)

Jefferson Tadeu Campos

2016-12-01

Full Text Available This study evaluated the pregnancy rate in Nelore cows (Bos indicus that were subjected to fixed-time artificial insemination (FTAI using different protocols consisting of injectable progesterone (P4 or an intravaginal device (impregnated with P4. Multiparous cows 72-84 months in age, 30-45 days postpartum, were selected on the basis of the absence of a corpus luteum (CL and follicles < 8 mm after transrectal palpation and ultrasound examinations. On a random day of the estrus cycle (D0, the selected animals (n = 135 were randomly assigned to one of three experimental groups (n = 45 each. Group I (injectable P4/FTAI 36 hours received 250 mg of injectable P4 and 2 mg EB on D0; on D7, they received 500 µg of cloprostenol; on D8, 300 IU of eCG and 1 mg of EB were administered; and finally, FTAI was performed 36 hours after the application of EB. Group II (injectable P4/FTAI 48 hours received the same protocol as Group I, except that the FTAI was performed 48 hours after ovulation induction. The animals of Group III (Control/CIDR received a conventional protocol for FTAI using an intravaginal device (D0: P4 and 2 mg EB; D8: device removal, 500 µg cloprostenol, 300 IU eCG, 1 mg EB; and FTAI performed 48 hours after removal of the device. The results showed that cows synchronized with the conventional protocol for FTAI (Control/CIDR had a higher pregnancy rate (60 %, 27/45 than those synchronized with an injectable P4/FTAI 36 hours (33.33 %; 15/45, P = 0.010. However, the group receiving injectable P4 group/FTAI 48 hours had a similar pregnancy rate (48.9 %; 22/45; P = 0.290 when compared to both the group receiving the conventional protocol and that receiving injectable P4/FTAI 36 hours (P = 0.134. Although the injectable P4 may affect pregnancy rate with the FTAI performed in 36 hours, we found similar pregnancy rates from cows inseminated 48 hours after induction ovulation, considering injectable or intravaginal P4. Therefore, we suggest that

Sarcocystis heydorni, n. sp. (Apicomplexa: Protozoa) with cattle (Bos taurus) and human (Homo sapiens) cycle

Science.gov (United States)

Cattle (Bos taurus) are intermediate hosts for four species of Sarcocystis, S. cruzi, S. hirsuta, S. hominis, and S. rommeli. Of these four species, mature sarcocysts of S. cruzi are thin-walled (< 1µm) whereas S. hirsuta, S. hominis, and S. rommeli have thick walls (4 µm or more). Here we describe ...

Recent Status of Banteng (Bos javanicus Conservation in East Java and Its Perspectives on Ecotourism Planning

Directory of Open Access Journals (Sweden)

Luchman Hakim

2015-09-01

Full Text Available The aims of this article are to examine the recent status of Banteng Bos javanicus conservation in East Java, identify the roots of conservation problems and propose the non-consumptive and sustainable uses of Banteng by implementing ecotourism. Recently, Banteng population distributes in Alas Purwo, Meru Betiri, and Baluran National Parks. The population in Alas Purwo and Meru Betiri were relatively stable yearly. Rapid population decrease found in Baluran National Park. The roots of threats may be categorized into two factors, socio-economic and ecological factors. Socio-economic problems lead to the increase of habitat disturbance, poaching, and illegal hunting. Ecological aspect was ranging from invasion of exotic plant species, competitors, predators, drought, forest fire and vegetation changes. Lack of habitat management also recognized as an important factor to drive Bos javanicus decline and extinction. Ecotourism in the national park may become one of the significant and effective stimuli to support Banteng conservation.

Molecular characterization of Cryptosporidium spp. in calves (Bos taurus and Bos indicus in the Formiga city, Minas Gerais - Brazil

Directory of Open Access Journals (Sweden)

Roberto César Araujo Lima

2014-02-01

Full Text Available Cryptosporidiosis is a waterborne disease, has as aggravating the difficulty of preventing environmental contamination and lack of effective therapeutic measures. With marked importance to the cattle, causes inflammation and intestinal villous atrophy resulting in loss of absorptive surface. This study aimed to perform molecular characterization of Cryptosporidium spp. in calves in the city of Formiga, Minas Gerais. A total of 300 faeces samples from Holstein calves, Nelore and indefinite breed, both healthy, were evaluated by negative contrast staining technique of malachite green and through the reaction of nested PCR for amplification of DNA fragments of the 18S subunit of the RNA gene ribosomal. Occurrence of 5.33 % ( 16/300 for malachite green and 4.66 % ( 14/300 by PCR was observed, whereas no correlation was found between positive and variables studied. Through molecular characterization were identified Cryptosporidium andersoni and Cryptosporidium ryanae species. In conclusion, we observed a low incidence of infection and elimination of Cryptosporidium spp. oocysts, the absence of clinical signs in animals, strong agreement between the results obtained by the two techniques. Beyond, with the molecular characterization ( nested PCR , species of C. andersoni and C. ryanae were diagnosed in age groups not present in the literature. These two species of Cryptosporidium are described above for the first time parasitizing cattle in the state of Minas Gerais.

Diarréia em bezerros da raça Nelore criados extensivamente: estudo clínico e etiológico Diarrhea in Nelore calves: Clinical and etiologic study

Directory of Open Access Journals (Sweden)

José P. Oliveira Filho

2007-10-01

Full Text Available A diarréia é considerada uma das principais causas de morbidade e mortalidade de bezerros neonatos. Foram colhidas 100 amostras fecais diarréicas e 30 amostras não diarréicas (grupo controle, de bezerros Nelore com até nove semanas de idade com o objetivo de detectar os enteropatógenos Salmonella spp., Escherichia coli, rotavírus, coronavírus, Cryptosporidium spp. e ovos de helmintos. Enteropatógenos foram detectados em 79,0% das amostras diarréicas e em 70,0% das amostras não-diarréicas. No grupo de bezerros com diarréia, E. coli (69,0% foi o agente mais freqüentemente isolado, seguido de Cryptosporidium spp. (30,0%, coronavírus (16,0% e rotavírus (11,0%. No grupo controle, E. coli, Cryptosporidium spp. e coronavírus foram detectados, respectivamente, em 66,7%, 10,0% e 3,3% das amostras. Salmonella spp. e ovos de estrongilídeos não foram encontrados nos dois grupos avaliados. A fímbria K99 foi identificada exclusivamente nas linhagens de E. coli isoladas de bezerros com diarréia (5,8%. Entre os antimicrobianos avaliados "in vitro" a enrofloxacina, a norfloxacina e a gentamicina foram os mais efetivos. O peso dos bezerros aos 210 dias de idade não apresentou diferença significativa entre os animais com e sem diarréia.Diarrhea is considered as one of the main causes of morbidity and mortality in neonates calves. Fecal samples from 100 diarrheic and 30 non-diarrheic (control group Nelore calves less than 9 weeks old were collected for Salmonella spp., Escherichia coli, rotavirus, coronavirus, Cryptosporidium spp., and for helminth eggs investigation. Enteropathogens were detected in 79.0% diarrheic samples and 70.0% non-diarrheic samples. Among diarrheic calves, Escherichia coli (69.0% was the most common agent found, following by Cryptosporidium spp. (30.0%, coronavirus (16.0%, and rotavirus (11.0%. In the control group, E. coli, Cryptosporidium spp. and coronavirus were detected in 66.7%, 10.0% and 3.3% of the samples

Ultrassonografia testicular em bovinos jovens da raça Nelore criados em sistema extensivo

Directory of Open Access Journals (Sweden)

D.J. Cardilli

2012-02-01

Full Text Available Este estudo visou avaliar o padrão ultrassonográfico do parênquima testicular de touros jovens da raça Nelore, desde a fase peripuberal até a puberdade, estabelecer padrões fisiológicos e também verificar se existe diferença de ecogenicidade entre animais púberes e pré-púberes na mesma idade. Foram realizados exames ecográficos dos testículos de 19 bovinos aos 10, 12, 14, 16 e 18 meses de idade. O padrão ultrassonográfico do parênquima testicular mostrou-se homogêneo e com ecogenicidade moderada. A ecogenicidade testicular aumentou em proporção direta com a idade dos animais. Não houve diferença significativa entre a ecogenicidade testicular de animais púberes e pré-púberes na mesma idade.

A Novel Bromophenol Derivative BOS-102 Induces Cell Cycle Arrest and Apoptosis in Human A549 Lung Cancer Cells via ROS-Mediated PI3K/Akt and the MAPK Signaling Pathway

Directory of Open Access Journals (Sweden)

Chuan-Long Guo

2018-01-01

Full Text Available Bromophenol is a type of natural marine product. It has excellent biological activities, especially anticancer activities. In our study of searching for potent anticancer drugs, a novel bromophenol derivative containing indolin-2-one moiety, 3-(4-(3-([1,4′-bipiperidin]-1′-ylpropoxy-3-bromo-5-methoxybenzylidene-N-(4-bromophenyl-2-oxoindoline-5-sulfonamide (BOS-102 was synthesized, which showed excellent anticancer activities on human lung cancer cell lines. A study of the mechanisms indicated that BOS-102 could significantly block cell proliferation in human A549 lung cancer cells and effectively induce G0/G1 cell cycle arrest via targeting cyclin D1 and cyclin-dependent kinase 4 (CDK4. BOS-102 could also induce apoptosis, including activating caspase-3 and poly (ADP-ribose polymerase (PARP, increasing the Bax/Bcl-2 ratio, enhancing reactive oxygen species (ROS generation, decreasing mitochondrial membrane potential (MMP, ΔΨm, and leading cytochrome c release from mitochondria. Further research revealed that BOS-102 deactivated the PI3K/Akt pathway and activated the mitogen-activated protein kinase (MAPK signaling pathway resulting in apoptosis and cell cycle arrest, which indicated that BOS-102 has the potential to develop into an anticancer drug.

Consumo, desempenho e parâmetros econômicos de novilhos Nelore e F1 Brangus x Nelore terminados em pastagens, suplementados com mistura mineral e sal nitrogenado com uréia ou amiréia Feed intake, performance and profitability of Nellore and crossbred (Brangus x Nellore steers finished in pastures, supplemented with mineralized salt and nitrogenous salt with urea or starea

Directory of Open Access Journals (Sweden)

L.C.V. Ítavo

2008-04-01

Full Text Available Avaliou-se o efeito da suplementação protéica (40% PB com amiréia ou uréia sobre o consumo de suplemento, desempenho e características econômicas de novilhos terminados em pastagens. Foram utilizados 120 novilhos com 19 meses de idade e 358kg, sendo 60 Nelore e 60 F1 Brangus x Nelore, divididos em três tratamentos com 20 animais, alojados em piquetes de Brachiaria brizantha cv. Marandu de 10 hectares cada, totalizando 120 hectares, sendo dois piquetes por grupo genético e tratamento, pastejados alternadamente a cada pesagem (42 dias. Os tratamentos consistiram em mistura mineral com amiréia-150S (AM, mistura mineral com uréia+milho+enxofre (UR e mistura mineral (MM. As médias de consumo de suplemento dos animais F1 foram de 206,1; 145,9 e 73,1g/dia, e as dos animais Nelore, 236,0; 205,1 e 94,3g/dia para os tratamentos AM, UR e MM, respectivamente. Para os novilhos Nelore, houve efeito (PThe effects of protein supplementation of finishing grazing steers by feeding nitrogenous salts (40% CP, urea or starea or mineralized salt only on supplement intake, growing performance and profitability were evaluated. One hundred and twenty steers (60 Nellore and 60 Brangus x Nellore, 19-month old, 358kg BW were divided in 12 equal groups which were allotted to one of 12 Brachiaria brizantha pastures (10-ha each performing two pastures for each breeding group and nutritional treatment. Groups were allowed to graze each pasture for 42 days when they were randomly moved into a new one. Nutritional treatments were as follow: MS - mineralized salt only; ST -mineralized salt plus starea - 150S; and UR - mineralized salt plus urea, corn and sulphur. UR supplement was prepared mixing the same ingredient contents of ST. Crossbred steers consumed 206.1; 145.9 and 73.1g/day whereas Nellore steers consumed 236.0; 205.11 and 94.29g/day of ST, UR and MS; respectively. For Nellore steers, UR increased slaughter weight (518.8kg compared to ST and MS (491.9 and

Temperature Studies for ATLAS MDT BOS Chambers

CERN Document Server

Engl, A.; Biebel, O.; Mameghani, R.; Merkl, D.; Rauscher, F.; Schaile, D.; Ströhmer, R.

Data sets with high statistics taken at the cosmic ray facility, equipped with 3 ATLAS BOS MDT chambers, in Garching (Munich) have been used to study temperature and pressure effects on gas gain and drifttime. The deformation of a thermally expanded chamber was reconstructed using the internal RasNik alignment monitoring system and the tracks from cosmic data. For these studies a heating system was designed to increase the temperature of the middle chamber by up to 20 Kelvins over room temperature. For comparison the temperature effects on gas properties have been simulated with Garfield. The maximum drifttime decreased under temperature raise by -2.21 +- 0.08 ns/K, in agreement with the results of pressure variations and the Garfield simulation. The increased temperatures led to a linear increase of the gas gain of about 2.1% 1/K. The chamber deformation has been analyzed with the help of reconstructed tracks. By the comparison of the tracks through the reference chambers with these through the test chamber ...

Hvordan påvirker indvandrernes integration, ressourcer og diaspora deres bosætningspræferencer?

DEFF Research Database (Denmark)

Andersen, Hans Skifter

Etniske minoriteters boligønsker må i vid udstrækning antages, at have de samme årsager, som generelt er fundet i forbindelse med studier af boligvalg i Danmark og andre europæiske lande. Men indvandreres bosætning i Danmark og andre lande afviger så meget fra den indfødte befolknings, at den ikk...

Dynamics of Haematobia irritans irritans (Diptera: Muscidae infestation on Nelore cattle in the Pantanal, Brazil

Directory of Open Access Journals (Sweden)

Barros Antonio Thadeu M

2001-01-01

Full Text Available From June 1993 to May 1995, horn fly counts were conducted twice a month on untreated Nelore cattle raised extensively in the Pantanal. Horn fly population showed a bimodal fluctuation and peaks were observed every year after the beginning (November/December and at the end (May/June of the rainy season, which coincided with mid-late spring and mid-late fall, respectively. Horn flies were present on cattle throughout the year in at least 64% of the animals. Mean horn fly numbers on animals did not exceed 85 flies/cow during peaks and were under 35 flies/cow in most of the remaining periods. The highest infestations (population peaks were short and dropped suddenly within two weeks. Less than 15% of the animals in both herds could be considered as "fly-susceptible" - showing consistently higher infestations, or "fly-resistant" - showing consistently lower infestations.

Revisiting AFLP fingerprinting for an unbiased assessment of genetic structure and differentiation of taurine and zebu cattle

Science.gov (United States)

2014-01-01

Background Descendants from the extinct aurochs (Bos primigenius), taurine (Bos taurus) and zebu cattle (Bos indicus) were domesticated 10,000 years ago in Southwestern and Southern Asia, respectively, and colonized the world undergoing complex events of admixture and selection. Molecular data, in particular genome-wide single nucleotide polymorphism (SNP) markers, can complement historic and archaeological records to elucidate these past events. However, SNP ascertainment in cattle has been optimized for taurine breeds, imposing limitations to the study of diversity in zebu cattle. As amplified fragment length polymorphism (AFLP) markers are discovered and genotyped as the samples are assayed, this type of marker is free of ascertainment bias. In order to obtain unbiased assessments of genetic differentiation and structure in taurine and zebu cattle, we analyzed a dataset of 135 AFLP markers in 1,593 samples from 13 zebu and 58 taurine breeds, representing nine continental areas. Results We found a geographical pattern of expected heterozygosity in European taurine breeds decreasing with the distance from the domestication centre, arguing against a large-scale introgression from European or African aurochs. Zebu cattle were found to be at least as diverse as taurine cattle. Western African zebu cattle were found to have diverged more from Indian zebu than South American zebu. Model-based clustering and ancestry informative markers analyses suggested that this is due to taurine introgression. Although a large part of South American zebu cattle also descend from taurine cows, we did not detect significant levels of taurine ancestry in these breeds, probably because of systematic backcrossing with zebu bulls. Furthermore, limited zebu introgression was found in Podolian taurine breeds in Italy. Conclusions The assessment of cattle diversity reported here contributes an unbiased global view to genetic differentiation and structure of taurine and zebu cattle

Uso de extratos vegetais, vitaminas e sua associação sobre o desempenho, temperamento e qualidade de carne de bovinos nelore confinados com dieta de alto grão

OpenAIRE

Silva, Maurícia Brandão da [UNESP

2015-01-01

Fifty-six Nellore (Bos taurus indicus) young bulls of 360 (±19,8) kg initial weight and 20 month of age were used to evaluate the effect of plant extract, vitamins A, D3 supplementation and their associations on the temperament, feedlot performance (finishing phase) and meat quality of Bos indicus cattle. Animals were located in individual pens during 105 days (21 and 84 days, for adaptation and trial period, respectively). Animals were individually weighed, and blocked by initial body weight...

Histórico genético e populacional do rebanho Nelore Puro de Origem no Sertão Nordestino Genetic and populational background of Pure Nelore cattle breed in Brazilian Northeastern Sertão

Directory of Open Access Journals (Sweden)

Carlos Henrique Mendes Malhado

2009-07-01

Full Text Available O objetivo deste trabalho foi avaliar o histórico do rebanho Nelore Puro de Origem no Sertão Nordestino por meio da determinação de sua estrutura populacional e da quantificação do progresso genético, fenotípico e ambiental ocorrido em características de desenvolvimento ponderal. Foram utilizadas informações de pedigree de animais nascidos no período de 1964 a 2006 e dados das massas corporais ajustadas aos 205 e 365 dias de idade de bovinos nascidos de 1978 a 2006. O pequeno número de ancestrais explicou a baixa variabilidade genética e os reduzidos valores dos coeficientes de herdabilidade observados para as características de crescimento. O coeficiente de endogamia média e a percentagem de animais endogâmicos na população aumentaram no decorrer das gerações. Contudo, o coeficiente de endogamia médio dos animais endogâmicos diminuiu, o que é indicativo de que os acasalamentos entre parentes próximos estão sendo evitados. O tamanho efetivo da população oscilou de 100 a 200 animais em quase todo o período estudado. Não se constatou ganho genético no período. Contudo, a raça obteve um considerável ganho fenotípico ocasionado por melhorias ambientais.The objective of this study was to evaluate the Pure Nelore cattle breed background in the Brazilian Northeastern Sertão region by determining its population structure and quantifying genetic, phenotypic and environmental progress based on ponderal development traits. Pedigree data of animals born between 1964 and 2006 and weight values, adjusted to 205 and 365 days of age, of bovines born between 1978 and 2006 were used. The small number of ancestors explained the population's low genetic variability and the reduced heritability coefficient values observed for growth traits. The mean inbreeding coefficient and the percentage of endogamic animals within the population increased over the generations. However, the mean inbreeding coefficient of endogamic animals

Anatomical characteristics of the ossa sesamoidea phalangis proximalis in cattle (Bos primigenius f. taurus Linné 1758)

Energy Technology Data Exchange (ETDEWEB)

Červený, Č. [Vysoka Skola Veterinarni, Brno, Czechoslovakia (Czech Republic)

1985-06-15

The anatomical structure and radiography of the sesamoid bones of the proximal phalanges of cattle digits were studied on osteological material and radiograms of 18 cows and 5 bulls. On the basis of detailed anatomical description, a list of new anatomical names for important anatomical formations was proposed in order to complete the anatomical nomenclature and to provide better orientation on the bones as well as a more precise description of the different bones and determine their origin from the respective digits and/or the left or right thoratic or pelvic limbs.

Anatomical characteristics of the ossa sesamoidea phalangis proximalis in cattle (Bos primigenius f. taurus Linné 1758)

International Nuclear Information System (INIS)

Červený, Č.

1985-01-01

The anatomical structure and radiography of the sesamoid bones of the proximal phalanges of cattle digits were studied on osteological material and radiograms of 18 cows and 5 bulls. On the basis of detailed anatomical description, a list of new anatomical names for important anatomical formations was proposed in order to complete the anatomical nomenclature and to provide better orientation on the bones as well as a more precise description of the different bones and determine their origin from the respective digits and/or the left or right thoratic or pelvic limbs

Caracterização molecular de animais da raça Nelore utilizando microssatélites e genes candidatos

Directory of Open Access Journals (Sweden)

Tambasco Daniella Debenedetti

2000-01-01

Full Text Available No presente trabalho, 180 fêmeas da raça Nelore, provenientes de oito rebanhos, foram analisadas quanto aos marcadores microssatélites TEXAN15, BM1224 e CSFM50 e aos polimorfismos de comprimento de fragmentos de restrição (RFLP nos locos k-caseína, beta-lactoglobulina e hormônio de crescimento (GH. Com exceção de GH, todos os marcadores foram polimórficos na amostra estudada. Os valores de heterozigosidade, diversidade gênica, conteúdo de informação polimórfica (PIC e probabilidade de exclusão de paternidade (PE foram estimados. Os maiores valores de PIC (0,685 e PE (0,521 foram obtidos para o marcador BM1224.

A deterministic simulation study of embryo marker-assisted selection for age at first calving in Nellore ( Bos indicus) beef cattle

NARCIS (Netherlands)

Rosa, A.J.M.; Bijma, P.; Oliveira, H.N.; Lobo, R.B.; Arendonk, van J.A.M.

2007-01-01

We used deterministic simulation of four alternative multiple ovulation and embryo manipulation (MOET) closed nucleus schemes to investigate the benefits of using marker-assisted selection (MAS) of Nellore (Bos indicus) beef cattle embryos prior to transplantation to reduce the age at first calving

Perfil hormonal de Progesterona durante o ciclo Estral em novilhas Nelore confinadas com Diferentes Ondas de Crescimento Folicular Plasma Progesterone Level during the Estrous Cycle in Nelore Heifers Confined with Two, Three and Four Waves of Follicular Growth

Directory of Open Access Journals (Sweden)

Luciene Lomas Santiago

2001-12-01

Full Text Available Efetuaram-se coletas diárias de sangue, de 16 novilhas Nelore confinadas, para análise de progesterona plasmática pelo método de radioimunoensaio (RIA. Os dias analisados para progesterona foram o dia zero (estro e a cada três dias até o dia -1 e o dia zero. Os animais foram divididos em dois grupos: 1 com ciclo estral de 21 dias aproximadamente (novilhas que apresentaram duas e três ondas de crescimento folicular e 2 com ciclo estral superior a 25 dias (novilhas com quatro ondas de crescimento folicular. As concentrações médias de progesterona plasmática dos animais durante o ciclo estral diferiram entre os dois grupos, sendo superiores (4,27 ng/mL para os ciclos de maior duração. A concentração média de progesterona no ciclo de aproximadamente 21 dias foi de 2,54 ng/mL. Os resultados sugerem que as novilhas que apresentam maior duração do ciclo estral necessitam de tempo adicional para que seus folículos cheguem ao estádio pré-ovulatório, havendo, dessa maneira, prolongamento e aumento da secreção de progesterona.Blood were collected daily from 16 Nelore heifers confined, for radioimmunoassay (RIA.analyses of progesterone The plasma progesterone assay were at day zero (estrus and at each three days until the -1 and the day zero.again The animals were divided in two groups: 1 with regular estrous cycle of 21 days (heifers with two and three follicular growth waves and 2 with prolonged estrous cycle, greater than 25 days (heifers with four follicular growth waves. The mean plasma progesterone level from the animals during the estrous cycle differed between the two groups, being greater (4,27 ng/mL for the extended cycles.(above 25 days; 4,27 ng/mL than for the regular estrous cycle (21 days; 2,54 ng/mL. Results suggest that those heifers which showed an extended estrous cycles, needs an additional time for the follicles to each the pre-ovulatory stadium, resulting in prolonged and increased progesterone secretion.

Reproductive activity and performance of ½ Nellore and heifers fed with supplementation with organic chromium Atividade reprodutiva e desempenho produtivo de novilhas nelore taurino submetidas a suplementação com cromo orgânico

Directory of Open Access Journals (Sweden)

Joilmaro Rodrigo Pereira Rosa

2011-06-01

Full Text Available This experimental evaluated the start of reproductive activity, body weight gain and carcass finishing of two genetic groups of heifers submitted to mineral supplementation with organic chromium. 90 heifers with 12 months of age were divided into four groups: 30 Nellore with chromium, 30 Nellore without chromium, 15 ½ Taurine with chromium, 15 ½ Taurine without chromium. For 12 months the animals were weighed every 28 days and ultrasound exams performed with 15 months of age for reproductive evaluation and 18 months for carcass evaluation. There was interaction between genetic groups and organic chromium supplementation for body weight at slaughter and body weight gain. The ½ Taurine heifers supplemented with chromium showed greater body weight at slaughter (330.1kg and body weight gain (0,563kg/day than Nellore heifers with chromium (304.8kg; 0,414kg/day, Nellore without chromium (304.7kg; 0,401kg/day and ½ Taurine without chromium (298.6kg; 0,408kg/day. However there was no effect of interaction between genetic groups and chromium organic supplementation, of genetic groups and of chromium organic supplementation on carcass characteristic. The use of organic chromium supplementation showed improvements on body growth and on the start of reproductive activity in heifers, without changing the finishing carcass characteristic.O presente experimento avaliou o início da atividade reprodutiva, ganho de peso corporal e acabamento de carcaça de dois grupos genéticos de novilhas submetidas à suplementação mineral com cromo orgânico em pastejo sob lotação intermitente. Noventa novilhas (60 Nelore e 30 ½ taurino de 12 meses de idade foram separadas em quatro grupos: Trinta fêmeas Nelore com cromo, 30 fêmeas Nelore sem cromo, 15 fêmeas ½ sangue taurino com cromo e 15 fêmeas ½ sangue taurino sem cromo. Durante 12 meses os animais foram pesados a cada 28 dias e os exames ultrassonográficos realizados aos 15 meses de idade para avalia

Parâmetros genéticos para diferentes relações de peso ao nascer e à desmama em vacas da raça Nelore Genetic parameters for different birth and weaning weight ratios in Nelore cows

Directory of Open Access Journals (Sweden)

Arione Augusti Boligon

2013-04-01

Full Text Available O presente estudo foi desenvolvido com o objetivo de estimar herdabilidade e repetibilidade para diferentes medidas de eficiência produtiva de vacas e determinar a melhor maneira de calcular as relações de peso, visando a sua utilização como critério de seleção em rebanhos da raça Nelore. Os dados analisados são de animais da raça Nelore, pertencentes ao Projeto de Seleção das Raças Zebuínas e Caracu do Centro APTA Bovinos de Corte, do Instituto de Zootecnia de Sertãozinho. Os animais são selecionados para maior peso ao sobreano (rebanhos NeS e NeT, analisados como um único rebanho e para peso ao sobreano próximo da média (NeC do grupo de contemporâneos, desde 1980. As características utilizadas no estudo foram: 1 RPN = relação de peso ao nascer do bezerro / peso da vaca ao parto; 2 RPN2 = relação do peso ao nascer do bezerro / peso metabólico da vaca ao parto; 3 RPD = relação de peso à desmama do bezerro / peso da vaca à desmama; e 4 RPD2 = relação do peso à desmama do bezerro / peso metabólico da vaca à desmama. Os parâmetros genéticos foram estimados considerando dois arquivos: vacas com bezerros (CB e vacas com e sem bezerros (SB. A RPN e a RPN2 foram calculadas somente no arquivo CB, enquanto que RPD e RPD2 foram calculadas em ambos os arquivos (CB e SB. Os parâmetros genéticos foram estimados pelo método da máxima verossimilhança restrita. As estimativas de herdabilidade para as características RPN; RPN2; RPD_CB; RPD2_CB; RPD_SB e RPD2_SB foram: 0,17±0,02; 0,16±0,02; 0,22±0,04; 0,19±0,03; 0,20±0,01 e 0,16±0,01, respectivamente. As repetibilidades estimadas variaram de 0,22 a 0,68. A utilização das relações de peso como critério de seleção deve promover, a longo prazo, melhorias na eficiência produtiva das vacas. As relações de peso têm sido consideradas apenas como informações para o descarte de vacas em alguns programas de seleção, mas poderiam ser incluídas em índices de

Bekalking en toevoegen van nutriënten; evaluatie van de effecten op de vitaliteit van het bos; een veldonderzoek naar boomgroei

NARCIS (Netherlands)

Wolf, R.J.A.M.; Engels, M.E.; Knotters, M.; Schraven, R.; Boertjes, M.

2006-01-01

Dit rapport doet verslag van een deelonderzoek uit de Evaluatie van effectgerichte maatregelen in multifunctionele bossen 2004-2005 en is gericht op de effecten van de maatregelen bemes-ting en bekalking in bossen als overbruggingsmaatregel in het kader van het Overlevingsplan Bos en Natuur (OBN).

The mummified brain of a pleistocene woolly mammoth (Mammuthus primigenius) compared with the brain of the extant African elephant (Loxodonta africana).

Science.gov (United States)

Kharlamova, Anastasia S; Saveliev, Sergei V; Protopopov, Albert V; Maseko, Busisiwe C; Bhagwandin, Adhil; Manger, Paul R

2015-11-01

This study presents the results of an examination of the mummified brain of a pleistocene woolly mammoth (Mammuthus primigenius) recovered from the Yakutian permafrost in Siberia, Russia. This unique specimen (from 39,440-38,850 years BP) provides the rare opportunity to compare the brain morphology of this extinct species with a related extant species, the African elephant (Loxodonta africana). An anatomical description of the preserved brain of the woolly mammoth is provided, along with a series of quantitative analyses of various brain structures. These descriptions are based on visual inspection of the actual specimen as well as qualitative and quantitative comparison of computed tomography imaging data obtained for the woolly mammoth in comparison with magnetic resonance imaging data from three African elephant brains. In general, the brain of the woolly mammoth specimen examined, estimated to weigh between 4,230 and 4,340 g, showed the typical shape, size, and gross structures observed in extant elephants. Quantitative comparative analyses of various features of the brain, such as the amygdala, corpus callosum, cerebellum, and gyrnecephalic index, all indicate that the brain of the woolly mammoth specimen examined has many similarities with that of modern African elephants. The analysis provided here indicates that a specific brain type representative of the Elephantidae is likely to be a feature of this mammalian family. In addition, the extensive similarities between the woolly mammoth brain and the African elephant brain indicate that the specializations observed in the extant elephant brain are likely to have been present in the woolly mammoth. © 2015 Wiley Periodicals, Inc.

Fatores de correção para perímetro escrotal ao sobreano para tourinhos mestiços Aberdeen Angus x Nelore Adjustment factors for scrotal circumference at yearling for crossbred Aberdeen Angus x Nelore young bulls

Directory of Open Access Journals (Sweden)

J.S. Lopes

2009-04-01

Full Text Available Obtiveram-se fatores de correção (FC para o perímetro escrotal ao sobreano (PES para os efeitos de grupo genético (GG, heterozigose individual (HI, peso ao sobreano (PS e idade do animal à pesagem de sobreano (IDS, utilizando-se registros de peso corporal e medidas de perímetro escrotal obtidos de 11.662 tourinhos das raças Aberdeen Angus, Nelore e de produtos do cruzamento entre elas, criados nas regiões Sul, Sudeste e Centro-Oeste do Brasil, nascidos entre 1987 e 2001. Os coeficientes de regressão que geraram os FC foram estimados pelo método dos quadrados mínimos, adotando um modelo que incluiu os efeitos de grupo de contemporâneos ao sobreano (GC, GG, heterozigose materna (HM, HI, PS e IDS. Todos os efeitos incluídos no modelo foram significativos (PAdjustment factors (AF for scrotal circumference at yearling (SCY were figured out for effects of genetic group (GG, individual heterozygosis (IH, yearling weight (YW, and age of the animal at yearling weight (AYW using body weight and scrotal circumference records from 11,662 Aberdeen Angus, Nelore, and their crosses. The animals were born from 1987 to 2001 and were raised in the South East and Central West Regions of Brazil. The regression coefficients to obtain AF were estimated by least squares means method. The model included the fixed effects of contemporaneous group at yearling (CG, maternal heterozygosis (MH, IH, and the covariates YW (linear and quadratic effects and AYW (linear effect. All the factors included in the model showed significant effects (P<0.01 on SCY. The mean and standard deviation for SCY were 29.90±3.55cm. Quadratic effect of YW on SCY was also observed. Decreases in SCY with the increase in YW was found. High SCY was observed immediately after post-weaning. The YW effects on SCY were 0.06695804±0.00345000cm/kg (linear effect and -0.00005252±0.00000508cm/kg² (quadratic effect. The AYW linear effect on SCY was 0.02176450±0.00038568cm/day. The factors

Tractus génital des vaches zébus (Bos indicus) au Niger.

OpenAIRE

Moussa Garba, Mahamadou; Marichatou, H; Issa, M; Abdoul Aziz, ML; Hanzen, Christian

2013-01-01

Les caractéristiques anatomiques et les structures ovariennes et pathologiques du tractus génital de 500 femelles zébus (Bos indicus), appartenant à quatre races bovines (Azawak, Bororo, Djelli, Goudali), ont été étudiées à l’abattoir de Niamey au Niger du 15 août au 15 décembre 2011. Chaque animal a été examiné avant abattage. Ces vaches et génisses, âgées en moyenne de 8 ± 2,5 ans, ont eu une note d’état corporel moyenne de 1,6 ± 0,6 et un poids moyen de carcasse de 113 ± ...

Absence of heat intolerance (panting) syndrome in foot-and-mouth disease-affected Indian cattle (Bos indicus) is associated with intact thyroid gland function.

Science.gov (United States)

Maddur, M S; Rao, S; Chockalingam, A K; Kishore, S; Gopalakrishna, S; Singh, N; Suryanarayana, V V S; Gajendragad, M R

2011-06-01

Foot-and-mouth disease (FMD) is a highly contagious and economically important viral disease with high morbidity and reduced productivity of affected animals. We studied the heat intolerance (HI) (panting) syndrome and the effect of FMD virus (FMDV) infection on thyroid gland function in Indian cattle (Bos indicus). Experimental infection with FMDV Asia 1 resulted in a mild form of disease with superficial lesions. Heat intolerance syndrome and its signs were not observed among the recovered animals. Subtle changes in the serum level of thyroid hormones, triiodothyronine (T₃) and thyroxine (T₄) were observed. However, there were no distinct histological changes in the thyroid gland, and FMDV antigens were not detected in the thyroid tissues. Our results thus suggest that the absence of panting syndrome in FMD-affected Bos indicus cattle may be associated with intact thyroid gland function.

The relevance, biases, and importance of digitising opportunistic non-standardised collections: A case study in Iberian harvestmen fauna with BOS Arthropod Collection datasets (Arachnida, Opiliones).

Science.gov (United States)

Merino-Sáinz, Izaskun; Torralba-Burrial, Antonio; Anadón, Araceli

2014-01-01

In this study, we analyse the relevance of harvestmen distribution data derived from opportunistic, unplanned, and non-standardised collection events in an area in the north of the Iberian Peninsula. Using specimens deposited in the BOS Arthropod Collection at the University of Oviedo, we compared these data with data from planned, standardised, and periodic collections with pitfall traps in several locations in the same area. The Arthropod Collection, begun in 1977, includes specimens derived from both sampling types, and its recent digitisation allows for this type of comparative analysis. Therefore, this is the first data-paper employing a hybrid approach, wherein subset metadata are described alongside a comparative analysis. The full dataset can be accessed through Spanish GBIF IPT at http://www.gbif.es:8080/ipt/archive.do?r=Bos-Opi, and the metadata of the unplanned collection events at http://www.gbif.es:8080/ipt/resource.do?r=bos-opi_unplanned_collection_events. We have mapped the data on the 18 harvestmen species included in the unplanned collections and provided records for some species in six provinces for the first time. We have also provided the locations of Phalangium opilio in eight provinces without published records. These results highlight the importance of digitising data from unplanned biodiversity collections, as well as those derived from planned collections, especially in scarcely studied groups and areas.

Selection for growth and maternal ability impacts simulation on the reproductive efficiency in a nellore herd Simulação dos impactos da seleção para crescimento e habilidade materna sobre a eficiência reprodutiva de um rebanho nelore

Directory of Open Access Journals (Sweden)

Moarcir Gabriel Saueressig

2010-09-01

Full Text Available The aim in this work was, using a simulation model, to verify the result of twenty years of selection for growth and maternal ability on the reproductive traits in a selection Nellore herd raised in the savannah biome. Data were reported to the DECI (Decision Evaluator for the Industry Cattle simulation model, reflecting the real situation of registered purebred Nellore herd of the Embrapa Cerrados (Brazil Nellore Genetics. The simulation model was effective in predicting the impacts of the selection for growth and maternal ability on the reproductive efficiency. In agreement with the program, at 20 years of selection, the medium puberty age of the herd would be 14,4 months, the age to the first partum 24,7 months, the service period 78 days, and the pregnancy rate 77%. Under the simulated conditions, it was possible to conclude that the selection for growth and maternal ability for 20 years in a Nellore herd did not affect negatively the reproductive performance of the herd.Objetivou-se, neste trabalho, verificar por meio de um programa de simulação o resultado de vinte anos de seleção para crescimento e habilidade materna sobre as características reprodutivas em um rebanho seleção Nelore puro de origem, marca BRGN (Brasil Genética Nelore criado no bioma Cerrado. O programa de simulação utilizado foi o DECI (Decision Evaluator for the Industry Cattle. Os dados informados ao programa buscaram refletir o mais fielmente possível o sistema de produção do rebanho Nelore BRGN da Embrapa Cerrados. O modelo de simulação foi eficaz em predizer os impactos da seleção para crescimento e habilidade materna sobre a eficiência reprodutiva. Ao final de 20 anos de seleção, a idade à puberdade média do rebanho seria 14,4 meses, a idade ao primeiro parto 24,7 meses, o período de serviço 78 dias e a taxa de prenhez 77%. Sob as condições simuladas, foi possível concluir que a seleção para crescimento e habilidade materna por 20 anos em

Effect of creep feeding on average daily gain and weaning weight of calves and on reproductive efficiency of primiparous Nelore cows under grazing

OpenAIRE

Nogueira, E.; Morais, M.G.; Andrade, V.J.; Rocha, E.D.S.; Silva, A.S.; Brito, A.T.

2006-01-01

Avaliou-se o efeito da suplementação de bezerros em sistema de creep feeding, em pastagens de Brachiaria brizantha, durante o período de amamentação, sobre o ganho médio diário (GMD), peso à desmama (PD) e taxa de gestação, em delineamento inteiramente ao acaso, utilizando 102 vacas Nelore (primíparas de baixa condição corporal ao início da estação de monta) e seus bezerros, divididos em dois grupos: T1 (n=52), não tratado e T2 (n=50), tratado com suplemento à base de 20% de PB e 75% de NDT. ...

Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on the disease phenotypes of dairy cows with experimentally induced Escherichia coli mastitis

DEFF Research Database (Denmark)

Khatun, Momena; Sørensen, Peter; Jørgensen, Hanne Birgitte Hede

2013-01-01

Several quantitative trait loci (QTL) affecting mastitis incidence and mastitis-related traits such as somatic cell score exist in dairy cows. Previously, QTL haplotypes associated with susceptibility to Escherichia coli mastitis in Nordic Holstein-Friesian (HF) cows were identified on Bos taurus...... autosome 9. In the present study, we induced experimental E. coli mastitis in Danish HF cows to investigate the effect of 2 E. coli mastitis-associated QTL haplotypes on the cows' disease phenotypes and recovery in early lactation. Thirty-two cows were divided in 2 groups bearing haplotypes with either low...... the HH group did. However, we also found interactions between the effects of haplotype and biopsy for body temperature, heart rate, and PMNL. In conclusion, when challenged with E. coli mastitis, HF cows with the specific Bos taurus autosome 9-located QTL haplotypes were associated with differences...

Evaluation of mature cow weight: genetic correlations with traits used in selection indices, correlated responses, and genetic trends in Nelore cattle.

Science.gov (United States)

Boligon, A A; Carvalheiro, R; Albuquerque, L G

2013-01-01

Genetic correlations of selection indices and the traits considered in these indices with mature weight (MW) of Nelore females and correlated responses were estimated to determine whether current selection practices will result in an undesired correlated response in MW. Genetic trends for weaning and yearling indices and MW were also estimated. Data from 612,244 Nelore animals born between 1984 and 2010, belonging to different beef cattle evaluation programs from Brazil and Paraguay, were used. The following traits were studied: weaning conformation (WC), weaning precocity (WP), weaning muscling (WM), yearling conformation (YC), yearling precocity (YP), yearling muscling (YM), weaning and yearling indices, BW gain from birth to weaning (BWG), postweaning BW gain (PWG), scrotal circumference (SC), and MW. The variance and covariance components were estimated by Bayesian inference in a multitrait analysis, including all traits in the same analysis, using a nonlinear (threshold) animal model for visual scores and a linear animal model for the other traits. The mean direct heritabilities were 0.21±0.007 (WC), 0.22±0.007 (WP), 0.20±0.007 (WM), 0.43±0.005 (YC), 0.40±0.005 (YP), 0.40±0.005 (YM), 0.17±0.003 (BWG), 0.21±0.004 (PWG), 0.32±0.001 (SC), and 0.44±0.018 (MW). The genetic correlations between MW and weaning and yearling indices were positive and of medium magnitude (0.30±0.01 and 0.31±0.01, respectively). The genetic changes in weaning index, yearling index, and MW, expressed as units of genetic SD per year, were 0.26, 0.27, and 0.01, respectively. The genetic trend for MW was nonsignificant, suggesting no negative correlated response. The selection practice based on the use of sires with high final index giving preference for those better ranked for yearling precocity and muscling than for conformation generates only a minimal correlated response in MW.

Iron Content Affects Lipogenic Gene Expression in the Muscle of Nelore Beef Cattle.

Directory of Open Access Journals (Sweden)

Wellison Jarles da Silva Diniz

Full Text Available Iron (Fe is an essential mineral for metabolism and plays a central role in a range of biochemical processes. Therefore, this study aimed to identify differentially expressed (DE genes and metabolic pathways in Longissimus dorsi (LD muscle from cattle with divergent iron content, as well as to investigate the likely role of these DE genes in biological processes underlying beef quality parameters. Samples for RNA extraction for sequencing and iron, copper, manganese, and zinc determination were collected from LD muscles at slaughter. Eight Nelore steers, with extreme genomic estimated breeding values for iron content (Fe-GEBV, were selected from a reference population of 373 animals. From the 49 annotated DE genes (FDR<0.05 found between the two groups, 18 were up-regulated and 31 down-regulated for the animals in the low Fe-GEBV group. The functional enrichment analyses identified several biological processes, such as lipid transport and metabolism, and cell growth. Lipid metabolism was the main pathway observed in the analysis of metabolic and canonical signaling pathways for the genes identified as DE, including the genes FASN, FABP4, and THRSP, which are functional candidates for beef quality, suggesting reduced lipogenic activities with lower iron content. Our results indicate metabolic pathways that are partially influenced by iron, contributing to a better understanding of its participation in skeletal muscle physiology.

Seleção e classificação multivariada de modelos de crescimento não lineares para bovinos Nelore

Directory of Open Access Journals (Sweden)

N.A.M. Silva

2011-04-01

Full Text Available Utilizou-se análise de agrupamento para classificar e selecionar modelos não lineares de crescimento de bovinos Nelore, tendo em vista os resultados de diferentes avaliadores de qualidade de ajuste. Ajustaram-se 12 modelos não lineares. A qualidade de ajuste dos modelos foi medida pelo coeficiente de determinação (R², quadrado médio do erro (QME, critério de informação de Akaike (AIC, critério de informação Bayesiano (BIC, erro quadrático médio de predição (MEP e coeficiente de determinação de predição (R²p. O modelo Brody foi o que apresentou o melhor ajuste para o conjunto de dados.

Dinâmica folicular e taxa de prenhez em novilhas receptoras de embrião (Bos taurus indicus x Bos taurus taurus tratadas com o protocolo "Ovsynch" para inovulação em tempo fixo

Directory of Open Access Journals (Sweden)

Pietro Sampaio Baruselli

2003-01-01

Full Text Available Objetivou-se avaliar a eficiência da sincronização da ovulação para inovulação em tempo fixo em novilhas Bos taurus indicus x Bos taurus taurus receptoras de embrião. No Experimento 1, a dinâmica folicular foi acompanhada durante o protocolo "Ovsynch" (G1; n=35 e após a aplicação de PGF2alfa (G2; n=34. No Experimento 2, os mesmos tratamentos foram realizados a campo em 168 (G1 e 177 (G2 novilhas. No D6, colheu-se sangue para dosagem de P4 e se realizaram exames ultra-sonográficos. No D7, realizou-se a inovulação. No Experimento 1, 45,7% dos animais ovularam após o 1º GnRH (P;0,05. Ao final, a taxa de prenhez no Gl foi de 35,7% e no G2 de 25,4% (P<0,05. Foram detectadas em estro 53,7% das novilhas do G2 e 33,3% do Gl (P<0,05. Os corpos lúteos com maior área determinaram maiores concentrações de P4 e taxa de concepção (P<0,05. A sincronização da ovulação para inovulação em tempo fixo aumentou as taxas de ovulação, de aproveitamento e de prenhez em novilhas receptoras de embrião.

Assessment of exposure to PCDD/F, PCB, and PAH at a basic oxygen Steelmaking (BOS) and an iron ore sintering plant in the UK.

Science.gov (United States)

Jackson, Kevin; Aries, Eric; Fisher, Raymond; Anderson, David R; Parris, Adrian

2012-01-01

An assessment was carried out at a UK integrated steelworks to investigate the exposure of workers via inhalation to dioxins [polychlorinated dibenzo-p-dioxins (PCDD/F)], polychlorinated biphenyls (PCBs), and polycyclic aromatic hydrocarbons (PAH) including benzo[a]pyrene (B[a]P). Investigations focused on a basic oxygen steelmaking (BOS) plant and an iron ore sintering plant. The highest concentrations of PCDD/F and dioxin-like PCB were found at the BOS vessels and sinter strand area at the BOS and sinter plant, respectively. A risk assessment was carried out by comparing the daily intake of PCDD/F and PCB via inhalation with the recommended tolerable daily intake (TDI) proposed by the World Health Organisation (WHO). For the most exposed category of worker in this study (i.e. sinter plant workers inside the strand area), the estimated daily intake via inhalation was estimated to be 0.25 pg WHO-toxic equivalent concentrations (TEQ) kg(-1) body weight (bw). Considering that the average UK adult exposure to PCDD/F from the diet is 1.8 pg WHO-TEQ kg(-1) bw day(-1), the results indicated that the estimated daily intake of PCDD/F and PCB via inhalation for sinter plant workers would not result in the recommended range of the TDI (1-4 pg WHO-TEQ kg(-1) bw day(-1)) being exceeded. Cancer risks for a 40-year occupational exposure period were determined by multiplying the estimated intake by the inhalation cancer potency factor for 2,3,7,8-tetrachlorodibenzo-p-dioxin. For the most exposed category of worker, cancer risks from exposure to PCDD/F and PCB ranged from 2.5 × 10(-6) to 5.2 × 10(-5). Under most regulatory programmes, excess cancer risks between 1.0 × 10(-6) and 1.0 × 10(-4) indicate an acceptable range of cancer risk, suggesting a limited risk from PCDD/F and PCB exposure for workers in the sinter plant. With regard to PAH, B[a]P concentrations were typically plant and the BOS plant. In several cases, particularly at the sinter plant, B[a]P concentrations

Cloning of an endangered species (Bos gaurus) using interspecies nuclear transfer.

Science.gov (United States)

Lanza, R P; Cibelli, J B; Diaz, F; Moraes, C T; Farin, P W; Farin, C E; Hammer, C J; West, M D; Damiani, P

2000-01-01

Approximately 100 species become extinct a day. Despite increasing interest in using cloning to rescue endangered species, successful interspecies nuclear transfer has not been previously described, and only a few reports of in vitro embryo formation exist. Here we show that interspecies nuclear transfer can be used to clone an endangered species with normal karyotypic and phenotypic development through implantation and the late stages of fetal growth. Somatic cells from a gaur bull (Bos gaurus), a large wild ox on the verge of extinction, (Species Survival Plan cloned animals was gaurus in origin. The gaur nuclei were shown to direct normal fetal development, with differentiation into complex tissue and organs, even though the mitochondrial DNA (mtDNA) within all the tissue types evaluated was derived exclusively from the recipient bovine oocytes. These results suggest that somatic cell cloning methods could be used to restore endangered, or even extinct, species and populations.

Identity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus) and the suppression of Sarcocystis sinensis as a nomen nudum

Science.gov (United States)

There are uncertainties concerning the identity and host species specificity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus). Currently, in cattle three species are recognized with known endogenous stages, viz.: S. cruzi (with canine definitive host), S. hirsuta...

Fertilidade de fêmeas Nelore após inseminação artificial em tempo fixo conforme a contagem de folículos antrais

Directory of Open Access Journals (Sweden)

Alexandra Soares Rodrigues

2013-07-01

Full Text Available O objetivo deste trabalho foi determinar o efeito do número de folículos antrais sobre as taxas de concepção de fêmeas Nelore, em programa de inseminação artificial em tempo fixo (IATF. Para isso, 481 fêmeas foram submetidas a um protocolo de IATF e avaliadas quanto à contagem de folículos antrais (CFA e ao diagnóstico de gestação. Os animais foram agrupados nas categorias de CFA baixa (53. Não houve diferença entre as taxas de concepção obtidas nas categorias de CFA em IATF com uso de gonadotrofina coriônica.

Altura da garupa e sua associação com características reprodutivas e de crescimento na raça Nelore Hip height and its relationships with reproductive and growth traits in Nelore cattle

Directory of Open Access Journals (Sweden)

Marcio Cinachi Pereira

2010-06-01

Full Text Available O objetivo deste trabalho foi determinar os fatores que afetam a altura da garupa em diferentes idades, em bovinos Nelore, e estimar a herdabilidade e as correlações genéticas entre esse caractere e as características reprodutivas e de crescimento. Os caracteres avaliados foram: altura da garupa à desmama, altura da garupa ao sobreano, peso à desmama, peso ao sobreano, perímetro escrotal e idade ao primeiro parto. Os fatores considerados foram: ano e mês de nascimento, rebanho, sexo, idade da vaca ao parto e idade do bezerro. Os componentes de variância e covariância foram estimados pela metodologia de máxima verossimilhança restrita, tendo-se utilizado um modelo animal. Todos os efeitos foram significativos para altura de garupa nas diferentes idades. As estimativas de herdabilidade quanto ao efeito genético direto indicaram que as características de crescimento e reprodutivas respondem à seleção, exceto a idade ao primeiro parto. As correlações genéticas entre as características de crescimento foram todas positivas e elevadas, de 0,42 a 0,90, o que indica que são determinadas em grande parte pelos mesmos conjuntos de genes de ação aditiva. Em razão das baixas magnitudes das estimativas de correlação genética (entre -0,14 e 0,16, a eficiência reprodutiva é pouco influenciada pela seleção quanto à altura de garupa.The objective of this work was to determine factors that affect hip height at different ages, in Nelore cattle, and to estimate the heritability and the genetic correlation between this character and reproductive and growth traits. The analyzed traits were: hip height at weaning, hip height at post weaning, weight at weaning, weight at post weaning, scrotal circumference, and age at first calving. The analyzed factors were: year and month of birth, herd, sex, age of dam at calving, and calf age. The variance covariance components were estimate by the restrict maximum likelihood methodology using animal

Efficacy evaluation of a commercial neem cake for control of Haematobia irritans on Nelore cattle Avaliação da eficácia de uma torta comercial de nim para o controle de Haematobia irritans em bovinos Nelore

Directory of Open Access Journals (Sweden)

Ana Carolina de Souza Chagas

2010-12-01

Full Text Available Much attention has been given to the development of botanical insecticides to provide effective natural control of cattle ectoparasites without harming animals, consumers, and environment. This study evaluated the efficacy of a commercial neem cake in controlling Haematobia irritans infestation on cattle. The study was conducted at the Embrapa Southeast Cattle Research Center (CPPSE, in São Carlos, SP, Brazil, from April to July 2008. The neem cake mixed in mineral salt in a 2% concentration was provided to 20 Nelore cows during nine weeks and had its efficacy evaluated by comparison of the infestation level against a control group. Fly infestations were recorded weekly by digital photographs of each animal from both groups and the number of flies was later counted in a computer-assisted image analyzer. Quantification of neem cake components by high-performance liquid chromatography revealed the presence of azadirachtin (421 mg.kg-1 and 3-tigloyl-azadirachtol (151 mg.kg-1 in the tested neem cake. Addition of the 2% neem cake reduced mineral salt intake in about 22%. The 2% neem cake treatment failed to reduce horn fly infestations on cattle during the 9-week study period.Muita atenção tem sido dada ao desenvolvimento de inseticidas vegetais buscando-se um efetivo controle de ectoparasitas de bovinos, sem prejudicar animais, consumidores e meio ambiente. Este estudo, realizado de abril a julho de 2008, na Embrapa Pecuária Sudeste, em São Carlos, SP, Brasil, avaliou a eficácia de uma torta comercial de nim (Azadirachta indica no controle da mosca-dos-chifres (Haematobia irritans em bovinos. A torta de nim, misturada ao sal mineral na concentração de 2%, foi fornecida a 20 vacas Nelore, durante nove semanas, e sua eficácia foi monitorada através de contagens semanais nos grupos tratado e controle. Infestações individuais foram registradas por meio de fotos digitais em todos os animais de ambos os grupos, e o número de moscas foi

Contagem de folículos antrais em fêmeas Nelore submetidas a inseminação artificial em tempo fixo

Directory of Open Access Journals (Sweden)

Alexandra Soares Rodrigues

2015-04-01

Full Text Available Objetivou-se categorizar a contagem de folículos antrais (CFA em fêmeas Nelore e posteriormente determinar o efeito de alguns parâmetros reprodutivos e do escore de condição corporal (ECC sobre a CFA, assim como, comparar a taxa de concepção entre fêmeas com distintas categorias de CFA submetidas a um protocolo de inseminação artificial em tempo fixo (IATF. Para tanto, 595 fêmeas Nelore foram submetidas a um protocolo para IATF; no D4 do protocolo, foi determinado o diâmetro ovariano (DOV, a presença de corpo lúteo (CL e a CFA. As inseminações foram executadas utilizando-se sêmen criopreservado. O diagnóstico de gestação foi realizado por ultrassonografia. As fêmeas foram dividas conforme a categoria animal, dias pós-parto (DPP, DOV, presença de CL e ECC. De acordo com a média da CFA, sugeriu-se uma categorização da CFA, a qual considerou baixa CFA ≤32, intermediária CFA entre 32 e 48 e alta CFA ≥48 folículos/animal. A categoria animal, os DPP e o ECC não afetaram a CFA dos animais. Entretanto, houve diferença entre a média de CFA na classe com maior DOV em comparação com as demais. A presença de CL influenciou na CFA dos animais. Em relação à fertilidade, não foi demonstrado efeito da CFA sobre a taxa de concepção das fêmeas submetidas à IATF. Os resultados encontrados sugerem que a CFA parece ser uma característica intrínseca, mantendo-se constante independente do status fisiológico do animal. Houve uma inter-relação positiva entre o DOV e CFA. A presença de CL influenciou a CFA. No entanto, a CFA não afeta a performance reprodutiva em programas de IATF

LUTEINIZING HORMONE SECRETION IN NELLORE HEIFER’S AFTER WEANING TO FIRST OVULATION CONCENTRAÇÃO DE LH EM NOVILHAS DA RAÇA NELORE DA DESMAMA À PRIMEIRA OVULAÇÃO

Directory of Open Access Journals (Sweden)

Daniel Cardoso

2009-12-01

Full Text Available

Cow allergen (Bos d2) and endotoxin concentrations are higher in the settled dust of homes proximate to industrial-scale dairy operations.

Science.gov (United States)

Williams, D' Ann L; McCormack, Meredith C; Matsui, Elizabeth C; Diette, Gregory B; McKenzie, Shawn E; Geyh, Alison S; Breysse, Patrick N

2016-01-01

Airborne contaminants produced by industrial agricultural facilities contain chemical and biological compounds that can impact the health of residents living in close proximity. Settled dust can be a reservoir for these contaminants and can influence long-term exposures. In this study, we sampled the indoor- and outdoor-settled dust from 40 homes that varied in proximity to industrial-scale dairies (ISD; industrial-scale dairy, a term used in this paper to describe a large dairy farm and adjacent waste sprayfields, concentrated animal feeding operation or animal feeding operation, that uses industrial processes) in the Yakima Valley, Washington. We analyzed settled dust samples for cow allergen (Bos d2, a cow allergen associated with dander, hair, sweat and urine, it is a member of the lipocalin family of allergens associated with mammals), mouse allergen (Mus m1; major mouse allergen, a mouse urinary allergen, in the lipocalin family), dust mite allergens (Der p1 (Dermatophagoides pteronissinus 1) and Der f1 (Dermatophagoides farinae 1)), and endotoxin (a component of the cell walls of gram negative bacteria, lipopolysaccharide, which can be found in air and dust and can produce a strong inflammatory response). A concentration gradient was observed for Bos d2 and endotoxin measured in outdoor-settled dust samples based on proximity to ISD. Indoor-settled dust concentrations of Bos d2 and endotoxin were also highest in proximal homes. While the associated health effects of exposure to cow allergen in settled dust is unknown, endotoxin at concentrations observed in these proximal homes (100 EU/mg) has been associated with increased negative respiratory health effects. These findings document that biological contaminants emitted from ISDs are elevated in indoor- and outdoor-settled dust samples at homes close to these facilities and extend to as much as three miles (4.8 km) away.

Association of ADIPOQ, OLR1 and PPARGC1A gene polymorphisms with growth and carcass traits in Nelore cattle

Science.gov (United States)

Fonseca, Patrícia D. da S.; de Souza, Fábio R.P.; de Camargo, Gregório M.F.; Gil, Fernanda M.M.; Cardoso, Diercles F.; Zetouni, Larissa; Braz, Camila U.; Boligon, Arione A.; Branco, Renata H.; de Albuquerque, Lucia G.; Mercadante, Maria E.Z.; Tonhati, Humberto

2015-01-01

In beef cattle farming, growth and carcass traits are important for genetic breeding programs. Molecular markers can be used to assist selection and increase genetic gain. The ADIPOQ, OLR1 and PPARGC1A genes are involved in lipid synthesis and fat accumulation in adipose tissue. The objective of this study was to identify polymorphisms in these genes and to assess the association with growth and carcass traits in Nelore cattle. A total of 639 animals were genotyped by PCR-RFLP for rs208549452, rs109019599 and rs109163366 in ADIPOQ, OLR1 and PPARGC1A gene, respectively. We analyzed the association of SNPs identified with birth weight, weaning weight, female yearling weight, female hip height, male yearling weight, male hip height, loin eye area, rump fat thickness, and backfat thickness. The OLR1 marker was associated with rump fat thickness and weaning weight (P < 0.05) and the PPARGC1 marker was associated with female yearling weight. PMID:25853056

Genetic trends in the expected progeny difference of the asymptotic weight of Nelore females

Directory of Open Access Journals (Sweden)

Analía del Valle Garnero

2006-01-01

Full Text Available There are few studies on weight covering the full life cycle of Zebu cattle, and there is no entire growth description or mean growth pattern for animals belonging to this breed. In order to provide such data, 1,158 Nelore females born between 1985 and 1995 were weighed 14,563 times from birth to full growth maturity, in ten herds spread over seven Brazilian states. The Von Bertalanffy, Brody, logistic and Gompertz non-linear models were used to obtain the asymptotic weights (A and the maturation rates (K. The (covariance and breeding value components for A and K were obtained by using the multiple trait derivative free restricted maximum likelihood method under the animal model. Genetic trends were calculated in function of the mean expected progeny differences (EPD for the trait (A or K divided by the number of animals according to their year of birth. The genetic trends of the expected progeny difference with reference to the date of birth of the cows were, on average, -6.5g y-1 for A and 2.0g y-1 for K, close to zero as confirmed by the low (0.0023 to 0.003 coefficient of regression values. The curve parameters are recommended as a selection criterion to reach precocity and avoid adult weight increase in the female herd.

Draft genome of the gayal, Bos frontalis

Science.gov (United States)

Wang, Ming-Shan; Zeng, Yan; Wang, Xiao; Nie, Wen-Hui; Wang, Jin-Huan; Su, Wei-Ting; Xiong, Zi-Jun; Wang, Sheng; Qu, Kai-Xing; Yan, Shou-Qing; Yang, Min-Min; Wang, Wen; Dong, Yang; Zhang, Ya-Ping

2017-01-01

Abstract Gayal (Bos frontalis), also known as mithan or mithun, is a large endangered semi-domesticated bovine that has a limited geographical distribution in the hill-forests of China, Northeast India, Bangladesh, Myanmar, and Bhutan. Many questions about the gayal such as its origin, population history, and genetic basis of local adaptation remain largely unresolved. De novo sequencing and assembly of the whole gayal genome provides an opportunity to address these issues. We report a high-depth sequencing, de novo assembly, and annotation of a female Chinese gayal genome. Based on the Illumina genomic sequencing platform, we have generated 350.38 Gb of raw data from 16 different insert-size libraries. A total of 276.86 Gb of clean data is retained after quality control. The assembled genome is about 2.85 Gb with scaffold and contig N50 sizes of 2.74 Mb and 14.41 kb, respectively. Repetitive elements account for 48.13% of the genome. Gene annotation has yielded 26 667 protein-coding genes, of which 97.18% have been functionally annotated. BUSCO assessment shows that our assembly captures 93% (3183 of 4104) of the core eukaryotic genes and 83.1% of vertebrate universal single-copy orthologs. We provide the first comprehensive de novo genome of the gayal. This genetic resource is integral for investigating the origin of the gayal and performing comparative genomic studies to improve understanding of the speciation and divergence of bovine species. The assembled genome could be used as reference in future population genetic studies of gayal. PMID:29048483

Exigências nutricionais de vacas nelores primíparas lactantes Nutritional requirements of primiparous lactating Nellore cows

Directory of Open Access Journals (Sweden)

Mozart Alves Fonseca

2012-05-01

Full Text Available Objetivou-se avaliar as exigências nutricionais de proteína e energia de vacas nelores em lactação no período de 0 a 180 dias. Foram utilizadas 20 vacas primíparas com peso corporal médio ao parto de 362±25 kg. Quatro vacas foram abatidas logo após o parto e foram consideradas grupo referência. Do parto aos 90 dias, quatro vacas receberam alimentação restrita na proporção de 1,5% do peso corporal (PC, em porcentagem da matéria seca (MS, e 12 foram alimentadas à vontade. Aos 90 dias do pós-parto, foram abatidas oito vacas (quatro de cada oferta alimentar. Dos 90 aos 180 dias, quatro vacas foram realocadas para mantença (1,8% PC em MS e quatro continuaram em consumo voluntário, sendo todas abatidas ao final do período. Os conteúdos corporais de proteína e energia foram estimados pelo equação Y = a . Xb, em que X é o peso de corpo vazio (PCVZ e a e b os parâmetros da equação. Foram obtidas relações médias de 0,894 para PCVZ/PC e de 0,936 para ganho de PCVZ (GPCVZ/ganho de PC (GPC. As exigências líquidas de energia para mantença (ELm foram de 97,84 kcal/PCVZ0,75 e as de energia metabolizável para mantença (EMm, 140,17 kcal/PCVZ0,75. As eficiências de utilização da energia para mantença e ganho de peso foram 0,70 e 0,44, respectivamente. Os conteúdos corporais de proteína diminuíram com o aumento do PC, enquanto os de energia aumentaram. No leite das vacas, foram determinados teores médios de 3,71; 3,88; e 4,74%, respectivamente, de proteína bruta, gordura e lactose. A exigência de ELm para lactação de vacas nelores é de 97,84 kcal/PCVZ0,75, enquanto a de EMm é de 140,17 kcal/PCVZ0,75 e a de proteína metabolizável, de 52,8 g. Para produzir 1 kg de leite com 4% de gordura, vacas nelores necessitam de 0,300 kg de NDT.This study was conducted to evaluate the nutritional requirements of protein and energy of primiparous lactating Nellore cows from 0 to 180 days after calving. A total of 20 lactating

Aktivitas Manusia dan Distribusi Banteng (Bos Javanicus D’alton 1832 di Taman Nasional Alas Purwo

Directory of Open Access Journals (Sweden)

Muhammad Ali Imron

2013-01-01

Full Text Available Human Activities and Distribution of Banteng (Bos Javanicus D’alton 1832 in Alas Purwo National Park This study aims to comprehend whether human activities contribute to the presence of banteng (Bos sundaicus d’Alton 1836 in the Alas Purwo National Park (APNP. We laid continuous strip line transects from centre of human activities to the direction of core area of APNP. Three locations were selected: Sadengan grazing area, Giri Salaka Hinduism praying area, and Kutorejo village; representing low to high human disturbance respectively. We collected both direct and indirect presence of banteng as well as human activities within 20 metre strip lines with 10 metre width. Data were compiled each 100 metres and analyzed with means comparison to observe difference among locations. Correlation analyses were used to assess the relation between distance from centre of human activities, human activities and banteng presence. Regression analysis was used when  significant correlations found. Our non parametric test showed that human disturbances are significantly different among sites (Kruskal Wallis Test; df 2 = 6.220, p< 0.05. In similar tendency but different manner, it is showed that the different levels of human disturbance conveyed significant difference in number of banteng’s tracks (Kruskal Wallis Test; df 2 = 18.888, p< 0.05. The distance from centre of human activities is negatively related to number of human tracks (Spearman rho; r2= -0.307 N= 64, p<0.05* and also to number of banteng’s tracks (Spearman rho, r2= -0.728 N= 30, p<0.05**. The regression analysis showed that number of human tracks explained 18.6% of total variation on number of Banteng’s tracks, while distance from centre of human activities explained 59%.

Alternative parameterizations of relatedness in whole genome association analysis of pre-weaning traits of Nelore-Angus calves

Directory of Open Access Journals (Sweden)

David G. Riley

2014-09-01

Full Text Available Gestation length, birth weight, and weaning weight of F2 Nelore-Angus calves (n = 737 with designed extensive full-sibling and half-sibling relatedness were evaluated for association with 34,957 SNP markers. In analyses of birth weight, random relatedness was modeled three ways: 1 none, 2 random animal, pedigree-based relationship matrix, or 3 random animal, genomic relationship matrix. Detected birth weight-SNP associations were 1,200, 735, and 31 for those parameterizations respectively; each additional model refinement removed associations that apparently were a result of the built-in stratification by relatedness. Subsequent analyses of gestation length and weaning weight modeled genomic relatedness; there were 40 and 26 trait-marker associations detected for those traits, respectively. Birth weight associations were on BTA14 except for a single marker on BTA5. Gestation length associations included 37 SNP on BTA21, 2 on BTA27 and one on BTA3. Weaning weight associations were on BTA14 except for a single marker on BTA10. Twenty-one SNP markers on BTA14 were detected in both birth and weaning weight analyses.

Research and development of evaluation system for photovoltaic power generation system. Research and survey on test and evaluation method for BOS component devices; Taiyoko hatsuden system hyoka gijutsu no kenkyu kaihatsu. Shuhen gijutsu hyoka system no kenkyu kaihatsu

Energy Technology Data Exchange (ETDEWEB)

Tatsuta, M [New Energy and Industrial Technology Development Organization, Tokyo (Japan)

1994-12-01

This paper reports the study results on R and D of the evaluation method for BOS component devices in fiscal 1994. (1) On the study on requirements of BOS component devices for practical use, the study results on storage battery, inverter, protective device for system interconnection, and effective use means for storage battery were summarized. On the future device technology, it was clarified that the following value added technologies are promising: simple design of inverter circuit, cost reduction by common specification and mass production, and stabilization of voltage and compensation of momentary peak load by combining inverter with small-capacity storage batteries. (2) On the study on the performance test method for BOS component devices, basic characteristic (capacity, efficiency) test, PSOC charge/discharge cycle test, and accelerated life cycle test were performed for 4 kinds of new storage batteries developed by NEDO. The whole characteristic test results satisfied specifications, and long-term cycle test is in promotion for all new storage batteries. 3 figs., 4 tabs.

Objective Measures for the Assessment of Post-Operative Pain in Bos indicus Bull Calves Following Castration

Science.gov (United States)

Musk, Gabrielle C.; Hyndman, Timothy H.; Lehmann, Heidi S.; Tuke, S. Jonathon; Collins, Teresa; Johnson, Craig B.

2017-01-01

Simple Summary Surgical castration of cattle is a common husbandry procedure, and although this procedure is known to cause pain in cattle and other species, in some countries it is often performed without anaesthesia or analgesia. Society is increasingly aware of this animal welfare issue and it is creating pressure to drive research into animal welfare science with the aim of identifying practical and economical approaches to pain management in livestock. To effectively manage pain, a pain assessment must be performed. Pain assessment methods are often subjective and therefore influenced by the observer. Ideally, objective assessments that generate consistent and repeatable results between observers should be identified. Bos indicus bull calves were divided into four groups: no castration (NC, n = 6); castration with pre-operative local anaesthetic (CL n = 12); castration with pre-operative anti-inflammatory medication (CM, n = 12); and, castration without pain relief (C, n = 12). A range of objective assessments was performed: bodyweight measurements, activity, and rest levels, and four different compounds in the blood. The results of this study suggest that animals rest for longer periods after the pre-operative administration of anti-inflammatory medication. The other objective assessments measured in this study were not able to consistently differentiate between treatment groups. These findings emphasise the need for alternative quantifiable and objective indicators of pain in Bos indicus bull calves. Abstract The aim of the study was to assess pain in Bos indicus bull calves following surgical castration. Forty-two animals were randomised to four groups: no castration (NC, n = 6); castration with pre-operative lidocaine (CL, n = 12); castration with pre-operative meloxicam (CM, n = 12); and, castration alone (C, n = 12). Bodyweight was measured regularly and pedometers provided data on activity and rest from day −7 (7 days prior to surgery) to 13. Blood

Conforto térmico de bovinos da raça nelore a pasto sob diferentes condições de sombreamento e a pleno sol Thermal comfort of nelore bovine in pasture under several lighting conditions

Directory of Open Access Journals (Sweden)

Franciele C. Navarini

2009-01-01

Full Text Available Principalmente em regiões de clima quente, a produção bovina sob condições de pasto pode ser melhorada com o uso de sombra natural para minimizar o estresse por calor. Desse modo, o objetivo do presente estudo foi avaliar o efeito do estresse térmico por meio de índices de conforto térmico na produção bovina sob diferentes condições de sombreamento natural. Este estudo foi conduzido na região oeste do Estado do Paraná, no período de janeiro a fevereiro de 2007. O delineamento experimental foi o inteiramente casualizado, com três tratamentos constituídos de árvores formando pequenos bosques, árvores isoladas e condição não sombreada. A cada um desses tratamentos foi submetido um grupo de dez animais da raça Nelore (repetições. Os valores diários de velocidade do vento, temperatura de globo negro, temperatura de bulbo seco e temperatura de bulbo molhado foram registrados a cada três horas a partir de 9 às 18 h. A temperatura da superfície corporal animal foi registrada com a mesma frequência. Para cada tratamento, com base nessas medidas, foram calculados o índice de temperatura e umidade (ITU, índice de temperatura de globo e umidade (ITGU e a carga térmica de radiação (CTR. Os valores de ITU variaram de 70 a 87, os de ITGU entre 73 e 93 e os de CTR entre 450 e 672 W m-2. O ambiente que proveu melhores condições térmicas para os animais foi constituído por pequenos bosques de árvores de Guajuvira.Mainly in hot climate conditions, the beef cattle production under pasture can be improved with the use of natural shade to minimize the heat stress. Therefore, the objective of the present study was to evaluate the effect of the thermal stress using thermal comfort indexes on the beef cattle production under different conditions of natural shade. This study was carried out in the West region of the State of Paraná in January and February 2007. The experimental design was completely randomized with three

Efecto de la manipulación del semen criopreservado de bovinos Bos Taurus sobre la integridad espermática

OpenAIRE

Norberto Villa-Duque; Claudia Marcela Amaya-Torres; Darwin García-Rojas; Natalia Nieto-Omeara; Natalia Terán-Acuña

2016-01-01

En el estudio se evaluó el efecto de descongelar y aplicar semen de bovinos Bos Taurus en 33 ganaderías del Magdalena Medio colombiano, y se estudió in vitro el efecto de la injuria encontrada sobre la integridad de las membranas espermáticas. La información en fincas se recopiló mediante formulario específico, mientras que el estudio in vitro se ejecutó en el laboratorio de Biotecnología Reproductiva Animal del Instituto Universitario de la Paz (Barrancabermeja, Santander). El estudio consis...

Composição corporal e exigências de energia de mantença em bovinos Nelore, puros mestiços, em confinamento Body composition and net energy requirements for maintenance of feedlot purebred and crossbred Nellore young bulls

Directory of Open Access Journals (Sweden)

José Antônio de Freitas

2006-06-01

Full Text Available Objetivou-se estimar a composição corporal de gordura e proteína e as exigências de energia de mantença em bovinos Nelore puros e mestiços. Foram utilizados 72 bovinos machos (18 Nelore, 18 F1 Nelore x Angus, 18 F1 Nelore x Pardo- Suíço e 18 F1 Nelore x Simental não-castrados, com 10 a 11 meses de idade e peso médio inicial de 286, 309, 333 e 310 kg, respectivamente. O delineamento utilizado foi o inteiramente casualizado, com quatro grupos genéticos, submetidos a quatro níveis de concentrado na ração (30, 40, 60 e 70%. No início do experimento, três animais de cada grupo genético foram alocados no grupo de alimentação restrita e três foram abatidos no grupo de abate inicial. As exigências líquidas de energia para mantença (ELm foram obtidas pela regressão da produção de calor (kcal/kg0,75/dia em função do consumo de energia metabolizável (CEM - Mcal/kg0,75/dia, extrapolando-se para o nível zero de ingestão de EM. Não houve diferenças nas exigências de energia líquida de mantença (ELm entre os grupos genéticos. Verificou-se elevação de 260,2; 92,6 e 67,8% nos conteúdos corporais de gordura e proteína e na concentração de gordura (g/kg de peso corporal vazio - PCV, com elevação de 250 para 550 kg no peso vivo, ao passo que a concentração de proteína corporal reduziu em 10,9%. O teste de identidade de modelos não-lineares indicou não haver diferenças entre os grupos genéticos para a composição corporal de gordura, proteína e energia e nas ELm. Desse modo, o valor da ELm foi estimado em 79 kcal/kg0,75/dia.The objectives of this trial were to estimate the body composition of fat and protein and the net energy requirements for maintenance of purebred and crossbred Nellore. Seventy-two young bulls averaging 10 to 11 months of age from four genetic groups were used: 18 Nellore, 18 F1 Nellore x Angus, 18 F1 Nellore x Brown Swiss and 18 F1 Nellore x Simental with initial average weights of 286, 309

Taxa de prenhez de vacas Nelore x Hereford em ambiente subtropical sob restrição alimentar Pregnancy rate of crossbred Nellore-Hereford cows in subtropical conditions under feeding restriction

Directory of Open Access Journals (Sweden)

Roberto Andrade Grecellé

2006-08-01

Full Text Available Foi desenvolvido um experimento para identificar os efeitos que influenciam a taxa de prenhez de 117 vacas de corte Nelore x Hereford aos 2 e 20 anos de idade e com diferentes frações gênicas de Nelore (25,0; 37,5; 50,0 e 100,0%, paridas no período de 11/08/03 a 23/12/03 e acasaladas, por monta natural, entre 10/12/03 e 12/03/04. Foram avaliados os efeitos dos fatores data juliana de parto (DJ, peso ao nascer (PN, sexo do bezerro (S do parto anterior, ordem de parto (OP, altura de garupa (H, peso ao início do acasalamento (PI, escore de condição corporal ao início do acasalamento (ECCI, ganho diário médio de peso durante o acasalamento (GDA, fração gênica de Nelore (FGN e peso ao desmame ajustado (PAJ205 do parto anterior sobre a probabilidade de prenhez e de concepção. Os dados foram submetidos à análise de regressão logística, por meio do procedimento LOGISTIC do pacote computacional SAS, para identificar os efeitos de cada variável. A média da taxa de prenhez foi de 43,2%. A probabilidade de prenhez e as chances de concepção foram explicadas pelas variações de DJ, PI, ECCI e GDA. A mudança na chance de prenhez para cada acréscimo na variável regressora foi estimada com base na estatística da razão entre chances (odds ratio, determinada por OR = exp(b k, considerando que chance é a razão entre a probabilidade de o evento ocorrer e a de não ocorrer. Não foram observados efeitos significativos de PN, S, OP, H, FGN e PAJ205. Portanto, para aumentar as taxas de prenhez de vacas de corte, são necessárias melhorias no escore de condição corporal (ECC no início do acasalamento e no ganho de peso (GP durante a estação de monta, ambos decorrentes de adequada nutrição pré e pós-parto.This experiment was conducted to evaluate factors affecting pregnancy rate of 117 crossbred Nelore x Hereford beef cows with age varying from 2 to 20 years, different gene proportion from Nellore breed (25.0, 37.5, 50.0, and 100

Influence of the development phase of the dominant follicle on the superovulatory response in Nelore heifers

Directory of Open Access Journals (Sweden)

Mayra Elena Ortiz D'’Avila Assumpção

1999-01-01

Full Text Available O objetivo deste trabalho foi avaliar a influência do folículo dominante nas fases de crescimento, estática e de regressão sobre a resposta superovulatória em 18 ciclos estrais de 9 novilhas da raça Nelore. Avaliaram-se os ovários entre o dia 6 e o dia 10 do ciclo estral pela técnica de ultra-sonografia, medindo-se o diâmetro do maior folículo e contando-se o número de folículos subordinados. Os animais foram superovulados com 400 ou 500 UI de FSH/LH, iniciando-se no dia 10 do ciclo estral, em subdoses decrescentes, por 4 dias consecutivos. Aplicou-se PGF2alfa concomitante com a quinta subdose de FSH/LH e realizaram-se inseminações artificiais às l2 horas e às 24 horas após o início dos sintomas de estro. Os embriões foram colhidos no dia 6,5 após a primeira inseminação artificial, obtendo-se 3,00; 3,83 e 10,17 embriões, respectivamente, nas fases de crescimento, estática e regressão. Observaram-se melhores resultados quanto ao número de embriões quando o folículo dominante se encontrava em fase de regressão.

Iberian Odonata distribution: data of the BOS Arthropod Collection (University of Oviedo, Spain)

Science.gov (United States)

Torralba-Burrial, Antonio; Ocharan, Francisco J.

2013-01-01

Abstract Odonata are represented from the Iberian Peninsula by 79 species. However, there exists a significant gap in accessible knowledge about these species,especially regarding their distribution. This data paper describes the specimen-based Odonata data of the Arthropod Collection of the Department of Biología de Organismos y Sistemas (BOS), University of Oviedo, Spain. The specimens were mainly collected from the Iberian Peninsula (98.63% of the data records), especially the northern region. The earliest specimen deposited in the collection dates back to 1950, while the 1980’s and 2000’s are the best-represented time periods. Between 1950 and 2009, 16, 604 Odonata specimens were deposited and are documented in the dataset. Approximately 20% of the specimens belong to the families Coenagrionidae and Calopterygidae. Specimens include the holotype and paratypes of the Iberian subspecies Calopteryx haemorrhoidalis asturica Ocharan, 1983 and Sympetrum vulgatum ibericum Ocharan, 1985. The complete dataset is also provided in Darwin Core Archive format. PMID:23794917

Estimativas de herdabilidade para idade ao primeiro parto de novilhas da raça Nelore Heritability estimates for age at first calving in Nelore cattle

Directory of Open Access Journals (Sweden)

Laila Talarico Dias

2004-02-01

Full Text Available Estimaram-se parâmetros genéticos para idade ao primeiro parto (IPP de, aproximadamente, 6.000 novilhas, utilizando-se três diferentes definições de grupo contemporâneo (GC. Foram considerados no modelo o efeito aleatório de animal e os efeitos fixos de GC, além dos efeitos linear e quadrático da idade da mãe da novilha ao parto (IDV. A primeira definição de grupo contemporâneo (GC1 considerou as variáveis fazenda, ano, estação de nascimento, grupo de manejo de nascimento, desmama e sobreano e tipo de serviço (monta natural, monta controlada ou inseminação artificial. A segunda definição de grupo contemporâneo (GC2 incluiu as mesmas variáveis de GC1, além de ano e estação do parto. A terceira definição de grupo contemporâneo considerou as variáveis ano e estação de nascimento, fazenda, ano e estação do parto e tipo de cobertura. As estimativas de herdabilidade para IPP foram de 0,16 ± 0,03, 0,09 ± 0,03 e 0,11 ± 0,02, considerando-se GC1, GC2 e GC3, respectivamente.Genetic parameters were estimated for, approximately, 6,000 records of age at first calving (IPP in Nelore cattle using three different definitions for contemporary group. The univariate analysis considered as fixed effect: contemporary group (GC and linear and quadratic effects of dam age (IDV. First contemporary group (GC1 was defined by farm, year and season at birth, management group at birth, weaning and yearling and mating type. Second contemporary group (GC2 included the same variables of GC1 and year and season at calving. Third contemporary group (GC3 was determined by year and season of birth, farm, year and season of calving and mating type. The heritability estimates for IPP were 0.16 ± 0.03, 0.09 ± 0.03 e 0.11 ± 0.02, respectively, to GC1, GC2 and GC3.

Efeito da seleção para crescimento na permanência de vacas Nelore no rebanho até cinco anos de idade Effect of selection for growth on the stayability of Nelore cows up to five years of age

Directory of Open Access Journals (Sweden)

Maria Eugênia Zerlotti Mercadante

2004-04-01

Full Text Available Registros de 1021 vacas Nelore foram analisados com o objetivo de estudar o efeito da seleção para crescimento na permanência de fêmeas no rebanho até cinco anos de idade, considerando-se que ela foi selecionada (P5|S. A variável, codificada como 0=descartada ou 1=não descartada, foi analisada com modelo de limiar. As vacas, nascidas de 1981 a 1997, foram provenientes dos rebanhos selecionados (NeS e NeT e controle (NeC da Estação Experimental de Zootecnia de Sertãozinho. Nos rebanhos NeS e NeT, foram selecionados animais com diferenciais de seleção máximos, dentro de rebanho e ano, e em NeC aqueles com diferenciais de seleção nulos, para peso ao sobreano. Após 3,5 gerações de seleção, o peso à seleção das fêmeas dos rebanhos NeS e NeT foi 22% maior que das fêmeas do NeC. A média observada de P5|S foi 68%. Os efeitos de rebanho e peso à seleção foram não significativos. O efeito da geração ao qual a fêmea pertence foi significativo, com tendência, similar nos três rebanhos, de diminuição da P5|S ao longo dos anos, refletindo as mudanças de manejo de novilhas à primeira monta, e não o efeito da seleção para crescimento. As variâncias de origem genética aditiva, estimadas por modelo animal, modelo touro e modelo touro avô-materno, foram 0,06; 0,16 e 0,17, proporcionalmente à sigma²e fixa em uma unidade da medida, e as herdabilidades iguais a 0,06±0,06; 0,15±0,13 e 0,16±13, respectivamente. As médias dos valores genéticos dos touros, por ano de nascimento, mostraram variação, sem tendência de alteração e de diferenciação entre os rebanhos no decorrer dos anos. A seleção para peso ao sobreano dentro de rebanho, por 3,5 gerações de seleção, não afetou a permanência das vacas no rebanho até cinco anos de idade. O modelo touro de limiar foi capaz de separar a mudança genética da mudança ambiental.Records of 1021 Nelore cows were analyzed in order to evaluate the effect of selection

Vaccine-induced rabies case in a cow (Bos taurus): Molecular characterisation of vaccine strain in brain tissue.

Science.gov (United States)

Vuta, Vlad; Picard-Meyer, Evelyne; Robardet, Emmanuelle; Barboi, Gheorghe; Motiu, Razvan; Barbuceanu, Florica; Vlagioiu, Constantin; Cliquet, Florence

2016-09-22

Rabies is a fatal neuropathogenic zoonosis caused by the rabies virus of the Lyssavirus genus, Rhabdoviridae family. The oral vaccination of foxes - the main reservoir of rabies in Europe - using a live attenuated rabies virus vaccine was successfully conducted in many Western European countries. In July 2015, a rabies vaccine strain was isolated from the brain tissues of a clinically suspect cow (Bos taurus) in Romania. The nucleotide analysis of both N and G gene sequences showed 100% identity between the rabid animal, the GenBank reference SAD B19 strain and five rabies vaccine batches used for the national oral vaccination campaign targeting foxes. Copyright © 2016 Elsevier Ltd. All rights reserved.

Composição do ganho e exigências de energia e proteína para ganho de peso em bovinos Nelore puros e mestiços Gain composition and net energy and protein requirements for weight gain in Nellore and crossbred cattle

Directory of Open Access Journals (Sweden)

José Antônio de Freitas

2006-06-01

Full Text Available Objetivou-se estimar a composição do ganho e as exigências de energia e proteína para ganho de peso em bovinos Nelore puros e mestiços. Utilizaram-se 60 bovinos machos (Nelore, F1 Nelore x Angus, F1 Nelore x Pardo-Suíço e F1 Nelore x Simental não-castrados, com 10 a 11 meses de idade e peso médio inicial de 286, 309, 333 e 310 kg, respectivamente. O delineamento utilizado foi o inteiramente casualizado, com quatro grupos genéticos, submetidos a quatro níveis de concentrado na ração (30, 40, 60 e 70%. Três animais de cada grupo genético foram abatidos ao início do experimento e serviram como referência na determinação da composição corporal inicial. As exigências líquidas de proteína e energia para ganho de 1 kg de peso corporal vazio (PCV foram estimadas pela equação Y' = a. b. X (b-1, em que a e b são os coeficientes das equações de regressão dos conteúdos de energia e proteína e X, o PCV dos animais. O teste de identidade de modelos não-lineares indicou não haver diferenças entre grupos genéticos para as exigências de energia e proteína para ganho de peso. Verificou-se decréscimo de 10,6% nas exigências de proteína e elevação de 37,8% nas exigências de energia para ganho de peso entre 250 e 550 kg, o que está relacionado à elevação do teor de gordura e à redução no teor de proteína com o acréscimo no PCV. As exigências líquidas de proteína e energia para ganho de peso foram estimadas em 143,5 g e 4,7 Mcal para o peso vivo de 450 kg.The objectives of this trial were to estimate gain composition and energy and protein requirements for weight gain of purebred and crossbred Nellore. Sixty young bulls averaging 10 to 11 months of age from four genetic groups: Nellore, F1 Nellore x Angus, F1 Nellore x Brown Swiss and F1 Nellore x Simental and initial average body weights of 286, 309, 333 and 310 kg, respectively, were used in this study. A completely randomized design was adopted and bulls from

Testicular Histomorphometric Evaluation of Zebu Bull Breeds

Directory of Open Access Journals (Sweden)

Paulo Antônio Terrabuio Andreussi

2014-12-01

Full Text Available The objective of this study was to evaluate the quantitative histology and testicular biometrics in zebu bulls of different breeds. Testicular fragments of Nelore (n=10, Polled Nelore (n=6, Gir (n=5, Guzerat (n=5 and Tabapuã bulls (n=5 were used. The fragments were perfusion-fixed in Karnovsky solution, embedded in glycol methacrylate and stained with toluidine blue-1% sodium borate. The Nelore animals had a higher tubular volumetric proportion (85.2% and greater height of the seminiferous epithelium (73.2 µm than the Gir, Guzerat and Tabapuã breeds. The Nelore animals also had a higher volumetric proportion of Leydig cells (5.2% than the Guzerat and Tabapuã breeds. There was no significant difference for any of these parameters between the Nelore and Polled Nelore breeds. The gonadosomatic index, seminiferous tubule diameter, cross-sectional area of the seminiferous tubule and tubule length (total length and length per gram of testicular parenchyma did not vary among the breeds studied. The morphometric parameters evaluated suggested that the genetic selection applied to the Nelore and Polled Nelore breeds improved the efficiency of spermatogenesis in these breeders.

Evaluation of a second uterine flushing on embryo recovery in Nelore cows / Avaliação de uma segunda lavagem uterina sobre a recuperacão de embriões em vacas Nelore

Directory of Open Access Journals (Sweden)

Marcelo Marcondes Seneda

2008-08-01

Full Text Available The objective of the present study was to evaluate the effect of a second uterine flushing on number of recovered embryos. Cyclic Nelore cows (n= were used as donors. Animals were kept under grazing conditions in a farm at Mamborê, Paraná state. Cows were submitted to two sessions of multiple ovulation 80 days apart. At a random stage of estrus cycle (Day 0 donors received an intravaginal device with 1.9 g of progesterone (CIDR; Pfizer; Brasil. Twenty four hours later (Day 1 cows were injected with 2.5 mg/ IM of Estradiol Benzoate (Estrogin, Farmavet, Brasil. Between Day 5 and Day 9, donors received decreasing doses of 250 UI of FSH (Pluset; Calier, Brasil. On Days 7 and cows received 25 mg/ IM of dinoprost (Lutalyse, Pfizer, Brasil and progesterone implants were removed 12 hs later. Artificial insemination was performed 12 and 24 hours after estrus detection. The first embryo recovery was performed 7 days after AI with the Foley catheter positioned in the uterine body. A total of 1.000 mL of PBS (Embriocare, Cultilab, Brasil was used in a closed system of uterine flushing, with a 70 µm filter. Recovered uterine fluid was evaluated under a stereomicroscope (SMZ 654, Nikon, Japan and embryos were classified accord to IETS (1998. Twenty four hours later, the second uterine flushing was performed following the same procedure. Results were analyzed by t-Student test (p O objetivo do presente experimento foi verificar a viabilidade de uma segunda lavagem uterina sobre a recuperação de embriões. Doadoras cíclicas da raça Nelore (n= foram mantidas a pasto no município de Mamborê, Estado do Paraná. Os animais foram submetidos a tratamentos de superovulação com intervalo de 80 dias. Em um dia aleatório do ciclo estral (Dia 0 as doadoras receberam um dispositivo intravaginal contendo 1,9 g de progesterona (CIDR; Pfizer, Brasil. Vinte e quatro horas após (Dia 1 administrou-se , mg de benzoato de Estradiol (Estrogin; Farmavet, Brasil por via

El ADN antiguo aplicado a contextos arqueopaleontológicos: el caso de la cueva de Arlanpe (Lemoa, Bizkaia

Directory of Open Access Journals (Sweden)

Iriarte, E.

2011-01-01

Full Text Available Los estudios de ADN antiguo están permitiendo conocer nuevos datos sobre la biología de especies actuales y extintas. Las técnicas de ADN antiguo pueden ser una herramienta adicional y complementaria dentro de los estudios multidisciplinares que son necesarios para abordar distintas problemáticas arqueopaleontológicas. En este artículo repasamos algunas de las aplicaciones en estos contextos: la determinación taxonómica y sexual, los estudios para conocer el proceso de domesticación, o la estructura filogeográfica durante ciclos glaciares subrayando la existencia o no de refugios glaciares. También proporcionamos información preliminar referente a la aplicación de estas técnicas en el yacimiento de Arlanpe (Lemoa, Bizkaia. En este yacimiento hemos obtenido ADN mitocondrial de muestras de oso pardo, gran bóvido y cabra montés. Una de las muestras de oso pardo de Arlanpe está dentro del clado 3c compuesto de osos pardos extintos de Alaska. Dos de las muestras de gran bóvido de Arlanpe han sido clasificadas como uro (Bos primigenius mediante métodos genéticos.

Genotype by environment interaction for 450-day weight of Nelore cattle analyzed by reaction norm models

Directory of Open Access Journals (Sweden)

Newton T. Pégolo

2009-01-01

Full Text Available Genotype by environment interactions (GEI have attracted increasing attention in tropical breeding programs because of the variety of production systems involved. In this work, we assessed GEI in 450-day adjusted weight (W450 Nelore cattle from 366 Brazilian herds by comparing traditional univariate single-environment model analysis (UM and random regression first order reaction norm models for six environmental variables: standard deviations of herd-year (RRMw and herd-year-season-management (RRMw-m groups for mean W450, standard deviations of herd-year (RRMg and herd-year-season-management (RRMg-m groups adjusted for 365-450 days weight gain (G450 averages, and two iterative algorithms using herd-year-season-management group solution estimates from a first RRMw-m and RRMg-m analysis (RRMITw-m and RRMITg-m, respectively. The RRM results showed similar tendencies in the variance components and heritability estimates along environmental gradient. Some of the variation among RRM estimates may have been related to the precision of the predictor and to correlations between environmental variables and the likely components of the weight trait. GEI, which was assessed by estimating the genetic correlation surfaces, had values < 0.5 between extreme environments in all models. Regression analyses showed that the correlation between the expected progeny differences for UM and the corresponding differences estimated by RRM was higher in intermediate and favorable environments than in unfavorable environments (p < 0.0001.

Bosón de Higgs o la partícula de Dios: Entre el hito investigador y la quimera

OpenAIRE

Sanz Pascual, Julián

2013-01-01

Últimamente ha habido una eclosión informativa respecto a un descubrimiento científico que se supone va a ser histórico, la detección en el acelerador de partículas LHC de la partícula denominada el bosón de Higgs, bautizada como la partícula de Dios. Cabe considerar que la detección de esta partícula puede suponer una clave que va a revolucionar la física. Nosotros, que no somos físicos especializados, sino que pertenecemos a la filosofía, vamos a intentar una visión del tema desde ...

Genital tract of zebu (Bos indicus cows in Niger

Directory of Open Access Journals (Sweden)

M. Moussa Garba

2014-01-01

Full Text Available The anatomical characteristics, and the ovarian and pathological structures of the genital tract of 500 zebu (Bos indicus females belonging to four breeds (Azawak, Bororo, Djelli, Goudali were studied at Niamey’s slaughterhouse in Niger from August 15 to December 15, 2011. Each animal was examined before slaughter. The cows and heifers were on average 8 ± 2.5 years old. Their mean body condition score was 1.6 ± 0.6 and mean carcass weight 113 ± 21 kg. The anatomical characteristics of the genital tract did not show differences between breeds (p > 0.05. The following characteristics were observed: cervix diameter 3.4 ± 1.1 cm, cervix length 8.1 ± 2.5 cm, horn length 21.6 ± 5.2 cm, horn diameter 1.6 ± 0.5 cm, length and width of the right ovary 19.8 ± 4.4 and 11.2 ± 3.8 mm, of the left ovary 18.8 ± 4.5 and 10.2 ± 3.3 mm, and weight of the right and left ovaries 2.9 ± 1.8 and 2.5 ± 1.6 g, respectively. A corpus luteum was identified in only 14% cases and no visible follicles were found on the surface of the ovaries in 32% cases. These characteristics were significantly (p < 0.05 influenced by the age of the animal. Among the examined females, 7.4% were confirmed pregnant. Various genital tract diseases (cysts, uterine infection, free martinism, pyometra... were observed in 10.4% of the genital tracts.

Feed Intake and Weight Changes in Bos indicus-Bos taurus Crossbred Steers Following Bovine Viral Diarrhea Virus Type 1b Challenge Under Production Conditions

Directory of Open Access Journals (Sweden)

Chase A. Runyan

2017-12-01

Full Text Available Bovine viral diarrhea virus (BVDV has major impacts on beef cattle production worldwide, but the understanding of host animal genetic influence on illness is limited. This study evaluated rectal temperature, weight change and feed intake in Bos indicus crossbred steers (n = 366 that were challenged with BVDV Type 1b, and where family lines were stratified across three vaccine treatments of modified live (MLV, killed, (KV or no vaccine (NON. Pyrexia classification based on 40.0 °C threshold following challenge and vaccine treatment were investigated for potential interactions with sire for weight change and feed intake following challenge. Pyrexia classification affected daily feed intake (ADFI, p = 0.05, and interacted with day (p < 0.001 for ADFI. Although low incidence of clinical signs was observed, there were marked reductions in average daily gain (ADG and cumulative feed intake during the first 14 day post-challenge; ADG (CV of 104% and feed efficiency were highly variable in the 14-day period immediately post-challenge as compared to the subsequent 14-day periods. A sire × vaccine strategy interaction affected ADFI (p < 0.001, and a sire by time period interaction affected ADG (p = 0.03 and total feed intake (p = 0.03. This study demonstrates that different coping responses may exist across genetic lines to the same pathogen, and that subclinical BVDV infection has a measurable impact on cattle production measures.

Shiga toxin-producing Escherichia coli in yaks (Bos grunniens from the Qinghai-Tibetan Plateau, China.

Directory of Open Access Journals (Sweden)

Xiangning Bai

Full Text Available Shiga toxin (Stx-producing Escherichia coli (STEC are recognized as important human pathogens of public health concern. Many animals are the sources of STEC. In this study we determined the occurrence and characteristics of the STEC in yaks (Bos grunniens from the Qinghai-Tibetan plateau, China. A total of 728 yak fecal samples was collected from June to August, 2012 and was screened for the presence of the stx 1 and stx 2 genes by TaqMan real-time PCR after the sample was enriched in modified Tryptone Soya Broth. Of the 138 (18.96% stx 1 and/or stx 2-positive samples, 85 (61.59% were confirmed to have at least 1 STEC isolate present by culture isolation, from which 128 STEC isolates were recovered. All STEC isolates were serotyped, genotyped by pulsed-field gel electrophoresis (PFGE and characterized for the presence of 16 known virulence factors. Fifteen different O serogroups and 36 different O:H serotypes were identified in the 128 STEC isolates with 21 and 4 untypable for the O and H antigens respectively. One stx 1 subtype (stx 1a and 5 stx 2 subtypes (stx 2a, stx 2b, stx 2c, stx 2d and stx 2g were present in these STEC isolates. Apart from lpfA O157/OI-141, lpfA O157/OI-154, lpfA O113, katP and toxB which were all absent, other virulence factors screened (eaeA, iha, efa1, saa, paa, cnf1, cnf2, astA, subA, exhA and espP were variably present in the 128 STEC isolates. PFGE were successful for all except 5 isolates and separated them into 67 different PFGE patterns. For the 18 serotypes with 2 or more isolates, isolates of the same serotypes had the same or closely related PFGE patterns, demonstrating clonality of these serotypes. This study was the first report on occurrence and characteristics of STEC isolated from yaks (Bos grunniens from the Qinghai-Tibetan plateau, China, and extended the genetic diversity and reservoir host range of STEC.

The Brazilian beef production chain has experienced an increase in ...

African Journals Online (AJOL)

ANA CAROLINA

Heat tolerance of Nelore, Senepol x Nelore and Angus x Nelore heifers in the ... 4 Graduate student, Federal University of São Carlos (UFSCAR) – São Carlos – Brasil .... Globe Humidity-Index (BGHI) as comfort equation for dairy cows.

Exigências nutricionais de bezerros nelores lactentes Nutritional requirements of nursing Nellore calves

Directory of Open Access Journals (Sweden)

Mozart Alves Fonseca

2012-05-01

Full Text Available Este trabalho foi conduzido com o objetivo de avaliar as exigências de proteína, energia e macrominerais de bezerros nelores do nascimento aos 180 dias. Foram utilizados 20 bezerros (10 machos e 10 fêmeas com peso corporal médio de 30±3 kg. Imediatamente após o nascimento, quatro bezerros, dois machos e duas fêmeas, foram abatidos para estimar a composição corporal inicial dos animais restantes no experimento. Aos 90 dias, foram abatidos oito bezerros (quatro machos e quatro fêmeas, o restante dos animais abatidos aos 180 dias. Além do leite, os bezerros foram alimentados com silagem de milho à vontade e concentrado comercial fixado em no máximo 0,5 kg/animal/dia. Foram conduzidos dois ensaios de digestibilidade, aos 30 e 90 dias para estimar os consumos de energia dos bezerros. Após o abate, todos os bezerros tiveram suas meias-carcaças direitas dissecadas. Os conteúdos corporais de proteína, energia e minerais foram estimados pela equação Y = a . PCVZb, sendo PCVZ o peso de corpo vazio. A relação PCVZ/PC dos bezerros foi de 0,9622 e a de ganho (G de PCVZ/GPC foi de 0,958. As exigências líquidas de proteína e energia aumentaram com o aumento do peso corporal, enquanto as de cálcio diminuíram. As exigências de proteína metabolizável para ganho de 1 kg de PC foram de 216,96 e 261,98 g para bezerros de 100 e 200 kg, respectivamente. Recomenda-se utilizar as seguintes equações para estimar os conteúdos corporais de bezerros Nelore lactentes: proteína (g/dia = 0,135 × PCVZ1,0351; energia (Mcal/dia = 1,1798 × PCVZ1,1805; cálcio (g/dia = 0,091 × PCVZ0,6019; fósforo (g/dia = 0,00894 × PCVZ0,9629; sódio (g/dia = 0,00126 × PCVZ0,9791; magnésio (g/dia = 0,000405 × PCVZ0,9827; potássio (g/dia = 0,00165 × PCVZ0,9364.This experiment was carried out to evaluate the nutritional requirements of protein, energy and macro minerals for Nellore calves from birth to 180 days. A total of 20 calves, 10 males (M and 10

Análise de polimorfismo do gene da somatotropina em vacas Nelore e seu efeito sobre o peso à desmama de suas progênies Polimorphism analisys of somatotropin gene on Nelore cows and effect on weaning weight of the calf

Directory of Open Access Journals (Sweden)

F.J.C. Faria

1999-12-01

Full Text Available Informações sobre peso à desmama de um rebanho Nelore foram utilizadas após ajuste para idade padrão de 205 dias, sexo da cria, idade da mãe, touro e mês de desmama, para separar as reprodutrizes em dois grupos, cujos filhos diferiam nesse peso. As médias ajustadas pelo método dos quadrados mínimos foram para os grupos pesado (P e leve (L de 163,21± 2,18kg e 134,44± 2,18kg, respectivamente, com 41 animais em cada grupo. Essas reprodutrizes foram submetidas à coleta de sangue para estudo de polimorfismos do gene da somatotropina bovina, pela técnica de PCR-RFLP (polymerase chain reaction-restriction fragment length polymorphism. A amplificação de uma região entre o éxon III e V do gene da somatotropina permitiu analisar dois sítios de restrição. Para o sítio do éxon V, todos os animais foram identificados como monomórficos (Leu-Leu. Quanto ao sítio do íntron 3, foi possível identificar os seguintes genótipos 21 (+/- e 60 (-/-, com as freqüências de 0,13 e 0,87 para os alelos (+ e (-, respectivamente. O peso dos filhos dos animais com o genótipo +/- foi de 152,42± 4,41kg e os -/- 147,60± 2,61kg. Os grupos P e L não diferiram entre si quanto às freqüências alélicas apresentadas. O genótipo das reprodutrizes não afetou o peso à desmama de suas crias, existindo portanto outros efeitos genéticos e não genéticos de maior magnitude.Data from a Nelore herd were used after adjustment of the weaning weight for 205 days of age, sex, age of dam, sire and weaning month and resulted into two groups of cows according to the in weaning weight of their calves (heavy and light groups. The least square means (LSM for weaning weights were 163.21± 2,18kg and 134,44± 2.18kg, for heavy (H and light (L groups, with 41 animals each one. These animals were genotyped for DNA polymorphisms of the bovine somatotropin gene, using PCR-RFLP (polymerase chain reaction-restriction fragment length polymorphism. Amplification of a

Tissue-specific and minor inter-individual variation in imprinting of IGF2R is a common feature of Bos taurus Concepti and not correlated with fetal weight.

Directory of Open Access Journals (Sweden)

Daniela Bebbere

Full Text Available The insulin-like growth factor 2 receptor (IGF2R is essential for prenatal growth regulation and shows gene dosage effects on fetal weight that can be affected by in-vitro embryo culture. Imprinted maternal expression of murine Igf2r is well documented for all fetal tissues excluding brain, but polymorphic imprinting and biallelic expression were reported for IGF2R in human. These differences have been attributed to evolutionary changes correlated with specific reproductive strategies. However, data from species suitable for testing this hypothesis are lacking. The domestic cow (Bos taurus carries a single conceptus with a similar gestation length as human. We identified 12 heterozygous concepti informative for imprinting studies among 68 Bos taurus fetuses at Day 80 of gestation (28% term and found predominantly maternal IGF2R expression in all fetal tissues but brain, which escapes imprinting. Inter-individual variation in allelic expression bias, i.e. expression of the repressed paternal allele relative to the maternal allele, ranged from 4.6-8.9% in heart, 4.3-10.2% in kidney, 6.1-11.2% in liver, 4.6-15.8% in lung and 3.2-12.2% in skeletal muscle. Allelic bias for mesodermal tissues (heart, skeletal muscle differed significantly (P<0.05 from endodermal tissues (liver, lung. The placenta showed partial imprinting with allelic bias of 22.9-34.7% and differed significantly (P<0.001 from all other tissues. Four informative fetuses were generated by in-vitro fertilization (IVF with embryo culture and two individuals displayed fetal overgrowth. However, there was no evidence for changes in imprinting or DNA methylation after IVF, or correlations between allelic bias and fetal weight. In conclusion, imprinting of Bos taurus IGF2R is similar to mouse except in placenta, which could indicate an effect of reproductive strategy. Common minor inter-individual variation in allelic bias and absence of imprinting abnormalities in IVF fetuses suggest

Pleiotropic Genes Affecting Carcass Traits in Bos indicus (Nellore Cattle Are Modulators of Growth.

Directory of Open Access Journals (Sweden)

Anirene G T Pereira

Full Text Available Two complementary methods, namely Multi-Trait Meta-Analysis and Versatile Gene-Based Test for Genome-wide Association Studies (VEGAS, were used to identify putative pleiotropic genes affecting carcass traits in Bos indicus (Nellore cattle. The genotypic data comprised over 777,000 single-nucleotide polymorphism markers scored in 995 bulls, and the phenotypic data included deregressed breeding values (dEBV for weight measurements at birth, weaning and yearling, as well visual scores taken at weaning and yearling for carcass finishing precocity, conformation and muscling. Both analyses pointed to the pleomorphic adenoma gene 1 (PLAG1 as a major pleiotropic gene. VEGAS analysis revealed 224 additional candidates. From these, 57 participated, together with PLAG1, in a network involved in the modulation of the function and expression of IGF1 (insulin like growth factor 1, IGF2 (insulin like growth factor 2, GH1 (growth hormone 1, IGF1R (insulin like growth factor 1 receptor and GHR (growth hormone receptor, suggesting that those pleiotropic genes operate as satellite regulators of the growth pathway.

Genótipo e condição sexual no desempenho e nas características de carcaça de bovinos de corte superjovens

OpenAIRE

Padua,João Teodoro; Magnabosco,Cláudio de Ulhôa; Sainz,Roberto Daniel; Miyagi,Eliane Sayuri; Prado,Cristiano Sales; Restle,João; Resende,Luciano Santos de

2004-01-01

Noventa e seis bovinos foram distribuídos aleatoriamente em um delineamento inteiramente casualizado, em esquema fatorial 4x3, sendo quatro genótipos, Nelore (N), ½ Simental ½ Nelore (SN), ½ Red Angus ½ Nelore (AN) e ½ Red Angus ¼ Simental ¼ Nelore (ASN), e três condições sexuais, inteiro (I), castrado (C) e castrado mais Synovex S® ® (CS). A castração ocorreu aos seis meses de idade e o confinamento, aos nove meses. A alimentação consistiu de ...

Análise de polimorfismos do gene da kapa-caseína em fêmeas da raça Nelore e efeito sobre o peso à desmama de suas progênies Polimorphism analysis of kappa -casein gene on Nelore females and effect on weaning weight of the calves

Directory of Open Access Journals (Sweden)

F.J.C. Faria

1999-08-01

Full Text Available Informações sobre peso à desmama de um rebanho Nelore, após ajuste para idade padrão de 205 dias, sexo da cria, idade da mãe, touro e mês de desmama, foram utilizadas para separar as reprodutrizes em dois grupos, cujos produtos diferiam em peso. As médias ajustadas pelo método dos quadrados mínimos e erros-padrão para os grupos pesado (P e leve (L foram 163,21±2,18kg e 134,44±2,18kg, respectivamente, com 41 animais em cada grupo. Colheram-se amostras de sangue das reprodutrizes para o estudo de polimorfismos do gene da kapa-caseína, pela técnica de polymerase chain reaction-restriction fragment length polymorphism. A análise de um segmento do éxon IV do gene da kapa-caseína identificou os genótipos 71AA, 10AB e 1BB, com as freqüências de 0,92 e 0,08 para os alelos A e B, respectivamente. Os pesos à desmama dos produtos dos genótipos AA e AB foram, respectivamente, 147,73±2,38kg e 156,76±6,35kg. Os grupos P e L não diferiram entre si quanto às freqüências alélicas apresentadas para esse gene. O genótipo das reprodutrizes não afetou o peso à desmama de suas crias, existindo, portanto, outros efeitos genéticos e não genéticos de maior magnitude.Data from a Nelore herd were used after adjustment of the weaning weight for 205 days of age, sex, age of dam, sire and month of weaning resulting two groups of cows that differed in weaning weight of their calves. The least square means (LSM and standard error (SE were 163.21±2.18kg and 134.44±2.18kg, for heavy (H and light (L groups, with 41 animals each one. These animals were genotyped for DNA polymorphisms of kappa-casein gene, using PCR-RFLP (polymerase chain reaction-restriction fragment length polymorphism. The segment analysis of kappa-casein IV exon identified the genotypes 71AA, 10AB and 1BB, with frequencies of 0.92 and 0.08 for A and B alleles, respectively. The LSM±SE for weaning weight were 147.73±2.38kg and 156.76± 6.35kg for calves of AA and AB

Histological characteristics of the corpus luteum of Nelore cows in the first, second and third trimester of pregnancy

Directory of Open Access Journals (Sweden)

P.R. Xavier

2012-04-01

Full Text Available Foram avaliadas características morfológicas do corpo lúteo de 48 vacas Nelore gestantes obtidos de abatedouros. Os ovários com o corpo lúteo foram coletados, identificados e divididos em três grupos, considerando o estágio da gestação determinado pelo tamanho do feto: Grupo I - onze animais com gestação até 90 dias; Grupo 2 - vinte animais com gestação de 90 a 180 dias, e Grupo 3 - 17 animais com gestação de 180 a 261 dias. Todos os corpos lúteos foram dissecados, submetidos a processamento histológico e avaliados utilizando microscopia de luz. As características morfológicas das células luteais esteroidogênicas não mudou durante a gestação. Porém, foi observado um aumento de tecido conjuntivo, fibroblastos e matriz extracelular durante o final da gestação. Células em degeneração foram observadas em todos os períodos da gestação, mas com maior intensidade no fim do terceiro trimestre. Grânulos foram observados após a coloração com Tricrômico de Gomory e Xylidine Ponceau, caracterizados como grânulos de proteína. Nenhuma explicação foi encontrada na literatura para coloração de grânulos pelo Tricrômico de Gomory.

Fontes de lipídeos e monensina na alimentação de novilhos Nelore e sua relação com a população de protozoários ciliados do rúmen

OpenAIRE

Valinote,Amaury Camilo; Nogueira Filho,José Carlos Machado; Leme,Paulo Roberto; Silva,Saulo da Luz e; Cunha,José Aparecido

2005-01-01

Quatro novilhos Nelore, fistulados e canulados no rúmen, foram distribuídos em um delineamento quadrado latino 4 x 4, para avaliar o caroço de algodão e o sal de cálcio de ácidos graxos como fontes de gordura assim como o efeito da monensina em dietas com caroço de algodão, sobre a população de protozoários ciliados e o pH do rúmen. Os tratamentos experimentais foram: dieta controle (CTRL), dieta com sal de cálcio de ácidos graxos (SC), dieta com caroço de algodão (CA) e dieta com caroço de a...

Influence of the age on hematological parameters of Sindi cattle (Bos indicus in Paraíba backwoods

Directory of Open Access Journals (Sweden)

Luciano José Bezerra Delfino

2014-09-01

Full Text Available ABSTRACT. Delfino L.J.B., de Souza B.B., Silva W.W., Ferreira A.F. & Soares C.E.A. Influence of the age on hematological parameters of Sindi cattle (Bos indicus in Paraíba backwoods. [Influência da idade nos parâmetros hematológicos do gado Sindi (Bos indicus no sertão paraibano.] Revista Brasileira de Medicina Veterinária, 36(3:266-270, 2014. Departamento de Medicina Veterinária, Universidade Federal de Campina Grande, Campus de Patos, Av. Universitária, s/n, Santa Cecília, Patos, PB 58708-110, Brasil. Email: zulu_vet@hotmail.com The aim this work was to establish reference values of the hemogram of Sindi cattle raised in Paraiba backwood and evaluate the influence of same age, on blood samples we collected from 60 clinically healthy animals, being 30 females and 30 males, with the following age groups: Group I: 6 - 24 months, Group II: 24 - 48 months and Group III: up to 48 months. The experiment was conducted at the Center for Research and Development for the Semiarid Tropics (NUPEÁRIDO and the Veterinary Clinical Pathology Laboratory of the Health Center and Rural Technology (CSTR, Universidade Federal de Campina Grande (UFCG, Campus de Patos-PB. Blood samples were placed in tubes containing EDTA (tetracético-ethylenediamine-di-sodium as an anticoagulant were performed the following tests: counting the number of red blood cells, packed cell volume (PCV, Hemoglobin (Hb content, calculations of absolute Erythrocyte count (RBC, Mean corpuscular volume (MCV and Mean corpuscular hemoglobin concentration (CHGH. Held global count and differential leukocyte such as segmented neutrophils, eosinophils, lymphocytes and monocytes. Reference values for erythrocyte count (RBC, hematocrit (PCV, hemoglobin (Hb, MCV and CHGH were, respectively, (6375 to 13,400 X106 / MM3 , (32 – 50 %, (9 - 15 G/DL (37 – 60 µ3, (23 to 33 µµG. And for the WBC were obtained the following results: WBC (5270 to 17,170 UL, segmented neutrophils (from 1360 to 5780

Desempenho de vacas Charolês e Nelore desterneiradas aos três ou sete meses

Directory of Open Access Journals (Sweden)

Restle João

2001-01-01

Full Text Available Foi avaliado o desempenho de vacas Charolês (C e Nelore (N, agrupadas em três classes de idade, jovens (3 e 4 anos, adultas (5 a 7 anos e velhas (8 ou mais anos, desmamadas aos três (precoce ou sete meses no outono (tradicional. O peso no outono das vacas desterneiradas aos três meses (T3 foi 45 kg superior ao das vacas com remoção do bezerro aos sete meses (T7. O estado corporal aos sete meses também foi melhor nas vacas do T3 (3,3 contra 2,1 pontos. Vacas do T3 apresentaram maior ganho de peso do parto ao final do período reprodutivo e apresentaram maiores porcentagem de cio (81 contra 51% e prenhez (67,2 contra 37,3% e menor intervalo do parto ao primeiro cio pós-parto (102 contra 114 dias que vacas do T7. Vacas adultas apresentaram melhor estado corporal aos sete meses e tiveram melhor desempenho reprodutivo do que vacas velhas e jovens. A diferença na porcentagem de prenhez entre o T3 e T7 foi mais evidente nas vacas jovens (42,11 contra 12,5% e velhas (51,72 contra 35,71% que nas adultas (62,50 contra 53,33%. Vacas C foram mais pesadas que as N, ao parto, aos três e sete meses pós-parto e apresentaram melhor estado corporal aos sete meses. O efeito do desmame precoce no desempenho reprodutivo foi mais evidente nas vacas C. A porcentagem de fêmeas prenhes nas C foi de 80,60% para o T3 e 41,90% para o T7, já nas N as porcentagens foram de 45,50 e 30,00%, respectivamente, para o T3 e T7. Nas vacas C, a produção de leite e a amamentação apresentaram efeito inibidor, sobre a reprodução, mais marcante que nas vacas N.

Feed intake and prediction assessments using the NRC, CNCPS and BR-CORTE systems in Nellore and Red Norte steers finished in feedlot Consumo alimentar e avaliação das predições pelos sistemas NRC, CNCPS e BR-CORTE em novilhos Nelore e Red Norte terminados em confinamento

Directory of Open Access Journals (Sweden)

Otávio Rodrigues Machado Neto

2010-02-01

Full Text Available The objective of this research was to evaluate the dry matter intake (DMI and nutrient consumption in Nellore and Red Norte steer finished in a feedlot and compare the actual and predicted values by NRC (2000, CNCPS 5.0 and BR-CORTE systems. Forty-one animals, 19 Nellore and 22 Red Norte steers, with initial live weight of 361 ± 31 kg and 367 ± 30 kg, respectively, were used. The experiment lasted 84 days, with 28 days for adaptation and 56 experimental days. The animals were weighed at the beginning and at end of each 28-day period after 16 hours fasting. The dry matter intake was estimated by LIPE, chrome oxide and indigestible dry matter (DMi markers. There were no differences between Nellore and Red Norte DMI when expressed in kg/day (10.66 vs. 10.44. When intake was expressed in percentage of live weight (% LW, Nellore steer presented higher intake than Red Norte steer (2.55 vs. 2.39%. All the systems evaluated presented a lower predicted intake than the observed intake. However, these differences were smaller for crossbreed animals.Este trabalho foi realizado com os objetivos de avaliar o consumo de matéria seca (CMS e dos nutrientes da dieta em novilhos Nelore e Red Norte terminados em confinamento e comparar os valores observados aos preditos por meio dos sistemas NRC (2000, CNCPS 5.0 e BR-CORTE. Utilizaram-se 41 novilhos, não-castrados, de dois grupos genéticos, sendo 19 Nelore com peso vivo inicial médio de 361 ± 31 kg e 22 Red Norte com peso vivo inicial de 367 ± 30 kg. No início do período de adaptação, com duração de 28 dias, os animais foram pesados após jejum alimentar de 16 horas e tratados contra endo e ecto parasitas. O período experimental teve duração de 56 dias e, além das pesagens nestes períodos, foram realizadas mensurações do consumo individual, utilizando-se os indicadores LIPE, óxido crômico e matéria seca indigestível (MSi. A comparação entre os dados de consumo observados com aqueles

Pregnancy rate evaluation in lactating and non-lactating Nelore cows subjected to fixed-time artificial insemination using injectable progesterone

Directory of Open Access Journals (Sweden)

Jefferson Tadeu Campos

2016-08-01

Full Text Available Most fixed-time artificial insemination (FTAI protocols utilize progesterone (P4 as a hormonal source to achieve synchronization of estrus in cattle. The use of an injectable P4 source to control estrus would be an interesting pharmacological strategy owing to the practicality of parenteral application. However, the effects of injectable P4 on estrus cycle control in cattle remain poorly studied. In particular, no existing studies have investigated the effect of injectable P4 on the fertility of cows subjected to FTAI. The aim of this study was to evaluate the pregnancy rate of lactating and non-lactating Nelore cows subjected to FTAI with injectable P4. Of the 422 non-lactating cows in this study, 162 (38.3% became pregnant by 60 days post-FTAI. In the lactating group (n = 516, 166 (32.1% were pregnant by 60 days after treatment with injectable P4. The proportions of lactating and non-lactating cows becoming pregnant were compared using the chi-square test, adopting a significance level of P < 0.05. It was found that the pregnancy rate of the cows subjected to FTAI with injectable P4 was influenced by lactation status. Lactating cows had lower reproductive performance, possibly because of their higher nutritional requirements. However, the use of injectable P4 shows promising results and may prove to be a useful strategy in large-scale livestock production.

RELAÇÃO ENTRE COMPONENTES DO CORPO VAZIO E RENDIMENTOS DE CARCAÇA DE NOVILHOS DE CORTE

Directory of Open Access Journals (Sweden)

Miguelangelo Ziegler Arboitte

2006-10-01

Full Text Available O objetivo deste experimento foi avaliar a relação entre os vários componentes das partes do corpo não-integrantes da carcaça com os rendimentos de carcaça quente (RCQ e fria (RCF expressos em relação ao peso de abate (PAB ou de corpo vazio (PCV de novilhos de corte. Foram utilizados 24 animais mestiços Charolês – Nelore,terminados em confinamento. Nenhum componente do corpo vazio, bem como os conjuntos dos componentes apresentaram relação significativa com os RCQ e RCF quando ajustados para PAB. Quando avaliados em relação ao PCV, o RCQ correlacionou-se positivamente com coração (r=0,41 e negativamente com as gorduras internas: inguinal (r=-0,62, renal (r=-0,48, toalete (r=-0,51 e ruminal+intestinal (r=-0,57. E o RCF apresentou relação positiva com cabeça (r=0,42, coração (r=0,45 e omaso (r=0,49, e negativa com couro (r=-0,45, abomaso (r=-0,52 e gorduras internas:inguinal (r=-0,46, renal (r=-0,43, toalete (r=-0,68 e ruminal+intestinal (r=-0,72. Para os conjuntos dos componentes, apenas as gorduras internas correlacionaram-se significativamente com os RCQ (r=-0,68 e RCF (r=-0,76 expressos em relação ao PCV. Correlação significativa foi verificada entre os conjuntos gorduras internas com componentes externos (r=0,50 e entre os conjuntos trato digestivo vazio com órgãos vitais (r=0,74. PALAVRAS-CHAVE: Bos indicus, Bos taurus, couro, cruzamento, gordura interna.

How to Implement Blue Ocean Strategy (BOS in B2B Sector Kaip įgyvendinti žydrųjų vandenynų strategiją (ŽVS sektoriuje „verslas – verslui“

Directory of Open Access Journals (Sweden)

Andrejs Čirjevskis

2011-11-01

Full Text Available The aim of research is to confirm the hypothesis that BOS is viable in the B2B sectors. The objects of research are two business entities: world’s lead­ing suppliers of construction chemicals and manufacturer of purification equip­ment. Authors posed first research question is BOS a suitable within construction chemicals and purification equipment manufacturers’ industries? Second research question was about how to evaluate acceptability of new strategic choice on BOS? Third research question was how to diagnosis organisational hurdles on BOS implementation? Research has confirmed the hypothesis and suggested application of innovation value chain to diagnosing company’s ability to implement value in­novation.

Tyrimo tikslas patvirtina hipotezę, kad ŽVS yra gyvybinga B2B sektoriuose. Tyrimo objektai yra du verslo subjektai: pasaulyje pirmaujantys statybos chemikalų tiekėjai ir valymo įrenginių gamintojai. Autorių keliamas pirmasis mokslinių tyrimų klausimas – ar ŽVS yra tinkama statybos chemikalų ir valymo įrenginių gamintojų pramonei? Antrasis mokslinių tyrimų klausimas – apie tai, kaip įvertinti naujo strateginio pasirinkimo

El bosón de Higgs no te va a hacer la cama la física como nunca te la han contado

CERN Document Server

Santaolalla, Javier

2016-01-01

Viajes en el tiempo, agujeros negros, motores de antimateria, aceleración del universo… La física moderna suena a película, pero es ciencia, de la de verdad verdadera, la que nos cuenta una historia fascinante de descubrimientos y sueños cumplidos, de luchas y disputas, de pasión por comprender la naturaleza. Este divertido libro te ayudará a entender de una vez por todas lo que nos rodea, desde lo más pequeño a lo más grande, y a saber que el bosón de Higgs no te va a hacer la cama, ¡ni aunque le insistas!

Consumo e tempo diário de pastejo por novilhos Nelore em pastagem de capim-tanzânia sob diferentes ofertas de forragem Effects of herbage allowance on the intake and grazing time of Nellore steers grazing tanzâniagrass pasture

Directory of Open Access Journals (Sweden)

Miguel Marques Gontijo Neto

2006-02-01

Full Text Available Os efeitos de diferentes níveis de oferta de forragem, associados a alterações no dossel induzidas pelo pastejo, sobre o tempo de pastejo e o consumo de forragem por novilhos mantidos em pastagem de capim-tanzânia foram avaliados neste experimento. Os quatro níveis planejados de oferta de forragem (OF (kg de MS de lâmina foliar/100 kg de PV animal/dia, % resultaram em OF de 6,1 ± 0,59; 11,1 ± 0,77; 18,0 ± 1,24; e 23,9 ± 1,15%. Cada piquete foi pastejado por oito animais Nelore, com peso médio de 229,0 e 249,5 kg, para o primeiro e segundo períodos de amostragem, respectivamente. Foi utilizado um delineamento em blocos casualizados com quatro tratamentos, definidos pelos níveis médios de oferta de forragem. O tempo de pastejo, a disponibilidade de matéria seca de folhas, a relação folha/colmo e a altura do dossel apresentaram alta correlação com o consumo de forragem e podem ser utilizados no desenvolvimento de modelos de predição de consumo de forragem ou desempenho animal em pastejo. Estudos avaliando consumo e desempenho de animais em pastejo em relação a ofertas de forragem necessitam de descrições das disponibilidades e condições estruturais da pastagem para interpretação e comparação de resultados. Alteraçõses nas OF de capim-tanzânia, associadas àquelas nas condições estruturais da pastagem induzidas pelo pastejo tiveram efeito quadrático sobre o tempo diário de pastejo e o consumo de forragem de novilhos Nelore. O menor tempo de pastejo e o maior consumo de forragem foram verificados no nível de OF próximo a 22,5 kg de lâminas foliares/100 kg PV, que corresponde a um resíduo pós-pastejo em torno de 4.323,2 kg/ha de MS, 2.887,6 kg/ha de matéria verde seca e altura média do dossel de 64 cm.This work aimed to evaluate the effects of forage allowances on canopy changes, the grazing time and forage intake by steers grazing tanzaniagrass (Panicum maximum Jacq. pasture. The four levels of herbage

THE INFLUENCE OF AUTOLYSIS ON THE PROTEIN-PEPTIDE PROFILE OF Bos taurus AND Sus scrofa HEART AND AORTA TISSUES

Directory of Open Access Journals (Sweden)

I. M. Chernukha

2016-01-01

Full Text Available The article presents the results of autolytic processes impact on the protein-peptide profile of Bos taurus and Sus scrofa cardiac muscle and aorta. The results of tissue-specific protein identification are also presented as well as the effect of autolysis. Apolipoprotein A-1 involved in the formation of high-density lipoproteins, peroxiredoxin-1 involved in the suppression of oxidative stress, galectin-1 induced apoptosis of T-lymphocytes, as well as number of heat shock proteins with molecular weight less than 30 kDa were identified in Sus scrofa aorta tissue. It was discovered that functional proteins with molecular weight less than 30 kDa are retained during the freezing process, but destroyed under the action of autolytic enzymes. This work was supported by the Russian Science Foundation (project No. 16–16–10073.

Desempenho em Pastagens e Características de Carcaça da 16a Progênie dos Rebanhos Nelore, Guzerá e Caracu de Sertãozinho (SP

Directory of Open Access Journals (Sweden)

Razook Alexander George

2002-01-01

Full Text Available Quarenta e um machos inteiros dos rebanhos selecionados para peso aos 378 dias (P378, nascidos em 1996, foram terminados em pastagens de Panicum Maximum (Jacq., Panicum Maximum (Jaq cv. Tanzania 1 e Brachiaria brizantha (Hoschst Stapf cv. Marandu na Estação Experimental de Zootecnia de Sertãozinho (SP. As amostras, representando a média de P378 em cada rebanho, foram: 11 animais Nelore Seleção (NeS e 10 para cada um dos grupos Nelore Controle (NeC, Guzerá Seleção (GuS e Caracu (Ca. O abate ocorreu aos 824 dias de idade e condição corporal 7,6, em uma escala de 1 a 9. As médias mínimas e máximas ajustadas, para as principais características, considerando-se todos os grupos, foram: ganho de peso médio diário, 406 (NeC e 501 g (NeS; peso de abate (PAB, 446,8 (NeC e 544,3 kg (NeS ; peso de carcaça (PCAR, 249,8 (NeC e 309,7 kg (NeS; rendimento de carcaça (REND, 54,0 (GuS e 56,3% (NeC e NeS. No corte entre a 9feminine e 11feminine costelas : músculo 59,6 (NeC e 65,2% (Ca; gordura, 15,6 (Ca e 21,4% (NeC; osso, 18,9 (NeC e 20,2% (GuS; espessura de gordura (ESPGOR, 2,0 (Ca e 4,2 mm (NeC; área de olho de lombo (AOL, 65,6 (NeC e 71,1 cmsuperscript two (NeS e Ca; força de cisalhamento (FC, 4,5 (Ca e 6,6 kg (GuS e perdas totais no cozimento (PERDAS, 22,5 (NeC e 24,9% (GuS. A seleção para peso provocou, em NeS, maiores PAB e PCAR, sem interferir no REND, na composição da costela, FC e PERDAS na carne. Houve, porém, menor ESPGOR em relação à NeC. Os animais GuS apresentaram PAB e PCAR intermediários, entre NeS e Ca, e menor REND e os Ca maior proporção de músculo na costela e carne com maior maciez em relação ao Zebu.

Production of volatile fatty acid in the rumen and its relationship with their concentration, intake of dry matter and digestible organic matter in buffalo (Bos bubalis) calves

International Nuclear Information System (INIS)

Verma, D.N.; Singh, U.B.

1979-01-01

The production rates of total volatile fatty acid (TVFA) in the rumen of buffalo (Bos bubalis) calves were estimated using a single injection isotope dilution technique. A series of twelve experiments were done with animals given wheat straw and concentrate mixture. The production rate of TVFA ranged from 19.77 to 24.84 moles/d depending upon the amount of food consumed by the animals. Highly significant correlations were observed between TVFA production and their concentration, dry matter and digestible organic matter intake. (auth.)

Composição em ácidos graxos e qualidade da carne de tourinhos Nelore e Canchim alimentados com dietas à base de cana-de-açúcar e dois níveis de concentrado Fatty acids composition and meat quality of Nellore and Canchim young bulls fed sugar cane-based diets with two concentrate levels

Directory of Open Access Journals (Sweden)

Alexandre Rodrigo Mendes Fernandes

2009-02-01

Full Text Available O objetivo neste trabalho foi avaliar a composição de ácidos graxos e a qualidade do contrafilé (músculo Longissimus lumborum de tourinhos das raças Nelore e Canchim. Os animais foram terminados em confinamento e alimentados com dietas contendo cana-de-açúcar e dois níveis de concentrado (40 e 60% na matéria seca. Os concentrados foram compostos de grãos de girassol, milho, farelo de soja, levedura seca de cana-de-açúcar, uréia e núcleo mineral. O delineamento experimental foi o inteiramente ao acaso, em esquema fatorial 2 × 2 (grupo genético × nível de concentrado. Não foram observadas diferenças nos teores de umidade, proteína e extrato etéreo da carne. Os animais da raça Nelore apresentaram maiores concentrações de ácido linoléico conjugado (0,52%, ácidos graxos insaturados (46,82% e também relações mais elevadas de ácidos graxos insaturados:saturados (1,02 e monoinsaturados:saturados (0,86 em comparação aos tourinhos da raça Canchim. Os tourinhos da raça Canchim apresentaram maior intensidade das cores vermelha e amarela no contrafilé e maior luminosidade da gordura de cobertura. Houve interação para força de cisalhamento, que foi menor nos tourinhos Nelore alimentados com 40% de concentrado. Tourinhos da raça Nelore apresentam carne com melhor composição de ácidos graxos na gordura intramuscular do ponto de vista da saúde humana.The objective of this work was to evaluate the fatty acids composition and the qualitative and chemical characteristics of the loin meat (Longissimus lumborum muscle of Nellore and Canchim young bulls. The animals were fedlot finished and fed sugar cane-based diets with two concentrate levels (40 and 60% of dry matter. The concentrates were formulated with sunflower grains, corn, soybean meal, dry sugar cane yeast from sugar and alcohol industry, urea and mineral mixture. The experimental design was a completely randomized design with a 2 × 2 factorial arrangement

Avaliação de fatores de ambiente e estimativas de parâmetros genéticos para a característica dias para o parto na raça Nelore Environmental effects and genetic parameters estimates for days to calving in Nelore cattle

Directory of Open Access Journals (Sweden)

Selma Forni

2006-08-01

Full Text Available Dados de um rebanho comercial da raça Nelore foram analisados com os objetivos de avaliar a influência de fatores ambientais e estimar parâmetros genéticos para a característica dias para o parto (DPP. Foram utilizados modelos fixos que incluíram os efeitos de grupo de contemporâneos, sexo do bezerro, idade da vaca no início da estação de monta, mês do parto anterior e peso do bezerro desmamado no final da estação de monta (apenas este último efeito não influenciou a característica significativamente. Duas definições de grupo de contemporâneos foram consideradas: a primeira definida pelas informações fazenda, ano e estação de monta, grupos de manejo (nascimento, desmama e reprodução e tipo de serviço (monta natural, monta controlada ou inseminação artificial; e a segunda, pelas mesmas informações mais o sexo do bezerro. As análises genéticas foram realizadas com conjuntos de dados que incluíram ou não os animais sem registros de parto. Quando incluídos, o valor de DPP atribuído a esses animais foi igual ao maior valor observado dentro do grupo de manejo somado a 21 dias. Os componentes de variância foram estimados por máxima verossimilhança restrita utilizando-se modelos animal unicaracterística. A inclusão do efeito aleatório de ambiente permanente nos modelos foi avaliada mediante o "Likelihood Ratio Test". As herdabilidades estimadas variaram entre 0,01 e 0,11 e a inclusão do efeito de ambiente permanente nos modelos foi significativa, de modo que a exclusão deste efeito superestimou a variância genética aditiva. A metodologia aplicada para penalizar os animais que não pariram não melhorou a identificação das diferenças genéticas entre eles. Os resultados indicaram que, como grande parte das características reprodutivas em bovinos, a DPP sofre grande influência do ambiente.Data from a Nelore population was used to evaluate environmental effects and to estimate genetic parameters for days

Do cattle (Bos taurus) retain an association of a visual cue with a food reward for a year?

Science.gov (United States)

Hirata, Masahiko; Takeno, Nozomi

2014-06-01

Use of visual cues to locate specific food resources from a distance is a critical ability of animals foraging in a spatially heterogeneous environment. However, relatively little is known about how long animals can retain the learned cue-reward association without reinforcement. We compared feeding behavior of experienced and naive Japanese Black cows (Bos taurus) in discovering food locations in a pasture. Experienced animals had been trained to respond to a visual cue (plastic washtub) for a preferred food (grain-based concentrate) 1 year prior to the experiment, while naive animals had no exposure to the cue. Cows were tested individually in a test arena including tubs filled with the concentrate on three successive days (Days 1-3). Experienced cows located the first tub more quickly and visited more tubs than naive cows on Day 1 (usually P visual cue with a food reward within a day and retain the association for 1 year despite a slight decay. © 2014 Japanese Society of Animal Science.

Eficiência de utilização da energia metabolizável em bovinos Nelore puros e cruzados submetidos a quatro níveis de concentrado na ração Net efficiency of metabolizable energy utilization of purebred and crossbred Nellore young bulls fed diets with different concentrate levels

Directory of Open Access Journals (Sweden)

José Antônio de Freitas

2006-06-01

Full Text Available Objetivou-se com este trabalho estimar as eficiências de utilização da energia metabolizável para mantença (Km e ganho de peso (Kg de bovinos Nelore puros e mestiços. Foram utilizados 72 bovinos machos, não-castrados, com idade inicial de 10 a 11 meses (18 Nelore, 18 F1 Nelore x Angus, 18 F1 Nelore x Pardo-Suíço e 18 F1 Nelore x Simental e peso médio inicial de 286, 309, 333 e 310 kg, respectivamente. Adotou-se o delineamento inteiramente casualizado em arranjo fatorial 4 x 4 m com três animais por grupo genético e quatro níveis de adição de concentrado (30, 40, 60 e 70% na MS. Três animais de cada grupo genético foram alocados no grupo mantença e três foram abatidos no início do experimento. O consumo de energia metabolizável de mantença (CEMm, em kcal/kg0,75, correspondeu ao ponto no qual o coeficiente entre a produção de calor em jejum (PCj e os CEM foram mais próximos de 1. As eficiências de utilização da EM para mantença (Km foram estimadas pela divisão da produção de calor em jejum pelo CEMm. A eficiência de utilização da EM para ganho de peso (kg foi estimada pela regressão entre a energia retida (kcal/kg0,75 e o CEMg. As exigências de EM foram obtidas dividindo-se as exigências líquidas pelo valor de Km. Não houve influência significativa dos grupos genéticos e dos níveis de concentrado na ração sobre Km e Kg, que apresentaram valores de 0,67 e 0,40, respectivamente. As exigências de EM para ganho (EMg e de EM total (EMt aumentaram com a elevação do peso vivo (PV. Por outro lado, as EMt e EMg por unidade de PCV decresceram com o aumento do PV, indicando maior eficiência de utilização da EM com a elevação do peso vivo dos animais.The objective of this trial was to estimate the efficiency of utilization of metabolizable energy (MEEU for maintenance (Km and weight gain (kg of feedlot purebred and crossbred Nellore. Seventy-two young bulls averaging 10 to 11 months of age from four genetic

Desempenho produtivo e eficiência bioeconômica de bovinos Nelore e Caracu selecionados para peso aos 378 dias de idade recebendo alimentação à vontade ou restrita Production and bioeconomic efficiency of Nellore and Caracu bulls selected to weight gain and fed ad libitum or restricted

Directory of Open Access Journals (Sweden)

Antonio Gesualdi Júnior

2006-04-01

Full Text Available Avaliou-se o desempenho de 56 bovinos machos não-castrados de três grupos genéticos, com idade média de 18 meses, submetidos à alimentação à vontade ou restrita, em confinamento. Doze animais foram abatidos no início do experimento e os demais (16 Nelore selecionados, 12 Nelore não-selecionados e 16 Caracu selecionados com peso vivo médio inicial de 404, 345 e 434 kg, respectivamente foram distribuídos em delineamento inteiramente casualizado, em esquema fatorial 2 x 3, composto por dois níveis de alimentação (restrito = consumo de 65 g de MS/kgPV0,75 por dia e ad libitum = fornecimento do alimento duas vezes ao dia e três grupos genéticos. O volumoso utilizado foi a silagem de milho e o concentrado foi constituído de milho moído, farelo de algodão, uréia, monensina e mistura mineral, com relação volumoso:concentrado 50:50. O abate foi realizado quando cada animal atingiu 4 mm gordura subcutânea à altura da 12ª costela, avaliada por ultra-som. Os grupos genéticos apresentaram ganhos médios diários de peso vivo e pesos de corpo vazio e de carcaça semelhantes, não havendo interação grupo genético × nível de alimentação. Os ganhos de peso vivo e os pesos de corpo vazio e de carcaça foram maiores nos animais alimentados ad libitum. Somente os consumos de matéria seca em kg/dia sofreram influência tanto do nível de alimentação quanto do grupo genético. Os animais Caracu apresentaram os maiores consumos, seguidos pelos Nelore selecionados. Os Nelores não-selecionados apresentaram melhor eficiência bionutricional e menor custo de produção da arroba que os demais grupos genéticos.Production of 56 feedlot bulls from three different genetic groups averaging 18 months of age and fed ad libitum or restricted was evaluated in this trial. Twelve animals were slaughtered at the beginning of the study and were used as references. The remaining 16 genetically selected Nellore, 12 ordinary Nellore, and 16

Comparação entre critérios de seleção de precocidade sexual e a associação destes com características de crescimento em bovinos Nelore

Directory of Open Access Journals (Sweden)

Ortiz Peña Carlos Dario

2001-01-01

Full Text Available Neste trabalho estimaram-se parâmetros genéticos do perímetro escrotal (PE, PE corrigido para idade (PEi e PEi corrigido para peso corporal (PEip de bovinos Nelore, comparando-se a classificação dos animais pelas DEPs, segundo o critério adotado. Além disso, estimaram-se a correlação genética existente entre as três expressões do PE e o ganho médio diário pré-desmama, o ganho médio diário pós-desmama, o número de dias para ganhar 160 kg após o nascimento e o número de dias para ganhar 240 kg após a desmama. As informações foram obtidas nos Registros de Produção da Associação Paraguaia dos Criadores de Nelore, entre 1986 e 1997, em 110 rebanhos. As estimativas dos componentes de variância e herdabilidade foram obtidas pelo Método da Máxima Verossimilhança Restrita, usando modelos animais uni característica. As herdabilidades estimadas foram 0,41; 0,40; e 0,47 para PE, PEi e PEip, respectivamente, todas indicando possibilidade de progresso genético por seleção. A estimativa de correlação genética entre PEi e PEip (0,62 foi moderada e os valores obtidos para as correlações entre as características de precocidade sexual e de crescimento foram de pequena magnitude. As estimativas de correlações de rank das DEPs foram 0,98 para PE e PEi e 0,59 para PEi e PEip. Os resultados evidenciaram a ocorrência de mudanças na classificação dos melhores animais, quando se considerou ou não o peso vivo na correção do PE. A utilização do perímetro escrotal corrigido para idade e peso corporal como critério de seleção evitaria ou reduziria a resposta correlacionada com tamanho adulto superior, trazendo maiores progressos genéticos na precocidade sexual.

Veda e vermifugação como alternativas de manejo para desmama de bezerros Nelore em pastagem nativa do Pantanal Alternative management for weaned nelore calves in the Pantanal's native pastures

Directory of Open Access Journals (Sweden)

JOSÉ ROBSON BEZERRA SERENO

2000-10-01

Full Text Available Entre março de 1992 e janeiro de 1993 realizou-se este estudo com o objetivo de avaliar o efeito integrado da veda do pasto nativo com o controle estratégico de nematóides gastrintestinais no desempenho corporal de bezerros Nelore pós-desmame no Pantanal da Nhecolândia, MS, Brasil. Dois lotes de animais recém-desmamados aos nove meses foram colocados em invernadas contíguas de pastagens nativas com as mesmas características fisionômicas, que foram vedadas por três meses e meio; a invernada do lote controle foi previamente pastejada por vacas com bezerro ao pé para contaminação. O lote tratado permaneceu com níveis muito baixos de ovos por grama de fezes durante todo o período experimental, e no lote controle foram diminuindo no decorrer do ensaio, terminando semelhantes. No desenvolvimento corporal, observou-se menor perda de peso do lote tratado durante a estação seca e ganho de peso compensatório do lote controle na estação chuvosa subseqüente. Os pesos médios dos dois lotes no final do experimento foram semelhantes.The aim of this study was to investigate the integrated effects of native pastures sealing with strategic control of gastrointestinal nematodes on body development of weaned Nellore calves, studied between March 1992 and January 1993 in the Pantanal region, Brazil. Two homogeneous groups of weanling calves were put on contiguous paddocks of native pastures with the same physiognomic characteristics and sealed for three and a half months. The paddock where the non-treated group was put, was previously used by cows that were rearing a calf for contamination of the pasture. The treated group remained with low levels of eggs per gram of feces (EGF during the whole experimental period. In the non-treated group, the EGF diminished during the assay, ending with similar levels of the treated group. On body development, it was observed a lower body weight loss of the treated group during the dry season and a

Suplementação de novilhos Nelore sob pastejo, no período de transição águas-seca

Directory of Open Access Journals (Sweden)

J.B.M.P. Lima

2012-08-01

Full Text Available Avaliou-se o efeito da suplementação proteica sobre o consumo e o desempenho de novilhos recriados em pastagens de capim-piatã (Brachiaria brizantha cv. Piatã, durante o período de transição águas-seca. Utilizaram-se 20 novilhos Nelore, com peso médio inicial de 260kg, distribuídos ao acaso, em esquema de parcelas subdivididas. Os suplementos foram: sal mineral com ureia (controle - ofertado ad libitum; sal proteinado - ofertado a 0,2% do peso vivo; suplemento proteico-energético - ofertado a 0,3% do peso vivo; e suplemento proteico-energético - ofertado a 0,5% do peso vivo. A suplementação teve efeito aditivo sobre o consumo de matéria seca total. O consumo médio diário dos suplementos foi de 0,167; 0,597; 0,865 e 1,469kg/animal, sendo observado ganho médio diário de 0,686; 0,761; 0,719 e 0,850kg/animal para os tratamentos controle e suplementados com 0,2; 0,3 e 0,5% do peso vivo, respectivamente. Verificou-se que as estratégias de suplementação avaliadas foram economicamente viáveis e proporcionaram desempenho semelhante sob condições de elevada oferta de forragem, sendo recomendado iniciar a suplementação proteica no período de transição águas-seca.

Relação entre genótipos e temperamento de novilhos Charolês x Nelore em confinamento Relations among genotypes and temperament of Charolais x Nellore steers in confinement

Directory of Open Access Journals (Sweden)

Isabella Dias Barbosa Silveira

2008-10-01

Full Text Available Avaliou-se a influência da interação entre genótipos e do temperamento de bovinos sobre os ganhos diretos e indiretos para a produção de carne. Utilizaram-se 79 machos castrados com 19 a 20 meses de idade, divididos em oito grupos genéticos resultantes de cruzamentos Charolês x Nelore: 0, 25, 31, 38, 63, 69, 75 ou 100% Charolês. Os animais foram mantidos em confinamento e alimentados com uma dieta contendo 50% de volumoso e 50% de concentrado. O temperamento foi avaliado utilizando-se quatro metodologias adotadas durante as pesagens: escore composto (EC; tempo de saída (TS; distância de fuga (DF; e escore de localização do redemoinho de pêlos faciais (RED. Maiores porcentagens de sangue Charolês estiveram relacionadas positivamente ao ganho de peso diário. Independentemente do grupo genético, os animais mais reativos ganharam menos peso. O temperamento é influenciado pelo grupo genético, uma vez que animais com maiores proporções de sangue Nelore são mais agitados e excitáveis.The influence of the relation among genotype and temperament of cattle on the direct and indirect gains for meat production. Seventy-nine steers with 19-20 mo old from eight genotype groups of Charolais x Nellore crossbred were evaluated: CH (100CH, ¾ CH1/4N (0.75CH, 11/16CH5/16N (0.69CH, 5/8CH3/8N (0.63CH, 3/8CH5/8N (0.38CH, 5/16CH11/16N (0.31CH, 1/4CH3/4N (0.25CH e N (0CH animals were kept in feedlot and were fed with diet containing 50:50 forage to concentrate ratio (%DM. The temperament was evaluated using are four methods adopted during the cattle weights: composite behavior score (BC, flight time (FT; flight distance (FD, and facial whorl (W position score. Higher percentages of blood Charolais were positively related to daily weight gain. Regardless of the genetic group, the animals more reactive gained less daily weight gain. The temperament is influenced by genetic group, since animals with higher proportions of blood Nellore are more

DGAT1 and ABCG2 polymorphism in Indian cattle (Bos indicus and buffalo (Bubalus bubalis breeds

Directory of Open Access Journals (Sweden)

Mishra Bina

2006-11-01

Full Text Available Abstract Background Indian cattle (Bos indicus and riverine buffalo (Bubalus bubalis give a poor yield of milk but it has a high fat and protein percentage compared to taurine cattle. The identification of QTLs (Quantitative Trait Loci on BTA14 and BTA6 and its subsequent fine mapping has led to identification of two non conservative mutations affecting milk production and composition. Our objective was to estimate the frequency of K232A (DGAT1 – diacylglycerol – acyltransferase 1 and Y581S (ABCG2 – ATP binding cassette sub family G member 2 polymorphisms in diverse cattle and buffalo breeds of India having large variation in terms of milk production. Results We screened the reported missense mutations in six cattle and five buffalo breeds. The DGAT1K and ABCG2Y alleles were found to be fixed in Indian cattle and buffalo breeds studied. Conclusion This study provides an indirect evidence that all the Indian cattle and buffalo breeds have fixed alleles with respect to DGAT1 and ABCG2 genes reported to be responsible for higher milk fat yield, higher fat and protein percent.

In vivo Efficacy of Vernonia amygdalina (Compositae Against Natural Helminth Infection in Bunaji (Bos indicus Calves

Directory of Open Access Journals (Sweden)

C. B. I. Alawa ab*, A. M. Adamu, J. O. Gefub, O. J. Ajanusic, P. A. Abdud and N. P. Chiezeyb

2010-10-01

Full Text Available Fifteen Bunaji calves (Bos indicus averaging 105±12.5 Kg liveweight and approximately nine months of age with natural helminth infection were distributed into three treatment groups of five animals each. Animals were either treated orally with aqueous extract of Vernonia amygdalina at a dose concentration of 1.1g/Kg body weight, a conventional anthelmintic or left untreated. V. amygdalina treatment produced 59.5% reduction in eggs per gram (EPG of faeces which was significantly different (P<0.001 from the untreated control (-17.24%, whereas levamisol hydrochloride treatment produced 100% reduction in EPG. A total of six genera of helminths were recovered from the gastrointestinal tracts and liver of experimental animals. These were Haemonchus contortus, Trichostrongylus spp, Bunostomum spp, Oesophagostomum spp, Fasciola spp and Dicrocoelium spp. There was significant difference (P<0.001 in worm load between the different treatment groups. Except for Haemonchus spp, animals in the untreated group had significantly (P<0.001 higher worm load for all the genera of helminth recovered than those of the V. amygdalina treated group, indicating that V. amygdalina had no effect on Haemonchus contortus.

Quantitative proteomic analysis of whey proteins in the colostrum and mature milk of yak (Bos grunniens).

Science.gov (United States)

Yang, Yongxin; Zhao, Xiaowei; Yu, Shumin; Cao, Suizhong

2015-02-01

Yak (Bos grunniens) is an important natural resource in mountainous regions. To date, few studies have addressed the differences in the protein profiles of yak colostrum and milk. We used quantitative proteomics to compare the protein profiles of whey from yak colostrum and milk. Milk samples were collected from 21 yaks after calving (1 and 28 d). Whey protein profiles were generated through isobaric tag for relative and absolute quantification (iTRAQ)-labelled proteomics. We identified 183 proteins in milk whey; of these, the expression levels of 86 proteins differed significantly between the whey from colostrum and milk. Haemoglobin expression showed the greatest change; its levels were significantly higher in the whey from colostrum than in mature milk whey. Functional analysis revealed that many of the differentially expressed proteins were associated with biological regulation and response to stimuli. Further, eight differentially expressed proteins involved in the complement and coagulation cascade pathway were enriched in milk whey. These findings add to the general understanding of the protein composition of yak milk, suggest potential functions of the differentially expressed proteins, and provide novel information on the role of colostral components in calf survival. © 2014 Society of Chemical Industry.

The Punta Lucero Quarry site (Zierbena, Bizkaia): a window into the Middle Pleistocene in the Northern Iberian Peninsula

Science.gov (United States)

Gómez-Olivencia, Asier; Sala, Nohemi; Arceredillo, Diego; García, Nuria; Martínez-Pillado, Virginia; Rios-Garaizar, Joseba; Garate, Diego; Solar, Gonzalo; Libano, Iñaki

2015-08-01

The period between the end of the Early Pleistocene and the mid-Middle Pleistocene (roughly between 1.0 and 0.4 Ma BP) is of great interest in Western Europe. It witnessed several climatic oscillations and changes in the fauna, the demise of a hominin species and the appearance of another, along with important cultural and technological changes. Thus, the few available sites with these chronologies is vital to the understanding of the tempo and mode of these changes. Middle Pleistocene sites in the Northern Iberian Peninsula are very rare. Here we present the study of the site found at the Punta Lucero Quarry (Biscay province, Northern Iberian Peninsula), which includes for the first time the complete collection from the site. The fossil association from this site includes several ungulates, such as a Megacerine deer, Cervus elaphus, large bovids (likely both Bos primigenius and Bison sp. are present), Stephanorhinus sp., and carnivores, such as Homotherium latidens, Panthera gombaszoegensis, Canis mosbachensis and Vulpes sp. This association is typical of a middle Middle Pleistocene chronology and would be the oldest macro-mammal site in the Eastern Cantabrian region. This site would likely correspond to a chronology after Mode 1 technological complex and before the arrival of Mode 2 technology in this region. Thus, it offers a glimpse into the paleoecological conditions slightly prior to or contemporaneous with the first Acheulian makers in the northern fringe of the Iberian Peninsula.

Mutagenic Potential ofBos taurus Papillomavirus Type 1 E6 Recombinant Protein: First Description

Directory of Open Access Journals (Sweden)

Rodrigo Pinheiro Araldi

2015-01-01

Full Text Available Bovine papillomavirus (BPV is considered a useful model to study HPV oncogenic process. BPV interacts with the host chromatin, resulting in DNA damage, which is attributed to E5, E6, and E7 viral oncoproteins activity. However, the oncogenic mechanisms of BPV E6 oncoprotein per se remain unknown. This study aimed to evaluate the mutagenic potential of Bos taurus papillomavirus type 1 (BPV-1 E6 recombinant oncoprotein by the cytokinesis-block micronucleus assay (CBMNA and comet assay (CA. Peripheral blood samples of five calves were collected. Samples were subjected to molecular diagnosis, which did not reveal presence of BPV sequences. Samples were treated with 1 μg/mL of BPV-1 E6 oncoprotein and 50 μg/mL of cyclophosphamide (positive control. Negative controls were not submitted to any treatment. The samples were submitted to the CBMNA and CA. The results showed that BPV E6 oncoprotein induces clastogenesis per se, which is indicative of genomic instability. These results allowed better understanding the mechanism of cancer promotion associated with the BPV E6 oncoprotein and revealed that this oncoprotein can induce carcinogenesis per se. E6 recombinant oncoprotein has been suggested as a possible vaccine candidate. Results pointed out that BPV E6 recombinant oncoprotein modifications are required to use it as vaccine.

Harvestmen of the BOS Arthropod Collection of the University of Oviedo (Spain) (Arachnida, Opiliones)

Science.gov (United States)

Merino-Sáinz, Izaskun; Anadón, Araceli; Torralba-Burrial, Antonio

2013-01-01

Abstract There are significant gaps in accessible knowledge about the distribution and phenology of Iberian harvestmen (Arachnida: Opiliones). Harvestmen accessible datasets in Iberian Peninsula are unknown, an only two other datasets available in GBIF are composed exclusively of harvestmen records. Moreover, only a few harvestmen data from Iberian Peninsula are available in GBIF network (or in any network that allows public retrieval or use these data). This paper describes the data associated with the Opiliones kept in the BOS Arthropod Collection of the University of Oviedo, Spain (hosted in the Department of Biología de Organismos y Sistemas), filling some of those gaps. The specimens were mainly collected from the northern third of the Iberian Peninsula. The earliest specimen deposited in the collection, dating back to the early 20th century, belongs to the P. Franganillo Collection. The dataset documents the collection of 16,455 specimens, preserved in 3,772 vials. Approximately 38% of the specimens belong to the family Sclerosomatidae, and 26% to Phalangidae; six other families with fewer specimens are also included. Data quality control was incorporated at several steps of digitisation process to facilitate reuse and improve accuracy. The complete dataset is also provided in Darwin Core Archive format, allowing public retrieval, use and combination with other biological, biodiversity of geographical variables datasets. PMID:24146596

Effect of follicular diameter, time of first cleavage and H3K4 methylation on embryo production rates of Bos indicus cattle

Directory of Open Access Journals (Sweden)

Paula Alvares Lunardelli

2016-10-01

Full Text Available This study aimed investigate the relationship between epigenetics, follicular diameter and cleavage speed, by evaluating the developmental potential and occurence of H3K4 monomethylation of early-, intermediate- and late-cleaving Bos indicus embryos from in vitro fertilized oocytes originating from follicles up to 2 mm in diameter or between 4 and 8 mm in diameter. Oocytes (n = 699 from small follicles (? 2 mm and 639 oocytes from large follicles (4-8 mm were punched from 1,982 Bos indicus’ slaughterhouse ovaries. After maturation and in vitro fertilization (IVF, the cultured embryos were separated into early (? 28 h post-IVF, intermediate (> 28 h and ? 34 h post-IVF and late (> 34 h and ? 54 h post-IVF cleavage groups. Blastocysts were subjected to an immunofluorescence assessment for H3K4me investigation. The blastocyst rate for large follicles (36.3% was higher than that for small follicles (22.9%, P < 0.05. In addition, blastocyst rates for early and intermediate cleavage groups (45.3% and 33.8%, respectively were higher than that for late cleavage group (13.5%, P < 0.05. The blastocysts from all groups displayed H3K4me staining by immunofluorescence, particularly intense in what seemed to be trophectoderm cells and weak or absent in cells seemingly from the inner cell mass. For the first time for indicus embryos, data from this study demonstrate that higher blastocyst embryo rates are obtained from embryos that cleave within 34 h after fertilization and from those produced from follicles of 4-8 mm in diameter, indicating a greater ability of these embryos to develop to the stage of embryonic preimplantation. This is the first article demonstrating the occurrence of H3K4me in cattle embryos; its presence in all the evaluated blastocysts suggests that this histone modification plays a key role in maintaining embryo viability at preimplantation stage.

Does ECG influence the conception rate Nelore cows presenting different body condition scores submitted to the same timed-AI protocol?

Directory of Open Access Journals (Sweden)

Erika Aline Ribeiro Dias

2013-03-01

Full Text Available The aim of this study was to evaluate the conception rate (CR of multiparous Nelore cows presenting different body condition scores (BCS, which were submitted to the same Timed-AI protocol with equine chorionic gonadotrophin (eCG. A total of 1574 cows were inseminated, between 40 and 50 days postpartum. During insemination (timed-AI, all data regarding to bull (n=8, inseminator (n=3 and BCS (1 to 5 were recorded. The pregnancy diagnosis was performed, by ultrasonography, 40 days after timed-AI. No effect (P>0.05 of inseminator or bull was observed. No statistical difference was also observed between the groups of animals with different BCS. The animals with lower BCS (Group 1 = BCS 1.5 to 2.0; n = 139 had a CR of 47.4%. The animals with BCS from 2.5 to 2.75 (Group 2; n = 741 and BCS from 3.0 to 3.25 (Group 3; n = 463 had a CR of 47.6% and 51.2%, respectively. The animals with higher BCS (Group 4 = BCS 3.5 to 4.0; n = 231 had a CR of 45.3% (P > 0.05. It was concluded that conception rates were similar between the animals presenting different BCS in the herd, likely because the eCG minimized the effects of low LH pulsatility in animals presenting reduced nutritional condition. However, other studies are recommended to verify the real need of using eCG in animals with body condition exceeding 3.5.

Viabilidade financeira da inseminação artificial em tempo fixo de bezerros cruzados Nelore e Aberdeen Angus = Economic feasibility of timed artificial insemination of Nellore and Aberdeen Angus crossbred calves

Directory of Open Access Journals (Sweden)

Nelson Zuchi Neto

2017-07-01

Full Text Available O cruzamento entre taurinos e zebuínos através de Inseminação Artificial em Tempo Fixo [IATF] é uma realidade presente em várias propriedades rurais no Brasil. Visando as vantagens da IATF em conjunto com as vantagens do cruzamento industrial o objetivo foi verificar a viabilidade financeira desta atividade em uma propriedade no município de Nova Lacerda, MT. Para tal, utilizou-se as ferramentas de matemática financeira Valor Presente Líquido [VPL], Taxa Interna de Retorno [TIR] e Payback. O projeto se mostrou viável com um VPL acima de R$ 300 mil, TIR de 23,03% e Payback descontado de aproximadamente oito anos. A venda de descartes e a suplementação dos bezerros em sistema de “creep feeding” se mostraram importantes para a viabilidade deste projeto. = Bos taurus and Bos indicus crossbred through Timed Artificial Insemination [TAI] is present in several farms in Brazil. Aiming the advantages of the TAI together with industrial crossing, the objective was to verify the economic feasibility of this activity on a farm in the city of Nova Lacerda, MT. Financial mathematics tools like Net Present Value [NPV], Internal Rate of Return [IRR] and Payback were used. The project was feasible with a NPV above R$ 300 thousand, an IRR of 23.03% and a Discounted Payback of approximately eight years. The sale of discards matrix and the supplementation of calves in a creep feeding system showed to be important for the viability of this project.

ANÁLISE DA PRODUÇÃO DE EMBRIÕES NA FERTILIZAÇÃO IN VITRO E TRANSFERÊNCIA DE EMBRIÕES PARA DOADORAS NELORE ANALYSIS OF EMBRYO PRODUCTION IN VITRO FERTILIZATION AND EMBRYO TRANSFER TO NELLORE DONORS

Directory of Open Access Journals (Sweden)

Renato Travassos Beltrame

2010-04-01

Full Text Available

Ajustou-se uma função de densidade probabilidade para o
número de embriões viáveis produzidos após fertilização in vitro
em doadoras da raça Nelore, a partir de dados fornecidos pela Associação Brasileira de Criadores de Zebu (ABCZ, referente à análise de 20.619 doadoras, 71.602 aspirações e um total de 509.643 embriões. Modelou-se a densidade probabilidade do número de embriões viáveis mediante a função exponencial, executando-se a determinação dos parâmetros por meio da máxima verossimilhança, em um método de gradiente não linear. O nível de precisão obtido foi de RMSE = 0,040 e R2 = 0,98, para a representação da probabilidade do número de embriões viáveis produzidos por doadoras Nelore na técnica de fertilização in vitro(FIV. Para comparar os modelos (curvas de probabilidade de transferência de embriões ajustada por Beltrame, em 2006, e de FIV, neste trabalho, aplicou-se a técnica de comparação de curvas com o teste F (Silva e Azevedo, 2002. Não foram encontradas diferenças entre as curvas do número de embriões viáveis obtidos após coleta e produzidos após aspiração de doadoras na raça Nelore. Ainda, sugere-se a existência de um fator único limitante que afete biologicamente a produção de embriões nas técnicas de transferência de embriões e fertilização in vitro.

PALAVRAS-CHAVES: Banco de dados, densidade probabilidade, doadoras, simulação.

Aprobability density function for the number of viable embryos produced after an in vitro fertilization program in Nellore donors  was adjusted through data provided by the Brazilian Association of Zebu breeders. Results were based on 20,619 donors, 71,602 aspirations and the total of 509,643 embryos. The probability density function of the number of viable embryos was modeled using exponential distribution. Parameters fitting were carried out for the maximum likelihood using a non-linear gradient method. The

Estimativa da gordura de cobertura ao abate, por ultra-som, em tourinhos Brangus e Nelore Prediction of backfat at slaughter, by ultrasound, in Nellore and Brangus young bulls

Directory of Open Access Journals (Sweden)

Saulo da Luz e Silva

2004-04-01

Full Text Available O objetivo deste trabalho foi verificar a viabilidade da utilização da ultra-sonografia para estimar a espessura de gordura na carcaça (EGSC no momento do abate. Foram confinados 24 machos inteiros Brangus e 24 Nelore com dietas contendo 20, 40, 60 ou 80% de concentrado. A área de olho de lombo (AOLU e a espessura de gordura (EGSU entre a 12ª e a 13ª costelas e a espessura de gordura sobre o músculo Biceps femoris (EGPU, foram obtidas com equipamento de ultra-som PieMedical Scanner 200 Vet com transdutor linear de 178 mm e guia acústica, a cada intervalo de aproximadamente 28 dias. Após 142 dias de confinamento, os animais foram abatidos e 24 h após foi obtida a EGSC. As correlações entre EGSU e EGSC foram de 0,19, 0,64, 0,74, 0,78, 0,82, 080 e 0,86, quando obtidas aos 0, 26, 53, 84, 109, 125 e 142 dias de confinamento. Equações de regressão múltipla entre raças para estimar a EGSC apresentaram R² = 0,10 e Sy,x = 2,04 quando realizadas 142 dias antes do abate e R² = 0,78 e Sy,x = 0,10 imediatamente antes do abate. Medidas de ultra-som podem ser úteis para classificar grupos de animais para abate em igual acabamento.The objective of this work was to verify the usefullness of ultrasound to estimate the carcass backfat thickness (EGSC at slaughter. Twenty four Brangus and 24 Nelore, intact males, were fed with diets containing 20, 40, 60 or 80% of concentrate. Ribeye area (AOLU and backfat thickness (EGSU between 12ª and 13ª ribs and the fat thickness over Biceps femoris muscle (EGPU were collected with a PieMedical Scanner 200 Vet equipment, with linear array transducer of 178 mm coupled with standoff guide, on intervals of approximately 28 days. After 142 days on fed, animals were slaughtered and the carcass backfat thickness (EGSC was taken, 24 hours after. The correlations between EGSU and EGSC were 0.19, 0.64, 0.74, 0.78, 0.82, 0.80 and 0.86 when taken at 0, 26, 53, 84, 109, 125 and 142 days on fed. Multiple regression

Níveis de suplementação na terminação de novilhos Nelore em pastagens: aspectos econômicos Supplementation levels in finishing of Nelore steers on pastures: economic aspects

Directory of Open Access Journals (Sweden)

Robério Rodrigues Silva

2010-09-01

Full Text Available Objetivou-se avaliar as respostas econômicas de novilhos Nelore em terminação à suplementação em pastagens de Brachiaria brizantha no Sudoeste da Bahia. O experimento foi desenvolvido no período de agosto a novembro de 2006 em uma área de 52,0 hectares, dividida em oito piquetes de aproximadamente 6,5 hectares. Testaram-se quatro níveis de suplementação com concentrado (controle, 0,3; 0,6 e 0,9% do peso vivo do animal em comparação à suplementação com sal mineral. Os níveis de suplementação elevaram a quantidade de carne produzida por hectare. A curva de crescimento da receita é menos acentuada que a dos custos, o que resulta em achatamento do lucro de acordo com os níveis de suplementação estudados. Os melhores resultados biológicos obtidos com elevados níveis de suplemento não são economicamente sustentáveis, em decorrência do aumento do custo de produção, no entanto, níveis de suplementação inferiores a 0,3% do peso vivo na fase de terminação são viáveis e têm potencial econômico.In this study, it was aimed to evaluate the economic responses of finishing Nellore steers to supplementation of Brachiaria brizantha pastures in southwestern Bahia. The experiment was developed from August to November 2006 in a 52-ha area divided in eight pickets of approximately 6.5 hectares each. It was tested four levels of concentrate supplementation (control, 0.3, 0.6 and 0.9% of the body weight of animal compared to supplementation with mineral salt. Supplementation levels raised the amount of meat produced per hectare. The curve of revenue growth is less sharp than the cost growth curve, resulting in a flattening of profit according to levels of the studied supplementation. The best biological results obtained from high levels of supplements are not economically sustainable because of the increase in the production cost, however, supplementation levels lower than 0.3% of body weight in the finishing phase are feasible

Alteração nas frações das proteínas miofibrilares e maciez do músculo Longissimus de bovinos no período post mortem

OpenAIRE

Santos,Gilmara Bruschi; Ramos,Paulo Roberto Rodrigues; Spim,Jeison Solano

2014-01-01

Objetivou-se com o estudo identificar por eletroforese as mudanças nas frações das proteínas musculares durante período postmortem de bovinos de diferentes grupos genéticos e analisar a maciez da carne em amostras resfriadas por 24 horas (não maturadas) e maturadas por 7 dias. Foram utilizadas amostras do musculo Longissimus de quarenta e oito bovinos pertencentes a 4 grupos genéticos: 12 Nelore; 12 cruzados ½ Nelore ½ Aberdeen-Angus x Brahman; 12 Brangus; 12 cruzados ½ nelore ½ Aberdeen-Angu...

Efeito do grupo genético sobre as características de carcaça e maciez da carne fresca e maturada de bovinos superprecoces

OpenAIRE

Bianchini,Waldmaryan; Silveira,Antônio Carlos; Jorge,André Mendes; Arrigoni,Mário De Beni; Martins,Cyntia Ludovico; Rodrigues,Érico; Hadlich,Janaína Conte; Andrighetto,Cristiana

2007-01-01

Objetivou-se estudar o efeito das diferentes proporções de sangue Simental e Nelore sobre as características da carcaça e da carne de bovinos superprecoces. Foram utilizados 72 bovinos jovens inteiros (18 Nelore; 18 ½ Simental × Nelore; 18 Simbrasil e 18 Simental), com 8 meses de idade e 250 kg PV médio inicial. Os animais foram desmamados aos 8 meses de idade em sistema creep-feeding e posteriormente confinados durante 150 dias até atingirem o peso de abate, acima de 465 kg, e a...

Efeito do grupo genético sobre as características de carcaça e maciez da carne fresca e maturada de bovinos superprecoces Effect of genetic group on carcass traits and fresh and aged beef tenderness from young cattle

OpenAIRE

Waldmaryan Bianchini; Antônio Carlos Silveira; André Mendes Jorge; Mário De Beni Arrigoni; Cyntia Ludovico Martins; Érico Rodrigues; Janaína Conte Hadlich; Cristiana Andrighetto

2007-01-01

Objetivou-se estudar o efeito das diferentes proporções de sangue Simental e Nelore sobre as características da carcaça e da carne de bovinos superprecoces. Foram utilizados 72 bovinos jovens inteiros (18 Nelore; 18 ½ Simental × Nelore; 18 Simbrasil e 18 Simental), com 8 meses de idade e 250 kg PV médio inicial. Os animais foram desmamados aos 8 meses de idade em sistema creep-feeding e posteriormente confinados durante 150 dias até atingirem o peso de abate, acima de 465 kg, e a...

Estudos de algumas correlações dos ovários com os corpos lúteos e o desenvolvimento fetal em fêmeas de bovinos nelore

Directory of Open Access Journals (Sweden)

Renata Barbieri Trevisan

2012-01-01

Foram avaliados os ovários direito e esquerdo de 30 vacas prenhes da raça Nelore, cujo aparelhos reprodutores foram coletados em frigoríficos da região de Oeste do Estado de São Paulo. Este material foi conduzidos ao Laboratório de Anatomia Animal do campus da Unesp de Araçatuba, para serem analisados o tamanho do feto, por meio de medida occipito-sacral, sua altura e peso. Também foi obtido dos ovários e corpos lúteos o comprimento, largura e espessura por meio de paquímetro, destas gônadas foram analisados também o seu peso e volume. Estas informações relativas aos ovários e aos corpos lúteos foram correlacionadas com o desenvolvimento fetal, utilizando o programa SAS para analisar o coeficiente de correlação de Pearson, além de ajustado um modelo de Regressão Linear Simples. Verificou-se que houve correlação significativa entre as variáveis ovários direito e desenvolvimento fetal, positiva para largura e negativa para espessura. Já entre o corpo lúteo e desenvolvimento do feto houve correlação significativa negativa para o volume.

Prevalence of Circulating Antibodies to Bovine Herpesvirus 1 in Yaks (Bos grunniens) on the Qinghai-Tibetan Plateau, China.

Science.gov (United States)

Han, Zhaoqing; Gao, Jianfeng; Li, Kun; Shahzad, Muhammad; Nabi, Fazul; Zhang, Ding; Li, Jiakui; Liu, Zhengfei

2016-01-01

Bovine Herpesvirus 1 (BoHV-1) causes infections with many clinical signs, including rhinotracheitis, encephalitis, and genital lesions. The virus occurs worldwide in bovines, and in recent years, it has been reported in yaks (Bos grunniens) inhabiting the Tibetan Plateau in China. However, there is little epidemiologic data describing BoHV-1 infections in China's yak herds. We conducted a cross-sectional study on the Qinghai-Tibetan Plateau (QTP) in China July 2011-July 2012 to estimate the prevalence of BoHV-1 antibody in yak herds. We collected 1,840 serum samples from yaks on the QTP, in Tibet (988 yaks), Qinghai (475 yaks), and Sichuan (377 yaks) Provinces. Using an enzyme-linked immunosorbent assay, we found that 381 (38.6%) of the Tibetan samples, 212 (44.6%) of the Qinghai samples, and 105 (27.9%) of the Sichuan samples had detectable antibodies to BoHV-1. Given that this high prevalence of infection in yaks could result in heavy economic losses, we suggest that an effective management program, including vaccination and strategies for infection control, be developed.

Dieta com alto teor de gordura e desempenho de tourinhos de grupos genéticos diferentes em confinamento High-fat diet and feedlot performance of bullocks of different genetic groups

Directory of Open Access Journals (Sweden)

Andréa Roberto Duarte Lopes Souza

2009-07-01

Full Text Available O objetivo deste trabalho foi avaliar o desempenho em confinamento de tourinhos de quatro grupos genéticos distintos tratados com dietas com diferentes teores de gordura. Foram utilizados nove animais Nelore, nove Caracu, dez ½ Caracu ¼ Angus ¼ Nelore e dez ½ Red Angus ¼ Caracu ¼ Nelore, com massa corporal inicial de 227±33 kg e dez meses de idade, distribuídos aleatoriamente em dois tratamentos nutricionais: baixo teor de gordura (3,15% de extrato etéreo e alto teor de gordura (7,28% de extrato etéreo. A ingestão de matéria seca (IMS foi quantificada durante 208 dias e as pesagens dos animais foram realizadas a cada 28 dias. Os animais alimentados com as dietas de alto e de baixo teor de gordura apresentaram resultados similares de ganho médio diário de peso (1,511x1,487 kg por dia, respectivamente e de eficiência alimentar (194x180 g de ganho por quilograma de MS ingerida, respectivamente; a IMS, em percentagem do peso vivo, foi menor nos animais alimentados com dieta de alto teor de gordura (2,25x2,40, respectivamente. Os animais cruzados apresentaram maior ganho de massa corporal e IMS que os Nelore. A dieta com alto teor de gordura pode ser utilizada em confinamento para melhorar o desempenho de tourinhos ½ Caracu ¼ Angus ¼ Nelore, pois é eficiente para reduzir a ingestão de matéria seca e não prejudica o ganho de massa corporal dos animais.This work aimed to evaluate the feedlot performance of bullocks of four distinct genetic groups receiving diets with different levels of fat. Nine Nelore; nine Caracu; ten ½ Caracu ¼ Angus ¼ Nelore and ten ½ Red Angus ¼ Caracu ¼ Nelore bullocks, with a mean initial weight of 227±33 kg and ten months of age, were randomly assigned to two nutritional treatments and fed either with low-fat (3.15% ether extract or high-fat diet (7.28% ether extract. Dry matter intake (DMI was quantified during 208 days and the animals were weighed every 28 days. Animals fed with the high-fat and

Desempenho ponderal de bovinos Nelore suplementados com fontes alternativas de fósforo

Directory of Open Access Journals (Sweden)

Guilherme Cazerta Lemos

2013-02-01

Full Text Available O desempenho produtivo e a possível interferência do flúor sobre a saúde dos animais foram investigados em bovinos Nelore suplementados, por 866 dias, com distintas fontes alternativas de fósforo com diferentes relações fósforo:fluor (P:F. Os tratamentos experimentais foram: Controle negativo (CONTNEG, sem qualquer suplementação com P, fosfato bicálcico (FB 120:1, FB 30:1 e FB 10:1, fosfato monobicálcico (FMBC 60:1, superfosfato triplo (SFT 30:1 e fosfato de rocha de Cajati (FR 10:1. Foram utilizados 49 novilhos, desmamados aos oito meses de idade, castrados e com 230 kg de peso médio, distribuídos em sete piquetes com água e mistura mineral formulada sem P. A dieta padrão foi feita com bagaço de cana (0,03% de P como volumoso e um concentrado contendo 0,239 % de P oferecido na base de 1% do peso dos animais para permitir um ganho de peso aproximado de 0,50 kg/dia. Até o dia 134, não houve diferença estatística entre os diversos lotes, inclusive para o tratamento CONTNEG, que não recebeu fósforo suplementar na dieta e ganhou 71,6 kg de peso ou 0,633 kg/dia. Após 866 dias de confinamento (2,37 anos, os animais suplementados com o fosfato bicálcico padrão (120:1 ganharam menos peso que os suplementados com as fontes FMCB 60:1, FB 30:1 e SFT 30:1. Até um ano de suplementação fosfórica com fosfato bicálcico padrão (120:1 artificialmente fluoretado com NaF ou com o fosfato de rocha não se detectou danos à saúde ou ao ganho de peso dos animais. As análises de fósforo nos ossos mostraram diferença estatística apenas entre o tratamento CONTNEG e os que tinham fosfato bicálcico. As concentrações de flúor nos ossos se mostraram intimamente associadas à quantidade de flúor disponível nas fontes utilizadas. Conforme a proporção P:F na dieta foi diminuindo, características relacionadas à fluorose dentária ficaram mais evidentes, sendo que os animais que receberam fontes com relação 10:1, apresentaram, ao

Participação da via alfa-2 adrenérgica no controle da secreção do hormônio do crescimento no período pré-púbere em novilhas da raça Nelore: adrenergic in the control of growth hormone secretion in the pre-puberty period of the Nellore heifers

Directory of Open Access Journals (Sweden)

Emiliana de Oliveira Santana Batista

2011-08-01

Full Text Available O objetivo deste trabalho foi investigar a variação na secreção de GH em resposta ao tratamento com clonidina, agonista alfa-2 adrenérgico, no período pré-púbere de novilhas da raça Nelore, e desta forma obter informações neuroendócrinas envolvidas no processo de maturação sexual destes animais. A administração de clonidina (10 µg/kg, I.V., amostras 15 min por 4h foi feita nas novilhas aos oito (n =4, 12(n = 5 e 15 meses de idade (n = 4. A concentração de GH foi quantificada por radioimunoensaio (sensibilidade = 0,25 ng/mL, CV = 16%. Aos oito meses, a administração do estimulador alfa-2 adrenérgico aumentou a concentração de GH, área total de picos, área total de secreção de GH e amplitude do maior pico e reduziu o tempo para aparecimento de pico (P < 0,05. A administração de clonidina aumentou a concentração de GH aos 15 meses, e aos 12 meses, em intervalos restritos (P < 0,05. O uso da clonidina estimulou a secreção de GH em novilhas Nelore pré-púberes. Este efeito foi mais evidente nas novilhas aos oito meses, comparado aos 12 e 15 meses de idade.

Rumen microbial variation and nutrient utilisation in mithun (Bos frontalis) under different feeding regimes.

Science.gov (United States)

Prakash, B; Saha, S K; Khate, K; Agarwal, N; Katole, S; Haque, N; Rajkhowa, C

2013-04-01

The aim of the study was to investigate the effect of feeding different diets on fermentation, enzyme activities and microbial population in the rumen fluid of mithun (Bos frontalis). In a randomized block design, 20 male mithun (6-8 months of age, 152 ± 12.6 kg body weight) were randomly divided into four experimental groups (n = 5/group) and fed experimental diets ad libitum for 180 days. The diet R1 contained tree foliages (TF), R2 comprised of 50% concentrate mixture (CM) and 50% TF, R3 contained 50% CM and 50% rice straw, and R4 contained 50% CM, 25% TF and 25% rice straw. Rumen liquor was collected at 0 and 180 days of the experiment for estimation of different ruminal parameters and a digestion trial was conducted at the end of the experiment. Rumen fluid was analysed for pH, ammonia nitrogen (NH3 -N), total-N, ruminal enzymes, short chain fatty acid (SCFA) and microbial profile. The relative quantification of ruminal microbes was carried out with real-time PCR using bacteria as the house keeping gene. The dry matter intake, nutrients digestibility, body weight gain, NH3 -N, total-N, carboxymethyl cellulase, avicelase, xylanase, amylase, protease and molar proportion of butyrate were (p ecology, nutrient utilization and thus better performance under stall fed system. © 2012 Blackwell Verlag GmbH.

Collection, analysis and cryopreservation of semen from Malayan gaur (Bos gaurus hubbacki: A preliminary study

Directory of Open Access Journals (Sweden)

M.S. Khairiah

2012-10-01

Full Text Available The Malayan gaur (Bos gaurus hubbacki or Seladang is classified as vulnerable by the International Union for Conservation of Nature and Natural Resources (IUCN. The Malayan gaur is mainly distributed in the tropical woodlands of Peninsular Malaysia and Southern Thailand. The aim of this study was to collect, analyze and cryopreserve the semen of wild Malayan gaur. Transrectal massage (TM and electroejaculation (EEJ technique was applied in semen collection of the Malayan gaur. The semen was then cryopreserved in liquid nitrogen using slow freezing technique. Makler counting chamber was used to evaluate sperm concentration and motility, while the sperm viability and morphology of fresh and post-thaw sperm was determined using eosin-nigrosin staining protocol. As a result, we have successfully collected the Malayan gaur semen using EEJ technique. Sperm motility, viability and morphological changes of the post-thaw semen of Malayan gaur were found undesirable due to the complication of the cryopreservation process. On the basis of current study it can be concluded that Malayan gaur bulls semen can be obtain by EEJ with no evidence of rectal trauma. Optimization of the process of cryopreservation for Malayan gaur sperm is needed to maintain the cryoviability of the good sperm quality. The data generated in this study would be useful in conservation of genetic diversity program for Malayan gaur.

Influência de polimorfismos genéticos sobre os parâmetros da curva de crescimento em bovinos de corte

OpenAIRE

Paro de Paz,Claudia Cristina; Packer,Irineu Umberto; Freitas,Alfredo Ribeiro de; Tambasco-Talhari,Daniela; Regitano,Luciana Correa de Almeida; Alencar,Maurício Mello de; Rodrigues,Armando de Andrade

2004-01-01

Registros de pesos ao nascimento, ao desmame e mensais dos 8 aos 19 meses de idade, referentes à animais dos grupos genéticos: ½Canchim-Nelore (CN), ½Angus-Nelore (AN) e ½Simental-Nelore (SN), pertencentes à Embrapa Pecuária Sudeste, São Carlos, SP, foram analisados pela técnica de modelos não-lineares incluindo, no modelo Logístico, os efeitos fixos de grupo de contemporâneos e das classes de genótipos dos genes da kappa-caseína-HinfI (CSN3): AA e AB, do hormônio do cres...

Transferência de imunidade passiva em bezerros das raças Nelore e Limousin e proteinograma sérico nos primeiros quatro meses de vida Passive transfer of immunity in Nelore and Limousin calves and serum proteinogram in the first four months of life

Directory of Open Access Journals (Sweden)

Márcio Carvalho da Costa

2008-09-01

Full Text Available Com o objetivo de investigar alguns aspectos relacionados à transferência de imunidade passiva em bovinos de corte, foram selecionados 90 bezerros aparentemente sadios, 45 da raça Nelore e 45 da raça Limousin, distribuídos em 3 grupos (com 15 bezerros cada de acordo com o número de parições de suas mães: primeira cria; segunda cria; e terceira ou mais crias. Amostras de sangue foram colhidas de cada bezerro entre 24 e 36 horas de vida e com 15, 30, 60, 90 e 120 dias. Determinaram-se as concentrações de proteína total no soro (PT e no plasma (PPT, a atividade sérica da gamaglutamiltransferase (GGT, e as concentrações séricas de albumina, alfa, beta e gamaglobulinas por eletroforese em gel de agarose e de IgG estimada por meio do método de turvação pelo sulfato de zinco. Empregou-se a análise de variância bifatorial para as variáveis mensuradas na primeira colheita. O comportamento das variáveis em função da idade foi estudado por meio da análise de variância de medidas repetidas. Correlações foram estabelecidas entre as variáveis. A transferência de imunidade passiva foi bem sucedida nos bezerros de ambas as raças e o número de parições das mães não interferiu no processo. As concentrações mais elevadas de gamaglobulinas ao término do primeiro dia de vida declinaram até valores mínimos aos 60 dias. A partir dessa idade, a elevação conseqüente à produção ativa de anticorpos foi mais precoce nos bezerros taurinos e mais lenta nos zebuínos. A gamaglobulina, ao término do primeiro dia de vida, correlacionou-se com as seguintes variáveis: IgG (r=0,859, PPT (r=0,807, PT (r=0,811 e GGT (r=0,399. O fator etário exerceu efeito sobre todas as variáveis mensuradas. As variações das proteínas séricas obedeceram a um padrão de comportamento fisiológico ao longo dos quatro primeiros meses de vida, de forma geral, não distinto em taurinos e zebuínos.To study the passive transfer of immunity, 90

USO DE ANTI-HELMÍNTICOS E BIOESTIMULANTES NO DESEMPENHO DE BOVINOS DE CORTE SUPLEMENTADOS A PASTO NO ESTADO DO PARÁ EFFECTS OF VERMIFUGES AND BIOSTIMULANTS ON BEEF CATTLE PERFORMANCE UNDER PASTURE SUPPLEMENTATION IN PARÁ STATE

Directory of Open Access Journals (Sweden)

Sâmia Rubielle Silva de Castro

2009-07-01

Full Text Available O experimento avaliou o efeito da vermifugação e da utilização de bioestimulantes no ganho de peso e no escore de condição corporal (ECC de bovinos de corte, criados em sistema de pastejo rotacionado com suplementação a pasto, no Estado do Pará, durante 160 dias. Foram utilizados 132 bovinos machos não castrados, com idade média de 24 meses, da raça Nelore (Bos taurus indicus. Os grupos experimentais compreenderam o grupo G1 (controle; n=33, G2 (moxidectina 1%; n=33, G3 (moxidectina 10%; n=33 e G4 (ivermectina 3,15%; n=33. Em todos os grupos foram estabelecidas três subparcelas, a fim de serem testados dois bioestimulantes de crescimento animal (bioestimulante 1 e bioestimulante 2. Não houve diferença estatística significativa no ganho de peso médio, no ECC e nas contagens de OPG entre animais do G1, G2, G3 e G4, independentemente dos anti-helmínticos e/ou bioestimulantes usados. Contudo, o tratamento baseado na associação de moxidectina 1% e o bioestimulante 2 apresentou maior receita líquida e incrementou a lucratividade da terminação em 1,24%. Os resultados sugerem que não há necessidade de um controle contra nematódeos durante a terminação, desde que os animais apresentem uma baixa carga parasitária, porém o uso de fármacos pode, sob certas condições, apresentar resultado econômico favorável.

PALAVRAS-CHAVES: Anti-helmíntico, bovinocultura, crescimento, rentabilidade, sistema de produção.
The experiment evaluated the effect of vermifuges and biostimulants on weight gain and body condition score (BCS of beef cattle, created in pasture supplementation system, in the State of Pará, during 160 days. Experimental animal were 132 Nelore (Bos taurus indicus, non-castrated male, with average age of 24 months. Experimental groups were: G1 group (control; n=33, G2 (1% moxidectin; n=33, G3 (10% moxidectin; n=33 and G4 (3.15% ivermectin; n=33. Each group was divided in three plots, in order to test

Composição química e de ácidos graxos do músculo longissimus dorsi e da gordura subcutânea de tourinhos Red Norte e Nelore Chemical composition and of fatty acids of the muscle longissimus dorsi and backfat of Red Norte and young Nellore bulls

Directory of Open Access Journals (Sweden)

Leandro Sâmia Lopes

2012-04-01

Full Text Available Objetivou-se com este trabalho avaliar a composição química e o perfil de ácidos graxos do músculo longissimus dorsi e da gordura subcutânea de tourinhos Red Norte e Nelore terminados em confinamento. Utilizaram-se 44 animais, sendo 22 Red Norte com peso vivo inicial médio de 367±30 kg e 22 do grupo Nelore com peso vivo inicial médio de 361±30 kg. Os animais receberam ração à vontade durante 112 dias e foram abatidos com 519 e 482 kg, respectivamente. Amostras do músculo longissimus dorsi e da gordura subcutânea foram coletadas 24 horas após abate entre a 12ª e 13ª costelas para análise da composição centesimal e do perfil de ácidos graxos. As análises de ácidos graxos foram realizadas por meio de cromatografia gasosa, em coluna capilar de 100 m. Não houve diferença na composição química da carne entre os grupos genéticos. Nos animais Red Norte, foram maiores os teores dos ácidos graxos pentadecanoico, palmítico, palmitoleico, linoleico e ácido linoleico conjugado (CLA, enquanto nos animais Nelore foi encontrado o maior teor de ácido oleico. O músculo longissimus dorsi apresentou maiores teores dos ácidos láurico, heptadecenoico, esteárico, linoleico, α-linolênico e araquidônico. Em comparação ao músculo longissimus dorsi, na gordura subcutânea foram maiores os teores dos ácidos mirístico, miristoleico, pentadecanoico, palmítico, palmitoleico, oleico e CLA. Os animais Red Norte apresentaram maiores teores de ácidos graxos saturados em comparação aos Nelore. Em bovinos, o perfil de ácidos graxos depositados no músculo é diferente do observado na gordura subcutânea. O perfil de ácidos graxos da carne de tourinhos difere entre grupos genéticos.The objective of this study was to evaluate the chemical composition and the fatty acid profile of the longissimus dorsi muscle and the backfat thickness of Red Norte and Nellore young bulls finished in feedlot. Fourty-four animals (22 Red Norte with

REVIEW: The Characteristics of Genetic Resource of Bali Cattle (Bos-bibos banteng and the Alternative of It's Conservation Methods

Directory of Open Access Journals (Sweden)

ACHMAD NUR CHAMDI

2005-01-01

Full Text Available Bali cattle is an Indonesian native beef cattle, the result of domestication of Banteng (Bos-bibos banteng. The main problem faced in the development of Bali cattle is the low quality of breed, which is predicted as the effect of inbreeding or raising management. The affects of genetic and cross breeding which usually inflict a loss are the decreasing of cattle’s endurance, fertility and birth weight. Seeing the fact, the government effort to introduce a quality bull to the breed source areas, the determination of cattle release including the controll on the cutting of productive female cattle, and to exactly count the number of Bali cattle which can be released in order to do not disturb its population balance, so it is necessary to do conservation attempt by in-situ and ex-situ. The result of this study shows that the characteristics on genetic resource of Bali cattle which comprises documentation, evaluation on reproduction and production, and attempt in increasing Bali cattle’s genetic quality in Indonesia have been done, eventhough those are still limited.

Proteomic analysis of a pleistocene mammoth femur reveals more than one hundred ancient bone proteins

DEFF Research Database (Denmark)

Cappellini, Enrico; Jensen, Lars Juhl; Szklarczyk, Damian Milosz

2012-01-01

We used high-sensitivity, high-resolution tandem mass spectrometry to shotgun sequence ancient protein remains extracted from a 43 000 year old woolly mammoth (Mammuthus primigenius) bone preserved in the Siberian permafrost. For the first time, 126 unique protein accessions, mostly low-abundance......We used high-sensitivity, high-resolution tandem mass spectrometry to shotgun sequence ancient protein remains extracted from a 43 000 year old woolly mammoth (Mammuthus primigenius) bone preserved in the Siberian permafrost. For the first time, 126 unique protein accessions, mostly low......-abundance extracellular matrix and plasma proteins, were confidently identified by solid molecular evidence. Among the best characterized was the carrier protein serum albumin, presenting two single amino acid substitutions compared to extant African (Loxodonta africana) and Indian (Elephas maximus) elephants. Strong...

Suplementos para recria de bovinos Nelore na época seca: desempenho, consumo e digestibilidade dos nutrientes = Supplements for Nellore rearing in dry season: performance, intake and nutrient digestibility

Directory of Open Access Journals (Sweden)

Rodrigo Gonçalves Mateus

2011-01-01

Full Text Available Objetivou-se avaliar o efeito do suplemento com consumo de 0; 0,25; 0,50 e 0,75% do peso corporal (PC de novilhos Nelore sobre o consumo, desempenho e digestibilidade aparente dos nutrientes no período seco. Foram utilizados 116 animais da raça Nelore, nãocastrados, com média de nove meses de idade e peso corporal de 168 ± 35 kg, com duração de 114 dias iniciando em 04 de agosto e finalizando em 25 de novembro de 2007. O delineamento foi o inteiramente casualizado, com quatro tratamentos e 29 repetições para o desempenho e cinco repetições para as avaliações de consumo e digestibilidade, mantidos em pastagem de Brachiaria brizantha diferida. Foram realizadas pesagens no início e final do período experimental. O consumo de MS da forragem apresentou efeito quadrático, com ponto de mínima de 0,4% PC, consumos de PB, CT e NDT aumentaram linearmente, GMD, GPT e peso corporal final apresentaram efeito quadrático, com o ponto de máxima ao redor de 0,60% do PC. O coeficiente de digestibilidade aparente da MS, MO, PB, CT, CNF e o valor de NDT demonstraram efeito linear crescente. Recomenda-se o fornecimento de suplemento até 0,60% PC, em que se obteve o ponto de máximo desempenho, e a digestibilidade apresentou efeito linear e o aumento das percentagens do suplemento proporcionou aumentos no consumo de nutrientes. The objective was to evaluate the effect of supplementation with intake of 0, 0.25, 0.50 and 0.75% body weight (BW of Nellore young bulls on intake, performance and apparent digestibility of nutrients during the dry season. A total of 116 Nellore young bulls were used with an average of nine months of age and body weight of 168 ± 35 kg. The study lasted 114 days, beginning on August 4 and ending on November 25, 2007. The design was completely randomized with four treatments and 29 replications for performance and five replications to evaluate intake and digestibility, in deferred Brachiaria brizantha grazing. The animals

Microbiota composition, gene pool and its expression in Gir cattle (Bos indicus) rumen under different forage diets using metagenomic and metatranscriptomic approaches.

Science.gov (United States)

Pandit, Ramesh J; Hinsu, Ankit T; Patel, Shriram H; Jakhesara, Subhash J; Koringa, Prakash G; Bruno, Fosso; Psifidi, Androniki; Shah, S V; Joshi, Chaitanya G

2018-03-09

Zebu (Bos indicus) is a domestic cattle species originating from the Indian subcontinent and now widely domesticated on several continents. In this study, we were particularly interested in understanding the functionally active rumen microbiota of an important Zebu breed, the Gir, under different dietary regimes. Metagenomic and metatranscriptomic data were compared at various taxonomic levels to elucidate the differential microbial population and its functional dynamics in Gir cattle rumen under different roughage dietary regimes. Different proportions of roughage rather than the type of roughage (dry or green) modulated microbiome composition and the expression of its gene pool. Fibre degrading bacteria (i.e. Clostridium, Ruminococcus, Eubacterium, Butyrivibrio, Bacillus and Roseburia) were higher in the solid fraction of rumen (Pcomparison of metagenomic shotgun and metatranscriptomic sequencing appeared to be a much richer source of information compared to conventional metagenomic analysis. Copyright © 2018 Elsevier GmbH. All rights reserved.

Composição química e perfil de ácidos graxos do músculo Longissimus de bovinos de diferentes grupos genéticos terminados em confinamento = Physical-chemical composition and fatty acid profile in Longissimus muscle of young bulls from different genetic groups finished in feedlot

Directory of Open Access Journals (Sweden)

José Jorge dos Santos Abrahão

2008-10-01

Full Text Available Objetivou-se avaliar a composição química e o perfil de ácidos graxos do músculo Longissimus de bovinos inteiros de diferentes grupos genéticos terminados em confinamento. Foram utilizados 40 animais, com idade média de 22 meses, oriundos de quatro grupos genéticos: NGR (¼ Nelore vs. ¼ Guzerá vs. ½ Red Angus; NSM (¼ Nelore vs. ¼ Simental vs. ½ Marchigiana; NRL (¼ Nelore vs. ¼ Red Angus vs. ½ Limousin eNMM (¼ Nelore vs. ¾ Marchigiana. Após o abate e resfriamento da carcaça, foram retiradas amostras do músculo Longissimus entre a 12ª e 13ª costelas. Não houve efeito (p > 0,05 do grupo genético sobre as percentagens de umidade (74,0%, cinzas (1,0%, proteína bruta (19,0% e lipídeos totais (2,0% do músculo Longissimus. O grupo NMM apresentou menor (p 0,05 entre os grupos genéticos. A razão AGI/AGS (0,2 não diferiu. Os grupos genéticos NMM e NGR apresentaram, respectivamente, maior (8,5% e menor (5,6% percentagem de ácidos graxos n-6 e maior (5,5 e menor (4,0 razão n-6 n-3-1.This work was undertaken to study the physical-chemical composition and fatty acid profile in the Longissimus muscle of young bulls from different genetic groups finished in feedlot. Forty animals were used, with average age of 22 months, from four genetic groups: NGR (¼ Nelore vs. ¼ Guzerá vs. ½ Red Angus; NSM (¼ Nelore vs. ¼ Simental vs. ½ Marchigiana; NRL (¼ Nelore vs. ¼ Red Angus vs. ½ Limousin and NMM (¼ Nelore vs. ¾ Marchigiana. After slaughter and carcass chilling, Longissimus muscle samples were collected between the 12th and 13th ribs. There was no genetic group effect (p > 0.05 on muscle moisture (74.0%, ash (1.0%, crude protein (19.0% and total lipids (2.0%. The NMM group presented the lowest (p 0.05 among the genetic groups. The AGS/AGI ratio (0.2 was similar. The NMM and NGR groups presented, respectively, the highest (8.5% and the lowest (5.6% ratios of n-6 fatty acids and the highest (5.5 and thelowest (4.0 n-6 n-3

Magnetic Resonance Imaging of the Normal Stifle Joint in Buffaloes (Bos Bubalis: An Anatomic Study

Directory of Open Access Journals (Sweden)

Moustafa Samy Sherif

2014-12-01

Full Text Available The aim of the present study was to describe the normal anatomy of the stifle joint in buffaloes (Bos bubalis on magnetic resonance images and related anatomical sectional slices to facilitate the interpretation of all these images, as well as to understand the basis for diseases diagnosis. The hind limbs of ten healthy adult buffaloes (Twenty stifle joints were used. After slaughtering, MR images were made in sagittal, transverse, and dorsal planes. The limbs then were frozen at -20° then correspondingly sectioned using an electric band saw. Clinically relevant anatomic structures were identified and labeled at each level in the corresponding images (MR and anatomic slices. MRI images were used to identify the bony and soft tissue structures of the stifle joint. The articular cartilage appeared with hyperintense signal and separated from the subcondral bone by gray line (moderate signal intensity. It is difficult to differentiate between the synovia, infrapatellar fat body and the articular cartilage because they appeared with hyperintense signal. The meniscial, femoropatellar and cruciate ligaments recognized as moderate signal intensity. However, the collateral and intermediate patellar ligaments, the common tendon of the Mm. extensor digitorum longus and peroneus tertius as well as the menisci and the medial patellar fibrocartilage appeared with hypointense signal. The knowledge of normal anatomy of the buffalo stifle joint would serve as initial reference to the evaluation of MR images in this species.

The mtDNA haplogroup P of modern Asian cattle: A genetic legacy of Asian aurochs?

Science.gov (United States)

Noda, Aoi; Yonesaka, Riku; Sasazaki, Shinji

2018-01-01

Background Aurochs (Bos primigenius) were distributed throughout large parts of Eurasia and Northern Africa during the late Pleistocene and the early Holocene, and all modern cattle are derived from the aurochs. Although the mtDNA haplogroups of most modern cattle belong to haplogroups T and I, several additional haplogroups (P, Q, R, C and E) have been identified in modern cattle and aurochs. Haplogroup P was the most common haplogroup in European aurochs, but so far, it has been identified in only three of >3,000 submitted haplotypes of modern Asian cattle. Methodology We sequenced the complete mtDNA D-loop region of 181 Japanese Shorthorn cattle and analyzed these together with representative bovine mtDNA sequences. The haplotype P of Japanese Shorthorn cattle was analyzed along with that of 36 previously published European aurochs and three modern Asian cattle sequences using the hypervariable 410 bp of the D-loop region. Conclusions We detected the mtDNA haplogroup P in Japanese Shorthorn cattle with an extremely high frequency (83/181). Phylogenetic networks revealed two main clusters, designated as Pa for haplogroup P in European aurochs and Pc in modern Asian cattle. We also report the genetic diversity of haplogroup P compared with the sequences of extinct aurochs. No shared haplotypes are observed between the European aurochs and the modern Asian cattle. This finding suggests the possibility of local and secondary introgression events of haplogroup P in northeast Asian cattle, and will contribute to a better understanding of its origin and genetic diversity. PMID:29304129

The mtDNA haplogroup P of modern Asian cattle: A genetic legacy of Asian aurochs?

Science.gov (United States)

Noda, Aoi; Yonesaka, Riku; Sasazaki, Shinji; Mannen, Hideyuki

2018-01-01

Aurochs (Bos primigenius) were distributed throughout large parts of Eurasia and Northern Africa during the late Pleistocene and the early Holocene, and all modern cattle are derived from the aurochs. Although the mtDNA haplogroups of most modern cattle belong to haplogroups T and I, several additional haplogroups (P, Q, R, C and E) have been identified in modern cattle and aurochs. Haplogroup P was the most common haplogroup in European aurochs, but so far, it has been identified in only three of >3,000 submitted haplotypes of modern Asian cattle. We sequenced the complete mtDNA D-loop region of 181 Japanese Shorthorn cattle and analyzed these together with representative bovine mtDNA sequences. The haplotype P of Japanese Shorthorn cattle was analyzed along with that of 36 previously published European aurochs and three modern Asian cattle sequences using the hypervariable 410 bp of the D-loop region. We detected the mtDNA haplogroup P in Japanese Shorthorn cattle with an extremely high frequency (83/181). Phylogenetic networks revealed two main clusters, designated as Pa for haplogroup P in European aurochs and Pc in modern Asian cattle. We also report the genetic diversity of haplogroup P compared with the sequences of extinct aurochs. No shared haplotypes are observed between the European aurochs and the modern Asian cattle. This finding suggests the possibility of local and secondary introgression events of haplogroup P in northeast Asian cattle, and will contribute to a better understanding of its origin and genetic diversity.

Distribution and extinction of ungulates during the Holocene of the southern Levant.

Directory of Open Access Journals (Sweden)

Ella Tsahar

Full Text Available BACKGROUND: The southern Levant (Israel, Palestinian Authority and Jordan has been continuously and extensively populated by succeeding phases of human cultures for the past 15,000 years. The long human impact on the ancient landscape has had great ecological consequences, and has caused continuous and accelerating damage to the natural environment. The rich zooarchaeological data gathered at the area provide a unique opportunity to reconstruct spatial and temporal changes in wild species distribution, and correlate them with human demographic changes. METHODOLOGY: Zoo-archaeological data (382 animal bone assemblages from 190 archaeological sites from various time periods, habitats and landscapes were compared. The bone assemblages were sorted into 12 major cultural periods. Distribution maps showing the presence of each ungulate species were established for each period. CONCLUSIONS: The first major ungulate extinction occurred during the local Iron Age (1,200-586 BCE, a period characterized by significant human population growth. During that time the last of the largest wild ungulates, the hartebeest (Alcelaphus buselaphus, aurochs (Bos primigenius and the hippopotamus (Hippopotamus amphibius became extinct, followed by a shrinking distribution of forest-dwelling cervids. A second major wave of extinction occurred only in the 19th and 20th centuries CE. Furthermore, a negative relationship was found between the average body mass of ungulate species that became extinct during the Holocene and their extinction date. It is thus very likely that the intensified human activity through habitat destruction and uncontrolled hunting were responsible for the two major waves of ungulate extinction in the southern Levant during the late Holocene.

Distribution and extinction of ungulates during the Holocene of the southern Levant.

Science.gov (United States)

Tsahar, Ella; Izhaki, Ido; Lev-Yadun, Simcha; Bar-Oz, Guy

2009-01-01

The southern Levant (Israel, Palestinian Authority and Jordan) has been continuously and extensively populated by succeeding phases of human cultures for the past 15,000 years. The long human impact on the ancient landscape has had great ecological consequences, and has caused continuous and accelerating damage to the natural environment. The rich zooarchaeological data gathered at the area provide a unique opportunity to reconstruct spatial and temporal changes in wild species distribution, and correlate them with human demographic changes. Zoo-archaeological data (382 animal bone assemblages from 190 archaeological sites) from various time periods, habitats and landscapes were compared. The bone assemblages were sorted into 12 major cultural periods. Distribution maps showing the presence of each ungulate species were established for each period. The first major ungulate extinction occurred during the local Iron Age (1,200-586 BCE), a period characterized by significant human population growth. During that time the last of the largest wild ungulates, the hartebeest (Alcelaphus buselaphus), aurochs (Bos primigenius) and the hippopotamus (Hippopotamus amphibius) became extinct, followed by a shrinking distribution of forest-dwelling cervids. A second major wave of extinction occurred only in the 19th and 20th centuries CE. Furthermore, a negative relationship was found between the average body mass of ungulate species that became extinct during the Holocene and their extinction date. It is thus very likely that the intensified human activity through habitat destruction and uncontrolled hunting were responsible for the two major waves of ungulate extinction in the southern Levant during the late Holocene.

Obtenção de oócitos e produção in vitro de embriões em doadoras lactantes da raça Gir (Bos taurus indicus)

OpenAIRE

Ferreira, Marcos Brandão Dias [UNESP

2011-01-01

Raças zebuínas (Bos taurus indicus) e seus cruzamentos têm papel fundamental na pecuária brasileira, e a raça Gir, em especial, acrescenta rusticidade e produtividade nas suas descendentes leiteiras. A produção in vitro de embriões bovinos é uma biotécnica de alto valor econômico, que, aliada à utilização de sêmen sexado para cromossoma X, possibilita a multiplicação com fêmeas de valor genético superior. Foram realizados dois experimentos com o objetivo de avaliar a produção in vitro (PIV) d...

Effect of sequence of insemination after simultaneous thawing of multiple semen straws on conception rate to timed AI in suckled multiparous Nelore cows.

Science.gov (United States)

Oliveira, L Z; Arruda, R P; de Andrade, A F C; Santos, R M; Beletti, M E; Peres, R F G; Martins, J P N; de Lima, V F M Hossepian

2012-11-01

The objective was to determine the effect of sequence of insemination after simultaneous thawing of multiple 0.5 mL semen straws on conception rate in suckled multiparous Nelore cows. The effect of this thawing procedure on in vitro sperm characteristics was also evaluated. All cows (N = 944) received the same timed AI protocol. Ten straws (0.5 mL) of frozen semen from the same batch were simultaneously thawed at 36 °C, for a minimum of 30 sec. One straw per cow was used for timed AI. Frozen semen from three Angus bulls was used. Timed AI records included sequence of insemination (first to tenth) and time of semen removal from thawing bath. For laboratory analyses, the same semen batches used in the field experiment were evaluated. Ten frozen straws from the same batch were thawed simultaneously in a thawing unit identical to that used in the field experiment. The following sperm characteristics were analyzed: sperm motility parameters, sperm thermal resistance, plasma and acrosomal membrane integrity, lipid peroxidation, chromatin structure, and sperm morphometry. Based on logistic regression, there were no significant effects of breeding group, body condition score, AI technician, and sire on conception rate, but there was an interaction between sire and straw group (P = 0.002). Semen from only one bull had decreased (P conception rates at timed AI, depending on the sire used. Nevertheless, the effects of this thawing environment on in vitro sperm characteristics, remain to be further investigated. Copyright © 2012 Elsevier Inc. All rights reserved.

Grupo genético, sistema de acasalamento e efeitos genéticos aditivos e não-aditivos nas características de musculosidade da carcaça de novilhos oriundos do cruzamento rotativo Charolês × Nelore Genetic group, breeding system and additive and non-additive genetic effects on characteristics that express muscularity of steer carcasses derived from Charolais × Nellore rotative crossbreeding

Directory of Open Access Journals (Sweden)

Paulo Santana Pacheco

2010-03-01

Full Text Available Foram avaliadas as carcaças de 800 novilhos oriundos do cruzamento rotativo entre as raças Charolesa e Nelore abatidos aos 2 anos de idade. As características avaliadas foram: conformação, espessura de coxão, perímetro de braço, área de olho-de-lombo e área de olho-de-lombo dividida por 100 kg de peso da carcaça fria (AOL100. Na análise dos dados, consideraram-se dois modelos: o Modelo 1 incluiu os efeitos genéticos de sistema de acasalamento e grupo genético do novilho aninhado em sistema de acasalamento e o Modelo 2 correspondeu ao Modelo 1, porém o sistema de acasalamento e o grupo genético foram substituídos pelas covariáveis representativas da porcentagem da raça Charolesa no indivíduo e na sua mãe e da porcentagem de heterozigose no indivíduo e na sua mãe. Pela análise do Modelo 1, novilhos charoleses foram superiores aos nelores em todas as características avaliadas. A heterose retida foi significativa para conformação (4,2%, espessura de coxão (3,2%, perímetro de braço (4,2%, área de olho-de-lombo (7,3% e AOL100 (-6,7%. O efeito genético aditivo individual da raça Charolesa em relação à Nelore foi de 1,89 pontos para conformação, 1,37 cm para espessura de cochão, 2,55 cm para perímetro de braço, 12,70 cm² para área de olho-de-lombo e 3,13 cm² para AOL100. O efeito genético heterótico individual (em relação à média dos definidos foi de 3,9% para conformação, 3,8% para espessura de cochão, 3,1% para perímetro de braço e 9,8% para área de olho-de-lombo. A heterose materna é significativa apenas para perímetro de braço (1,6% e AOL100 (-5,4%. Os efeitos genéticos não-aditivos, representados por epistasia e ligação gênica, não influenciam as características avaliadas.The carcasses of 800 steers derived from rotational crossbreeding between Charolais and Nellore breeds, slaughtered at two years of age, were evaluated. The evaluated characteristics were the following: conformation

Bronchiolitis obliterans syndrome after single-lung transplantation: impact of time to onset on functional pattern and survival.

Science.gov (United States)

Brugière, Olivier; Pessione, Fabienne; Thabut, Gabriel; Mal, Hervé; Jebrak, Gilles; Lesèche, Guy; Fournier, Michel

2002-06-01

Among risk factors for the progression of bronchiolitis obliterans syndrome (BOS) after lung transplantation (LT), the influence of time to BOS onset is not known. The aim of the study was to assess if BOS occurring earlier after LT is associated with worse functional prognosis and worse graft survival. We retrospectively compared functional outcome and survival of all single-LT (SLT) recipients who had BOS develop during follow-up in our center according to time to onset of BOS ( or = 3 years after transplantation). Among the 29 SLT recipients with BOS identified during the study period, 20 patients had early-onset BOS and 9 patients had late-onset BOS. The mean decline of FEV(1) over time during the first 9 months in patients with early-onset BOS was significantly greater than in patients with of late-onset BOS (p = 0.04). At last follow-up, patients with early-onset BOS had a lower mean FEV(1) value (25% vs 39% of predicted, p = 0.004), a lower mean PaO(2) value (54 mm Hg vs 73 mm Hg, p = 0.0005), a lower 6-min walk test distance (241 m vs 414 m, p = 0.001), a higher Medical Research Council index value (3.6 vs 1.6, p = 0.0001), and a higher percentage of oxygen dependency (90% vs 11%, p = 0.001) compared with patients with late-onset BOS. In addition, graft survival of patients with early-onset BOS was significantly lower than that of patients with late-onset BOS (log-rank test, p = 0.04). There were 18 of 20 graft failures (90%) in the early-onset BOS group, directly attributable to BOS in all cases (deaths [n = 10] or retransplantation [n = 8]). In the late-onset BOS group, graft failure occurred in four of nine patients due to death from extrapulmonary causes in three of four cases. The median duration of follow-up after occurrence of BOS was not statistically different between patients with early-onset BOS and patients with late-onset BOS (31 +/- 28 months and 37 +/- 26 months, respectively; p = not significant). The subgroup of patients who had BOS develop

Recria de machos Nelore em pastagens cultivadas com suplementação na seca nos Cerrados do Brasil Central Rearing of Nelore calves weaned on cultivated pasture and supplemented during the dry season on the Cerrado Region of Central Brazil

Directory of Open Access Journals (Sweden)

Antonio Vieira

2005-08-01

Full Text Available Foi avaliado, durante três anos, o desempenho de 103 bezerros Nelore criados a pasto, recriados com suplementação na primeira seca pós-desmama, com o objetivo de se obterem animais com desenvolvimento suficiente para serem confinados aos 20/21 meses de idade. Os animais apresentaram, início da suplementação, 189,51 ± 21,08 kg de peso vivo e 254 ± 29,22 dias de idade e, ao final, de 242,38 ± 29,22 kg e 400 ± 31,08 dias de idade e consumo médio diário de ração de 1,52 kg. Durante a suplementação, o ganho de peso médio diário foi de 0,377 kg e, nas águas, de 0,534 kg. A correlação do peso vivo do início ao final da suplementação foi de 0,78 e, ao final do período das águas, de 0,65. As maiores correlações entre pesos vivos foram: peso no final da seca e nas águas (0,86, peso e ganho de peso no final da águas (0,62, peso no final e ganho de peso das águas e ganho total (0,75 e 0,71, respectivamente, ganho na seca e ganho total (0,80. Após a desmama, os animais foram estratificados em três classes: inferior (140 ± 11,37 kg, média (187 ± 11,09 kg e superior (219 ± 8,51 kg. Os pesos no final do período das águas foram de 271 ± 9,56 kg, 362 ± 22,75 kg e 425 ± 15,32 kg, respectivamente. Pelo menos 54% dos animais permaneceram como inferiores, 60% como médios e 54% como superiores no final do período das águas. Somente 4% dos animais inferiores atingiram a classe superior no final do período avaliado. Aos 20/21 meses de idade, os novilhos apresentaram, em média, de 366 ± 39,04 kg e condições para terminação em confinamento. Entretanto, existem bezerros com peso inferior a 150 kg aos seis/sete meses de idade à desmama, mesmo criados em boas condições de manejo, com baixo potencial de ganho de peso e menores condições de serem terminados precocemente quando suplementados previamente.Body weight gain of 103 Nelore calves until 20/21 months old when weaned on cultivated pasture and supplemented during

CATTLE PRODUCTIVE PERFORMANCE EVALUATION CONFINED SUBMITTED IMMUNOCASTRATION

Directory of Open Access Journals (Sweden)

J. M. Maluf

2016-09-01

Full Text Available In order to evaluate the performance and carcass characteristics of cattle cross breeds ½ Aberdeen Angus x ½Nelore and Nelore confined submitted to immunocastration 218 male animals were used, feedlot, averaging 342 kg, divided into three experimental groups, T1: 117 steers ½ Angus x ½ Nelore no castrated (ANC, T2: 51 Nelore steers uncastrated (NNC and T3: 50 Nellore steers immunocastrated (NIC. The experiment lasted 144 days of confinement. The selection of animals for group formation was according to the individual weight, breed, sex condition and age. For immunocastration it wasused Bopriva® vaccine. The rating was finished according to the parameter used by the meatpacking industry ranging from 1 to 5. The experimental design was completely randomized in three groups. For the analyzes the variables studied statistics were submitted to analysis of variance (ANOVA and Tukey test both at the 5% level of significance. The results showed differences (p <0.01 at various features of productive performance and carcass between treatments. For slaughter weight, the ANC animals were higher (with 582.1 kg to Nelore, regardless of sexual condition, and the NNC were in turn heavier than the NIC, 527.4 and 503.7 respectively. Finally, it observed that the use of immunocastration in Nellore animals provided a decrease in productive performance of confined animals, but provided better finish carcass similar to crossbred (ANC.

Composição química e perfil de ácidos graxos do músculo Longissimus de bovinos de diferentes grupos genéticos terminados em confinamento - DOI: 10.4025/actascianimsci.v30i4.465 Physical-chemical composition and fatty acids profile in Longissimus muscle of young bulls from different genetic groups finished in feedlot - DOI: 10.4025/actascianimsci.v30i4.465

Directory of Open Access Journals (Sweden)

Jesuí Virgílio Visantainer

2009-03-01

Full Text Available Objetivou-se avaliar a composição química e o perfil de ácidos graxos do músculo Longissimus de bovinos inteiros de diferentes grupos genéticos terminados em confinamento. Foram utilizados 40 animais, com idade média de 22 meses, oriundos de quatro grupos genéticos: NGR (¼ Nelore vs. ¼ Guzerá vs. ½ Red Angus; NSM (¼ Nelore VS. ¼ Simental vs. ½ Marchigiana; NRL (¼ Nelore VS. ¼ Red Angus vs. ½ Limousin e NMM (¼ Nelore VS. ¾ Marchigiana. Após o abate e resfriamento da carcaça, foram retiradas amostras do músculo Longissimus entre a 12ª e 13ª costelas. Não houve efeito (p > 0,05 do grupo genético sobre as percentagens de umidade (74,0%, cinzas (1,0%, proteína bruta (19,0% e lipídeos totais (2,0% do músculo Longissimus. O grupo NMM apresentou menor (p 0,05 entre os grupos genéticos. A razão AGI/AGS (0,2 não diferiu. Os grupos genéticos NMM e NGR apresentaram, respectivamente, maior (8,5% e menor (5,6% percentagem de ácidos graxos n-6 e maior (5,5 e menor (4,0 razão n-6 n-3-1.This work was undertaken to study physical-chemical composition and fatty acids profile in Longissimus muscle of young bulls from different genetic groups finished in feedlot. Fourty animals were used, with average age of 22 months, from four genetic groups: NGR (¼ Nelore vs. ¼ Guzerá vs. ½ Red Angus; NSM (¼ Nelore vs. ¼ Simental vs. ½ Marchigiana; NRL (¼ Nelore vs. ¼ Red Angus vs. ½ Limousin and NMM (¼ Nelore vs. ¾ Marchigiana. After slaughter and chilled of carcass, Longissimus muscle samples between 12th and 13th rib were collected. The fatty acid composition was evaluated using the gas chromatograph. There was no genetic group effect (P>0.05 on muscle moisture (74.0%, ash (1.0%, crude protein (19.0% and total lipids (2.0%. The group NMM presented the lowest (P0.05 between the genetic groups. The AGS/AGI reason (0.2 was similar. The NMM and NGR groups presented, respectively, the highest (8.5% and the lowest (5.6% proportion of n

Características andrológicas e do sêmen de touros do composto Red Norte (Nelore x Tabapuã x Red Angus x Sinepol Andrological and semen characteristics of cross-bred Red Norte (Nelore x Tabapuã x Red Angus x Sinepol young bulls

Directory of Open Access Journals (Sweden)

R.O.D.S. Rossi

2009-12-01

Full Text Available Avaliaram-se as características andrológicas do sêmen de touros jovens do composto Red Norte (Nelore x Tabapuã x Red Angus x Sinepol, com idade média de 13,9±0,8 meses, com o objetivo de estimar o advento da puberdade e a qualidade do sêmen. Foram avaliados o perímetro escrotal (PE, o peso e as características seminais de 70 tourinhos, classificados em três grupos, de acordo com o PE: GI=27-33cm (n=24, GII=33-35cm (n=24 e GIII=35-43cm (n=22. As médias de peso e a idade de cada grupo (G foram, respectivamente: GI=411,2±37,4kg e 13,8±1,0 meses, GII=426,9±31,5kg e 14,0±0,7 meses e GIII=438,4±38,3kg e 14,0±0,6 meses. As características seminais para cada grupo foram, volume 4,2±3,1mL, 5,3±2,6mL e 4,5±2,1mL; motilidade 31,3±24,1%, 44,2±23,9% e 43,9±21,5% e vigor 2,8±1,6, 3,5±1,3 e 3,5±1,3, respectivamente. O espermiograma apresentou valores médios de concentração de 130,5±266,2x10(6/mL, 289,5±390,2x10(6/mL e 333,9±523,7x10(6/mL, defeitos totais de 81,4±15,9%, 73,8±15,4% e 67,9±19,0%; defeitos maiores de 87,3±26,2%, 66,8±24,9% e 56,7±17,1% e defeitos menores de 16,6±14,9%, 33,2±24,9% e 43,3±17,1%, respectivamente. Dos setenta animais examinados, sete (10% foram considerados aptos à reprodução. Os resultados mostraram que a patologia espermática diminuiu em razão do aumento do PE.Reproductive traits of cross-breed Red Norte (Nelore x Tabapuã x Red Angus x Sinepol young bulls averaging of 13.9±0.8 month-old were evaluated, in order to determine the puberty onset and semen quality in these animals. Scrotal circumference (SC, body weight (BW, and semen parameters of 70 bulls were measured. Animals were allotted in three groups (G according to their SC: GI=27-33cm (n=24, GII=33-35cm (n=24, and GIII=35-43cm (n=22. BW and age of each group were, respectively: GI=411.2±37.4kg and 13.8±1.0 month-old, GII=426.9±31.5kg and 14.0±0.7 month-old, and GIII=438.4±38.3kg and 14.0±0.6 month-old. Seminal physical

Recombinant lactoferrin (Lf) of Vechur cow, the critical breed of Bos indicus and the Lf gene variants.

Science.gov (United States)

Anisha, Shashidharan; Bhasker, Salini; Mohankumar, Chinnamma

2012-03-01

Vechur cow, categorized as a critically maintained breed by the FAO, is a unique breed of Bos indicus due to its extremely small size, less fodder intake, adaptability, easy domestication and traditional medicinal property of the milk. Lactoferrin (Lf) is an iron-binding glycoprotein that is found predominantly in the milk of mammals. The full coding region of Lf gene of Vechur cow was cloned, sequenced and expressed in a prokaryotic system. Antibacterial activity of the recombinant Lf showed suppression of bacterial growth. To the best of our knowledge this is the first time that the full coding region of Lf gene of B. indicus Vechur breed is sequenced, successfully expressed in a prokaryotic system and characterized. Comparative analysis of Lf gene sequence of five Vechur cows with B. taurus revealed 15 SNPs in the exon region associated with 11 amino acid substitutions. The amino acid arginine was noticed as a pronounced substitution and the tertiary structure analysis of the BLfV protein confirmed the positions of arginine in the β sheet region, random coil and helix region 1. Based on the recent reports on the nutritional therapies of arginine supplementation for wound healing and for cardiovascular diseases, the higher level of arginine in the lactoferrin protein of Vechur cow milk provides enormous scope for further therapeutic studies. Copyright © 2011 Elsevier B.V. All rights reserved.

Seroprevalence and Risk Factors of Fascioliasis in Yaks, Bos grunniens, from Three Counties of Gansu Province, China.

Science.gov (United States)

Zhang, Xiao-Xuan; Feng, Sheng-Yong; Ma, Jian-Gang; Zheng, Wen-Bin; Yin, Ming-Yang; Qin, Si-Yuan; Zhou, Dong-Hui; Zhao, Quan; Zhu, Xing-Quan

2017-02-01

The aim of this study was to determine the seroprevalence and risk factors of fascioliasis in yaks, Bos grunniens , from 3 counties of Gansu Province in China. A total of 1,584 serum samples, including 974 samples from white yaks from Tianzhu, 464 from black yaks from Maqu, and 146 from black yaks from Luqu County, were collected and analyzed using ELISA to detect IgG antibodies against Fasciola hepatica . The overall F. hepatica seroprevalence was 28.7% (454/1,584), with 29.2% in white yaks (284/974) and 27.9% in black yaks (170/610). The seroprevalence of F. hepatica in yaks from Tianzhu, Luqu, and Maqu was 29.2%, 22.6%, and 29.5%, respectively. Female yaks (30.9%) had higher F. hepatica seroprevalence than male yaks (23.4%). Also, F. hepatica seroprevalence varied by different age group from 24.1% to 33.8%. Further, the seroprevalence ranged from 21.8% to 39.1% over different seasons. Interestingly, the season and age of yaks were associated with F. hepatica infection in yaks in the investigated areas. These findings provided a basis for further studies on this disease in yaks from 3 counties of Gansu Province in northwestern China, which may ultimately support the development of effective control strategies of fascioliasis in these areas.

Machine Learning Algorithms Utilizing Quantitative CT Features May Predict Eventual Onset of Bronchiolitis Obliterans Syndrome After Lung Transplantation.

Science.gov (United States)

Barbosa, Eduardo J Mortani; Lanclus, Maarten; Vos, Wim; Van Holsbeke, Cedric; De Backer, William; De Backer, Jan; Lee, James

2018-02-19

Long-term survival after lung transplantation (LTx) is limited by bronchiolitis obliterans syndrome (BOS), defined as a sustained decline in forced expiratory volume in the first second (FEV 1 ) not explained by other causes. We assessed whether machine learning (ML) utilizing quantitative computed tomography (qCT) metrics can predict eventual development of BOS. Paired inspiratory-expiratory CT scans of 71 patients who underwent LTx were analyzed retrospectively (BOS [n = 41] versus non-BOS [n = 30]), using at least two different time points. The BOS cohort experienced a reduction in FEV 1 of >10% compared to baseline FEV 1 post LTx. Multifactor analysis correlated declining FEV 1 with qCT features linked to acute inflammation or BOS onset. Student t test and ML were applied on baseline qCT features to identify lung transplant patients at baseline that eventually developed BOS. The FEV 1 decline in the BOS cohort correlated with an increase in the lung volume (P = .027) and in the central airway volume at functional residual capacity (P = .018), not observed in non-BOS patients, whereas the non-BOS cohort experienced a decrease in the central airway volume at total lung capacity with declining FEV 1 (P = .039). Twenty-three baseline qCT parameters could significantly distinguish between non-BOS patients and eventual BOS developers (P machine), we could identify BOS developers at baseline with an accuracy of 85%, using only three qCT parameters. ML utilizing qCT could discern distinct mechanisms driving FEV 1 decline in BOS and non-BOS LTx patients and predict eventual onset of BOS. This approach may become useful to optimize management of LTx patients. Copyright © 2018 The Association of University Radiologists. Published by Elsevier Inc. All rights reserved.

Withers height of pig - Sus scrofa domestica L. 1758, domestic cow - Bos taurus L. 1758 and sheep - Ovis aries L. 1758 at the “Gornja šuma” archaeological site (Novi Sad

Directory of Open Access Journals (Sweden)

Radmanović Darko P

2016-01-01

Full Text Available In spring 2012, osteological material was collected at the “Gornja Šuma” site (site no. 47, located in the territory of Novi Sad, and it was dated to the early 9th century. The withers heights of pig - Sus scrofa domestica, domestic cow - Bos taurus and sheep - Ovis aries, as the three most dominant species at this archaeological site, were analysed based on the length of bones and according to various authors [Boessneck 1956; Zalkin 1960; Matolcsi 1970; Teichert 1975]. It was determined that in these three species the withers heights mostly corresponded to the data from the Middle Ages.

Mammoths inside the Alps during the last glacial period: Radiocarbon constraints from Austria and palaeoenvironmental implications

Science.gov (United States)

Spötl, Christoph; Reimer, Paula J.; Göhlich, Ursula B.

2018-06-01

This study examines remains of the woolly mammoth (Mammuthus primigenius) found inside the Austrian Alps, an area occupied by an extensive ice-stream network during the Last Glacial Maximum. The data demonstrate that these cold steppe-adapted animals locally migrated several tens of kilometers into alpine valleys. Radiocarbon analyses constrain the age of these fossils to the first half of Marine Isotope Stage 3, documenting ice-free conditions in major valleys at that time. We also provide a list of all traceable Austrian sites of Mammuthus primigenius, totaling about 230 localities, compiled through 15 museums and collections in Austria. The vast majority of these findings are from the corridors of the Danube and Mur rivers and their tributaries and the adjacent loess-covered foreland of the Alps, areas that were never ice-covered during Pleistocene glaciations.

Isolation, identification and retrospective study of foot-and-mouth disease virus from affected Mithun (Bos frontalis) in north-eastern India.

Science.gov (United States)

Borah, B; Deka, P; Sharma, K; Baro, S; Hazarika, A K; Das, C; Garam, G B; Boro, P; Ltu, K

2018-02-01

Foot-and-mouth disease (FMD) is a contagious disease of cloven-hoofed animals that causes substantial and perpetual economic loss. Apart from the contagious nature of the disease, the FMD virus can establish in a "carrier state" among all cloven-hoofed animals. The Mithun (Bos frontalis), popularly called the "Cattle of Mountain," is found in the geographically isolated, hilly region of north-east India: Arunachal Pradesh, Nagaland, Manipur and Mizoram. Despite the geographical inaccessibility, infection by FMD virus has emerged as the single most devastating disease among Mithun after the eradication of rinderpest from this region. Samples from outbreaks of FMD in Mithun were analysed by sandwich ELISA, multiplex RT-PCR (MRT-PCR) and liquid-phase blocking enzyme-linked immunosorbent assay and isolated in the BHK-21 cell line. The results indicate the presence of FMDV serotype "O." The sequencing and molecular phylogenies have revealed close relationships in the lineage of type "O" isolates from Bangladesh. The findings will provide useful information for further research and development of a sustainable programme for the progressive control of FMD in the Mithun population. © 2017 Blackwell Verlag GmbH.

Influência de Alguns Fatores de Ambiente sobre os Escores de Conformação, Precocidade e Musculatura à Desmama em um Rebanho da Raça Nelore

Directory of Open Access Journals (Sweden)

Jorge Júnior João

2001-01-01

Full Text Available Dados de 23.251 animais da raça Nelore desmamados no período de 1994 a 1997, pertencentes à Agropecuária Jacarezinho Ltda., foram analisados para se avaliar os efeitos ambientais da idade da vaca, data de nascimento e idade à desmama sobre os escores visuais de conformação (C, precocidade (P e musculatura (M. Todos os efeitos estudados influenciaram significativamente os escores visuais. As análises indicaram que as vacas que pariram aos sete, oito e nove anos, obtiveram os melhores resultados para os escores visuais de C, P e M, assim como os animais que nasceram mais cedo dentro da estação de parição. Para a idade à desmama foi constatado que, quanto mais tarde o animal for desmamado, melhores serão seus escores. Os animais que desmamaram com 220 dias tiveram os melhores escores, enquanto os piores escores foram daqueles que desmamaram com 140 dias. Portanto, para se ter maior precisão na avaliação genética dos indivíduos jovens, fatores de correção para idade da vaca, data juliana de nascimento e idade à desmama devem ser utilizados sobre os escores de conformação, precocidade e musculatura.

Resposta imune-humoral e celular em bovinos da raça Nelore imunizados com extrato de larvas (L2 e L3 de Dermatobia hominis (Linnaeus Jr., 1781 Immune humoral and cellular response of nelore bovines immunized with larvae extract (L2 and L3 of Dermatobia hominis (Linnaeus Jr., 1781

Directory of Open Access Journals (Sweden)

Nelson Luis Mello Fernandes

2007-06-01

Full Text Available As larvas da Dermatobia hominis provocam lesões ulcerativas, danificando o tecido subcutâneo e conseqüentemente a pele do hospedeiro. O couro é o subproduto que sofre maior depreciação, o que, muitas vezes, impossibilita seu aproveitamento na industrialização. Atualmente o controle químico é utilizado como forma de combate à dermatobiose, entretanto, leva ao acúmulo de substâncias tóxicas nos animais e no ambiente. No presente trabalho, foram avaliadas as respostas imune-humoral e celular de bovinos imunizados com extrato antigênico preparado com larvas de D. hominis. Três grupos de oito bezerras da raça Nelore com 10 meses de idade foram usados, tendo o primeiro grupo (A recebido aplicação de extrato imunogênico de larvas de D. hominis, com intervalos de quinze dias; o grupo (B, utilizado como controle, não recebendo nenhum tipo de tratamento; e o grupo (C recebendo o tratamento ectoparasiticida à base de Dichlorvos associado a Cypermetrina. Neste mesmo período, foram avaliados o leucograma e os níveis de IgG contra D. hominis pela técnica de enzimoimunoensaio-ELISA. Quanto à avaliação da imunidade humoral, verificou-se que os animais do grupo A apresentaram maior produção de IgG contra D. hominis, com níveis máximos de anticorpos circulantes aos 45 dias após a primeira imunização. Estes animais também apresentaram maior produção de neutrófilos, eosinófilos e monócitos que os dos grupos B e C. O número de nódulos de larvas encontrado nos animais do grupo C foi 148,3% maior que nos animais dos grupos A e B. A comprovação da resposta imune celular e humoral, parcialmente caracterizadas, bem como a redução do número de nódulos, são indicadores que a imunização contra D. hominis foi parcialmente protetora para os bovinos imunizados.Dermatobia hominis larvae cause ulcerative lesions and damage to subcutaneous tissue and skin of the host. Leather is the subproduct which undergoes major depreciation

Estimativas de herdabilidades e correlações genéticas entre características reprodutivas em touros da raça Nelore

Directory of Open Access Journals (Sweden)

T.S. Silveira

2012-12-01

Full Text Available Foram obtidas estimativas de variância fenotípica, genética e residual, herdabilidades e correlações genéticas para as características reprodutivas em 5.903 animais da raça Nelore. O modelo experimental utilizado foi o método de máxima verossimilhança restrita livre de derivadas. Os valores de herdabilidade foram de 0,24±0,05 para perímetro escrotal aos 450 dias de idade e de 0,37±0,05 aos 21 meses de idade, na ocasião do exame andrológico; de 0,24±0,05 e 0,26±0,05 para comprimento dos testículos esquerdo e direito; de 0,29±0,05 e 0,31±0,05 para largura dos testículos esquerdo e direito; de 0,12±0,04 para formato testicular; de 0,33±0,06 para volume testicular; de 0,11±0,03 para turbilhonamento; de 0,08±0,03 para motilidade e de 0,05±0,02 para vigor espermático; de 0,20±0,04, 0,03±0,02 e 0,19±0,04 para defeitos espermáticos maiores, menores e totais, respectivamente. As características biométricas testiculares apresentaram valores de herdabilidade moderados a altos, enquanto as características seminais valores baixos. Correlações genéticas entre perímetro escrotal com todas as características reprodutivas foram favoráveis, o que sugere o perímetro escrotal como característica de escolha na seleção de touros.

Estimativas de Herdabilidade e Correlação Genética para Características de Crescimento na Fase de Pré-desmama e Medidas de Perímetro Escrotal ao Sobreano em Bovinos Angus-Nelore Heritability Estimates and Genetic Correlation of Growth Characteristics in the Preweaning Period and Scrotal Circumference Measurement at Yearling for Angus-Nelore Beef Cattle

Directory of Open Access Journals (Sweden)

Dionéia Magda Everling

2001-12-01

Full Text Available Os dados utilizados neste estudo são originários de 53.938 bovinos puros e cruzados (Angus x Nelore, coletados em várias regiões do Brasil e da Argentina nascidos entre 1987 e 1998. O objetivo do trabalho foi verificar as herdabilidades e as correlações existentes entre as características de crescimento e as medidas de perímetro escrotal (PE. As variáveis estudadas foram ganho médio diário do nascimento à desmama (GMDND, dias para ganhar 160 kg do nascimento à desmama (D160, peso à desmama (PD e perímetro escrotal ao sobreano (PE. Foi utilizado o método da Máxima Verossimilhança Restrita, com o programa computacional MTDFREML e um modelo animal bi-caráter. Para as características de crescimento, foram incluídos, como efeitos fixos, o grupo contemporâneo de desmama, a interação das composições raciais dos pais do produto; como covariável, a idade da mãe ao parto; e como aleatórios, os efeitos direto e materno. Para a característica PE, no modelo utilizado, consideraram-se os efeitos linear e quadrático da idade ao sobreano e o peso ao sobreano, a interação das proporções raciais, maternas e paternas e o grupo contemporâneo de sobreano foram introduzidos no modelo como efeitos fixos e o efeito direto do animal como aleatório. As estimativas de herdabilidade foram 0,25, 0,13, 0,23 e 0,21 para GMDND, D160, PD e PE respectivamente. As estimativas de correlações com PE foram 0,17, -0,17 e 0,16 para GMDND, D160 e PD, respectivamente. Os resultados sugerem que as características analisadas podem ser selecionadas conjuntamente em programas de seleção.The data utilized in this work were originated from 53.938 pure and crossbred (Angus x Nelore, collected in different regions of Brazil and Argentina born from 1987 to 1998 were analyzed. The objectives of this work were to verity the heritabilities and correlation among the growing and scrotal circumference traits. The variables analyzed were the average daily gain

Altas concentrações de FSH-p na maturação in vitro de oócitos Bos indicus High concentrations of FSH-p on the in vitro maturation of Bos indicus oocytes

Directory of Open Access Journals (Sweden)

Joana D'Arc Rocha Alves

2001-08-01

Full Text Available O objetivo deste trabalho foi avaliar a eficiência de diferentes concentrações de um FSH-p comercial sobre a maturação nuclear de oócitos Bos indicus, clivagem e desenvolvimento in vitro de embriões até estádios de blastocisto. Após seleção e transferência para o meio TCM 199/HEPES suplementado com diferentes concentrações de FSH-p (T1 = 10mg/m ; T2 = 20mg/m ; T3 = 40mg/m, os oócitos foram incubados, durante 24 horas, a 39ºC em atmosfera úmida contendo 5% de CO2. Parte dos oócitos foram retirados para análise da maturação nuclear e os demais foram transferidos para o meio de fecundação (mDM. Após 18 horas de incubação nas mesmas condições atmosféricas mencionadas para os oócitos, os presumíveis zigotos foram distribuídos no meio de desenvolvimento embrionário (KSOM contendo monocamada de células da granulosa. As porcentagens de metáfase II, de clivagem e de blastocisto foram, respectivamente, de 81,8/62,5/17,6% (T1; 55,6/64,0/19,5% (T2 e 50,0/65,0/16,3% (T3. A análise estatística revelou que uma menor porcentagem (P £ 0,05 de oócitos tratados com 20mg/m e 40mg/m de FSH-p alcançou o estádio de metáfase II e que as taxas de clivagem e blastocisto não diferiram (P ³ 0,05 entre os tratamentos. Os resultados permitem concluir que a adição de 20mg/m e 40mg/m de FSH-p ao meio de cultura interfere no processo de maturação nuclear, mas todas as concentrações testadas podem ser utilizadas sem prejuízo aparente para a clivagem e o posterior desenvolvimento embrionário.The aim of this work was to evaluate the efficiency of different concentrations of a commercial FSH-p on the nuclear maturation of Bos indicus oocytes, cleavage and in vitro development of embryos until blastocyst stages. The oocytes were selected and transferred to the maturation medium (TCM 199/25 mM HEPES supplemented with different concentrations of FSH-p (T1 = 10mg/m ; T2 - 20mg/m ; T3 - 40mg/m and after 24 hours of incubation, at 39º

Composição centesimal e perfil de ácidos graxos da carne de novilho precoce alimentado com lipídios protegidos Centesimal composition and fatty acids profile of veal calves fed protected lipids

Directory of Open Access Journals (Sweden)

Ivy Scorzi Cazelli Pires

2008-12-01

Full Text Available É crescente a preocupação da população em ingerir dietas mais saudáveis, mantendo adequado o nível de colesterol plasmático, com conseqüente redução na incidência de doenças cardiovasculares. O objetivo deste estudo foi avaliar a composição centesimal e o perfil de ácidos graxos da carne de novilho precoce de quatro grupos genéticos: Nelore (R1, Nelore x Canchin (R2, Nelore x Limousin (R3 e Nelore x Aberdeen Angus (R4, alimentados com dieta normal (D1 ou por outra constituída por lipídios protegidos (D2. Determinaram-se os teores de umidade, proteína, lipídios totais, resíduo mineral fixo e o perfil de ácidos graxos. Não foram encontradas diferenças para os teores de umidade, proteína, lipídios totais, Ácidos Graxos Saturados (AGS e Ácidos Graxos Monoinsaturados (AGMI. A dieta protegida ocasionou aumento do teor total de Ácidos Graxos Poliinsaturados (AGPI, quando comparada à D1. Por sua vez, animais que receberam D1 apresentaram maior teor de AGPI w-3 que os da D2. Verificou-se que as técnicas de nutrição animal utilizadas neste estudo garantiram um produto com maior teor de AGPI, característica esta desejável na saúde humana. Fazem-se necessários novos estudos, utilizando-se modelos experimentais, para que sejam avaliados os efeitos da carne de novilho precoce na colesterolemia.Nowadays, the concern about ingesting healthier diets, maintaining adequate plasma cholesterol level, and consequent reduction on the incidence of cardiovascular diseases has been growing. The main objective of this study was to evaluate the centesimal composition and the fatty acids profile of calves of four different genetic groups: Nelore (R1, Nelore x Canchin (R2, Nelore x Limousin (R3, and Nelore x Aberdeen Angus (R4, fed basal diet (D1 or a diet with protected lipids (D2. No differences were observed for the contents of moisture, protein, total lipids, saturated fatty acids, and monounsaturated fatty acids. The protected diet

Avaliação de modelos não-lineares e da relação do consumo voluntário de vacas primíparas e de bezerros com a curva de lactação de vacas Nelore Evaluation of non-linear models and the effects of primiparous cows and calves intake on the lactation curve of Nelore cows

Directory of Open Access Journals (Sweden)

Lara Toledo Henriques

2011-06-01

Full Text Available Procurou-se avaliar a precisão de cinco modelos não-lineares em descrever a forma da curva de produção de leite de vacas Nelore e o efeito do consumo voluntário (CV da vaca e do bezerro sobre a produção de leite (PL. Foram testados os modelos de Sikka, Nelder, Wood, Jenkins & Ferrell, e Jenkins & Ferrell com um parâmetro de ajustamento. Foram utilizadas 12 vacas primíparas com peso corporal médio de 359 kg (± 8 e seus respectivos bezerros. A produção de leite foi estimada pela pesagem do bezerro antes e após a mamada, do nascimento aos 180 dias de idade. As pesagens foram efetuadas duas vezes ao dia, semanalmente, após 6 horas de jejum de líquido e sólidos. Os modelos não-lineares de Sikka, Jenkins & Ferrell, Nelder e Wood não descreveram a curva de lactação apropriada devido ao excesso ou subestimação d o pico da produção de leite. O melhor ajustamento foi encontrado para o modelo de Jenkins & Ferrell com um parâmetro de ajustamento. O efeito do consumo voluntário da vaca e do bezerro, avaliado separadamente, não se correlacionou com a produção de leite. Entretanto, ao avaliar o consumo da vaca e do bezerro conjuntamente, foi encontrada uma correlação positiva e negativa com a produção de leite, respectivamente. A produção de leite está intimamente correlacionada com o consumo da vaca e do bezerro, e a capacidade de ingerir sólidos não lácteos reulta na redução da necessidade de leite da mãe.This research was carried out to evaluate five non-linear mathematical models to describe lactation curves of Nelore cows and effect of the cow and calf intake on milk yield. In this study we compared the models of Sikka (1950, Nelder (1966, Wood (1967, Jenkins & Ferrell (1984 and Jenkins & Ferrell (1984 with a fit parameter. Data of production were collected from 12 primiparous cows with a mean live weight of 359 kg (± 8 and its offspring. The milk production was estimated weighing the calf before and after

External body components and internal fat of Charolais or Nellore steers, fed with different concentrate levelComponentes externos e gordura interna de novilhos Charolês ou Nelore alimentados com diferentes proporções de concentrado

Directory of Open Access Journals (Sweden)

Magali Floriano da Silveira

2013-05-01

Full Text Available The objective was to evaluate the development of external body components and the distribution of internal fat of Charolais (CH and Nellore (NE steers, fed with different concentrate level in the diet. The steers were distributed in six treatments constituted by three concentrate level: 35, 50 or 65% (dry matter basis and two genetic group (Charolais or Nellore. NE steers fed with 65% concentrate in diet showed higher EBW yield, it was not different to CH and NE steers fed with 50% concentrate. Head weigth in relation to EBW was decrease with the increase of the proportions concentrate (4.67, 4.30 and 4.28 to 35; 50 and 65% concentrate, respectively. The head weigh also was lower from NE steers in relation to CH steers (4.30 versus 4.54, respectively. The absolute total weight of internal fat was higher (PAvaliaram-se os componentes externos e a distribuição da gordura interna de novilhos das raças Charolês (CH ou Nelore (NE, alimentados com diferentes proporções de concentrado na dieta. Os novilhos foram distribuídos em seis tratamentos que corresponderam a três níveis de concentrado: 35, 50 e 65% (com base na matéria seca e dois grupos genéticos (Charolês e Nelore. Os novilhos NE alimentados com 65% de concentrado na dieta apresentaram maior rendimento de corpo vazio (RCV, não diferindo dos novilhos CH e NE alimentados com 50% de concentrado. O peso da cabeça ajustado para peso de corpo vazio (PCV foi menor para os animais que consumiram dieta com proporção mais alta de concentrado (4,67, 4,30 e 4,28 para 35, 50 e 65% de concentrado, respectivamente e para os novilhos da raça NE em relação aos CH (4,30 contra 4,54, respectivamente. O peso absoluto total das gorduras internas foi superior (P<0,05 para os novilhos alimentados com proporções mais elevadas de concentrado (18,13; 22,58 e 21,74 kg para 35 50 e 65% de concentrado, e para os novilhos CH em relação aos NE (22,52 contra 19,11, respectivamente. Novilhos CH

A Critical Care Societies Collaborative Statement: Burnout Syndrome in Critical Care Health-care Professionals. A Call for Action.

Science.gov (United States)

Moss, Marc; Good, Vicki S; Gozal, David; Kleinpell, Ruth; Sessler, Curtis N

2016-07-01

Burnout syndrome (BOS) occurs in all types of health-care professionals and is especially common in individuals who care for critically ill patients. The development of BOS is related to an imbalance of personal characteristics of the employee and work-related issues or other organizational factors. BOS is associated with many deleterious consequences, including increased rates of job turnover, reduced patient satisfaction, and decreased quality of care. BOS also directly affects the mental health and physical well-being of the many critical care physicians, nurses, and other health-care professionals who practice worldwide. Until recently, BOS and other psychological disorders in critical care health-care professionals remained relatively unrecognized. To raise awareness of BOS, the Critical Care Societies Collaborative (CCSC) developed this call to action. The present article reviews the diagnostic criteria, prevalence, causative factors, and consequences of BOS. It also discusses potential interventions that may be used to prevent and treat BOS. Finally, we urge multiple stakeholders to help mitigate the development of BOS in critical care health-care professionals and diminish the harmful consequences of BOS, both for critical care health-care professionals and for patients.

Preliminary results of studies of the Valea Morilor Upper Palaeolithic site (Chisinau, Republic of Moldova) : A new camp of mammoth hunters

NARCIS (Netherlands)

Obada, Teodor; van der Plicht, Johannes; Markova, Anastasia; Prepelitsa, Afanasie

2012-01-01

Preliminary results are presented from the studies of a newly found Paleolithic site - Valea Morilor (Chisingu, Republic of Moldova). The excavations produced unquestionable evidence of mammoth hunting (Mammuthus primigenius Blumenbach, 1799). Excavations of 2009-2010 opened an area of 1264 m(2).

Development of ELISA-detected anti-HLA antibodies precedes the development of bronchiolitis obliterans syndrome and correlates with progressive decline in pulmonary function after lung transplantation.

Science.gov (United States)

Jaramillo, A; Smith, M A; Phelan, D; Sundaresan, S; Trulock, E P; Lynch, J P; Cooper, J D; Patterson, G A; Mohanakumar, T

1999-04-27

Development of anti-HLA antibodies after lung transplantation (LT) is thought to play an important role in the etiology of bronchiolitis obliterans syndrome (BOS). However, a cause-effect relationship between anti-HLA antibodies and BOS has not been established. This study was conducted to determine the temporal relationship between the development of anti-HLA antibodies and BOS after LT, and to determine the antigenic specificity of the antibodies developed in BOS patients. Sera from 15 BOS+ LT patients and 12 BOS- LT patients were obtained before LT and collected again at 6, 12, 24, 36, and 48 months after LT. Anti-HLA antibodies were detected by the PRA-STAT ELISA system and by complement-dependent cytotoxicity assays. Anti-HLA reactivity was further characterized by flow cytometry and absorption/elution with human platelets. When analyzed by ELISA, 10 of 15 BOS+ patients developed anti-HLA antibodies, whereas 0 of 12 BOS- patients developed anti-HLA antibodies (PELISA after LT can provide an early identification of an important subset of LT patients with an increased risk of developing BOS.

Efeito da substituição do farelo de algodão pelo farelo de canola no desempenho de novilhas Nelore confinadas Effect of cottonseed meal replacement by canola meal on performance of feedlot Nellore heifers

Directory of Open Access Journals (Sweden)

Ivanor Nunes do Prado

1999-01-01

Full Text Available O objetivo deste trabalho foi estudar o efeito da substituição do farelo de algodão pelo farelo de canola sobre ganho em peso, consumo de ração, conversão alimentar e rendimento de carcaça de novilhas Nelore confinadas. Trinta novilhas com, em média, 225 kg PV inicial e 20 meses de idade foram distribuídas ao acaso em dois tratamentos (farelo de algodão - FAG ou farelo de canola - FAC como fontes de proteína com 15 animais por tratamento. O experimento foi realizado em três períodos de 28 dias, mais 14 dias de adaptação. O ganho médio diário no tratamento FAC (1,05 kg foi maior que no tratamento FAG (0,87 kg. Da mesma forma, a conversão alimentar da MS no tratamento FAC (6,72 foi melhor que no tratamento FAG (8,13; todavia, o rendimento de carcaça foi semelhante para ambos os tratamentos (51,6 e 51,7%, para FAC e FAG, respectivamente. O uso de farelo de canola, em comparação ao farelo de algodão, como fonte de proteína alternativa na ração de novilhas Nelore em crescimento e terminação, mostrou-se viável, uma vez que o ganho em peso e a conversão alimentar dos animais foram melhores.The objective of this work was to study the effect of the substitution of cottonseed meal by canola meal on weight gain, feed intake, feed:gain ratio and dressing percentage of the feedlot Nellore heifers. Thirty Nellore heifers averaging initial of 225 kg LW and 20 months of age were randomly allotted to two treatments (cottonseed meal - COM or canola meal - CAM as protein sources with 15 animals for each treatment. The experiment was carried out in three periods of 28 days each, plus 14 days of adaptation. The daily average weight gain in CAM treatment (1.05 kg was higher than in the COM treatment (.87 kg. In the same way, feed:gain ratio of DM in CAM treatment (6.72 was better than COM treatment (8.13. However, the dressing percentage was similar for both treatments (51.6 and 51.7, for CAM and COM, respectively. The use of canola meal

Avaliação clínica e hematológica em bezerros Nelore infectados experimentalmente com isolados de Babesia bigemina das regiões Sudeste, Nordeste e Norte do Brasil Clinical and hematological evaluation of Nelore calves experimentally infected with isolates of Babesia bigemina from the Southeastern, Northeastern and Northern regions of Brazil

Directory of Open Access Journals (Sweden)

Carla Lopes de Mendonça

2003-06-01

Full Text Available O presente trabalho teve por objetivo estudar comparativamente as alterações clínicas e hematológicas desencadeadas por isolados de Babesia bigemina das regiões Sudeste, Nordeste e Norte do Brasil em bezerros Nelore infectados experimentalmente. Foram utilizados 18 bezerros com idade entre sete e nove meses, isentos de anticorpos contra Babesia sp. e criados livres de carrapatos. Três animais foram previamente inoculados com 2,0x10(9 eritrócitos parasitados (EP para cada isolado. Os outros 15 bezerros foram subdivididos em três grupos de cinco animais, que foram subinoculados com 1,0x10(10 EP dos respectivos isolados. Foram avaliadas as alterações clínicas e hematológicas por meio da determinação da parasitemia, do hemograma, do fibrinogênio plasmático, da contagem de reticulócitos, da análise descritiva da medula óssea e da fragilidade osmótica eritrocitária, no decorrer de 30 dias, perfazendo um total de sete momentos de observação. O acompanhamento da resposta imunológica pelo teste de imunofluorescência indireta foi realizado diariamente até o 10º dia pós-inoculação (DPI e posteriormente no 15º, 20º, 25º e 30º DPI. Clinicamente, observou-se uma manifestação muito branda da doença. Os achados laboratoriais revelaram baixos níveis de parasitemia; decréscimo nos valores do eritrograma; ausência de reticulócitos; diminuição inicial na contagem total dos leucócitos, neutrófilos e linfócitos com posterior elevação do número destas células; hipercelularidade da série eritrocítica e decréscimo da relação mielóide:eritróide mais acentuada entre o 8º e 12º DPI e um aumento da fragilidade osmótica eritrocitária nos grupos inoculados com os isolados sudeste e nordeste. Nenhum dos três isolados de B. bigemina desencadeou a forma clínica característica da enfermidade, apesar de induzirem uma resposta imune humoral.A comparative study was made regarding the clinical and hematological

An Official Critical Care Societies Collaborative Statement-Burnout Syndrome in Critical Care Health-care Professionals: A Call for Action.

Science.gov (United States)

Moss, Marc; Good, Vicki S; Gozal, David; Kleinpell, Ruth; Sessler, Curtis N

2016-07-01

Burnout syndrome (BOS) occurs in all types of health-care professionals and is especially common in individuals who care for critically ill patients. The development of BOS is related to an imbalance of personal characteristics of the employee and work-related issues or other organizational factors. BOS is associated with many deleterious consequences, including increased rates of job turnover, reduced patient satisfaction, and decreased quality of care. BOS also directly affects the mental health and physical well-being of the many critical care physicians, nurses, and other health-care professionals who practice worldwide. Until recently, BOS and other psychological disorders in critical care health-care professionals remained relatively unrecognized. To raise awareness of BOS, the Critical Care Societies Collaborative (CCSC) developed this call to action. The present article reviews the diagnostic criteria, prevalence, causative factors, and consequences of BOS. It also discusses potential interventions that may be used to prevent and treat BOS. Finally, we urge multiple stakeholders to help mitigate the development of BOS in critical care health-care professionals and diminish the harmful consequences of BOS, both for critical care health-care professionals and for patients. Copyright © 2016 American College of Chest Physicians. Published by Elsevier Inc. All rights reserved.

Suplementação com aditivos nutricionais e minerais orgânicos no desempenho de bezerros Nelore recém-desmamados em pastagem

Directory of Open Access Journals (Sweden)

André Soligo Vizeu de Palma

2015-11-01

Full Text Available Resumo: O objetivo deste trabalho foi avaliar o desempenho de bezerros Nelore recém-desmamados em resposta à suplementação com aditivos nutricionais e minerais orgânicos no sal mineral proteinado, em pastagem de Urochloa brizantha 'Marandu', na época seca. Foram utilizados 112 bezerros com idade entre 7-8 meses e com 252±24 kg. Os animais foram divididos em pastos sob lotação rotativa e receberam os tratamentos: sal mineral proteinado (controle; e sal mineral proteinado com minerais na forma orgânica, com monensina ou com óleos funcionais. A cada ciclo de pastejo, foram calculados o consumo de suplemento, o ganho de peso e a eficiência; coletadas amostras de sangue para análise de minerais; e feitas ultrassonografias de carcaça. O consumo do tratamento com monensina foi inferior ao dos demais (0,47 kg por dia; os consumos dos tratamentos controle (0,82 kg por dia e com óleo (0,8 kg por dia foram semelhantes; e o do tratamento com minerais orgânicos foi superior ao dos outros (0,92 kg por dia. Diferenças entre os tratamentos não foram observadas para ganho de peso (0,123 kg por dia e para eficiência (0,161. A área de olho de lombo (46,81 cm2 e a espessura de gordura subcutânea (0,77 mm não diferiram significativamente entre os tratamentos. A adição de monensina diminui o consumo do suplemento, o que pode significar menor ingestão de proteína e prejuízo ao desempenho dos animais.

Effect of Vitamin E and Polyunsaturated Fatty Acids on Cryopreserved Sperm Quality in Bos taurus Bulls Under Testicular Heat Stress.

Science.gov (United States)

Losano, João D A; Angrimani, Daniel S R; Dalmazzo, Andressa; Rocha, Carolina C; Brito, Maíra M; Perez, Eduardo G A; Tsunoda, Roberta H; Góes, Paola A A; Mendes, Camilla M; Assumpção, Mayra E O A; Barnabe, Valquiria H; Nichi, Marcilio

2018-04-03

Taurine bulls are highly susceptible to heat stress, leading to increased oxidative stress (OS) and impaired sperm viability. Polyunsaturated fatty acids (PUFAs) supplementation can be an alternative to improve semen quality, which also results in more sperm susceptibility to lipid peroxidation. Moreover, this deleterious effect can be exacerbated in animals affected by heat stress. Vitamin E is a key antioxidant that counteracts lipid peroxidation of sperm membrane caused by OS. Thus, combining PUFAs with vitamin E may improve sperm quality. In this context, this study aimed to evaluate the effect of interaction between PUFAs and vitamin E on sperm quality in Bos taurus bulls under testicular heat stress. Sixteen taurine bulls under testicular heat stress were randomly assigned in four groups: Control, Vitamin E, PUFA, and PUFA + Vitamin E. All groups lasted for 60 days. Samples were cryopreserved/thawed and analyzed for motility variables (CASA), membrane and acrosome integrity, mitochondrial activity, susceptibility to oxidative stress, DNA integrity, and sperm-binding capacity. Results showed that vitamin E had a beneficial effect on some sperm characteristics, whereas PUFA supplementation had an adverse effect when the two treatments were evaluated separately. Finally, the association between PUFAs and vitamin E did not improve sperm quality.

Results of the CERPOLEX/Mammuthus expeditions on the Taimyr peninsula, Arctic Siberia, Russian federation

NARCIS (Netherlands)

Mol, D; Tikhonov, A; van der Plicht, J; Kahlke, RD; Debruyne, R; van Geel, B; van Reenen, G; Pals, JP; de Marliave, C; Reumer, JWF; Kahlke, Ralf-Dietrich; Pals, Jan Peter; Reumer, Jelle W.F.

During a series of expeditions organized by CERPOLEX/Mammuthus to the Taimyr region in northern Siberia several mammoth (Mammuthus primigenius) carcasses were discovered and subsequently excavated and studied. The oldest specimen is the Arilakh Mammoth (ca. 55,800 BP). Much younger are the Jarkov

Parâmetros genéticos do peso no início da estação de monta, considerado indicativo do peso adulto de matrizes Nelore Genetic parameters for weight at the beginning of breeding season, considered indicative of mature weight of Nelore cows

Directory of Open Access Journals (Sweden)

Maria Eugênia Zerlotti Mercadante

2004-10-01

Full Text Available Parâmetros genéticos foram estimados para peso na entrada da monta (PEM, considerado como indicativo do peso adulto de vacas Nelore. O arquivo de dados continha 7.902 registros de 1.556 vacas pertencentes a um experimento de seleção conduzido na Estação Experimental de Zootecnia de Sertãozinho, SP, Brasil. O PEM foi analisado como o último peso disponível para cada vaca no arquivo (PEM_U ou como registros repetidos, incluindo todos os pesos (PEM_R. As análises foram feitas também em dois outros arquivos excluindo os registros das vacas descartadas antes de chegar aos 4 anos de idade, para o último peso registrado (PEM_U2 e para os registros repetidos (PEM_R2. Os componentes de variância foram estimados por máxima verossimilhança restrita, ajustando modelo animal uni e multivariado. O modelo multivariado incluiu pesos à seleção ajustados para 378 (somente machos e 550 (somente fêmeas dias de idade. As estimativas de herdabilidade obtidas nas análises univariadas foram 0,30±0,05; 0,37±0,06; 0,35±0,04; e 0,42±0,05, para PEM_U, PEM_U2, PEM_R e PEM_R2, respectivamente. Os valores correspondentes para as análises multivariadas foram 0,34; 0,42; 0,56; e 0,57. As estimativas de repetibilidade de PEM_R e PEM_R2 foram 0,58±0,01 e 0,69±0,01 nas análises univariadas e 0,61 e 0,72 nas análises multivariadas. As estimativas da mudança genética em PEM foram positivas e significativas, iguais a 0,40±0,08 e 0,35±0,07 por cento da média ao ano, para os dois rebanhos selecionados do experimento. Há evidências de que o emprego de modelos multivariados incluindo registros repetidos e os pesos à seleção de machos e fêmeas seja mais apropriado que a utilização de apenas o último PEM como indicativo do peso adulto. O PEM poderia ser incluído em um programa de seleção visando mudanças (aumento ou diminuição ou monitoração, para manter o peso adulto desejável.Genetic parameters were estimated for weight at the beginning

Repetibilidade da mensuração de imagens das características de carcaça obtidas por ultrassonografia em fêmeas Nelore Repeatability of ultrasound image measurements of carcass traits in Nellore cattle

Directory of Open Access Journals (Sweden)

Maria Eugênia Zerlotti Mercadante

2010-04-01

Full Text Available Avaliou-se a repetibilidade da mensuração de imagens de ultrassom da área do músculo longissimus dorsi (AOL e das espessuras de gordura subcutânea do lombo (EGL e da garupa (EGG. Imagens de ultrassom tomadas no lombo (entre a 12ª e a 13ª costela e na garupa (entre os músculos gluteus medium e biceps femoris de novilhas Nelore de 14 a 22 meses de idade foram classificadas em aceitáveis, marginais e rejeitáveis. As imagens aceitáveis e marginais foram mensuradas duas vezes por três técnicos em diferentes níveis de treinamento. Foram estimadas as repetibilidades entre e dentro de técnicos por classe de qualidade da imagem, para determinação do efeito da qualidade da imagem e do técnico no valor absoluto da diferença entre a primeira e a segunda mensuração dessas características. A repetibilidade para as imagens aceitáveis foi maior que para imagens marginais, tanto entre como dentro de técnicos. Na análise da diferença absoluta entre a primeira e a segunda interpretação, foram significativos os efeitos de técnico para AOL e EGL e de classe de qualidade da imagem para AOL. Em geral, o técnico com maior experiência apresentou maiores valores de repetibilidade. É recomendável que a mensuração de imagens de animais de mesmo grupo contemporâneo seja feita por um único técnico.The repeatability of ultrasound image measurements of the longissimus dorsi muscle (AOL and of the rumpfat (EGG and backfat (EGL subcutaneous thickness was evaluated. Ultrasound images taken from the back (between 12th and 13th ribs and from the rump (between gluteus medium and biceps femoris muscles of Nelore heifers at 14 and 22 months of age were classified as acceptable, marginal and rejected. The acceptable and marginal images were measured twice by three technicians at different levels of training. It was estimated repeatabilities among and within technicians by class of image quality in order to determine effect of image quality and of

Produção de leite e comportamento de amamentação em cinco sistemas de produção de gado de corte Milk yield and suckling behavior in five beef cattle production system

Directory of Open Access Journals (Sweden)

Ana Carolina Espasandin

2001-06-01

Full Text Available Foram estudados a produção de leite de vacas Nelore e o comportamento de amamentação em diferentes sistemas de produção: NR-Nelore Referência, sob manejo extensivo (manejo tradicional; NI-Nelore, sob manejo intensivo; e três cruzamentos CN-Canchim x Nelore, AN-Angus x Nelore e SN-Simental x Nelore, sob manejo intensivo. Em três momentos da lactação (60, 120 e 180 dias após o parto, foram medidos, nos bezerros, o número e a duração das mamadas, o ganho diário de peso (kg/dia e o peso à desmama. O momento da lactação e a interação sistema de produção x momento da lactação apresentaram efeito significativo sobre a produção de leite. A produção de leite não apresentou corrrelação com o comportamento de amamentação nem com o ganho de peso dos bezerros dos diferentes sistemas de produção. Condições deficientes de alimentação não resultaram em menores produções de leite de vacas Nelore, mas sim em acentuadas perdas de peso (80 kg durante a estação de monta no sistema NR. O tempo diário de amamentação apresentou diminuições significativas no sistema extensivo com o decorrer da lactação, enquanto os sistemas intensivos não mudaram ou aumentaram os minutos de amamentação por dia. Para as condições nas quais o experimento foi desenvolvido, os bezerros cruzados apresentaram os melhores desempenhos durante a fase pré-desmama, em comparação com os bezerros Nelore.Milk yield in Nellore cows and suckling behavior of their calves of different production systems: NR- Extensive Nellore, NI- Intensive Nellore; and three crossbreeding systems (CN- Canchim-Nellore, AN-Angus-Nellore and SN-Simmental-Nellore in intensive management, were studied. Milk production of cows and number and length of suckles, and daily gain (kg/day of calves were obtained in three moments of lactation (60, 120 and 180 days after calving. Moment of lactation and production system by lactation moment interaction had a significant

Relação da circunferência escrotal e parâmetros da qualidade do sêmen em touros da raça Nelore, PO

Directory of Open Access Journals (Sweden)

Silva Antonio Emidio Dias Feliciano

2002-01-01

Full Text Available Em 960 touros da raça Nelore, PO, de 11,4 a 135 meses de idade, pertencentes a fazendas localizadas nos Estados de São Paulo, Goiás e Pará, estudou-se a possível associação entre o tamanho da circunferência escrotal (CE e os parâmetros da qualidade do sêmen, motilidade progressiva (MOT e patologias espermáticas: defeitos maiores (DEFMAI, menores (DEFMEN e totais (DEFTOT. Os touros foram divididos por faixas etárias em: menores que 18, de 18 a 24, de 24 a 30, de 30 a 36 e maiores que 36 meses de idade. Este estudo foi realizado com a finalidade de obter tamanhos de CE que possam indicar o estatus funcional dos testículos, ou seja, a qualidade do sêmen, a serem utilizados para predizer o potencial reprodutivo dos animais destinados à seleção de reprodutores. Da correlação da CE com a MOT, por faixa etária, resultou uma associação (R=0,60; P<0,0001 destes parâmetros nos touros até 18 meses de idade, em que CEs acima de 26 cm indicaram sêmen de alta MOT (60 a 80%. As correlações entre CE e patologias espermáticas foram baixas e a maioria, negativa. Foi concluído, neste estudo, que nos touros jovens o tamanho da CE indica a qualidade do sêmen, portanto pode ser utilizado como um dos critérios na seleção de animais de alto potencial reprodutivo.

Cost of photovoltaic energy systems as determined by balance-of-system costs

Science.gov (United States)

Rosenblum, L.

1978-01-01

The effect of the balance-of-system (BOS), i.e., the total system less the modules, on photo-voltaic energy system costs is discussed for multikilowatt, flat-plate systems. Present BOS costs are in the range of 10 to 16 dollars per peak watt (1978 dollars). BOS costs represent approximately 50% of total system cost. The possibility of future BOS cost reduction is examined. It is concluded that, given the nature of BOS costs and the lack of comprehensive national effort focussed on cost reduction, it is unlikely that BOS costs will decline greatly in the next several years. This prognosis is contrasted with the expectations of the Department of Energy National Photovoltaic Program goals and pending legislation in the Congress which require a BOS cost reduction of an order of magnitude or more by the mid-1980s.

A Novel Protocol to Assess Acclimation Rate in Bos taurus Heifers during Yard Weaning

Directory of Open Access Journals (Sweden)

Jessica E. Monk

2018-04-01

Full Text Available The speed with which animals acclimate to a new environment could be an important measure of ability to cope with management induced stress. This study developed a measure of acclimation rate in a group of 50 Bos taurus heifers during yard weaning over nine days. We recorded the time and order in which heifers moved through a novel funnel structure into a feeding yard daily. We hypothesised that addition of an obstacle at the entrance would increase the time it took heifers to move through the funnel, but that they would acclimate to the obstacle over a three-day period. The change in latency to move through could then be used as a measure of acclimation rate. We hypothesised that individuals which acclimated to obstacles at a faster rate might display favourable temperament as assessed by flight time. All heifers took longer to move through the funnel after a novel object was introduced, then latency decreased over the following two days while the object was present. This indicates the protocol could be useful for measuring acclimation rate at a group level. Individual acclimation rate variables, measured as change in times and orders of heifers between test days, did not appear to have any consistent relationships with flight time or weight change during or post-weaning (p > 0.05. We concluded that the protocol was inappropriate for assessing acclimation rate at an individual level, due to social effects while testing heifers as a group. Heifers which were consistently one of the first 20 to move through the funnel had a significantly greater average weight 5 and 10 months post-weaning (345 ± 9 kg and 518 ± 10 kg respectively than heifers which were consistently one of the last 20 through the funnel (311 ± 8 kg and 484 ± 8 kg respectively; p < 0.001. This may indicate order of movement through the funnel was related to feeding motivation or another aspect of temperament not reflected by flight time.

Cattle phenotypes can disguise their maternal ancestry.

Science.gov (United States)

Srirattana, Kanokwan; McCosker, Kieren; Schatz, Tim; St John, Justin C

2017-06-26

Cattle are bred for, amongst other factors, specific traits, including parasite resistance and adaptation to climate. However, the influence and inheritance of mitochondrial DNA (mtDNA) are not usually considered in breeding programmes. In this study, we analysed the mtDNA profiles of cattle from Victoria (VIC), southern Australia, which is a temperate climate, and the Northern Territory (NT), the northern part of Australia, which has a tropical climate, to determine if the mtDNA profiles of these cattle are indicative of breed and phenotype, and whether these profiles are appropriate for their environments. A phylogenetic tree of the full mtDNA sequences of different breeds of cattle, which were obtained from the NCBI database, showed that the mtDNA profiles of cattle do not always reflect their phenotype as some cattle with Bos taurus phenotypes had Bos indicus mtDNA, whilst some cattle with Bos indicus phenotypes had Bos taurus mtDNA. Using D-loop sequencing, we were able to contrast the phenotypes and mtDNA profiles from different species of cattle from the 2 distinct cattle breeding regions of Australia. We found that 67 of the 121 cattle with Bos indicus phenotypes from NT (55.4%) had Bos taurus mtDNA. In VIC, 92 of the 225 cattle with Bos taurus phenotypes (40.9%) possessed Bos indicus mtDNA. When focusing on oocytes from cattle with the Bos taurus phenotype in VIC, their respective oocytes with Bos indicus mtDNA had significantly lower levels of mtDNA copy number compared with oocytes possessing Bos taurus mtDNA (P cattle with a Bos taurus phenotype. The phenotype of cattle is not always related to their mtDNA profiles. MtDNA profiles should be considered for breeding programmes as they also influence phenotypic traits and reproductive capacity in terms of oocyte quality.

Dias ao Parto de Fêmeas Nelore de um Experimento de Seleção para Crescimento: I - Modelo de Repetibilidade

Directory of Open Access Journals (Sweden)

Mercadante Maria Eugênia Zerlotti

2002-01-01

Full Text Available Registros de datas de entrada na monta e respectiva data do parto, referentes a 1.247 fêmeas Nelore dos rebanhos experimentais da Estação Experimental de Zootecnia de Sertãozinho (IZ - SP, selecionadas para altos (seleção e tradicional e para médios (controle pesos ao sobreano foram usados para obter a variável dias ao parto, a fim de estudar o efeito da seleção para crescimento sobre o desempenho reprodutivo. Arquivos de novilhas e de vacas e novilhas foram analisados incluindo e não incluindo as não paridas. Nenhuma diferença significativa foi detectada entre os registros provenientes das vacas dos rebanhos selecionados e do controle, apesar das vacas do rebanho seleção apresentarem as maiores médias de dias ao parto na maioria dos arquivos estudados. Concordando com os resultados obtidos para o efeito de rebanho, o peso à seleção foi significativo somente para as vacas e novilhas, considerando as não paridas, com tendência das mais pesadas à seleção apresentarem menores valores para dias ao parto. Modelos nos quais não foi considerado o peso à seleção forneceram os mesmos resultados para o efeito de rebanho. As herdabilidades variaram de 0,02 a 0,16, sendo as mais altas obtidas em arquivos nos quais foram incluídos os registros das não paridas, indicando que a observação de caracteres de reprodução somente das fêmeas férteis contribui para mascarar as diferenças genéticas entre os animais, e quando esta variabilidade é re-introduzida, designando-se penalidades às fêmeas que não pariram, as diferenças genéticas entre os animais aparecem. Existem evidências que a seleção para peso não comprometeu o desempenho reprodutivo das fêmeas, mesmo sendo criadas em condições ambientais similares.

Exposing Compassion Fatigue and Burnout Syndrome in a Trauma Team: A Qualitative Study.

Science.gov (United States)

Berg, Gina M; Harshbarger, Jenni L; Ahlers-Schmidt, Carolyn R; Lippoldt, Diana

2016-01-01

Compassion fatigue (CF) and burnout syndrome (BOS) are identified in trauma, emergency, and critical care nursing practices. The purpose of this qualitative study was to measure CF and BOS in a trauma team and allow them to share perceptions of related stress triggers and coping strategies. Surveys to measure CF and BOS and a focus group allowed a trauma team (12 practitioners) to share perceptions of related stress triggers and coping strategies. More than half scored at risk for CF and BOS. Stress triggers were described as situation (abuse, age of patient) versus injury-related. Personal coping mechanisms were most often reported. Both CF and BOS can be assessed with a simple survey tool. Strategies for developing a program culturally sensitive to CF and BOS are provided.

Dicty_cDB: Contig-U16181-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available s taurus Y Chr NOVECTOR CH240-507F20 (Children'... 48 0.79 1 ( AC232941 ) Bos taurus Y Chr NOVECTOR CH240-255J15 (Children...'... 48 0.79 1 ( AC232940 ) Bos taurus Y Chr NOVECTOR CH240-62I11 (Children's... 48 0.79 1 ( A...C232929 ) Bos taurus Y Chr NOVECTOR CH240-291F15 (Children'... 48 0.79 1 ( AC232768 ) Bos taurus Y Chr NOVECTOR CH240-460C15 (Childre...n'... 48 0.79 1 ( AC232755 ) Bos taurus Y Chr NOVECTOR CH240-409J7 (Children...'s... 48 0.79 1 ( AC232753 ) Bos taurus Y Chr NOVECTOR CH240-45P20 (Children's... 48 0.7

Órgãos internos e trato gastrintestinal de novilhos de gerações avançadas do cruzamento rotativo entre as raças Charolês e Nelore terminados em confinamento Internal organs and gastrointestinal tract of feedlot finished steers of advanced generations of rotational crossbreeding between Charolais and Nellore

Directory of Open Access Journals (Sweden)

Luís Fernando Glasenapp de Menezes

2007-02-01

Full Text Available Foram avaliados os efeitos de heterose e de grupo genético nos órgãos internos e no trato gastrintestinal de novilhos puros (Charolês - C e Nelore - N e cruzados da segunda (G2 (3/4C 1/4N e 3/4N 1/4C, terceira (G3 (5/8C 3/8N e 5/8N 3/8C e quarta (G4 (11/16C 5/16N e 11/16N 5/16C gerações de cruzamento terminados em confinamento e abatidos com 23 meses de idade. Os animais cruzados da G2, G3 e G4 foram, respectivamente, 14,95; 17,25 e 18,46% superiores aos puros quanto ao peso de corpo vazio (PCVZ. A heterose para o rendimento de carcaça fria em relação ao PCVZ (RCFCVZ foi positiva em todas as gerações. Os mestiços apresentaram menor peso relativo (ao PCVZ de coração, pulmões e rins, de modo que a heterose foi significativa para peso de coração (-18,29% e rins (-14,29% na G3 e para pulmões (-13,45% na G4. Novilhos mestiços apresentaram valores inferiores à média dos puros para todos os componentes do trato gastrintestinal quando o peso destes componentes foi expresso em relação a 100 kg de PCVZ ou de peso vivo ao abate (PVA, com exceção do rúmen na G2. A heterose retida foi positiva e significativa para PCVZ, RCFCVZ e para peso absoluto do fígado. Entretanto, foi negativa para a quantidade de sangue para os pesos de coração, intestino delgado + grosso e trato gastrintestinal quando expressos em relação a 100 kg de PCVZ e de PVA. Entre os animais puros, os novilhos Nelore tiveram maior RCFCVZ (57,09 vs 61,64%. O peso absoluto de rúmen, abomaso, intestino delgado + grosso e o trato gastrintestinal foram maiores nos novilhos Charolês em relação aos Nelore, o que também foi observado quando estes componentes foram expressos em relação ao PCVZ e PVA, com exceção para o intestino grosso + delgado. Estas diferenças explicam, em parte, o maior rendimento de carcaça dos novilhos Nelore.The objective of this trial was to investigate the effect of heterosis and genetic group on the yield and weight of internal organs

Chest health surveillance utility in the early detection of bronchiolitis obliterans syndrome in children after allo-SCT.

Science.gov (United States)

Gassas, A; Craig-Barnes, H; Dell, S; Doyle, J; Schechter, T; Sung, L; Egeler, M; Palaniyar, N

2013-06-01

To prospectively assess whether periodic chest health surveillance is beneficial for the early detection of bronchiolitis obliterans syndrome (BOS) in children after allo-SCT. Children up to 18 years of age receiving allo-SCT from September 2009 to September 2011 were included. Surveillance consisted of the following: a 7-item respiratory system questionnaire of cough, wheeze and shortness of breath; focused physical examination; and pulmonary function test (PFT) conducted before SCT and at 1, 3, 6, 9, 12, 18 and 24 months after SCT. Thirty-nine patients were enrolled. Five children developed BOS at a median time of 192 days (range 94-282). Positive response comparisons between the BOS group vs the non-BOS group were NS for history questionnaire (P=0.2), heart rate (P=0.3), respiratory rate (P=0.3) and oxygen saturation monitoring (P=0.8). Differences between the two groups for chest auscultation and PFT were statistically significant (P=0.03 and P=0.01, respectively). However, chest auscultation in the BOS group was only positive after BOS diagnosis. PFT reduction was evident in the asymptomatic phase (BOS group 33%; non-BOS group 4.5%, P=0.01). Changes in PFT, but not history/physical examination, allow the early detection of BOS in children after SCT. Our study is limited by the small sample size.

Repeatability and genotypic correlations of reproductive and productive traits of crossbred beef cattle dams.

Science.gov (United States)

Silva, L N; Gasparino, E; Torres Júnior, R A A; Euclides Filho, K; Silva, L O C; Alencar, M M; Souza Júnior, M D; Battistelli, J V F; Silva, S C C

2015-05-22

Beef cattle production requires reproductive efficiency. However, measures of reproductive traits are not usually collected; consequently, correlated traits that could be used as indicators would be useful. We examined associations between measures of reproductive and productive efficiency that could be used as selection indicators. Data from 194 dams of the genetic groups Angus x Nelore, Caracu x Nelore, and Valdostana x Nelore collected over 4 years were used. The reproductive traits analyzed were days to heat (DH), calving interval (CI), days to calving (DC), and pregnancy rate (PR). The productive traits were dam weight (DW), body condition score (BCS), calf weight (CW), and weaning rate (WR). The effects on the model were: year, genetic group, reproductive status (RS), age, reproductive rest, and breed of bull (CW and WR). Multivariate analyses were performed, using the Bayesian approach via Gibbs sampling. We conclude that the reproductive measures are ineffective as selection indicators, whereas using dam weight may be a good alternative.

Effects of 12 hour calf withdrawal on conception rate and calf performance of Bos indicus cattle under extensive conditions.

Science.gov (United States)

Escrivão, R J A; Webb, E C; Garcês, A P J T

2009-01-01

Fifty-two multiparous Brahman type cows with reproductive tract scoring (RTS) >/=4 at 45 days post-partum were randomly assigned to two groups of 26 cows each separated into an ad libitum suckling group (C) and treatment group (T). Calves in the T group were separated for 12 h during the night from 45 days post-partum to the onset of the breeding season. Body condition score (BCS) and body weight (BW) were recorded 45 days post-partum, at the start of the breeding season, and at pregnancy diagnosis. Calves were weighed at calving and weaning. Weaning weights were corrected to 205 days. BW and BCS at the onset of the breeding season were similar (p > 0.05) between the experimental groups. Calving to breeding intervals were 93 +/- 18 d and 99 +/- 22 d for T and C groups, respectively. Calving to conception intervals differed significantly between the groups (111 +/- 10 d for T and 133 +/- 19 d for C) and a similar result was obtained for the breeding to conception intervals (18 +/- 15 d for T and 31 +/- 19 d for C). Conception rates were 80% for the T group and 59% for the C group, which correlated better with BW than BCS at the onset of the breeding season. Weaning weights differed (p conception rates and improves the calf weaning weights of Bos indicus beef cattle under extensive production systems in sub-tropical conditions.

Evidence of solitary chemosensory cells in a large mammal: the diffuse chemosensory system in Bos taurus airways

Science.gov (United States)

Tizzano, Marco; Merigo, Flavia; Sbarbati, Andrea

2006-01-01

The diffuse chemosensory system (DCS) of the respiratory apparatus is composed of solitary chemosensory cells (SCCs) that resemble taste cells but are not organized in end organs. The discovery of the DCS may open up new approaches to respiratory diseases. However, available data on mammalian SCCs have so far been collected from rodents, the airways of which display some differences from those of large mammals. Here we investigated the presence of the DCS and of SCCs in cows and bulls (Bos taurus), in which the airway cytology is similar to that in humans, focusing our attention on detection in the airways of molecules involved in the transduction cascade of taste [i.e. α-gustducin and phospholipase C of the β2 subtype (PLCβ2)]. The aim of the research was to extend our understanding of airway chemoreceptors and to compare the organization of the DCS in a large mammal with that in rodents. Using immunocytochemistry for α-gustducin, the taste buds of the tongue and arytenoid were visualized. In the trachea and bronchi, α-gustducin-immunoreactive SCCs were frequently found. Using immunocytochemistry for PLCβ2, the staining pattern was generally similar to those seen for α-gustducin. Immunoblotting confirmed the expression of α-gustducin in the tongue and in all the airway regions tested. The study demonstrated the presence of SCCs in cows and bulls, suggesting that DCSs are present in many mammalian species. The description of areas with a high density of SCCs in bovine bronchi seems to indicate that the view of the DCS as made up of isolated cells totally devoid of ancillary elements is probably an oversimplification. PMID:16928202

The ecological implications of a Yakutian mammoth’s last meal

NARCIS (Netherlands)

van Geel, B.; Aptroot, A.; Baittinger, C.; Birks, H.H.; Bull, I.D.; Cross, H.B.; Evershed, R.P.; Gravendeel, B.; Kompanje, E.J.O.; Kuperus, P.; Mol, D.; Nierop, K.G.J.; Pals, J.P.; Tikhonov, A.N.; van Reenen, G.; van Tienderen, P.

2008-01-01

Part of a large male woolly mammoth (Mammuthus primigenius) was preserved in permafrost in northern Yakutia. It was radiocarbon dated to ca. 18,500 14C yr BP (ca. 22,500 cal yr BP). Dung from the lower intestine was subjected to a multiproxy array of microscopic, chemical, and molecular techniques

Predição da composição corporal e da carcaça a partir da seção entre a 9ª e 11ª costelas em bovinos Nelore Predicting body and carcass composition using the section between 9th and 11th ribs in Nellore cattle

Directory of Open Access Journals (Sweden)

Marcos Inácio Marcondes

2009-08-01

Full Text Available Objetivou-se avaliar as equações de Hankins & Howe para estimação da composição física da carcaça e as de Paulino para estimação da composição de macrominerais no corpo vazio de bovinos Nelore. Foram utilizados nove machos castrados, nove machos não-castrados e nove fêmeas. Três animais de cada classe foram abatidos ao início do experimento como referência. Os 18 animais remanescentes foram alimentados durante 112 dias com uma ração com 12,5% de proteína bruta, e concentrado, fornecido na proporção de 1,00 ou 1,25% do PV, e abatidos ao final para determinação da composição corporal. As composições física e química foram determinadas em uma amostra entre a 9ª e 11ª costelas (seção HH da meia-carcaça esquerda e na meia-carcaça direita inteira, a qual foi totalmente dissecada. A seção HH não possibilitou estimar corretamente a composição física de nenhum dos componentes da carcaça, e apenas a equação proposta para cálcio foi eficiente para estimar a porcentagem de cálcio no corpo vazio. Propõe-se o uso de novas equações para estimar o conteúdo corporal dos macrominerais a partir de sua concentração na seção HH. As equações de Hankins & Howe não estimam corretamente a composição física da carcaça de bovinos Nelore, no entanto, é possível estimar a composição de macrominerais no corpo vazio de Nelore a partir da seção HH.The objective of this study was to evaluate the Hankins and Howe equations, to estimate the carcass physical composition, and the Paulino equations, to estimate the empty body weight macromineral composition of Nellore cattle. Twenty seven Nellore animls (9 bulls, 9 steers and 9 heifers were used, and nine animals (three of each gender were slaughtered at the beginning and formed the reference group. The 18 remaining animals (6 of each gender were allotted in two levels of concentrate offer (1.0% and 1.25% live weight and were fed over 112 days. At the end of the

Documentation and quantitative analysis of local ethnozoological knowledge among traditional healers of Theni district, Tamil Nadu, India.

Science.gov (United States)

Chellappandian, M; Pandikumar, P; Mutheeswaran, S; Gabriel Paulraj, M; Prabakaran, S; Duraipandiyan, V; Ignacimuthu, S; Al-Dhabi, N A

2014-05-28

This study investigated the use of animals among the traditional healers in Theni district of Tamil Nadu, India. The data regarding the medicinal animals/animal products were documented and their usages were analyzed quantitatively. Based on free list interviews with the traditional healers, we documented the medicinal usage of animals/animal products and calculated the indices such as informant consensus factor (Fic) to determine the consensus over the species for an illness category, as well as the Index Agreement on Remedies (IAR) to determine the extent of potential utilization of each species. In this study, 69 medicinal animals/animal products were documented with the help of standardized questionnaires among the local healers. The results were tabulated and Fic value for each illness category was calculated. Three illness categories viz., jaundice (milk of Capra aegagrus hircus), orthopedics (egg white and meat of Gallus gallus domesticus) and pediatrics (milk of Equus africanus asinus) had got high Fic values. Fifteen illness categories had moderate Fic values. Highly cited animals in these illness categories were: Rusa unicolor (antiemetic), Reticulitermes spp. (diabetes), flesh of Varanus benghalensis (oral ailments), milk (eye ailments, fever) and urine (antidote) of Homo sepians, meat of Trachypithecus johnii (respiratory ailments), various parts of C. aegagrus hircus (blood ailments, coolants, diarrhea, pulmonary and urinary ailments), flesh of Chamaeleon zeyalnica (neural ailments), meat of Passer domesticus (aphrodisiac), curd and dung of Bos primigenius taurus (dermatological ailments), meat of G. domesticus (musculo-skeletal disorders, analgesic), meat of Lissemys punctata (hemorrhoids), and Pherthima posthuma (psychological ailments). Six illness categories had low Fic values. This study indicated that the animals are still being used by the local healers of Theni district, to treat various illnesses. Cross-disciplinary approaches to explore the

Microsatellite and Mitochondrial DNA Study of Native Eastern European Cattle Populations: The Case of the Romanian Grey.

Science.gov (United States)

Ilie, Daniela Elena; Cean, Ada; Cziszter, Ludovic Toma; Gavojdian, Dinu; Ivan, Alexandra; Kusza, Szilvia

2015-01-01

The Eastern European Grey cattle are regarded as the direct descendants of the aurochs (Bos taurus primigenius). Nowadays in Romania, less than 100 Grey animals are being reared and included in the national gene reserve. We examined the genetic diversity among Romanian Grey, Brown, Spotted and Black and White cattle breeds, with a particular focus on Romanian Grey through the use of (i) 11 bovine specific microsatellite markers on 83 animals and (ii) 638 bp length of mitochondrial DNA (mtDNA) D-loop region sequence data from a total of 81 animals. Both microsatellite and mtDNA analysis revealed a high level of genetic variation in the studied breeds. In Romanian Grey a total of 100 alleles were found, the mean number of observed alleles per locus was 9.091; the average observed heterozygosity was 0.940; the Wright's fixation index (FIS) was negative (-0.189) and indicates that there is no inbreeding and no selection pressure. MtDNA analysis revealed 52 haplotypes with 67 variable sites among the Romanian cattle breeds without any insertion or deletion. Haplotype diversity was 0.980 ± 0.007 and ranged from 0.883 ± 0.056 (Brown) to 0.990 ± 0.028 (Spotted and Black and White). The highest genetic variability of the mtDNA was recorded in the Grey breed, where 18 haplotypes were identified. The most frequent mtDNA D-loop region belonged to T3 haplogroup (80.247%), which was found across all studied breeds, while T2 haplotypes (16.049%) was only found in Grey, Spotted and Black and White genotypes. The T1 haplotypes (3.704%) were found in the Grey and Spotted. The current results contribute to the general knowledge on genetic diversity found in Eastern European cattle breeds and could prove a valuable tool for the conservation efforts of animal genetic resources (FAnGR).

Magnetically frustrated double perovskites: synthesis, structural properties, and magnetic order of Sr{sub 2}BOsO{sub 6} (B = Y, In, Sc)

Energy Technology Data Exchange (ETDEWEB)

Paul, Avijit Kumar; Sarapulova, Angelina; Adler, Peter; Kanungo, Sudipta; Mikhailova, Daria; Schnelle, Walter; Hu, Zhiwei; Kuo, Changyang; Yan, Binghai; Felser, Claudia; Tjeng, Liu Hao [Max-Planck-Institut fuer Chemische Physik fester Stoffe,Dresden (Germany); Reehuis, Manfred [Helmholtz-Zentrum Berlin fuer Materialien und Energie, Berlin (Germany); Siruguri, Vasudeva; Rayaprol, Sudhindra [UGC-DAE Consortium for Scientific Research (CSR), Mumbai Centre, Mumbai (India); Soo, Yunlian [Department of Physics, National Tsing Hua University, Hsinchu (China); Jansen, Martin [Max-Planck-Institut fuer Chemische Physik fester Stoffe,Dresden (Germany); Max-Planck-Institut fuer Festkoerperforschung, Stuttgart (Germany)

2015-02-15

Double perovskites Sr{sub 2}BOsO{sub 6} (B = Y, In, and Sc) were prepared from the respective binary metal oxides, and their structural, magnetic, and electronic properties were investigated. At room temperature all these compounds crystallize in the monoclinic space group P2{sub 1}/n. They contain magnetic osmium (Os{sup 5+}, t{sub 2g}{sup 3}) ions and are antiferromagnetic insulators with Neel temperatures T{sub N} = 53 K, 26 K, and 92 K for B = Y, In, and Sc, respectively. Powder neutron diffraction studies on Sr{sub 2}YOsO{sub 6} and Sr{sub 2}InOsO{sub 6} showed that the crystal structures remain unchanged down to 3 K. The Y and In compounds feature a type I antiferromagnetic spin structure with ordered Os moments of 1.91 μ{sub B} and 1.77 μ{sub B}, respectively. The trend in T{sub N} does not simply follow the development of the lattice parameters, which suggests that d{sup 0} compared to d{sup 10} ions on the B site favor a somewhat different balance of exchange interactions in the frustrated Os{sup 5+} fcc-like lattice. (Copyright copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Effects of temperament and acclimation to handling on reproductive performance of Bos taurus beef females.

Science.gov (United States)

Cooke, R F; Bohnert, D W; Cappellozza, B I; Mueller, C J; Delcurto, T

2012-10-01

Two experiments evaluated the effects of temperament and acclimation to handling on reproductive performance of Bos taurus beef females. In Exp. 1, 433 multiparous, lactating Angus × Hereford cows were sampled for blood and evaluated for temperament before the breeding season. Cow temperament was assessed by chute score and exit velocity. Chute score was assessed on a 5-point scale according to behavioral responses during chute restraining. Exit score was calculated by dividing exit velocity into quintiles and assigning cows with a score from 1 to 5 (1 = slowest, 5 = fastest cows). Temperament score was calculated by averaging chute and exit scores. Cows were classified for temperament type according to temperament score (≤ 3 = adequate, > 3 = aggressive). Plasma cortisol concentrations were greater (P score (d 10). On d 11, heifers were ranked by these variables and assigned to receive or not (control) an acclimation treatment. Acclimated heifers were processed through a handling facility 3 times weekly for 4 wk (d 11 to 39; Mondays, Wednesdays, and Fridays), whereas control heifers remained undisturbed on pasture. Heifer puberty status, evaluated via plasma progesterone concentrations, was assessed on d 0 and 10, d 40 and 50, 70 and 80, 100 and 110, 130 and 140, 160 and 170, and 190 and 200. Blood samples collected on d 10 and 40 were also analyzed for plasma concentrations of cortisol and haptoglobin. Temperament score was assessed again on d 40 and d 200. Acclimated heifers had reduced (P = 0.01) concentrations of cortisol and haptoglobin on d 40 and reduced (P = 0.02) exit velocity on d 200 compared with control heifers. Puberty was hastened in acclimated heifers compared with control (P = 0.01). Results from this study indicate that B. taurus beef cows with aggressive temperament have impaired reproductive performance compared with cohorts with adequate temperament, whereas acclimation to human handling after weaning hastens reproductive development of

Dampak Program Bantuan Operasional Sekolah (BOSTerhadap Tingkat Putus Sekolah Di Indonesia: Analisis DID

Directory of Open Access Journals (Sweden)

Bayu Kharisma

2013-02-01

Full Text Available This study aims to analyze the impact of school operational assistance (BOS program on the dropout rate of school during the post-rising fuel prices using difference in difference (DID approach. BOS program is a further development of the social safety net programs (JPS education of the government in the period of 1998-2003 and a reduction in fuel subsidy compensation program implemented over 2003-2005. The results showed that the impact of BOS on the dropout rate of students aged 7-15 years, during the period investigated in this study was lower than those who did not receive BOS fund, but it was not statistically significant. Meanwhile, if the account of the research is to be limited to the influence of students aged 16-20 years who had previously received the benefit of  BOS, it shows that BOS program had a positive influence to the dropout rates of school. However, children aged 16-20 years who had not previously received benefits BOS program have negatively affect to the dropout rates of school. Based on this fact, the benefit of the BOS proram following the fuel price hike in Indonesia during the research  period did not seem to be particularly effective in reducing the dropout rates of school.

Emotional Body Odors as Context: Effects on Cardiac and Subjective Responses.

Science.gov (United States)

Ferreira, Jacqueline; Parma, Valentina; Alho, Laura; Silva, Carlos F; Soares, Sandra C

2018-05-23

Many studies have indicated that the chemical cues from body odors (BOs) of donors experiencing negative emotions can influence the psychophysiological and behavioral response of the observers. However, these olfactory cues have been used mainly as contextual information for processing visual stimuli. Here, for the first time, we evaluate how emotional BO affects the emotional tone of a subsequent BO message. Axillary sweat samples were taken from 20 donors in 3 separate sessions while they watched fear, disgust, or neutral videos. In a double-blind experiment, we assessed the cardiac and subjective responses from 69 participants who were either exposed to negative emotional or neutral BOs. Our results showed a reduced cardiac parasympathetic activity (HF%)-indicating increased stress-when participants smelled the emotional BOs before the neutral BOs, compared to when they smelled neutral followed by emotional BOs. The intensity of the neutral odor also increased following the exposure to both negative BOs. These findings indicate that BOs contain an emotion-dependent chemical cue that affects the perceiver both at the physiological and subjective levels.

Imperfuração congênita do óstio uretral externo associada à persistência de úraco em bezerra Nelore: relato de caso

Directory of Open Access Journals (Sweden)

J.M. Alonso

Full Text Available RESUMO A imperfuração uretral associada ou não à persistência do úraco é rara; quando concomitante, o animal mantém o fluxo urinário por via umbilical, entretanto, após o tratamento de correção da persistência do úraco, ocorre o armazenamento de urina, que pode culminar em complicações como bexigoma, hidroureter e ruptura vesical. Uma bezerra Nelore, com 20 dias de idade, foi atendida com persistência de úraco. Prescreveu-se a aplicação local de tintura de iodo a 10% durante cinco dias, e indicou-se retorno para obliteração cirúrgica caso não houvesse resposta à terapia proposta. Após 30 dias, o animal retornou com distensão abdominal, histórico de diminuição gradual do fluxo urinário, com ausência de micção via vaginal e discreto gotejamento de urina através do umbigo. Após diversas tentativas de cateterismo uretral sem sucesso, diagnosticou-se a imperfuração do óstio uretral externo. O exame ultrassonográfico revelou distensão vesical com aproximadamente sete litros de conteúdo, hidroureter e hidronefrose bilateral. Realizou-se a cistocentese e o esvaziamento vesical guiado por ultrassom e optou-se pela abordagem cirúrgica para criação do óstio uretral e correção do úraco persistente. Por meio de cistotomia, realizou-se a sondagem retrógrada da uretra e a perfuração da membrana que recobria o óstio uretral no vestíbulo vaginal, a fim de criar um novo óstio. A sondagem foi mantida por 10 dias, com o intuito de evitar estenose do óstio e, após 30 dias de pós-operatório, o animal recebeu alta com óstio uretral patente no vestíbulo vaginal.

Efeito da suplementação protéica a pasto sobre consumo de forragens, ganho de peso e condição corporal, em vacas Nelore

Directory of Open Access Journals (Sweden)

Ruas José Reinaldo Mendes

2000-01-01

Full Text Available O objetivo do presente trabalho foi verificar o efeito da utilização de concentrado protéico, durante a época de verão, sobre consumo de forragem e variação no ganho de peso e no escore da condição corporal após o parto. Foram utilizadas 51 vacas paridas da raça Nelore, distribuídas ao acaso nos seguintes tratamentos: T0 = sem suplementação; T1 = suplementação com 1 kg; e T2 = suplementação com 2 kg de concentrado contendo 40,8% de PB, durante 105 dias. Neste período, foram determinados o escore corporal e o peso. Para determinar o consumo, utilizaram-se o marcador externo óxido de cromo, em dose única diária de 20 g, e o marcador interno FDA indigestível das extrusas, coletadas por meio de fístulas esofágicas. A suplementação não influenciou o consumo de MS de pasto, que ficou em torno de 9,87 kg MS/dia, correspondente a 2,13% do peso vivo, mas o consumo total de MS foi superior nos tratamentos T1 e T2. Escore da condição corporal, ganho de peso diário e peso final das vacas mostraram-se superiores nos animais suplementados em relação aos não-suplementados. Não foi observada diferença entre os pesos das crias ao final do período experimental.

Acute cellular rejection is a risk factor for bronchiolitis obliterans syndrome independent of post-transplant baseline FEV1

DEFF Research Database (Denmark)

Burton, C.M.; Iversen, M.; Carlsen, J.

2009-01-01

BACKGROUND: Post-transplant baseline forced expiratory volume in 1 second (FEV(1)) constitutes a systematic bias in analyses of bronchiolitis obliterans syndrome (BOS). This retrospective study evaluates risk factors for BOS adjusting for the confounding of post-transplant baseline FEV(1). METHODS......-specific hazard of BOS (hazard ratio 1.4, confidence interval 1.1 to 1.8, p = 0.009). The absolute value of baseline FEV(1) was a significant confounder in all survival and competing risk analyses of BOS (p ... an independent risk factor for the development of BOS after adjusting for the confounding of post-transplant baseline FEV(1) Udgivelsesdato: 2009/9...

Poliformismo e expressão gênica da leptina em bovinos superprecoces

OpenAIRE

Salman, Ana Karina Dias [UNESP

2003-01-01

Este estudo foi conduzido com novilhos pertencentes a diferentes grupos genéticos, Angus x Nelore (n=31), Simental x Nelore (n=30) e Canchim (n=30), objetivando identificar SSCPs (Polimorfismos de Conformação de Cadeia Simples) e RFLP (Polimorfismo no Comprimento do Fragmento de Restrição) no gene da obesidade e relacionar esses polimorfismos com a área-de-olho-de-lombo (AOL) e a espessura de gordura subcutânea (EGS) na carcaça. Cinco pares de oligonucleotídeos iniciadores foram desenhados co...

Genome-wide identification, classification, and functional analysis of the basic helix-loop-helix transcription factors in the cattle, Bos Taurus.

Science.gov (United States)

Li, Fengmei; Liu, Wuyi

2017-06-01

The basic helix-loop-helix (bHLH) transcription factors (TFs) form a huge superfamily and play crucial roles in many essential developmental, genetic, and physiological-biochemical processes of eukaryotes. In total, 109 putative bHLH TFs were identified and categorized successfully in the genomic databases of cattle, Bos Taurus, after removing redundant sequences and merging genetic isoforms. Through phylogenetic analyses, 105 proteins among these bHLH TFs were classified into 44 families with 46, 25, 14, 3, 13, and 4 members in the high-order groups A, B, C, D, E, and F, respectively. The remaining 4 bHLH proteins were sorted out as 'orphans.' Next, these 109 putative bHLH proteins identified were further characterized as significantly enriched in 524 significant Gene Ontology (GO) annotations (corrected P value ≤ 0.05) and 21 significantly enriched pathways (corrected P value ≤ 0.05) that had been mapped by the web server KOBAS 2.0. Furthermore, 95 bHLH proteins were further screened and analyzed together with two uncharacterized proteins in the STRING online database to reconstruct the protein-protein interaction network of cattle bHLH TFs. Ultimately, 89 bHLH proteins were fully mapped in a network with 67 biological process, 13 molecular functions, 5 KEGG pathways, 12 PFAM protein domains, and 25 INTERPRO classified protein domains and features. These results provide much useful information and a good reference for further functional investigations and updated researches on cattle bHLH TFs.

Structure analysis and laxative effects of oligosaccharides isolated from bananas.

Science.gov (United States)

Wang, Juan; Huang, Hui Hua; Cheng, Yan Feng; Yang, Gong Ming

2012-10-01

Banana oligosaccharides (BOS) were extracted with water, and then separated and purified using column chromatography. Gel penetration chromatography was used to determine the molecular weights. Thin layer chromatogram and capillary electrophoresis were employed to analyze the monosaccharide composition. The indican bond and structure of the BOS molecule were determined using Fourier transform infrared spectroscopy and nuclear magnetic resonance. Results showed that BOS were probably composed of eight β-D-pyran glucose units linked with 1→6 indican bonds. The laxative effects of BOS were investigated in mice using the method described in "Handbook of Technical Standards for Testing and Assessment of Health Food in China." The length of the small intestine over which a carbon suspension solution advanced in mice treated with low-, middle-, and high-dose BOS was significantly greater than that in the model group, suggesting that BOS are effective in accelerating the movement of the small intestine.

Early extracellular matrix changes are associated with later development of bronchiolitis obliterans syndrome after lung transplantation

DEFF Research Database (Denmark)

Müller, Catharina; Andersson-Sjöland, Annika; Schultz, Hans Henrik

2017-01-01

are largely unknown. The aim of this study was to identify potential early changes in the extracellular matrix (ECM) in different compartments of the transplanted lung prior to the development of BOS. Methods: Transbronchial biopsies from a cohort of 58 lung transplantation patients at the Copenhagen...... and immunohistochemistry. Results: A time-specific and compartment-specific pattern of ECM changes was detected. Alveolar total collagen (p=0.0190) and small airway biglycan (p=0.0199) increased between 3 and 12 months after transplantation in patients developing BOS, while collagen type IV (p=0.0124) increased...... in patients without BOS. Patients with early-onset BOS mirrored this increase. Patients developing grade 3 BOS showed distinct ECM changes already at 3 months. Patients with BOS with treated acute rejections displayed reduced alveolar total collagen (p=0.0501) and small airway biglycan (p=0.0485) at 3 months...

Blood Gene Expression Predicts Bronchiolitis Obliterans Syndrome

Directory of Open Access Journals (Sweden)

Richard Danger

2018-01-01

Full Text Available Bronchiolitis obliterans syndrome (BOS, the main manifestation of chronic lung allograft dysfunction, leads to poor long-term survival after lung transplantation. Identifying predictors of BOS is essential to prevent the progression of dysfunction before irreversible damage occurs. By using a large set of 107 samples from lung recipients, we performed microarray gene expression profiling of whole blood to identify early biomarkers of BOS, including samples from 49 patients with stable function for at least 3 years, 32 samples collected at least 6 months before BOS diagnosis (prediction group, and 26 samples at or after BOS diagnosis (diagnosis group. An independent set from 25 lung recipients was used for validation by quantitative PCR (13 stables, 11 in the prediction group, and 8 in the diagnosis group. We identified 50 transcripts differentially expressed between stable and BOS recipients. Three genes, namely POU class 2 associating factor 1 (POU2AF1, T-cell leukemia/lymphoma protein 1A (TCL1A, and B cell lymphocyte kinase, were validated as predictive biomarkers of BOS more than 6 months before diagnosis, with areas under the curve of 0.83, 0.77, and 0.78 respectively. These genes allow stratification based on BOS risk (log-rank test p < 0.01 and are not associated with time posttransplantation. This is the first published large-scale gene expression analysis of blood after lung transplantation. The three-gene blood signature could provide clinicians with new tools to improve follow-up and adapt treatment of patients likely to develop BOS.

Biomarkers for the prediction of the bronchiolitis obliterans syndrome after lung transplantation

NARCIS (Netherlands)

Paantjens, A.W.M.

2011-01-01

The main limitation for overall survival after lung transplantation (LTx) is the development of chronic rejection, which is represented by the bronchiolitis obliterans syndrome (BOS). The diagnosis BOS is based on lung function testing, however, it is a surrogate marker. And because BOS is an

Plenoptic background oriented schlieren imaging

International Nuclear Information System (INIS)

Klemkowsky, Jenna N; Fahringer, Timothy W; Clifford, Christopher J; Thurow, Brian S; Bathel, Brett F

2017-01-01

The combination of the background oriented schlieren (BOS) technique with the unique imaging capabilities of a plenoptic camera, termed plenoptic BOS, is introduced as a new addition to the family of schlieren techniques. Compared to conventional single camera BOS, plenoptic BOS is capable of sampling multiple lines-of-sight simultaneously. Displacements from each line-of-sight are collectively used to build a four-dimensional displacement field, which is a vector function structured similarly to the original light field captured in a raw plenoptic image. The displacement field is used to render focused BOS images, which qualitatively are narrow depth of field slices of the density gradient field. Unlike focused schlieren methods that require manually changing the focal plane during data collection, plenoptic BOS synthetically changes the focal plane position during post-processing, such that all focal planes are captured in a single snapshot. Through two different experiments, this work demonstrates that plenoptic BOS is capable of isolating narrow depth of field features, qualitatively inferring depth, and quantitatively estimating the location of disturbances in 3D space. Such results motivate future work to transition this single-camera technique towards quantitative reconstructions of 3D density fields. (paper)

Análise da variabilidade genética aditiva de características de crescimento na raça Nelore Additive genetic variability analysis in the growth characteristics of Nellore breed

Directory of Open Access Journals (Sweden)

Roberta Lisboa Pontes Gestal de Siqueira

2003-02-01

Full Text Available Foram utilizados dados de cinqüenta e um rebanhos participantes do Programa de Melhoramento Genético da Raça Nelore (PMGRN, distribuídos nos estados de Goiás (GO, Mato Grosso do Sul (MS, Mato Grosso (MT, Minas Gerais (MG, São Paulo (SP, Maranhão (MA e Bahia (BA. Foram obtidas estimativas de parâmetros genéticos para os pesos padronizados aos 120 (P120, 455 (P455 e 550 (P550 dias de idade. Análises unicaráter e bicaráter foram realizadas por modelo animal usando o aplicativo MTDFREML. Para P120 foi utilizado um modelo que incluiu como efeitos fixos, grupo de contemporâneos e classe de idade da vaca ao parto, e como aleatórios, os efeitos genéticos direto, materno e de ambiente permanente da vaca. Para P455 e P550, o modelo utilizado incluiu os mesmos efeitos fixos e o efeito genético direto do animal. ANas análises unicaráter, as estimativas de herdabilidade direta foram 0,29, 0,51 e 0,47 para P120, P455 e P550, respectivamente. Nas análises bicaráter, observaram-se coeficientes de herdabilidade direta de 0,50 e 0,58 para P120, 0,50 e 0,53 para P455 e 0,44 e 0,49 para P550. As correlações genéticas estimadas entre P120 e P455, P120 e P550 e P455 e P550, foram 0,92, 0,93 e 0,96, respectivamente. As estimativas de herdabilidade obtidas para P455 e as correlações genéticas deste peso com P120 e P550 sugerem que a avaliação genética pode ser feita aos 15 meses de idade em substituição aos 18 meses.The data were obtained from 51 herds to participate in the Nelore Catttle Breeding Program (NCBP from the states of Goiás (GO, Mato Grosso do Sul (MS, Mato Grosso (MT, Minas Gerais (MG, São Paulo (SP, Maranhão (MA and Bahia (BA. Were used to estimative genetic parameters for standardized weights at 120 (P120, 455 (P455 and 550 (550 days of age. Univariate and bivariate analysis were performed by animal model using MTDFREML program. For P120 was used a model that included contemporary groups and cow age at calving as fixed

Evaluation of indirect TaSP enzyme-linked immunosorbent assay for diagnosis of tropical theileriosis in cattle (Bos indicus) and water buffaloes (Bubalus bubalis) in Egypt.

Science.gov (United States)

Mohamed, Amr M; Abdel-Rady, Ahmed; Ahmed, Laila S; El-Hosary, Amira

2012-05-25

The aim of the present study was to evaluate the validity of Theileria annulata surface protein (TaSP)-ELISA, in comparison with traditional microscopic test, for the diagnosis of T. annulata infection among Egyptian baladi cattle (Bos taurus) and water buffaloes (Bubalus bubalis). Molecular confirmation of infection using T. annulata merozoite surface (Tams-1) target amplification by PCR was used as a gold standard. A total of 76 clinically suspected animals including 64 baladi cattle and 12 water buffaloes were investigated in the current study by the three methods. Based on the PCR-confirmed results, the evaluation study revealed higher sensitivity of TaSP-ELISA (72.9% and 75%) as compared to microscopic examination (58.3% and 50%) among cattle and buffaloes, respectively. On the other hand, the specificity of TaSP-ELISA in diagnosis of T. annulata infection was higher (87.5%) in baladi cattle as compared to water buffaloes (37.5%). In conclusion, TaSP-ELISA was shown to be suitable for the diagnosis of T. annulata infection in cattle under field conditions. Copyright © 2011 Elsevier B.V. All rights reserved.

Característica leucocitária, relação albumina/globulina, proteína plasmática e fibrinogênio de bovinos da raça Nelore, confinados e terminados a pasto Leukocyte characteristic, albumin/globulin relation, plasmatic protein and fibrinogen of bovines of the Nelore race confined and grazing

Directory of Open Access Journals (Sweden)

Ediane Batista da Silva

2008-11-01

Full Text Available Esse trabalho avaliou as mudanças na contagem de leucócitos e algumas proteínas séricas de bovinos confinados e terminados a pasto. De 120 amostras sangüíneas coletadas, 60 foram obtidas de bovinos Nelores machos confinados e 60 de animais com as mesmas características, porém manejados extensivamente. As amostras foram obtidas por ocasião do abate desses animais. Os parâmetros estudados foram contagem de leucócitos, razão albumina/globulina e concentração de fibrinogênio plasmático. Na análise dos dados empregou-se estatística descritiva, obtendo-se as médias, desvio padrão e coeficiente de variação para todos as variáveis avaliadas e posteriormente comparou-se as médias por meio de teste não-paramétrico. Os bovinos terminados a pasto apresentaram maior nível de globulina e fibrinogênio (P>0,05 quando comparados com os confinados (globulina: pastejo=3,29g dL-1 0,76; confinamento 2,99g dL-1±0,60 e Fibrinogênio: pastejo=872mg dL-1±610; confinamento=633mg dL-1±319. O número de leucócitos total foi de 7,64±2,15 em bovinos confinados e de 7,72±1,84 nos terminados a pasto. Não houve diferença (P>0,05 entre essa variável e a contagem diferencial de leucócitos bem como na proteína sérica total (g dL-1 dos bovinos terminados a pasto (6,10±0,53 e dos confinados (5,96±0,49. O nível de albumina dos bovinos confinados (3,01g dL-1±0,43 e a razão A/G (1,07±8,91 foram maiores quando comparados com os bovinos terminados a pasto (2,82g dL-1±0,45 e (0,95±0,38 respectivamente. O nível mais elevado de albumina nos bovinos confinados sugere que eles foram submetidos a uma dieta nutricional mais adequada. O constante desafio imunológico sofrido pelos animais terminados a pasto pode ter sido responsável pelo elevado nível de globulina e fibrinogênio. Esses resultados indicaram que, apesar das adversidades que os bovinos confinados são submetidos, eles não apresentaram alterações correlacionadas com esse fato

Development of a Multivariate Prediction Model for Early-Onset Bronchiolitis Obliterans Syndrome and Restrictive Allograft Syndrome in Lung Transplantation

Directory of Open Access Journals (Sweden)

Angela Koutsokera

2017-07-01

Full Text Available BackgroundChronic lung allograft dysfunction and its main phenotypes, bronchiolitis obliterans syndrome (BOS and restrictive allograft syndrome (RAS, are major causes of mortality after lung transplantation (LT. RAS and early-onset BOS, developing within 3 years after LT, are associated with particularly inferior clinical outcomes. Prediction models for early-onset BOS and RAS have not been previously described.MethodsLT recipients of the French and Swiss transplant cohorts were eligible for inclusion in the SysCLAD cohort if they were alive with at least 2 years of follow-up but less than 3 years, or if they died or were retransplanted at any time less than 3 years. These patients were assessed for early-onset BOS, RAS, or stable allograft function by an adjudication committee. Baseline characteristics, data on surgery, immunosuppression, and year-1 follow-up were collected. Prediction models for BOS and RAS were developed using multivariate logistic regression and multivariate multinomial analysis.ResultsAmong patients fulfilling the eligibility criteria, we identified 149 stable, 51 BOS, and 30 RAS subjects. The best prediction model for early-onset BOS and RAS included the underlying diagnosis, induction treatment, immunosuppression, and year-1 class II donor-specific antibodies (DSAs. Within this model, class II DSAs were associated with BOS and RAS, whereas pre-LT diagnoses of interstitial lung disease and chronic obstructive pulmonary disease were associated with RAS.ConclusionAlthough these findings need further validation, results indicate that specific baseline and year-1 parameters may serve as predictors of BOS or RAS by 3 years post-LT. Their identification may allow intervention or guide risk stratification, aiming for an individualized patient management approach.

Artificial infestation of Boophilus microplus in beef cattle heifers of four genetic groups

Directory of Open Access Journals (Sweden)

Ana Mary da Silva

2007-01-01

Full Text Available Resistance of beef cattle heifers to the cattle tick Boophilus microplus was evaluated by artificial infestation of 66 beef cattle heifers of the following genetic groups: 16 Nelore (NE, 18 Canchim x Nelore (CN, 16 Angus x Nelore (AN and 16 Simmental x Nelore (SN. The animals, with a mean age of 16.5 months, were maintained with no chemical tick control in a Brachiaria decumbens pasture. Four artificial infestations with 20,000 B. microplus larvae were carried out 14 days apart and from day 18 to day 22 of each infestation the number of engorged female ticks (> 4.5 mm was counted on the left side of each heifer. Data were analyzed as the percentage of return (PR = percentage of ticks counted relative to the number infested, transformed to (PR¼, and as log10 (Cij + 1, in which Cij is the number of ticks in each infestation, using the least squares method with a model that included the effects of genetic group (GG, animal within GG (error a, infestation number (I, GG x I and the residual (error b. Results indicated a significant GG x I interaction, because AN and SN heifers had a higher percentage of return than CN and NE heifers, while CN heifers showed a higher percentage of return than the NE heifers only in infestations 3 and 4. Transformed percentages of return were NE = 0.35 ± 0.06, AN = 0.89 ± 0.06, CN = 0.54 ± 0.05 and SN = 0.85 ± 0.06.

Desempenho, fibras musculares e carne de bovinos jovens de três grupos genéticos Performance, muscle fibers and meat traits of young bulls of three genetic groups

Directory of Open Access Journals (Sweden)

Mário De Beni Arrigoni

2004-10-01

Full Text Available O objetivo deste trabalho foi avaliar as características de desempenho, carcaça, qualidade de carne e das fibras musculares esqueléticas de bovinos jovens de três grupos genéticos, Angus x Nelore, Canchim x Nelore e Simental x Nelore. Noventa bovinos inteiros mestiços jovens, com idade média de oito meses, sendo 30 de cada grupo genético, foram distribuídos em delineamento experimental inteiramente casualizado, com três tratamentos (grupos genéticos e seis repetições. Nas análises das fibras musculares, foram utilizados seis animais por tratamento e na avaliação de desempenho e características de carcaça, foram utilizados todos os animais. Em relação a ganho de peso diário, rendimentos de carcaça e cortes cárneos, área do músculo longissimus dorsi e proteínas e lipídeos totais na carne, não houve diferença entre os grupos genéticos, porém os mestiços Angus apresentaram maior espessura de gordura subcutânea. A maciez da carne não variou entre os grupos genéticos e entre os períodos de 7 e 14 dias de maturação. A semelhança da maciez da carne de 7 e 14 dias permite que o tempo de maturação das carnes seja reduzido, quando se utiliza animais jovens.The performance, carcass traits and quality of meat and muscle fibers of young bulls of three genetic groups, Angus x Nelore, Canchim x Nelore and Simmental x Nelore, were analysed. Ninety crossbred young bulls, averaging eight months old, being 30 of each genetic group, were allotted in a completely randomized design, with three treatments (genetic groups and six replicates. Six animals per treatment were used for the analysis of muscular fibers, while for the evaluation of performance and carcass traits, all animals were used. Average daily gain, dressing percentage, primal cuts yield, rib eye area and total meat protein and fat did not differ among treatments. Angus crossbreed showed greater fat thickness than the other groups. Meat shear force values did not

A clone-free, single molecule map of the domestic cow (Bos taurus) genome.

Science.gov (United States)

Zhou, Shiguo; Goldstein, Steve; Place, Michael; Bechner, Michael; Patino, Diego; Potamousis, Konstantinos; Ravindran, Prabu; Pape, Louise; Rincon, Gonzalo; Hernandez-Ortiz, Juan; Medrano, Juan F; Schwartz, David C

2015-08-28

The cattle (Bos taurus) genome was originally selected for sequencing due to its economic importance and unique biology as a model organism for understanding other ruminants, or mammals. Currently, there are two cattle genome sequence assemblies (UMD3.1 and Btau4.6) from groups using dissimilar assembly algorithms, which were complemented by genetic and physical map resources. However, past comparisons between these assemblies revealed substantial differences. Consequently, such discordances have engendered ambiguities when using reference sequence data, impacting genomic studies in cattle and motivating construction of a new optical map resource--BtOM1.0--to guide comparisons and improvements to the current sequence builds. Accordingly, our comprehensive comparisons of BtOM1.0 against the UMD3.1 and Btau4.6 sequence builds tabulate large-to-immediate scale discordances requiring mediation. The optical map, BtOM1.0, spanning the B. taurus genome (Hereford breed, L1 Dominette 01449) was assembled from an optical map dataset consisting of 2,973,315 (439 X; raw dataset size before assembly) single molecule optical maps (Rmaps; 1 Rmap = 1 restriction mapped DNA molecule) generated by the Optical Mapping System. The BamHI map spans 2,575.30 Mb and comprises 78 optical contigs assembled by a combination of iterative (using the reference sequence: UMD3.1) and de novo assembly techniques. BtOM1.0 is a high-resolution physical map featuring an average restriction fragment size of 8.91 Kb. Comparisons of BtOM1.0 vs. UMD3.1, or Btau4.6, revealed that Btau4.6 presented far more discordances (7,463) vs. UMD3.1 (4,754). Overall, we found that Btau4.6 presented almost double the number of discordances than UMD3.1 across most of the 6 categories of sequence vs. map discrepancies, which are: COMPLEX (misassembly), DELs (extraneous sequences), INSs (missing sequences), ITs (Inverted/Translocated sequences), ECs (extra restriction cuts) and MCs (missing restriction cuts

[Burnout syndrome in pre-hospital and hospital emergency. Cognitive study in two cohorts of nurses].

Science.gov (United States)

Cicchitti, Chiara; Cannizzaro, Giorgia; Rosi, Fabrizio; Maccaroni, Roberto; Menditto, Vincenzo G

2014-01-01

Burnout syndrome (BOS) associated with stress has been documented in health care professionals in many specialties. The emergency department and the pre-hospital healthcare services are highly stressful environments. Little is known about the BOS in critical care nursing staff. The objective of the study is to compare the incidence of BOS and its three domains, namely, emotional exhaustion, depersonalization and reduced professional accomplishment, in two cohorts of critical care nurses: a pre-hospital and a hospital emergency service. A survey using a questionnaire (the Maslach Burnout Inventory-General Survey, MBI-GS), among nurses of two Italian emergency services has been performed: a hospital emergency service (HES, Emergency Department or "Pronto Soccorso") and a pre-hospital emergency service (PHES, territorial healthcare service or "Centrale Operativa 118"). All 60 nurses surveyed (82% female) filled the questionnaires. BOS-related symptoms have been identified in at least 50% of the nurses in the HES: 50% suffered a medium-high emotional exhaustion, 75% had a medium-high depersonalization and 92.5% had a medium-high reduced professional accomplishment. Among the PEHS nurses, BOS-related symptoms have been identified in at least 60% of the respondents: 60% had a medium-high emotional exhaustion, 70% had a medium-high depersonalization and 95% had a medium-high reduced professional accomplishment. Moreover, the likelihood that a nurse has a severe BOS, that is at least one degree of high burnout or ≥2 degrees of medium burnout, is significantly higher in the group of the PHES than in the HES (90% vs 60%, p nursing staff had a severe BOS. The incidence of BOS appeared to be similar among PHES and HES nurses with a higher trend for the former. Further interventional studies are needed to investigate the determinants of BOS among critical care nurses and the potentially preventive strategies.

Experimental Evaluation of Processing Time for the Synchronization of XML-Based Business Objects

Science.gov (United States)

Ameling, Michael; Wolf, Bernhard; Springer, Thomas; Schill, Alexander

Business objects (BOs) are data containers for complex data structures used in business applications such as Supply Chain Management and Customer Relationship Management. Due to the replication of application logic, multiple copies of BOs are created which have to be synchronized and updated. This is a complex and time consuming task because BOs rigorously vary in their structure according to the distribution, number and size of elements. Since BOs are internally represented as XML documents, the parsing of XML is one major cost factor which has to be considered for minimizing the processing time during synchronization. The prediction of the parsing time for BOs is an significant property for the selection of an efficient synchronization mechanism. In this paper, we present a method to evaluate the influence of the structure of BOs on their parsing time. The results of our experimental evaluation incorporating four different XML parsers examine the dependencies between the distribution of elements and the parsing time. Finally, a general cost model will be validated and simplified according to the results of the experimental setup.

UCP Mainport : kontseptuaalne uurimus Utrechti raudteejaama maa-ala arendamiseks = UCP Mainport : concept study redevelopment station area Utrecht

Index Scriptorium Estoniae

2000-01-01

Mainporti projekti arhitekt Ben van Berkel, projekteerijad: Van Berkel & Bos, Holland Railconsult. Projekti II etapis uuriti Hoog Catherijne ostukeskuse laiendamist. Projekteerijad: Van Berkel & Bos, Neutelings & Riedijk, Alsop & Störmer.Van Berkel & Bos (arhitektibüroo, Holland). Holland Railconsult (projekteerimisbüroo, Utrecht). Alsop & Störmer (arhitektibüroo, London). Neutelings & Riedijk (arhitektibüroo, Rotterdam)

Alternativas de análises em dados de medidas repetidas de bovinos de corte Alternative analyses of repeated weight measurements of beef cattle

Directory of Open Access Journals (Sweden)

Alfredo Ribeiro de Freitas

2005-12-01

Full Text Available Objetivou-se estudar duas alternativas de análises de variâncias e covariâncias para dados de pesagens de bovinos. Foram utilizados dados de animais Nelore, Guzerá, Gir e Indubrasil, machos e fêmeas, pertencentes à Associação Brasileira de Criadores de Zebu - ABCZ. De cada indivíduo, foram obtidas, em intervalos trimestrais, nove medidas repetidas de pesos, do nascimento aos dois anos de idade. Na primeira análise, a variável resposta y i foi transformada por meio da família de transformação de Box-Cox y ilambda = (ylambda-lambda/lambda, (l ¹ 0 ou y i = log y i, (lambda = 0. Essa transformação foi efetiva na redução dos coeficientes de assimetria e da heterogeneidade de variância para todas as pesagens e raças. Na segunda análise, foi selecionada a estrutura de covariâncias mais adequada para representar a variabilidade dentro de indivíduo, considerando-se um modelo misto usual para medidas repetidas. Utilizando-se os critérios fornecidos pelo procedimento MIXED do SAS: distribuição de chi2, AIC ("Akaike's Information Criterion" e SBC ("Schwarz's Bayesian Criterion", a estrutura de covariância mais adequada para todas as raças foi a Não-Estruturada, seguida da estrutura Fator-Analítico para Nelore, Gir e Indubrasil e Simetria Composta Heterogênea para Guzerá.Data consisting of individual records of male and female animals of purebred Bos Indicus beef cattle (Nellore, Guzerá, Gir and Indubrasil weighted every three months from birth to 24 months of age available from National Archive of Brazilian Zebu Breeders Association (ABCZ were used to evaluate two alternatives (covariance analyses for body weight. In the first analysis the Box-Cox family transformation y ilambda = (ylambda-lambda/lambda (l ¹ 0 or y i = log y i, for lambda=0 was effective in reducing the asymmetry of the coefficients and variance heterogeneity for all weights and breeds. In the second analysis a usual standard mixed model for repeated

Protection against bronchiolitis obliterans syndrome is associated with allograft CCR7+ CD45RA- T regulatory cells.

Directory of Open Access Journals (Sweden)

Aric L Gregson

2010-06-01

Full Text Available Bronchiolitis obliterans syndrome (BOS is the major obstacle to long-term survival after lung transplantation, yet markers for early detection and intervention are currently lacking. Given the role of regulatory T cells (Treg in modulation of immunity, we hypothesized that frequencies of Treg in bronchoalveolar lavage fluid (BALF after lung transplantation would predict subsequent development of BOS. Seventy BALF specimens obtained from 47 lung transplant recipients were analyzed for Treg lymphocyte subsets by flow cytometry, in parallel with ELISA measurements of chemokines. Allograft biopsy tissue was stained for chemokines of interest. Treg were essentially all CD45RA(-, and total Treg frequency did not correlate to BOS outcome. The majority of Treg were CCR4(+ and CD103(- and neither of these subsets correlated to risk for BOS. In contrast, higher percentages of CCR7(+ Treg correlated to reduced risk of BOS. Additionally, the CCR7 ligand CCL21 correlated with CCR7(+ Treg frequency and inversely with BOS. Higher frequencies of CCR7(+ CD3(+CD4(+CD25(hiFoxp3(+CD45RA(- lymphocytes in lung allografts is associated with protection against subsequent development of BOS, suggesting that this subset of putative Treg may down-modulate alloimmunity. CCL21 may be pivotal for the recruitment of this distinct subset to the lung allograft and thereby decrease the risk for chronic rejection.

AVALIAÇÃO DAS CARACTERÍSTICAS DE CARCAÇA DE NOVILHOS NELORE SUPLEMENTADOS A PASTO NA ESTAÇÃO CHUVOSA

Directory of Open Access Journals (Sweden)

Carlos Stuart Coronel Palma

2006-10-01

Full Text Available A base de sustentação da pecuária de corte no Brasil são as pastagens, implantadas em aproximadamente 171milhões de hectares. Das 35,7 milhões de cabeças abatidas anualmente no Brasil, apenas 1,5 milhões são terminadas em regime de confinamento, o restante, cerca de 34,2 milhões de cabeças, é mantido em regime de pasto. Na última década, os criadores brasileiros de gado de corte, utilizando-se de técnicas de manejo e alimentação, têm procurado produzir bovinos jovens para o abate, alcançando não só maior produtividade e qualidade de carcaça, como também retorno mais rápido dos investimentos e melhor remuneração. Considerando a necessidade do aumento da eficiência produtiva para viabilização comercial da atividade e a importância da nutrição nesse processo, uma avaliação de alternativas de suplementação torna-se necessária. Assim, com este experimento avaliaram-se os efeitos da suplementação mineral e suplementação completa (mineral, protéica, energética e vitamínica sobre as características de carcaça de novilhos Nelore, terminados a pasto, na estaçãochuvosa. Durante 156 dias, divididos em cinco períodos, foram avaliados 60 novilhos, divididos em três lotes de 20animais, com média de 292,3kg (±19,2 e 27 meses (±2,6 deidade no início do experimento e peso final dos animais de411,5kg (±24,9 de peso vivo aos 32 meses (±2,6, em pastagem de Brachiaria bryzantha cv. Marandu. Foram utilizados três tratamentos: suplemento mineral, suplemento com-pleto e suplemento completo servido em duas porções, uma com os sais minerais e outra com os demais nutrientes. Não houve efeito dos tratamentos (P>0,05 sobre o rendimento de carcaça, área do lombo, espessura de gordura, redução do peso da carcaça no resfriamento e composição da carcaça em traseiro, dianteiro e ponta-de-agulha. PALAVRAS-CHAVE: Bovinos de corte, carcaça, nutrição, pastagem, suplementação.

Curvas de crescimento em vacas de corte de diferentes tipos biológicos

Directory of Open Access Journals (Sweden)

Fabiane de Lima Silva

2011-03-01

Full Text Available O objetivo deste trabalho foi selecionar o modelo de curvas de crescimento mais adequado e avaliar a influência de efeitos de ambiente e de grupo genético sobre os parâmetros estimados do modelo. Cinco modelos não lineares, Brody, Gompertz, Logístico, Von Bertalanffy e Richards, foram ajustados a dados de peso-idade coletados de 316 vacas, de quatro grupos genéticos: G (Nelore, ½Canchim + ½Nelore, ½Angus + ½Nelore e ½Simental + ½Nelore, do nascimento até 100 meses de idade; em duas estações do ano: E (primavera e outono. As vacas foram submetidas a dois níveis de concentrado (S durante quatro meses, pós-desmama. O ajuste dos modelos foi realizado por mínimos quadrados ordinários, usando os pesos ponderado e não ponderado pelo inverso da variância. Os modelos Brody e Von Bertalanffy convergiram para todos os grupos genéticos; porém, o Brody foi o mais adequado. As estimativas do peso assintótico (A e da taxa de maturação (k do modelo Brody ponderado pelo inverso da variância foram analisadas por modelo misto, que incluiu efeito médio global e efeitos principais de G, E e S, e suas interações. O parâmetro A foi influenciado pelo efeito de G e E, enquanto k foi influenciado por S, o que indica que melhorias no manejo alimentar resultam em menor variação na forma das curvas de crescimento e em altas taxas de maturação.

in silico identification of cross affinity towards Cry1Ac pesticidal protein with receptor enzyme in Bos taurus and sequence, structure analysis of crystal proteins for stability.

Science.gov (United States)

Ebenezer, King Solomon; Nachimuthu, Ramesh; Thiagarajan, Prabha; Velu, Rajesh Kannan

2013-01-01

Any novel protein introduced into the GM crops need to be evaluated for cross affinity on living organisms. Many researchers are currently focusing on the impact of Bacillus thuringiensis cotton on soil and microbial diversity by field experiments. In spite of this, in silico approach might be helpful to elucidate the impact of cry genes. The crystal a protein which was produced by Bt at the time of sporulation has been used as a biological pesticide to target the insectivorous pests like Cry1Ac for Helicoverpa armigera and Cry2Ab for Spodoptera sp. and Heliothis sp. Here, we present the comprehensive in silico analysis of Cry1Ac and Cry2Ab proteins with available in silico tools, databases and docking servers. Molecular docking of Cry1Ac with procarboxypeptidase from Helicoverpa armigera and Cry1Ac with Leucine aminopeptidase from Bos taurus has showed the 125(th) amino acid position to be the preference site of Cry1Ac protein. The structures were compared with each other and it showed 5% of similarity. The cross affinity of this toxin that have confirmed the earlier reports of ill effects of Bt cotton consumed by cattle.

Avaliação ultrassonográfica da involução das estruturas umbilicais extra e intracavitárias em bezerros sadios da raça Nelore concebidos naturalmente e produtos de fertilização in vitro

Directory of Open Access Journals (Sweden)

Tiago Torrecillas Sturion

2013-08-01

Full Text Available Esse trabalho foi desenvolvido com o objetivo de caracterizar a involução das estruturas umbilicais em bezerros sadios da raça Nelore ao longo dos primeiros 35 dias de vida, e de comparar esse processo em bezerros concebidos por métodos naturais ou por fertilização in vitro (FIV. Quarenta bezerros foram distribuídos em dois grupos (n=20 de acordo com o método de concepção (natural ou FIV e cada grupo foi composto por dez machos e dez fêmeas. A ultrassonografia (transdutor microconvexo de 7,5 MHz foi empregada para examinar o conjunto das estruturas remanescentes do cordão umbilical que compõem o umbigo externo e as estruturas abdominais (veia umbilical, artéria umbilical esquerda e ducto alantóide, mensurando-se os seus diâmetros em locais definidos. Os exames foram realizados entre 24 e 36 horas de vida e aos 7, 14, 21, 28 e 35 dias de idade. Testaram-se os efeitos do sexo, da idade e do método de concepção por meio da análise de variâncias de medidas repetidas. O exame ultrassonográfico provou-se adequado para a avaliação das estruturas umbilicais extra e intracavitárias permitindo a caracterização do processo fisiológico de involução das mesmas. No umbigo externo, as veias umbilicais foram observadas como imagem individualizada até os 14 dias de vida e um conjunto de estruturas em processo de atrofia era visualizado após essa idade. No abdômen, a veia e a artéria umbilicais foram visualizadas até os 35 dias de idade e o ducto alantóide somente durante a primeira semana de vida. Essas estruturas apresentaram-se com parede hiperecóica regular e contínua e lúmen homogeneamente anecóico. O diâmetro de todas as estruturas umbilicais estudadas se reduziu continuamente ao longo do primeiro mês de vida (p0,05. Comparados aos bezerros concebidos por métodos naturais, os produtos de FIV nasceram com os vasos umbilicais e o ducto alantóide um pouco mais calibrosos (diâmetros 1 a 3 mm maiores. Distintamente

Efecto de la manipulación del semen criopreservado de bovinos Bos Taurus sobre la integridad espermática

Directory of Open Access Journals (Sweden)

Norberto Villa-Duque

2016-01-01

Full Text Available En el estudio se evaluó el efecto de descongelar y aplicar semen de bovinos Bos Taurus en 33 ganaderías del Magdalena Medio colombiano, y se estudió in vitro el efecto de la injuria encontrada sobre la integridad de las membranas espermáticas. La información en fincas se recopiló mediante formulario específico, mientras que el estudio in vitro se ejecutó en el laboratorio de Biotecnología Reproductiva Animal del Instituto Universitario de la Paz (Barrancabermeja, Santander. El estudio consistió en someter pajillas comerciales de 0.5 ml de toros Holstein y Pardo Suizo a la técnica convencional y a tres modificaciones de esta (injurias mediante un diseño randomizado. Ninguna de las fincas evaluadas aplicó correctamente la práctica de la inseminación artificial; errores notorios fueron: exceso de tiempo durante la extracción de la pajilla, descongelación en la región axilar y no combinación correcta entre tiempo y temperatura. Los resultados evidenciaron diferencia significativa (P<0.05 por efecto de la raza para la integridad y resistencia de las membranas espermáticas, para la integridad de las membranas por efecto de los tratamientos cuando la pajilla se descongelo a temperatura corporal en la región axilar y para la integridad de la membrana acrosomal cuando la extracción de la pajilla se realizó en forma incorrecta. El semen de la raza Holstein evidencia una ligera tendencia a ser más resistente que el de la raza Pardo Suizo.

Burnout syndrome in critical care team members: A monocentric cross sectional survey.

Science.gov (United States)

Malaquin, Stéphanie; Mahjoub, Yazine; Musi, Arianna; Zogheib, Elie; Salomon, Alexis; Guilbart, Mathieu; Dupont, Hervé

2017-08-01

There has been a growing interest in evaluating the occurrence of burnout syndrome (BOS) among intensive care units (ICU) team over recent years. The aims of this study were to determine the prevalence of BOS among staff working in the Amiens University Hospital and to assess associated factors. Prospective observational study based on self-administered questionnaires filled in by physicians and non-physicians working in 3 ICUs. Demographic data, well-being assessment, work relationships, level of BOS and depressive symptoms were investigated. Logistic regression analysis was performed to identify variables independently associated with BOS. One hundred and sixty-one questionnaires were analysed. Participation rate was 90%. Thirty-two respondents were physicians and 129 were non-physicians. The prevalence of BOS was 51% and was not significantly different between physicians and non-physicians (56% versus 50%; P=0.501). Respondents who reported BOS less frequently had regular leisure activities (54 [66%] versus 70 [87%], P=0.001). In the BOS group, well-being was significantly lower (4.8±2.5/10 versus 6±2/10, P=0.001), a desire to leave the job was more frequently expressed (50 [61%] versus 32 [40%], P=0.009) and depressive symptoms were significantly more frequent (41 [50%] versus 21 [27%], P=0.002). Factors independently associated with BOS were regular leisure activities (OR 0.24 [0.1-0.59]; P=0.002), the presence of depressive symptoms (OR 2.71 [1.26-5.84]; P=0.011) and a well-being visual analogue scale≥5 (OR 0.40 [0.18-0.89]; P=0.024). BOS affects all ICU workers and is determined by multiple factors. Leisure activities and measures designed to improve well-being should be promoted. Copyright © 2016 Société française d'anesthésie et de réanimation (Sfar). Published by Elsevier Masson SAS. All rights reserved.

Desempenho produtivo de bovinos Nelore de diferentes classes sexuais alimentados com dietas contendo dois níveis de oferta de concentrado Productive performance of Nellore cattle of different gender fed diets containing two levels of concentrate allowance

Directory of Open Access Journals (Sweden)

Pedro Veiga Rodrigues Paulino

2008-06-01

Full Text Available Objetivou-se avaliar os efeitos de classe sexual e nível de oferta de concentrado sobre o desempenho, o consumo e a digestibilidade dos nutrientes em bovinos Nelore. Trinta e cinco animais, 12 machos inteiros, 11 machos castrados e 12 fêmeas, provenientes de um mesmo grupo contemporâneo, foram distribuídos aleatoriamente a dois tratamentos, correspondentes aos níveis de oferta de concentrado, 0,6 e 1,2% do peso corporal, respectivamente. Os animais foram alimentados individualmente durante 112 dias, sendo abatidos ao final do experimento, com um grupo referência abatido ao início. Os machos inteiros foram mais eficientes, pois apresentaram maior peso final e de corpo vazio, como resultado da maior taxa de crescimento em relação às fêmeas, ficando os machos castrados em posição intermediária. Os consumos relativos de matéria seca e de todos os demais nutrientes foram superiores nas fêmeas em relação aos machos inteiros, de modo que os castrados apresentaram valores intermediários. As digestibilidades, à exceção do extrato etéreo, não foram afetadas pela classe sexual. As digestibilidades da matéria seca e matéria orgânica foram superiores para a dieta com nível de oferta de concentrado de 1,2% do PV. Classe sexual afetou o crescimento e a capacidade de consumo dos animais, porém não teve efeito sobre a digestibilidade dos nutrientes da dieta. Níveis de oferta de concentrado de 0,6 e 1,2% do PV não foram suficientes para promover diferenças no desempenho de bovinos Nelore, independentemente de classe sexual.The objective of this work was to evaluate the effects of sex class and concentrate allowance level on performance and digestibility of the nutrients in Nellore cattle. Thirty five animals were used, 12 young bulls, 11 steers and 12 heifers, from the same contemporary group, were randomly allotted into two treatments: concentrate allowance levels of 0.6 and 1.2% BW, respectively. The animals were individually

Patologia de neonatos bovinos originados por meio da técnica de transferência nuclear de células somáticas: clonagem

Directory of Open Access Journals (Sweden)

Caio Rodrigues dos Santos

2010-12-01

Full Text Available Os mecanismos de morte em animais clonados a partir de células somáticas são poucos elucidados. Malformações de órgãos, alterações de tamanho e peso desses animais foram anomalias já descritas, porém em casos isolados. Desse modo, estudos nos níveis anatomo e histopatológicos são de suma importância para ajudar a compreensão dos fatores responsáveis pelos altos índices de insucessos com a utilização da TNCS (transferência nuclear de células somáticas. Assim, o presente trabalho foi realizado com o objetivo de descrever, por meio de exames anatomopatológicos, as alterações presentes em um grupo de animais gerados por TNCS, que vieram a óbito entre 1 e 19 dias de vida. Esse experimento foi realizado entre os anos de 2004 e 2008 na fazenda Tambaú, cidade de Tambaú, Estado de São Paulo. No total foram gerados 21 animais da raça Nelore (Bos indicus, sendo que 11 vieram a óbito e dez apresentaram boa evolução clínica no período perinatal. Foram realizadas as necropsias dos animais e posterior análise histopatológica de tecidos alterados. Esse estudo mostrou alta prevalência de alterações cardiopulmonares, que provavelmente foram determinantes nos mecanismos de morte dos animais. Dentre essas alterações a hipertensão pulmonar e modificações hemodinâmicas diagnosticadas através do exame histopatológico foram as mais frequentes.

Estimativas de correlações genéticas entre escores visuais e características de carcaça medidas por ultrassonografia em bovinos Nelore utilizando modelos bayesianos linear-limiar Genetic correlation estimates between visual scores and carcass traits measured by ultrasound in Nelore cattle using linear-threshold bayesian models

Directory of Open Access Journals (Sweden)

Carina Ubirajara de Faria

2009-11-01

Full Text Available O objetivo neste estudo foi estimar as correlações genéticas entre escores visuais e características de carcaça medidas por ultrassonografia em bovinos da raça Nelore utilizando a estatística bayesiana por meio da Amostragem de Gibbs, sob modelo animal linear-limiar. Foram estudadas as características categóricas morfológicas de musculosidade, estrutura física, conformação e sacro, avaliadas aos 15 e 22 meses de idade. Para as características de carcaça, foram avaliadas as características área de olho-de-lombo, espessura de gordura subcutânea, espessura de gordura subcutânea na garupa e altura na garupa. Os escores visuais devem ser empregados como critérios de seleção para aumentar o progresso genético para a característica área de olhode-lombo e, consequentemente, melhorar o rendimento de carcaça. As estimativas de correlação genética obtidas para musculosidade com espessura de gordura subcutânea e espessura de gordura subcutânea na garupa indicaram que a seleção para musculosidade pode levar a animais com melhor acabamento de carcaça. A seleção para a estrutura física e conformação aos 15 e 22 meses de idade pode promover resposta correlacionada para o aumento da altura na garupa.The objective of this study was to estimate the genetic correlations between visual scores and the carcass traits measured by ultrasound, in Nellore breed cattle, using the bayesian statistics by Gibbs Sampling, in the linear-threshold model. The morphological categorical traits of musculature, physical structure, conformation and sacrum were studied, evaluated at 15 and 22 months. The carcass traits of the longissimus muscle area, backfat thickness, rump fat thickness and hip height were evaluated. Visual scores should be used as selection criterion to increase genetic progress for the longissumus muscle area. The estimates of genetic correlations obtained between musculature and backfat thickness and rump fat thickness

DIVERSIDAD GENÉTICA ENTRE SUBPOBLACIONES RACIALES BOVINAS DE COSTA RICA

Directory of Open Access Journals (Sweden)

Marco Martínez

2015-01-01

Full Text Available El objetivo del estudio fue cuantificar la diversidad genética entre 16 subpoblaciones raciales bovinas de Costa Rica, con base en 1412 muestras de ADN bovino de todo el país, evaluadas mediante 18 marcadores microsatélites. El número promedio de alelos (Na por locus dentro de raza fue de 10,3, que varían entre 8 (Holstein×Jersey y 13 (Criolla para doble propósito. El número promedio de alelos efectivo (Ne fue de 5,04, con cambios entre 4,18 (Jersey y 5,64 (Bos taurus×Bos indicus. La heterocigosidad observada promedio fue de 0,77, variando entre 0,73 (Jersey y 0,81 (Bos taurus×Bos indicus. La heterocigosidad esperada (He promedio fue de 0,78, que oscilan entre 0,74 (Jersey y Holstein×Jersey y 0,81 (Bos taurus×Bos indicus, Criolla para doble propósito y Cruces para doble propósito. El contenido de información polimórfica (PIC fue de 0,76, con variaciones entre 0,71 (Jersey y Holstein×Jersey y 0,79 (Criollas para doble propósito y Cruces para doble propósito. El FIS promedio fue de 0,02, con oscilaciones entre -0,03 (Holstein×Jersey a 0,04 (Brahman, Criolla para carne y Cruces para leche. La desviación del equilibrio Hardy Weinberg no fue significativa (p>0,05 en la mayoría de los loci para las subpoblaciones raciales. El subgrupo con mayor número de loci en desequilibrio fue Jersey (8 loci, mientras que los subgrupos Bos taurus×Bos indicus, Criolla para leche y Holstein×Jersey presentaron solo 1 locus en desequilibrio. Los índices de fijación FIS (0,02, FIT (0,05 y FST (0,03 indicaron cierta tendencia hacia la homocigosidad. Los dendrogramas mostraron 3 agrupaciones raciales claramente diferenciadas que coinciden con las razas de origen Bos taurus, Bos indicus y sus respectivos cruces. Los resultados del análisis indicaron que el número de microsatélites empleados sí permitió establecer una discriminación clara a nivel de las frecuencias alélicas y en la distribución del tamaño de los alelos entre las

QUALIDADE E PERFIL SENSORIAL DESCRITIVO DA CARNE MATURADA PROVENIENTE DE ANIMAIS CRUZADOS

OpenAIRE

Nassu, Renata Tieko; Verruma-Bernardi, Marta Regina; Tullio, Rymer Ramiz; Cruz, Geraldo Maria da; Alencar, Maurício Mello de

2014-01-01

A maturação é uma alternativa para obtenção de carne de melhor qualidade, além de diminuir a variabilidade da maciez da carne proveniente de animais do mesmo grupo genético. Neste estudo, carnes provenientes de animais cruzados ½ Angus + ½ Nelore (AN) e ½ Senepol + ½ Nelore (SN) foram maturadas até 28 dias e analisadas em relação a parâmetros físico-químicos e sensoriais. Para todos os parâmetros a interação tempo de maturação x grupo genético não foi significativa, com exceção do atributo te...

Diferenças genéticas e estimação de coeficientes de herdabilidade para características morfológicas em fêmeas zebus e F1 holandês x zebu

OpenAIRE

Mourão,Gerson Barreto; Bergmann,José Aurélio Garcia; Madalena,Fernando Enrique; Ferreira,Marcos Brandão Dias

1999-01-01

O objetivo deste trabalho foi averiguar possíveis variações nas mensurações morfológicas entre reprodutrizes zebus dos grupos genéticos (GG) Indubrasil, Nelore e Tabapuã e entre os GG de suas filhas F1 Holandês x Indubrasil (HxI), Holandês x Nelore (HxN) e Holandês x Tabapuã (HxT), além de estimar coeficientes de herdabilidade (h²) para estas características. O método dos quadrados mínimos foi usado para verificação das diferenças nas características morfológicas entre os GG e para obtenção d...

Simulação dos efeitos dos preços de produtos e insumos na avaliação econômica de três sistemas alternativos de bovinocultura de cria

OpenAIRE

Guimarães,P.H.S.; Madalena,F.E.; Cezar,I.M.

2005-01-01

Avaliou-se a sensibilidade de indicadores econômicos de três sistemas alternativos de produção de bovinos à variação de preços de insumos e produtos. Observou-se que o sistema de produção de bezerros F1 Holandês × Gir apresentou maior eficiência econômica que os sistemas de produção de bezerros Nelore e de produção de bezerros F1 Angus × Nelore, principalmente devido ao maior valor agregado de seu principal produto (novilha F1). O preço do sêmen não teve importância econômica sign...

Simulação dos efeitos dos preços de produtos e insumos na avaliação econômica de três sistemas alternativos de bovinocultura de cria Simulated effects of input and output prices on economic returns from three calf production systems

OpenAIRE

P.H.S. Guimarães; F.E. Madalena; I.M. Cezar

2005-01-01

Avaliou-se a sensibilidade de indicadores econômicos de três sistemas alternativos de produção de bovinos à variação de preços de insumos e produtos. Observou-se que o sistema de produção de bezerros F1 Holandês × Gir apresentou maior eficiência econômica que os sistemas de produção de bezerros Nelore e de produção de bezerros F1 Angus × Nelore, principalmente devido ao maior valor agregado de seu principal produto (novilha F1). O preço do sêmen não teve importância econômica sign...

Biochemical polymorphism in Egyptian Baladi cattle and their relationship with other breeds.

Science.gov (United States)

Graml, R; Ohmayer, G; Pirchner, F; Erhard, L; Buchberger, J; Mostageer, A

1986-01-01

Gene frequencies were estimated in a sample of Baladi cattle for milk proteins, blood proteins and blood groups. Gene frequency estimates of Bos taurus, Bos indicus and Sanga breeds were assembled from the literature. The gene frequencies were utilized for estimating the genetic distance between the breeds and breed groups. The Egyptian Baladi cattle appeared to be closer to Bos taurus breeds than to the Sanga. They are far removed from Zebus.

Comparison of 37 months global net radiation flux derived from PICARD-BOS over the same period observations of CERES and ARGO

Science.gov (United States)

Zhu, Ping; Wild, Martin

2016-04-01

The absolute level of the global net radiation flux (NRF) is fixed at the level of [0.5-1.0] Wm-2 based on the ocean heat content measurements [1]. The space derived global NRF is at the same order of magnitude than the ocean [2]. Considering the atmosphere has a negligible effects on the global NRF determination, the surface global NRF is consistent with the values determined from space [3]. Instead of studying the absolute level of the global NRF, we focus on the interannual variation of global net radiation flux, which were derived from the PICARD-BOS experiment and its comparison with values over the same period but obtained from the NASA-CERES system and inferred from the ocean heat content survey by ARGO network. [1] Allan, Richard P., Chunlei Liu, Norman G. Loeb, Matthew D. Palmer, Malcolm Roberts, Doug Smith, and Pier-Luigi Vidale (2014), Changes in global net radiative imbalance 1985-2012, Geophysical Research Letters, 41 (no.15), 5588-5597. [2] Loeb, Norman G., John M. Lyman, Gregory C. Johnson, Richard P. Allan, David R. Doelling, Takmeng Wong, Brian J. Soden, and Graeme L. Stephens (2012), Observed changes in top-of-the-atmosphere radiation and upper-ocean heating consistent within uncertainty, Nature Geoscience, 5 (no.2), 110-113. [3] Wild, Martin, Doris Folini, Maria Z. Hakuba, Christoph Schar, Sonia I. Seneviratne, Seiji Kato, David Rutan, Christof Ammann, Eric F. Wood, and Gert Konig-Langlo (2015), the energy balance over land and oceans: an assessment based on direct observations and CMIP5 climate models, Climate Dynamics, 44 (no.11-12), 3393-3429.

ORF Alignment: NT_033779 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available rEMBL::g2674107:GUANINE NUCLEOTIDE-EXCHANGE ... PROTEIN. organism:BOS TAURUS (BOVINE). dbxref:GenBank...; ... AF023451; g2674107; -.'', species:''BOS TAURUS ... Length = 185 ... Query: 586 METGIELFNRKP

Body composition and net and dietary macrominerals requirements of Nellore steers under grazing Composição corporal e exigências líquidas e dietéticas de macrominerais de bovinos Nelore castrados em pastejo

Directory of Open Access Journals (Sweden)

Vitor Visintin Silva de Almeida

2009-06-01

Full Text Available This experiment was carried out with the objective of determining the macrominerals (Ca, P, Mg, K and Na requirements of Nellore steers under grazing. Twenty four Nellore steers (371 ± 14 kg of BW and 26 mo old were used. Four steers were slaughtered at the beginning of the experiment (reference group, serving as a reference in subsequent study. The remaining 20 animals were weighed and distributed into a completely randomized design with four supplementation levels offer: 0.0 (mineral mixture - control, 0.3, 0.6 and 0.9% of BW, with five replications. The supplements, based on ground corn, soybean meal and/or urea, were previously balanced to achieve an average daily gain of 350, 650 and 850g, respectively, for the different supplementation levels offer. The contents of macrominerals retained in the animal body were determined by regression equations of the macrominerals body content logarithm in function of the empty body weight logarithm (EBW. Net macrominerals requirements for a gain of 1kg of EBW were obtained using the equation Y'= b.10ª.Xb-1, with a and b, respectively, the intercept and the regression coefficient of the prediction equations of macrominerals in the animal body contents for each macromineral considered. The concentrations of all macrominerals, in the empty body weight and gain of the empty body weight, decreased with the increase in the body weight. Total calcium and phosphorus dietary requirements are higher than those recommended in the literature.Com o objetivo de determinar as exigências de macrominerais (Ca, P, Mg, K e Na de bovinos Nelore castrados sob pastejo, foi conduzido um experimento com 24 novilhos da raça Nelore, castrados, com peso inicial de 371 ± 14 kg e 26 meses de idade. Quatro novilhos foram abatidos no início do experimento (grupo referência para servir de referência nos estudos subsequentes. Os animais restantes (20 foram pesados e distribuídos em delineamento inteiramente casualizado com

An international ISHLT/ATS/ERS clinical practice guideline:

DEFF Research Database (Denmark)

Meyer, Keith C; Raghu, Ganesh; Verleden, Geert M

2014-01-01

Bronchiolitis obliterans syndrome (BOS) is a major complication of lung transplantation that is associated with poor survival. The International Society for Heart and Lung Transplantation, American Thoracic Society, and European Respiratory Society convened a committee of international experts...... to March, 2013. The expert committee discussed the available research evidence upon which the updated definition of BOS, identified risk factors and recommendations are based. The committee followed the GRADE (Grading of Recommendation, Assessment, Development and Evaluation) approach to develop specific......, and several risk factors have been identified that have a significant association with the onset of BOS. Currently available therapies have not been proven to result in significant benefit in the prevention or treatment of BOS. Adequately designed and executed randomised controlled trials that properly...

Produtividade acumulada como critério de seleção em fêmeas da raça nelore Accumulated productivity as selection criteria in nellore breed females

Directory of Open Access Journals (Sweden)

Eduardo Brum Schwengber

2001-06-01

Full Text Available O presente trabalho teve por objetivo determinar os componentes de variância e estimar a herdabilidade da produtividade acumulada (PAC de 15.070 fêmeas, criadas em diferentes rebanhos participantes do Programa de Melhoramento Genético da Raça Nelore. A PAC é um índice que considera a produção total de bezerros desmamados em kg, o tempo total de produção de bezerros e o início de parição. As análises estatísticas foram realizadas por meio do programa SAS (Statistical Analysis System e os componentes de variância pelo método de máxima verossimilhança restrita utilizando o software MTDFREML. A média da PAC foi de 130kg de bezerros desmamados por vaca ao ano, e os efeitos do pai da vaca, rebanho e ano de nascimento da vaca foram significativos (PThis work had for objective to determine the variance components and to estimate the heritability of the accumulated productivity (ACP of 15,070 females, reared in different participant herds of the Nellore Breeding Program. ACP is an index that considers the total production of calves weaned in kg, the total time of production of calves and the calving beginning. The statistical analyses were accomplished through the SAS program (Statistical Analysis System and the variance components for the restricted maximum likelihood method using the software MTDFREML. The average of ACP was of 130kg of calves weaned by cow to the year, and the sire of cow effects, herd and year of the birth cow significatly (P<0.0001 affected in the variation of this characteristic. The coefficient of heritability of ACP was estimated in 0.15, indicating the existence of enough genetic variability for its inclusion in the improvement programs, what would result in the obtaining of more productive females in the herds.

Vitamin D level and peculiarities of IFN-γ and IL-4 production in young children with recurrent broncho-obstructive syndrome

Directory of Open Access Journals (Sweden)

Yu.K. Bolbot

2018-02-01

Full Text Available Background. Broncho-obstructive syndrome (BOS, particularly, its recurrent course in young children, is an important question of modern pediatrics. The burdened allergic history, manifestations of atopy are traditionally considered as risk factors for recurrent episodes of BOS, which, however, are not present in all cases. Recently, the possible role of vitamin D (VD in susceptibility to recurrent episodes of BOS is discussed due to its anti-infective effect that is provided by activating immune mechanisms. Thus, purpose of the research was to study VD level and peculiarities of interferon gamma (INF-g and interleukin (IL 4 production in the blood serum of young children with recurrent episodes of BOS. Materials and methods. 120 children aged 6 months to 3 years with a clinical diagnosis of acute obstructive bronchitis (J20 were examined, they were divided into two groups (group I — 60 patients with episodic BOS, group II — 60 children with recurrent BOS. The control group consisted of 30 clinically healthy children from 6 months to 3 years old. All patients were evaluated for anamnestic data, including the level of insolation, the severity of BOS according to a 12-point scoring scale, general clinical examination, pulse oximetry, and the asthma predictive index (API was calculated. Laboratory studies included determination of 25-hydroxyvitamin-D (25(OHD concentration in the blood serum on days 2 and 3 of the disease using an electrochemiluminescence method on the Cobas e411 analyzer (serial number 1041-24, manufactured by Roche Diagnostics GmbH, Germany, serum concentrations of IFN-g, IL-4 by enzyme-linked immunosorbent assay method using IFA-Best sets (manufactured by Vector-Best, Russian Federation and total calcium (Ca according to the generally accepted method. Nonparametric statistical criteria were used in the analysis of the obtained data. The difference between the compared indicators was considered to be significant at a rate of p

Bronchiolitis obliterans syndrome after allogeneic hematopoietic SCT: phenotypes and prognosis.

Science.gov (United States)

Bergeron, A; Godet, C; Chevret, S; Lorillon, G; Peffault de Latour, R; de Revel, T; Robin, M; Ribaud, P; Socié, G; Tazi, A

2013-06-01

Bronchiolitis obliterans syndrome (BOS) after allogeneic hematopoietic SCT (HSCT) is recognized as a new-onset obstructive lung defect (OLD) in pulmonary function testing and is related to pulmonary chronic GVHD. Little is known about the different phenotypes of patients with BOS and their outcomes. We reviewed the data of all allogeneic HSCT recipients referred to our pulmonary department for a non-infectious bronchial disease between 1999 and 2010. We identified 103 patients (BOS (n=77), asthma (n=11) and chronic bronchitis (n=15)). In patients with BOS, we identified two functional phenotypes: a typical OLD, that is, forced expiratory volume in 1 s (FEV1)/forced vital capacity (FVC) ratio <0.7 (n=53), and an atypical OLD with a concomitant decrease in the FEV1 <80% and FVC <80% predicted with a normal total lung capacity (n=24). The typical OLD was characterized by more severe FEV1 and fewer centrilobular nodules on the computed tomography scan. The FEV1 was not significantly affected during the follow-up, regardless of the phenotype. In addition to acute and extensive chronic GVHD, only the occurrence of BOS soon after transplantation and the intentional treatment of BOS with steroids were associated with a poor survival. The determination of patient subgroups should be explored to improve the management of this condition.

Low-dose computed tomography volumetry for subtyping chronic lung allograft dysfunction.

Science.gov (United States)

Saito, Tomohito; Horie, Miho; Sato, Masaaki; Nakajima, Daisuke; Shoushtarizadeh, Hassan; Binnie, Matthew; Azad, Sassan; Hwang, David M; Machuca, Tiago N; Waddell, Thomas K; Singer, Lianne G; Cypel, Marcelo; Liu, Mingyao; Paul, Narinder S; Keshavjee, Shaf

2016-01-01

The long-term success of lung transplantation is challenged by the development of chronic lung allograft dysfunction (CLAD) and its distinct subtypes of bronchiolitis obliterans syndrome (BOS) and restrictive allograft syndrome (RAS). However, the current diagnostic criteria for CLAD subtypes rely on total lung capacity (TLC), which is not always measured during routine post-transplant assessment. Our aim was to investigate the utility of low-dose 3-dimensional computed tomography (CT) lung volumetry for differentiating RAS from BOS. This study was a retrospective evaluation of 63 patients who had developed CLAD after bilateral lung or heart‒lung transplantation between 2006 and 2011, including 44 BOS and 19 RAS cases. Median post-transplant follow-up was 65 months in BOS and 27 months in RAS. The median interval between baseline and the disease-onset time-point for CT volumetry was 11 months in both BOS and RAS. Chronologic changes and diagnostic accuracy of CT lung volume (measured as percent of baseline) were investigated. RAS showed a significant decrease in CT lung volume at disease onset compared with baseline (mean 3,916 ml vs 3,055 ml when excluding opacities, p volumetry is a useful tool to differentiate patients who develop RAS from those who develop BOS. Copyright © 2016 International Society for Heart and Lung Transplantation. Published by Elsevier Inc. All rights reserved.

Interaction between Pseudomonas and CXC Chemokines Increases Risk of Bronchiolitis Obliterans Syndrome and Death in Lung Transplantation

Science.gov (United States)

Wang, Xiaoyan; Weigt, S. Sam; Palchevskiy, Vyacheslav; Lynch, Joseph P.; Ross, David J.; Kubak, Bernard M.; Saggar, Rajan; Fishbein, Michael C.; Ardehali, Abbas; Li, Gang; Elashoff, Robert; Belperio, John A.

2013-01-01

Rationale: Pseudomonas aeruginosa is the most commonly isolated gram-negative bacterium after lung transplantation and has been shown to up-regulate glutamic acid–leucine–arginine–positive (ELR+) CXC chemokines associated with bronchiolitis obliterans syndrome (BOS), but the effect of pseudomonas on BOS and death has not been well defined. Objectives: To determine if the influence of pseudomonas isolation and ELR+ CXC chemokines on the subsequent development of BOS and the occurrence of death is time dependent. Methods: A three-state model was developed to assess the likelihood of transitioning from lung transplant (state 1) to BOS (state 2), from transplant (state 1) to death (state 3), and from BOS (state 2) to death (state 3). This Cox semi-Markovian approach determines state survival rates and cause-specific hazards for movement from one state to another. Measurements and Main Results: The likelihood of transition from transplant to BOS was increased by acute rejection, CXCL5, and the interaction between pseudomonas and CXCL1. The pseudomonas effect in this transition was due to infection rather than colonization. Movement from transplant to death was facilitated by pseudomonas infection and single lung transplant. Transition from BOS to death was affected by the length of time in state 1 and by the interactions between any pseudomonas isolation and CXCL5 and aspergillus, either independently or in combination. Conclusions: Our model demonstrates that common post-transplantation events drive movement from one post-transplantation state to another and influence outcomes differently depending upon when after transplantation they occur. Pseudomonas and the ELR+ CXC chemokines may interact to negatively influence lung transplant outcomes. PMID:23328531

Influência do grupo genético, condição sexual e tratamento antiparasitário nas medidas de área de olho do lombo e espessura de gordura in vivo e na carcaça de bovinos de corte Influence of breed, gender condition, and anti-parasitic treatment on the measurements of in vivo rib eye area and fat thickness and on the carcass of beef cattle

Directory of Open Access Journals (Sweden)

R.M.K. Pinheiro

2009-06-01

Full Text Available Foram estudados 48 bovinos machos oriundos de inseminação artificial, criados em pasto, sendo 24 (12 Nelore e 12 F1 ½ Red Angus-Nelore tratados com antiparasitários alopáticos e 24 (mesmo número de puros e cruzados tratados com o antiparasitário bioterápico Fator C&MC. Os animais foram desmamados aos oito meses, metade de cada subgrupo genético (6 foi castrado aos 13 meses e todos abatidos aos 32 meses, com o objetivo de verificar a influência do tratamento antiparasitário, do grupo genético e da condição sexual sobre as medidas de área de olho de lombo (AOL e espessura de gordura de lombo (EGL. Usaram-se medidas de ultrassonografia no animal vivo (AOLU e EGLU e na carcaça, plástico quadriculado e paquímetro (AOLC e EGLC. Os animais F1, os inteiros e os tratados com alopatia apresentaram peso vivo maior quando comparados aos Nelores, castrados e tratados com bioterápicos. Não houve diferença da AOLU e AOLC entre os grupos genéticos. EGLC foi mais alta nos cruzados. Os animais inteiros apresentaram AOLU e AOLC maiores que os castrados, e EGLU e EGLC menores. Foram altamente significativos os coeficientes de correlação entre as medidas por ultrassom e na carcaça para área de olho de lombo (0,87 e espessura de gordura do lombo (0,95.Forty-eight male bovines, products of artificial insemination and raised on pasture, were studied, being 24 (12 Nelore, 12 F1 ½ Nelore ½ Red Angus treated with allopathic antiparasitic drugs and 24 (same number of pure and crossbred treated with a biotherapic antiparasitic drug Factor C&MC. Animals were weaned at eight months of age and half of each genetic subgroup (six was castrated at 13 months of age. All animals were slaughtered at 32 months of age, in an attempt to evaluate the influence of antiparasitic treatment, genetic group, and gender condition in the measurements of rib eye area (AOL and fat thickness (EGL of loin. Measurements of ultrasonography were used for live animals (AOLU

A shift in the collagen V antigenic epitope leads to T helper phenotype switch and immune response to self-antigen leading to chronic lung allograft rejection.

Science.gov (United States)

Tiriveedhi, V; Angaswamy, N; Brand, D; Weber, J; Gelman, A G; Hachem, R; Trulock, E P; Meyers, B; Patterson, G; Mohanakumar, T

2012-01-01

Immune responses to human leucocyte antigen (HLA) and self-antigen collagen V (Col-V) have been proposed in the pathogenesis of chronic rejection (bronchiolitis obliterans syndrome, BOS) following human lung transplantation (LTx). In this study, we defined the role for the shift in immunodominant epitopes of Col-V in inducing T helper phenotype switch leading to immunity to Col-V and BOS. Sera and lavage from BOS(+) LTx recipients with antibodies to Col-V were analysed. Two years prior to BOS, patients developed antibodies to both Col-V,α1(V) and α2(V) chains. However, at clinical diagnosis of BOS, antibodies became restricted to α1(V). Further, lung biopsy from BOS(+) patients bound to antibodies to α1(V), indicating that these epitopes are exposed. Fourteen Col-V peptides [pep1-14, pep1-4 specific to α1(V), pep5-8 to α1,2(V) and pep9-14 to α2(V)] which bind to HLA-DR4 and -DR7, demonstrated that prior to BOS, pep 6, 7, 9, 11 and 14 were immunodominant and induced interleukin (IL)-10. However, at BOS, the response switched to pep1, 4 and 5 and induced interferon (IFN)-γ and IL-17 responses, but not IL-10. The T helper (Th) phenotype switch is accompanied by decreased frequency of regulatory T cells (T(regs) ) in the lavage. LTx recipients with antibodies to α1(V) also demonstrated increased matrix metalloproteinase (MMP) activation with decreased MMP inhibitor, tissue inhibitor of metalloproteinase (TIMP), suggesting that MMP activation may play a role in the exposure of new Col-V antigenic epitopes. We conclude that a shift in immunodominance of self-antigenic determinants of Col-V results in induction of IFN-γ and IL-17 with loss of tolerance leading to autoimmunity to Col-V, which leads to chronic lung allograft rejection. © 2011 The Authors. Clinical and Experimental Immunology © 2011 British Society for Immunology.

Bos frontalis

Indian Academy of Sciences (India)

SAMEEULLAH MEMON

2018-02-28

Feb 28, 2018 ... In rat, mouse, rabbit and pig, there was a single gene of the DQ genes, whereas in ... 1997). Hence, the polymorphisms as well as the duplication of DQ gene ... constructed using the commercial RevertAid First Strand. cDNA synthesis kit .... icance of maintaining their molecular conformation and function to ...

Functional and structural comparison of pyrrolnitrin- and iprodione-induced modifications in the class III histidine-kinase Bos1 of Botrytis cinerea.

Directory of Open Access Journals (Sweden)

Sabine Fillinger

Full Text Available Dicarboximides and phenylpyrroles are commonly used fungicides against plant pathogenic ascomycetes. Although their effect on fungal osmosensing systems has been shown in many studies, their modes-of-action still remain unclear. Laboratory- or field-mutants of fungi resistant to either or both fungicide categories generally harbour point mutations in the sensor histidine kinase of the osmotic signal transduction cascade.In the present study we compared the mechanisms of resistance to the dicarboximide iprodione and to pyrrolnitrin, a structural analogue of phenylpyrrole fungicides, in Botrytis cinerea. Pyrrolnitrin-induced mutants and iprodione-induced mutants of B. cinerea were produced in vitro. For the pyrrolnitrin-induced mutants, a high level of resistance to pyrrolnitrin was associated with a high level of resistance to iprodione. For the iprodione-induced mutants, the high level of resistance to iprodione generated variable levels of resistance to pyrrolnitrin and phenylpyrroles. All selected mutants showed hypersensitivity to high osmolarity and regardless of their resistance levels to phenylpyrroles, they showed strongly reduced fitness parameters (sporulation, mycelial growth, aggressiveness on plants compared to the parental phenotypes. Most of the mutants presented modifications in the osmosensing class III histidine kinase affecting the HAMP domains. Site directed mutagenesis of the bos1 gene was applied to validate eight of the identified mutations. Structure modelling of the HAMP domains revealed that the replacements of hydrophobic residues within the HAMP domains generally affected their helical structure, probably abolishing signal transduction. Comparing mutant phenotypes to the HAMP structures, our study suggests that mutations perturbing helical structures of HAMP2-4 abolish signal-transduction leading to loss-of-function phenotype. The mutation of residues E529, M427, and T581, without consequences on HAMP structure

Breeding programs for the main economically important traits of zebu dairy cattle

OpenAIRE

Ariosto Ardila Silva

2010-01-01

In tropical regions, Gyr and Guzerat breeds (Bos indicus) are most explored for dairy industry and are much more adapted to climate. Gyr and Guzerat are Zebu breeds very common in Brazil and they are being used to generate Bos taurus x Bos indicus crosses in order to combine good production, heat and parasite tolerance on the tropics. Breeding programs for the main economically important traits of Zebu dairy cattle have been recently introduced in Brazil and is based on the use of genetically...

Novel polymorphisms in UTR and coding region of inducible heat shock protein 70.1 gene in tropically adapted Indian zebu cattle (Bos indicus) and riverine buffalo (Bubalus bubalis).

Science.gov (United States)

Sodhi, M; Mukesh, M; Kishore, A; Mishra, B P; Kataria, R S; Joshi, B K

2013-09-25

Due to evolutionary divergence, cattle (taurine, and indicine) and buffalo are speculated to have different responses to heat stress condition. Variation in candidate genes associated with a heat-shock response may provide an insight into the dissimilarity and suggest targets for intervention. The present work was undertaken to characterize one of the inducible heat shock protein genes promoter and coding regions in diverse breeds of Indian zebu cattle and buffaloes. The genomic DNA from a panel of 117 unrelated animals representing 14 diversified native cattle breeds and 6 buffalo breeds were utilized to determine the complete sequence and gene diversity of HSP70.1 gene. The coding region of HSP70.1 gene in Indian zebu cattle, Bos taurus and buffalo was similar in length (1,926 bp) encoding a HSP70 protein of 641 amino acids with a calculated molecular weight (Mw) of 70.26 kDa. However buffalo had a longer 5' and 3' untranslated region (UTR) of 204 and 293 nucleotides respectively, in comparison to Indian zebu cattle and Bos taurus wherein length of 5' and 3'-UTR was 172 and 286 nucleotides, respectively. The increased length of buffalo HSP70.1 gene compared to indicine and taurine gene was due to two insertions each in 5' and 3'-UTR. Comparative sequence analysis of cattle (taurine and indicine) and buffalo HSP70.1 gene revealed a total of 54 gene variations (50 SNPs and 4 INDELs) among the three species in the HSP70.1 gene. The minor allele frequencies of these nucleotide variations varied from 0.03 to 0.5 with an average of 0.26. Among the 14 B. indicus cattle breeds studied, a total of 19 polymorphic sites were identified: 4 in the 5'-UTR and 15 in the coding region (of these 2 were non-synonymous). Analysis among buffalo breeds revealed 15 SNPs throughout the gene: 6 at the 5' flanking region and 9 in the coding region. In bubaline 5'-UTR, 2 additional putative transcription factor binding sites (Elk-1 and C-Re1) were identified, other than three common sites

Quantitative trait locus affecting birth weight on bovine chromosome 5 in a F2 Gyr x Holstein population

Directory of Open Access Journals (Sweden)

Gustavo Gasparin

2005-12-01

Full Text Available Segregation between a genetic marker and a locus influencing a quantitative trait in a well delineated population is the basis for success in mapping quantitative trait loci (QTL. To detect bovine chromosome 5 (BTA5 birth weight QTL we genotyped 294 F2 Gyr (Bos indicus x Holstein (Bos taurus crossbreed cattle for five microsatellite markers. A linkage map was constructed for the markers and an interval analysis for the presence of QTL was performed. The linkage map indicated differences in the order of two markers relative to the reference map (http://www.marc.usda.gov. Interval analysis detected a QTL controlling birth weight (p < 0.01 at 69 centimorgans (cM from the most centromeric marker with an effect of 0.32 phenotypic standard-error. These results support other studies with crossbred Bos taurus x Bos indicus populations.

PP167. A process evaluation of an innovative implementation strategy of the Dutch guidelines on hypertensive disorders in pregnancy using a computerized decision support system

DEFF Research Database (Denmark)

Luitjes, S.H.E.; Mesri, K; Wouters, M

2012-01-01

strategy of professional audit and feedback. In this study a process evaluation of BOS has been done, analyzing its efficiency, barriers and formulate improvement points.OBJECTIVES: Gynecologists, residents and clinical midwives from seven hospitals using BOS were asked to fill in the questionnaire...... by the respondents were mainly regarding the lay-out. Most respondents (85.3%) found it useful to make a computer based support system for other guidelines and 79.4% would also use this.CONCLUSION: BOS is regarded suitable as an instrument for implementing guidelines and respondents find it useful to develop...

Gene : CBRC-PABE-07-0025 [SEVENS

Lifescience Database Archive (English)

Full Text Available e-82 48% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-130 78% MINDSYFSGFILLGFT...QIFIDVALYSVECILLAMMSCDRLNAICKPLHHMTIMNLQLCQGLVVISWVVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAA

Gene : CBRC-PTRO-07-0026 [SEVENS

Lifescience Database Archive (English)

Full Text Available e-79 50% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-120 76% MINDSRFSGFILLGFT...QLFIDVALYSVECILLSMMSYDRLNAICKPLHHMTIMNLQLCQGLVVISWIVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAAGRQKAFGTCSSHLIVVSIFYGTVRYMYTQPGNSPSQDEGKLLHIFYSIFTPTLNPSH ...

Heat-tolerant versus heat-sensitive Bos taurus cattle: influence of air temperature and breed on the acute phase response to a provocative immune challenge.

Science.gov (United States)

Carroll, J A; Burdick Sanchez, N C; Chaffin, R; Chase, C C; Coleman, S W; Spiers, D E

2013-10-01

The difference in the acute phase response of a heat-tolerant and a heat-sensitive Bos taurus breed to a lipopolysaccharide (LPS) challenge when housed at different air temperatures (Ta) was studied. Angus (ANG; heat-sensitive; n = 11; 306 ± 26 kg BW) and Romosinuano (RO; heat-tolerant; n = 10; 313 ± 32 kg BW) heifers were transported from the USDA Agricultural Research Service SubTropical Agricultural Research Station in Florida to the Brody Environmental Chambers at the University of Missouri, Columbia. Heifers were housed in stanchions in 4 temperature-controlled environmental chambers. Initially, Ta in the 4 chambers was cycling at thermoneutrality (TN; 18.5°C-23.5°C) for a 1-wk adjustment period, followed by an increase in 2 of the 4 chambers to cycling heat stress (HS; 24°C-38°C) for 2 wk. On day 19, heifers were fitted with jugular catheters and rectal temperature (RT) recording devices. On day 20, heifers were challenged with LPS (0.5 μg/kg BW; 0 h), sickness behavior scores (SBSs) were recorded, and blood samples were collected at 0.5-h intervals from -2 to 8 h and again at 24 h relative to LPS challenge at 0 h. Serum was isolated and stored at -80°C until analyzed for cortisol and cytokine concentrations. A breed by Ta interaction (P heat-tolerant RO and heat-sensitive ANG heifers under different Ta which may aid in elucidating differences in productivity, disease resistance, and longevity among cattle breeds. Published by Elsevier Inc.

crossbreeding wit}i africander dam as basis . 3. post-weaning ...

African Journals Online (AJOL)

'n stelsel van rntensiewe vetmesting, het laasgenoemde drie 8os taurus vaarras nageslaggroepe opvallend beter presteer as eersgenoemde twee Bos indicus vaarras nageslaggroepe. Onder ekstensiewe veldtoestande het alle krusgeteelde groepe egter die Afrikanerkontroles geklop. Die nageslag van beide Bos indicus ...

Características de carcaça e composição corporal de touros jovens da raça Nelore terminados em diferentes sistemas Carcass traits and body composition of young Nellore bulls finished at different feeding regime

Directory of Open Access Journals (Sweden)

Marcelo Pereira Macedo

2001-10-01

Full Text Available O objetivo do trabalho foi avaliar comparativamente as características de carcaça e a composição corporal de machos jovens da raça Nelore não-castrados, filhos de touros com diferencial positivo (Linhagem Seleção ou nulo (Linhagem Controle para ganho de peso aos 378 dias de idade. Utilizaram-se informações de 92 zebuínos Nelore, com peso de abate médio de 456,00 kg, sendo 51 animais pertencentes à Linhagem Seleção e 41 animais da Linhagem Controle, foram criados em pastagens cultivadas até os 18 meses, quando foram alocados nos dois sistemas de terminação, de forma a compor grupos homogêneos quanto ao peso e filiação. Os animais de confinamento receberam, em baias individuais, ração para possibilitar ganhos de 1,0 kg/cab/dia. Antes do abate, os animais foram submetidos a jejum e pesados, quando se obteve o peso de abate. Após o armazenamento das carcaças em câmara fria, obteve-se a seção da 9ª-10ª-11ª costelas. Não houve efeito significativo de linhagem para nenhuma das características analisadas, exceto para a porcentagem de ossos, sendo que os animais da Linhagem Seleção superaram os animais da Linhagem Controle. O regime de terminação apresentou efeito significativo para a quase totalidade das características estudadas, com exceção para as características de composição corporal. Não houve efeito significativo de interação entre linhagem e terminação. As classes de idade apresentaram efeito significativo para as características peso de abate, peso de carcaça quente, peso da gordura renal-pélvica-ingüinal, porcentagem de músculo, gordura e osso.The objective of this work was to evaluate comparatively the carcass traits and body composition of young Nellore breed intact male, sons of bulls with differentials positive (Selection Lineage or null (Control Lineage at weight gain at 378 days of age. Data from 92 Nellore cattle, with 456.00 kg of slaughter weight, being 51 animals of Selection

Utilização do bagaço de cana-de-açúcar em dietas com elevada proporção de concentrados para novilhos Nelore em confinamento Levels of sugarcane bagasse in diets with high concentrate for Nellore steers in feedlot

Directory of Open Access Journals (Sweden)

Paulo Roberto Leme

2003-12-01

Full Text Available O objetivo deste trabalho foi avaliar o desempenho e características de carcaça de bovinos submetidos a dietas de alto concentrado contendo 15, 21 ou 27% da matéria seca em bagaço de cana-de-açúcar. Foram utilizados 24 novilhos Nelore, com peso médio em jejum de 279 kg e 24 meses de idade, confinados por um período de 98 dias. Não foram observados efeitos significativos para as características de ganho médio diário (média =1,461 kg e eficiência alimentar. Foi observado efeito linear entre matéria seca ingerida e níveis de bagaço, com maior consumo nos tratamentos com menor percentagem de bagaço. Consistente com o comportamento do consumo, o peso do fígado também apresentou efeito linear, em função dos níveis de bagaço, sendo maior nos tratamentos com maior proporção de concentrado. As características peso de carcaça quente, gordura renal e pélvica, área de olho de lombo e espessura de gordura subcutânea não diferiram entre os tratamentos. Entretanto, observou-se comportamento linear do rendimento de carcaça, em função dos níveis de bagaço, sendo maior nos tratamentos com maior proporção de concentrado, consistente com o nível energético da ração. Os resultados indicam a viabilidade do uso de 15 ou 21% de bagaço como único volumoso, em dietas com elevada proporção de concentrado contendo milho, polpa de citrus e farelo de soja para novilhos Nelore em confinamento.The objective of this work was to evaluate the performance and carcass characteristics of cattle fed high concentrate diets containing 15, 21 or 27% of sugarcane bagasse in the dry matter. Twenty-four Nellore steers with 279 kg of shrunk body weight and 24 months of age, two per pen, were fed for 98 days. No significant effects were observed for average daily gain (mean =1.461 kg and feed efficiency among the treatments. It was observed a linear effect between dry matter intake and levels of bagasse, with greater intake in treatments with

Intraspecific phylogenetic analysis of Siberian woolly mammoths using complete mitochondrial genomes

DEFF Research Database (Denmark)

Gilbert, M Thomas P; Drautz, Daniela I; Lesk, Arthur M

2008-01-01

We report five new complete mitochondrial DNA (mtDNA) genomes of Siberian woolly mammoth (Mammuthus primigenius), sequenced with up to 73-fold coverage from DNA extracted from hair shaft material. Three of the sequences present the first complete mtDNA genomes of mammoth clade II. Analysis...... to indicate any important functional difference between genomes belonging to the two clades, suggesting that the loss of clade II more likely is due to genetic drift than a selective sweep....

A deterministic simulation study of embryo marker-assisted selection for age at first calving in Nellore (Bos indicus beef cattle

Directory of Open Access Journals (Sweden)

Artur J.M. Rosa

2007-01-01

Full Text Available We used deterministic simulation of four alternative multiple ovulation and embryo manipulation (MOET closed nucleus schemes to investigate the benefits of using marker-assisted selection (MAS of Nellore (Bos indicus beef cattle embryos prior to transplantation to reduce the age at first calving (AFC. We found that MAS resulted in increased genetic gain as compared to selection without AFC quantitative trait loci (AFC-QTL information. With single-stage selection the genetic response (GR increased as follows: GR = 0.68% when the AFC-QTL explained 0.02 of the AFC additive genetic variance (sigma2A; GR = 1.76% for AFC-QTL explaining 0.05 sigma2A; GR = 3.7% for AFC-QTL explaining 0.1 sigma2A; and GR = 55.76% for AFC-QTL explaining 0.95 sigma2A. At the same total selected proportion, two-stage selection resulted in less genetic gain than single stage MAS at two-years of age. A single stage selection responses of > 95% occurred with pre-selected proportions of 0.4 (0.1 sigma2A explained by AFC-QTL, 0.2 (0.3 sigma2A explained by AFC-QTL and 0.1 (0.5 sigma2A explained by AFC-QTL, indicating that the combined use of MAS and pre-selection can substantially reduce the cost of keeping recipient heifers in MOET breeding schemes. When the number of recipients was kept constant, the benefit of increasing embryo production was greater for the QTL explaining a higher proportion of the additive genetic variance. However this advantage had a diminishing return especially for QTL explaining a small proportion of the additive genetic variance. Thus, marker assisted selection of embryos can be used to achieve increased genetic gain or a similar genetic response at reduced expense by decreasing the number of recipient cows and number of offspring raised to two-years of age.

Development and Application of a Sensitive, Second Antibody Format Enzymeimmunoassay (EIA) for Estimation of Plasma FSH in Mithun (Bos frontalis).

Science.gov (United States)

Mondal, Mohan; Baruah, Kishore Kumar; Prakash, B S

2016-01-01

Mithun (Bos frontalis) is a semi-wild rare ruminant species. A simple sensitive enzymeimmunoassay suitable for assaying FSH in the blood plasma of mithun is not available which thereby limits our ability to understand this species reproductive processes. Therefore, the aim of this article was to develop a simple and sensitive enzymeimmunoassay (EIA) for estimation of FSH in mithun plasma and apply the assay to understand the estrous cycle and superovulatory process in this species. To accomplish this goal, biotinylated FSH was bridged between streptavidin-peroxidase and immobilized antiserum in a competitive assay. Forty microlitre mithun plasma was used directly in the EIA. The FSH standards were prepared in hormone free plasma and ranged from 5-1280 pg/well/40 μL. The sensitivity of EIA was 5 pg/well FSH, which corresponds to 0.125 ng/mL plasma and the 50% relative binding sensitivity was 90 pg/well/40 μL. Although the shape of the standard curve was not influenced by different plasma volumes viz. 40 and 80 μL, a slight drop in the OD450 was observed with the increasing volume of plasma. Parallelism tests conducted between the endogenous mithun FSH and bovine FSH standards showed good homology between them. Plasma FSH estimated using the developed EIA and commercially available FSH EIA kit in the same samples were correlated (r = 0.98) and showed linearity. Both the Intra- and inter-assay CV were below 6%. Recovery of known concentrations of added FSH showed linearity (r = 0.99). The developed EIA was further validated biologically by estimating FSH in cyclic cows for the entire estrous cycle, in mithun heifers administered with GnRH analogues and in mithun cows during superovulatory treatment with FSH. In conclusion, the EIA developed for FSH determination in mithun blood plasma is simple and highly sensitive for estimation of mithun FSH in all physiological conditions.

Social relationships enhance the time spent eating and intake of a novel diet in pregnant Hanwoo (Bos taurus coreanae) heifers.

Science.gov (United States)

Shin, Dong-Han; Kang, Hyun-Min; Seo, Seongwon

2017-01-01

The objective of this study was to evaluate the effects of social relationships on the feed intake, eating behavior, and growth, upon exposure to a novel diet, in Hanwoo ( Bos taurus coreanae ) heifers during pregnancy. Twenty-four pregnant Hanwoo heifers, averaging 438 ± 27.8 kg in weight, 21 months in age, and 194 ± 8.5 days in pregnancy, were involved in a two-month (eight weeks) experiment. The heifers were randomly assigned to either the single housing group (SG; one individual per pen, n = 12), or the paired housing group (PG; two individuals per pen, n = 12). All pens were of the same size (5 × 5 m) and provided with one feed bin, which automatically recorded the individual feed intake and eating behavior. As the experiment began, the diet of the heifers was switched from a total mixed ration (TMR; 250 g/kg ryegrass straw and 750 g/kg concentrate mix) to a forage-only diet (mixed hay cubes composed of 500 g/kg alfalfa, 250 g/kg timothy, and 250 g/kg blue grass hay). The heifers were fed ad libitum twice a day. The individual feed intake and eating behavior were recorded daily throughout the experiment, and body weights (BWs) were measured every four weeks before the morning feeding. PG animals visited the feed bin 22% less often than SG. PG, however, stayed 39% longer in the feed bin and consumed 40% more feed per visit, compared with SG. Consequently, PG heifers spent 23% more time in eating and had 16% more daily dry matter intake than SG during the experiment. Average daily gain during the experimental period tended to be greater in PG than in SG. When pregnant Hanwoo heifers encountered a novel diet, social relationships (i.e., presence of a pen-mate) enhanced their time spent eating and feed intake. Social interactions, even with an unfamiliar individual, may be helpful for pregnant Hanwoo heifers cope with a diet challenge compared to solitary situation.

Aspiration, Localized Pulmonary Inflammation, and Predictors of Early-Onset Bronchiolitis Obliterans Syndrome after Lung Transplantation

Science.gov (United States)

Fisichella, P Marco; Davis, Christopher S; Lowery, Erin; Ramirez, Luis; Gamelli, Richard L; Kovacs, Elizabeth J

2014-01-01

BACKGROUND We hypothesized that immune mediator concentrations in the bronchoalveolar fluid (BALF) are predictive of bronchiolitis obliterans syndrome (BOS) and demonstrate specific patterns of dysregulation, depending on the presence of acute cellular rejection, BOS, aspiration, and timing of lung transplantation. STUDY DESIGN We prospectively collected 257 BALF samples from 105 lung transplant recipients. The BALF samples were assessed for absolute and differential white blood cell counts and 34 proteins implicated in pulmonary immunity, inflammation, fibrosis, and aspiration. RESULTS There were elevated BALF concentrations of interleukin (IL)-15, IL-17, basic fibroblast growth factor, tumor necrosis factor–α, and myeloperoxidase, and reduced concentrations of α1-antitrypsin, which were predictive of early-onset BOS. Patients with BOS had an increased percentage of BALF lymphocytes and neutrophils, with a reduced percentage of macrophages (p < 0.05). The BALF concentrations of IL-1β; IL-8; interferon-γ–induced protein 10; regulated upon activation, normal T-cell expressed and secreted; neutrophil elastase; and pepsin were higher in patients with BOS (p < 0.05). Among those with BOS, BALF concentrations of IL-1RA; IL-8; eotaxin; interferon-γ–induced protein 10; regulated upon activation, normal T-cell expressed and secreted; myeloperoxidase; and neutrophil elastase were positively correlated with time since transplantation (p < 0.01). Those with worse grades of acute cellular rejection had an increased percentage of lymphocytes in their BALF (p < 0.0001) and reduced BALF concentrations of IL-1β, IL-7, IL-9, IL-12, granulocyte colony-stimulating factor, granulocyte-macrophage colony-stimulating factor, interferon-γ, and vascular endothelial growth factor (p ≤ 0.001). Patients with aspiration based on detectable pepsin had increased percentage of neutrophils (p < 0.001) and reduced BALF concentrations of IL-12 (p < 0.001). CONCLUSIONS The BALF levels

A microsatellite-based analysis for the detection of selection on BTA1 and BTA20 in northern Eurasian cattle (Bos taurus populations

Directory of Open Access Journals (Sweden)

Li Meng-Hua

2010-08-01

Full Text Available Abstract Background Microsatellites surrounding functionally important candidate genes or quantitative trait loci have received attention as proxy measures of polymorphism level at the candidate loci themselves. In cattle, selection for economically important traits is a long-term strategy and it has been reported that microsatellites are linked to these important loci. Methods We have investigated the variation of seven microsatellites on BTA1 (Bos taurus autosome 1 and 16 on BTA20, using bovine populations of typical production types and horn status in northern Eurasia. Genetic variability of these loci and linkage disequilibrium among these loci were compared with those of 28 microsatellites on other bovine chromosomes. Four different tests were applied to detect molecular signatures of selection. Results No marked difference in locus variability was found between microsatellites on BTA1, BTA20 and the other chromosomes in terms of different diversity indices. Average D' values of pairwise syntenic markers (0.32 and 0.28 across BTA 1 and BTA20 respectively were significantly (P FST-test indicated elevated or decreased genetic differentiation, at SOD1 and AGLA17 markers respectively, deviating significantly (P SOD1 and AGLA17. Our data also indicate significant intergenic linkage disequilibrium around the candidate loci and suggest that hitchhiking selection has played a role in shaping the pattern of observed linkage disequilibrium. Conclusion Hitchhiking due to tight linkage with alleles at candidate genes, e.g. the POLL gene, is a possible explanation for this pattern. The potential impact of selective breeding by man on cattle populations is discussed in the context of selection effects. Our results also suggest that a practical approach to detect loci under selection is to simultaneously apply multiple neutrality tests based on different assumptions and estimations.

NCBI nr-aa BLAST: CBRC-OLAT-15-0022 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-15-0022 ref|NP_001073692.1| solute carrier family 29 (nucleoside transporters...), member 3 [Bos taurus] gb|AAI26742.1| Solute carrier family 29 (nucleoside transporters), member 3 [Bos taurus] NP_001073692.1 9e-68 49% ...

Marginal costs of abating greenhouse gases in the global ruminant livestock sector

NARCIS (Netherlands)

Henderson, B.; Falcucci, A.; Early, L.; Gerber, P.J.

2017-01-01

Livestock [inclusive of ruminant species, namely cattle (Bos Taurus and Bos indicus), sheep (Ovis aries), goats (Capra hircus), and buffaloes (Bubalus bubalis), and non-ruminant species, namely pigs (Sus scrofa domesticus) and chickens (Gallus domesticus)] are both affected by climate change and

NCBI nr-aa BLAST: CBRC-ETEL-01-0499 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-0499 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-175 86% ...

NCBI nr-aa BLAST: CBRC-MDOM-07-0106 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-07-0106 ref|NP_001071419.1| progestin and adipoQ receptor family member I...X [Bos taurus] gb|AAI22754.1| Progestin and adipoQ receptor family member IX [Bos taurus] NP_001071419.1 0.0 87% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2314 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2314 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-161 89% ...

NCBI nr-aa BLAST: CBRC-PCAP-01-0894 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0894 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-176 84% ...

NCBI nr-aa BLAST: CBRC-RNOR-05-0235 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-05-0235 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-169 83% ...

NCBI nr-aa BLAST: CBRC-GGAL-23-0005 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGAL-23-0005 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-120 65% ...

NCBI nr-aa BLAST: CBRC-MDOM-04-0428 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-04-0428 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-149 76% ...

NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...

NCBI nr-aa BLAST: CBRC-PVAM-01-1596 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1596 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 0.0 89% ...

NCBI nr-aa BLAST: CBRC-TTRU-01-1190 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-1190 ref|NP_001071419.1| progestin and adipoQ receptor family member I...X [Bos taurus] gb|AAI22754.1| Progestin and adipoQ receptor family member IX [Bos taurus] NP_001071419.1 0.0 96% ...

NCBI nr-aa BLAST: CBRC-TTRU-01-0287 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0287 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 0.0 94% ...

NCBI nr-aa BLAST: CBRC-MMUR-01-1487 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-1487 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-179 87% ...

NCBI nr-aa BLAST: CBRC-PVAM-01-1010 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1010 ref|NP_001071419.1| progestin and adipoQ receptor family member I...X [Bos taurus] gb|AAI22754.1| Progestin and adipoQ receptor family member IX [Bos taurus] NP_001071419.1 0.0 92% ...

Background-Oriented Schlieren used in a hypersonic inlet test at NASA GRC

Science.gov (United States)

Clem, Michelle; Woike, Mark; Saunders, John

2016-01-01

Background Oriented Schlieren (BOS) is a derivative of the classical schlieren technology, which is used to visualize density gradients, such as shock wave structures in a wind tunnel. Changes in refractive index resulting from density gradients cause light rays to bend, resulting in apparent motion of a random background pattern. The apparent motion of the pattern is determined using cross-correlation algorithms (between no-flow and with-flow image pairs) producing a schlieren-like image. One advantage of BOS is its simplified setup which enables a larger field-of-view (FOV) than traditional schlieren systems. In the present study, BOS was implemented into the Combined Cycle Engine Large-Scale Inlet Mode Transition Experiment (CCE LIMX) in the 10x10 Supersonic Wind Tunnel at NASA Glenn Research Center. The model hardware for the CCE LIMX accommodates a fully integrated turbine based combined cycle propulsion system. To date, inlet mode transition between turbine and ramjet operation has been successfully demonstrated. High-speed BOS was used to visualize the behavior of the flow structures shock waves during unsteady inlet unstarts, a phenomenon known as buzz. Transient video images of inlet buzz were recorded for both the ramjet flow path (high speed inlet) and turbine flow path (low speed inlet). To understand the stability limits of the inlet, operation was pushed to the point of unstart and buzz. BOS was implemented in order to view both inlets simultaneously, since the required FOV was beyond the capability of the current traditional schlieren system. An example of BOS data (Images 1-6) capturing inlet buzz are presented.

Linear and nonlinear auditory response properties of interneurons in a high-order avian vocal motor nucleus during wakefulness.

Science.gov (United States)

Raksin, Jonathan N; Glaze, Christopher M; Smith, Sarah; Schmidt, Marc F

2012-04-01

Motor-related forebrain areas in higher vertebrates also show responses to passively presented sensory stimuli. However, sensory tuning properties in these areas, especially during wakefulness, and their relation to perception, are poorly understood. In the avian song system, HVC (proper name) is a vocal-motor structure with auditory responses well defined under anesthesia but poorly characterized during wakefulness. We used a large set of stimuli including the bird's own song (BOS) and many conspecific songs (CON) to characterize auditory tuning properties in putative interneurons (HVC(IN)) during wakefulness. Our findings suggest that HVC contains a diversity of responses that vary in overall excitability to auditory stimuli, as well as bias in spike rate increases to BOS over CON. We used statistical tests to classify cells in order to further probe auditory responses, yielding one-third of neurons that were either unresponsive or suppressed and two-thirds with excitatory responses to one or more stimuli. A subset of excitatory neurons were tuned exclusively to BOS and showed very low linearity as measured by spectrotemporal receptive field analysis (STRF). The remaining excitatory neurons responded well to CON stimuli, although many cells still expressed a bias toward BOS. These findings suggest the concurrent presence of a nonlinear and a linear component to responses in HVC, even within the same neuron. These characteristics are consistent with perceptual deficits in distinguishing BOS from CON stimuli following lesions of HVC and other song nuclei and suggest mirror neuronlike qualities in which "self" (here BOS) is used as a referent to judge "other" (here CON).

Reactive Balance in Individuals With Chronic Stroke: Biomechanical Factors Related to Perturbation-Induced Backward Falling.

Science.gov (United States)

Salot, Pooja; Patel, Prakruti; Bhatt, Tanvi

2016-03-01

An effective compensatory stepping response is the first line of defense for preventing a fall during sudden large external perturbations. The biomechanical factors that contribute to heightened fall risk in survivors of stroke, however, are not clearly understood. It is known that impending sensorimotor and balance deficits poststroke predispose these individuals to a risk of fall during sudden external perturbations. The purpose of this study was to examine the mechanism of fall risk in survivors of chronic stroke when exposed to sudden, slip-like forward perturbations in stance. This was a cross-sectional study. Fourteen individuals with stroke, 14 age-matched controls (AC group), and 14 young controls (YC group) were exposed to large-magnitude forward stance perturbations. Postural stability was computed as center of mass (COM) position (XCOM/BOS) and velocity (ẊCOM/BOS) relative to the base of support (BOS) at first step lift-off (LO) and touch-down (TD) and at second step TD. Limb support was quantified as vertical hip descent (Zhip) from baseline after perturbation onset. All participants showed a backward balance loss, with 71% of the stroke group experiencing a fall compared with no falls in the control groups (AC and YC groups). At first step LO, no between-group differences in XCOM/BOS and ẊCOM/BOS were noted. At first step TD, however, the stroke group had a significantly posterior XCOM/BOS and backward ẊCOM/BOS compared with the control groups. At second step TD, individuals with stroke were still more unstable (more posterior XCOM/BOS and backward ẊCOM/BOS) compared with the AC group. Individuals with stroke also showed greater peak Zhip compared with the control groups. Furthermore, the stroke group took a larger number of steps with shorter step length and delayed step initiation compared with the control groups. Although the study highlights the reactive balance deficits increasing fall risk in survivors of stroke compared with healthy

Effects of retinol on the in vitro development of Bos indicus embryos to blastocysts in two different culture systems.

Science.gov (United States)

Lima, P F; Oliveira, M A L; Gonçalves, P B D; Montagner, M M; Reichenbach, H-D; Weppert, M; Neto, C C C; Pina, V M R; Santos, M H B

2004-10-01

The objective of this study was to evaluate the effect of retinol on the in vitro development of early embryos of cultured Bos indicus (Expt 1) to the blastocyst stage in medium simplex of optimization (KSOM) or sintetic fluid of oviduct (SOF) or co-cultured (Expt 2) with an oviduct cell monolayer (OCM) in KSOM or SOF. A total of 3149 cumulus-oocyte complexes obtained by aspirating follicles (2-5 mm diameter) from ovaries of slaughtered animals were selected for IVM and incubated in TCM 199 supplemented with 25 mM HEPES at 39 degrees C in air with 5% CO(2) and maximum humidity for 24 h. In vitro fertilization (IVF) was performed in modified defined medium (mDM) medium. Eighteen hours after IVF, cumulus cells were removed and presumptive zygotes were randomly allocated to the experimental groups. Zygotes cultured (Expt 1) in KSOM + retinol, KSOM, SOF + retinol and SOF were incubated in maximum humidity at 39 degrees C, 5% CO(2), 5% O(2) and 90% N(2). Zygotes co-cultured (Expt 2) in KSOM + retinol + OCM, KSOM + OCM, SOF + retinol + OCM and SOF + OCM were incubated at 39 degrees C, 5% CO(2). In both experiments media were partially changed 48 h after IVF and unfertilized ova were removed. Afterwards embryos were kept in culture or co-culture for further 9 days. In Expt 1, blastocyst rates (day 7) were 14.6% (KSOM + retinol), 15.8% (KSOM), 16.4% (SOF + retinol) and 15.9% (SOF). In Expt 2, the blastocyst rates (day 7) were 25.4% (KSOM + retinol + OCM) 14.2% (KSOM + OCM), 24.3% (SOF + retinol + OCM) and 15.9% (SOF + OCM). The same influence profile of retinol was observed in the formation of the expanded (day 9) and hatched (day 11) blastocysts. The results obtained in Expt 2 demonstrated that the addition of 0.28 microg/ml retinol to the embryo culture media used in this study had a significant (p < 0.05) positive effect on bovine early embryonic development, under the conditions tested, and can be used to enhance in vitro embryo production.

Effect of Concentrate Supplementation on Reproductive ...

African Journals Online (AJOL)

A study was conducted in Rungwe district in Tanzania, to assess the effect of concentrate supplementation on reproductive performance of smallholder dairy cattle. Cattle used were crossbreds, mainly between Friesian (Bos taurus) and indigenous Tanzania Short Horn Zebu (Bos indicus). All animals were managed under ...

The power and pain of market-based carbon policies

NARCIS (Netherlands)

Henderson, B.; Golub, A.; Pambudi, D.; Hertel, T.; Godde, C.; Herrero, M.; Cacho, O.; Gerber, P.

2018-01-01

The objectives of this research are to assess the greenhouse gas mitigation potential of carbon policies applied to the ruminant livestock sector [inclusive of the major ruminant species—cattle (Bos Taurus and Bos indicus), sheep (Ovis aries), and goats (Capra hircus)]—with particular emphasis on

Germline LEMD3 mutations are rare in sporadic patients with isolated melorheostosis

DEFF Research Database (Denmark)

Hellemans, Jan; Debeer, Philippe; Wright, Michael

2006-01-01

To further explore the allelic heterogeneity within the group of LEMD3-related disorders, we have screened a larger series of patients including 5 probands with osteopoikilosis or Buschke-Ollendorff syndrome (BOS), 2 families with the co-occurrence of melorheostosis and BOS, and 12 unrelated pati...

NCBI nr-aa BLAST: CBRC-TTRU-01-0672 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0672 ref|NP_001039933.1| protein kinase C and casein kinase substrate in neurons... 2 [Bos taurus] gb|AAI14746.1| Protein kinase C and casein kinase substrate in neurons 2 [Bos taurus] NP_001039933.1 1e-178 74% ...

Inviscid Limit for Damped and Driven Incompressible Navier-Stokes Equations in mathbb R^2

Science.gov (United States)

Ramanah, D.; Raghunath, S.; Mee, D. J.; Rösgen, T.; Jacobs, P. A.

2007-08-01

Experiments to demonstrate the use of the background-oriented schlieren (BOS) technique in hypersonic impulse facilities are reported. BOS uses a simple optical set-up consisting of a structured background pattern, an electronic camera with a high shutter speed and a high intensity light source. The visualization technique is demonstrated in a small reflected shock tunnel with a Mach 4 conical nozzle, nozzle supply pressure of 2.2 MPa and nozzle supply enthalpy of 1.8 MJ/kg. A 20° sharp circular cone and a model of the MUSES-C re-entry body were tested. Images captured were processed using PIV-style image analysis to visualize variations in the density field. The shock angle on the cone measured from the BOS images agreed with theoretical calculations to within 0.5°. Shock standoff distances could be measured from the BOS image for the re-entry body. Preliminary experiments are also reported in higher enthalpy facilities where flow luminosity can interfere with imaging of the background pattern.

Mutation in LEMD3 (Man1 Associated with Osteopoikilosis and Late-Onset Generalized Morphea: A New Buschke-Ollendorf Syndrome Variant

Directory of Open Access Journals (Sweden)

Benjamin Korman

2016-01-01

Full Text Available Introduction. Buschke-Ollendorf syndrome (BOS is an uncommon syndrome characterized by osteopoikilosis and other bone abnormalities, accompanied by skin lesions, most frequently connective tissue nevi. BOS is caused by mutations in the LEMD3 gene, which encodes the inner nuclear membrane protein Man1. We describe a unique case of osteopoikilosis associated with late-onset localized scleroderma and familial LEMD3 mutations. Case Report. A 72-year-old woman presented with adult-onset diffuse morphea and bullous skin lesions. Evaluation revealed multiple hyperostotic lesions (osteopoikilosis suggestive of BOS. DNA sequencing identified a previously undescribed nonsense mutation (Trp621X in the LEMD3 gene encoding Man1. Two additional family members were found to have osteopoikilosis and carry the same LEMD3 mutation. Conclusions and Relevance. We report a unique familial LEMD3 mutation in an individual with osteopoikilosis and late-onset morphea. We propose that this constellation represents a novel syndromic variant of BOS.

Análise de polimorfismos do gene da beta-lactoglobulina em vacas da raça Nelore e efeitos sobre o peso à desmama de suas progênies Polimorphism analisys of beta-lactoglobulin gene on Nellore cows and effects on weaning weight of the calves

Directory of Open Access Journals (Sweden)

F.J.C. Faria

2000-06-01

Full Text Available Informações sobre peso à desmama de bezerros Nelore foram utilizadas após ajuste para idade padrão aos 205 dias, sexo, idade da mãe, touro e mês de desmama, para separar as reprodutrizes em dois grupos, segundo o peso de suas crias. As médias de peso dos bezerros ajustadas pelo método dos quadrados mínimos e erros-padrão (LSM± SE foram para os grupos pesados (P e leves (L 163,21± 2,18kg e 134,44± 2,18kg, respectivamente, com 41 animais em cada grupo. Essas reprodutrizes foram submetidas a coleta de sangue para estudo de polimorfismos do gene da beta-lactoglobulina, por meio da técnica de PCR-RFLP. A amplificação e a digestão de um fragmento do gene da beta-lactoglobulina entre o éxon II e III identificou os genótipos 1AA, 24AB e 56BB, com as freqüências de 0,16 e 0,84 para os alelos A e B, respectivamente. Os 24 animais com genótipo AB apresentaram LSM± SE de peso de seus produtos de 149,50± 4,17kg, e os 56 animais de genótipo BB tiveram média de 148,44± 2,73kg. O teste do qui-quadrado não apresentou significância (P>0,05, isto é, os grupos P e L não diferiram entre si quanto às freqüências alélicas apresentadas para esse gene. O genótipo das reprodutrizes não afetou o peso à desmama de suas crias, o que sugere haver outros fatores genéticos e não genéticos de maior magnitude que afetam o peso à desmama.Weaning weights from a Nelore herd were used after adjustment of means for 205 days of age, sex, age of dam, sire and weaning month, and resulted into two groups of cows that differed by the weaning weight of their calves. The least square means (LSM and standard error (SE were for heavy group 163.21± 2.18kg and for light group 134.44± 2.18kg, with 41 animals in each group. These animals were genotyped by DNA polymorphisms of beta -lactoglobulin gene, using PCR-RFLP. After amplification and digestion of a beta-lactoglobulin gene fragment between II and III exon, genotypes 1AA, 24AB and 56BB were

9 CFR 94.0 - Definitions.

Science.gov (United States)

2010-01-01

... than poultry or game birds). Bovine. Bos taurus, Bos indicus, and Bison bison. Bovine spongiform... loaded with meat product, or the areas at various points along the belt in an oven chamber, slowest to.... Game birds. Migratory birds, including certain ducks, geese, pigeons, and doves (“migratory” refers to...

Dood hout in de bosreservaten

NARCIS (Netherlands)

Hees, van A.F.M.; Clerkx, A.P.P.M.

1999-01-01

Overzicht van de hoeveelheid dood hout, de sterfte van bomen en de verteringssnelheid van deze bomen in enkele niet meer beheerde Nederlandse bosreservaten. Voor drie typen bos (gemengd bos; grove den; zomereik) is op grond van een beheerscenario de te verwachten hoeveelheid hout in de loop van de

Endothelin-1 receptor antagonists protect the kidney against the nephrotoxicity induced by cyclosporine-A in normotensive and hypertensive rats.

Science.gov (United States)

Caires, A; Fernandes, G S; Leme, A M; Castino, B; Pessoa, E A; Fernandes, S M; Fonseca, C D; Vattimo, M F; Schor, N; Borges, F T

2017-12-11

Cyclosporin-A (CsA) is an immunosuppressant associated with acute kidney injury and chronic kidney disease. Nephrotoxicity associated with CsA involves the increase in afferent and efferent arteriole resistance, decreased renal blood flow (RBF) and glomerular filtration. The aim of this study was to evaluate the effect of Endothelin-1 (ET-1) receptor blockade with bosentan (BOS) and macitentan (MAC) antagonists on altered renal function induced by CsA in normotensive and hypertensive animals. Wistar and genetically hypertensive rats (SHR) were separated into control group, CsA group that received intraperitoneal injections of CsA (40 mg/kg) for 15 days, CsA+BOS and CsA+MAC that received CsA and BOS (5 mg/kg) or MAC (25 mg/kg) by gavage for 15 days. Plasma creatinine and urea, mean arterial pressure (MAP), RBF and renal vascular resistance (RVR), and immunohistochemistry for ET-1 in the kidney cortex were measured. CsA decreased renal function, as shown by increased creatinine and urea. There was a decrease in RBF and an increase in MAP and RVR in normotensive and hypertensive animals. These effects were partially reversed by ET-1 antagonists, especially in SHR where increased ET-1 production was observed in the kidney. Most MAC effects were similar to BOS, but BOS seemed to be better at reversing cyclosporine-induced changes in renal function in hypertensive animals. The results of this work suggested the direct participation of ET-1 in renal hemodynamics changes induced by cyclosporin in normotensive and hypertensive rats. The antagonists of ET-1 MAC and BOS reversed part of these effects.

Endothelin-1 receptor antagonists protect the kidney against the nephrotoxicity induced by cyclosporine-A in normotensive and hypertensive rats

Directory of Open Access Journals (Sweden)

A. Caires

2017-12-01

Full Text Available Cyclosporin-A (CsA is an immunosuppressant associated with acute kidney injury and chronic kidney disease. Nephrotoxicity associated with CsA involves the increase in afferent and efferent arteriole resistance, decreased renal blood flow (RBF and glomerular filtration. The aim of this study was to evaluate the effect of Endothelin-1 (ET-1 receptor blockade with bosentan (BOS and macitentan (MAC antagonists on altered renal function induced by CsA in normotensive and hypertensive animals. Wistar and genetically hypertensive rats (SHR were separated into control group, CsA group that received intraperitoneal injections of CsA (40 mg/kg for 15 days, CsA+BOS and CsA+MAC that received CsA and BOS (5 mg/kg or MAC (25 mg/kg by gavage for 15 days. Plasma creatinine and urea, mean arterial pressure (MAP, RBF and renal vascular resistance (RVR, and immunohistochemistry for ET-1 in the kidney cortex were measured. CsA decreased renal function, as shown by increased creatinine and urea. There was a decrease in RBF and an increase in MAP and RVR in normotensive and hypertensive animals. These effects were partially reversed by ET-1 antagonists, especially in SHR where increased ET-1 production was observed in the kidney. Most MAC effects were similar to BOS, but BOS seemed to be better at reversing cyclosporine-induced changes in renal function in hypertensive animals. The results of this work suggested the direct participation of ET-1 in renal hemodynamics changes induced by cyclosporin in normotensive and hypertensive rats. The antagonists of ET-1 MAC and BOS reversed part of these effects.

Maternal rigidity in infancy and level of intelligence at school age in children born preterm

NARCIS (Netherlands)

Butcher, P.R.; Wijnberg-Williams, B.J; Hegemann, N; Stremmelaar, E.F; Schoemaker, M.M.; Van der Meere, J.J.; Bambang Oetomo, S

2004-01-01

Forty-four children who had been born preterm and their mothers participated in the follow-up study. At 3 and 14 months (corrected age) cognitive development was assessed using the BOS 2-30, the Dutch version of the Bayley Scales of Infant Development. The BOS yields measures of mental and motor

Urinary catecholamine concentrations in three beef breeds at ...

African Journals Online (AJOL)

Handling and transport of live animals is a stressful experience for animals. The temperaments of cattle affect their behaviour and differ between breeds, i.e. studies have shown that Bos indicus types are more temperamental than Sanga and Bos taurus types. Catecholamines (CAT's) are considered as indicators of stress, ...

An extension of uncertainty management theory to the self : The relationship between justice, social comparison orientation, and antisocial work behaviors

NARCIS (Netherlands)

Thau, Stefan; Aquino, Karl; Wittek, Rafael; Aquino, 27021

A multisource field study of 103 employees and their supervisors tested an extension of uncertainty management theory (E. A. Lind & K. Van den Bos, 2002; K. Van den Bos & E. A. Lind, 2002). According to this theory, persons high in social comparison orientation (F. X. Gibbons & B. P. Buunk, 1999)

Intervalo de partos e fertilidade real em vacas Nelore no Estado do Maranhão Calving interval and real fertility of Nellore cows in State of Maranhão

Directory of Open Access Journals (Sweden)

Claudio Cabral Campello

1999-01-01

Full Text Available Os efeitos de fatores genéticos e de ambiente sobre características reprodutivas, a partir de 475 observações de intervalos de partos (IDP e 401 de fertilidade real (FR de vacas da raça Nelore, criadas no município de Santa Inês, Estado do Maranhão, em regime de pasto com suplementação na estação seca, no período de 1980 a 1994, foram estudados. Os dados foram analisados por intermédio de modelos lineares, que incluíram efeito de touro (aleatório, mês e ano do parto anterior e atual, ordem de parição e sexo da cria (fixos. O pai da vaca e a ordem de parição influenciaram significativamente ambas as características estudadas, enquanto o sexo da cria influiu apenas na FR. As médias estimada pelo método dos quadrados mínimos, para IDP e FR, foram 433,84 ± 88,20 dias e 184,69 ± 37,09 kg, respectivamente. Os coeficientes de herdabilidade estimados pela correlação intraclasse entre meio-irmãs paternas foram estimados em 0,32 ± 0,15 e 0,49 ± 0,19, respectivamente, para IDP e FR.The effects of genetic and environmental factors on reproductive traits, from 475 records of calving interval (CI and 401 of real fertility (RF of Nellore cows reared at Santa Inês county, Maranhão State, in pasture grazing system with supplementation in the dry season, from 1980 to 1994, were studied. The data were analyzed by means of linear models, which included the sire effect (random effects, month and year of the last and the actual calving, calving number and sex of calf (fixed effects. The sire effect and calving number significantly affected both studied traits, while calf sex affected only the RF. The calving interval and R F by least square means were: 433.84 ± 88.20 days and 184.69 ± 37.09 kg, respectively. The heritability coefficients estimated by intraclass correlation of paternal half-sisters were .32 ± .15 and .49 ± .19, for CI. and RF. respectively.

Oxygen-sensitive 3He-MRI in bronchiolitis obliterans after lung transplantation

International Nuclear Information System (INIS)

Gast, Klaus K.; Biedermann, Alexander; Herweling, Annette; Schreiber, Wolfgang G.; Schmiedeskamp, Joerg; Mayer, Eckhard; Heussel, Claus P.; Markstaller, Klaus; Eberle, Balthasar; Kauczor, Hans-Ulrich

2008-01-01

Oxygen-sensitive 3 He-MRI was studied for the detection of differences in intrapulmonary oxygen partial pressure (pO 2 ) between patients with normal lung transplants and those with bronchiolitis obliterans syndrome (BOS). Using software developed in-house, oxygen-sensitive 3 He-MRI datasets from patients with normal lung grafts (n = 8) and with BOS (n = 6) were evaluated quantitatively. Datasets were acquired on a 1.5-T system using a spoiled gradient echo pulse sequence. Underlying diseases were pulmonary emphysema (n 10 datasets) and fibrosis (n = 4). BOS status was verified by pulmonary function tests. Additionally, 3 He-MRI was assessed blindedly for ventilation defects. Median intrapulmonary pO 2 in patients with normal lung grafts was 146 mbar compared with 108 mbar in patients with BOS. Homogeneity of pO2 distribution was greater in normal grafts (standard deviation pO2 34 versus 43 mbar). Median oxygen decrease rate during breath hold was higher in unaffected patients (-1.75 mbar/s versus -0.38 mbar/s). Normal grafts showed fewer ventilation defects (5% versus 28%, medians). Oxygen-sensitive 3 He-MRI appears capable of demonstrating differences of intrapulmonary pO2 between normal lung grafts and grafts affected by BOS. Oxygen-sensitive 3 He-MRI may add helpful regional information to other diagnostic techniques for the assessment and follow-up of lung transplant recipients. (orig.)

The Induction of IgM and IgG Antibodies against HLA or MICA after Lung Transplantation

Directory of Open Access Journals (Sweden)

Annelieke W. M. Paantjens

2011-01-01

Full Text Available The production of IgG HLA antibodies after lung transplantation (LTx is considered to be a major risk factor for the development of chronic rejection, represented by the bronchiolitis obliterans syndrome (BOS. It has recently been observed that elevated levels of IgM HLA antibodies also correlates with the development of chronic rejection in heart and kidney transplantation. This study investigates the relationship between IgM and IgG antibodies against HLA and MICA after lung transplantation. Serum was collected from 49 patients once prior to transplantation and monthly for up to 1 year after lung transplantation was analyzed by Luminex to detect IgM and IgG antibodies against HLA and MICA. The presence of either IgM or IgG HLA and/or MICA antibodies prior to or after transplantation was not related to survival, gender, primary disease, or the development of BOS. Additionally, the production of IgG alloantibodies was not preceded by an increase in levels of IgM, and IgM levels were not followed by an increase in IgG. Under current immune suppressive regimen, although the presence of IgM antibodies does not correlate with BOS after LTx, IgM high IgG low HLA class I antibody titers were observed more in patients with BOS compared to patients without BOS.

Fontes de energia em suplementos múltiplos para bezerros Nelore em creep-feeding: desempenho produtivo, consumo e digestibilidade dos nutrientes Energy sources in multiple supplements for Nellore calves in creep-feeding: productive performance, nutrient intake and digestibility

Directory of Open Access Journals (Sweden)

Marlos Oliveira Porto

2009-07-01

Full Text Available Avaliaram-se o desempenho produtivo, o consumo e a digestibilidade em bezerros Nelore em fase de amamentação em pastagem de Brachiaria decumbens suplementada com diferentes fontes de energia. A área foi dividida em cinco piquetes de 6,8 ha, com disponibilidade média de matéria seca e matéria seca potencialmente digestível de 4,10 e 2,38 t/ha, respectivamente. Foram utilizados 45 bezerros Nelore, com peso e idade iniciais de 96,0 ± 11,0 kg e 101 ± 12 dias, em delineamento inteiramente casualizado, em arranjo fatorial 5 × 2 (cinco suplementos e dois sexos. Os suplementos foram: MM - mistura mineral (controle; GM - farelo de soja (FS + grão de milho triturado (GM e mistura mineral; FTGM - farelo de soja + farelo de trigo + grão de milho triturado e mistura mineral; FA - farelo de soja + farelo de arroz e mistura mineral; GMS - farelo de soja + grão de milho triturado + grão de sorgo triturados e mistura mineral, fornecidos diariamente na quantidade de 60 g/animal para o grupo controle e 500 g/animal para os demais suplementos. Os animais que receberam suplemento múltiplo com milho e sorgo como fonte de energia proporcionaram ganho diário médio adicional de 100 g/animal (16,39% em comparação à mistura mineral. O uso do suplemento múltiplo à base de grão de milho como fonte de energia reduziu o consumo de matéria seca, matéria orgânica de pasto e fibra em detergente neutro em relação às fontes energéticas farelo de arroz e à combinação de milho com sorgo. A suplementação com as fontes de energia, sobretudo as combinações de farelo de trigo e milho ou de milho e sorgo, podem proporcionar ganhos adicionais em animais em creep-feeding. A suplementação múltipla aumenta o consumo de pasto quando se utilizam grão de milho e sorgo combinados como fonte de energia.The performance, intake and digestibility were evaluated in Nellore beef calves supplemented with different energy sources in Brachiaria decumbens pasture

Indvandring, integration og etnisk segregation

DEFF Research Database (Denmark)

Andersen, Hans Skifter

I denne publikation belyses udviklingen i indvandrernes bosætning i Danmark, analyserer årsagerne til at mange indvandrere er blevet bosat i den almene sektor og koncentreret i bestemte byområder og belyser sammenhængen mellem bosætningen og indvandrernes integration i samfundet. Vi tager afsæt i...

Herdabilidades de parâmetros de curvas de crescimento não-lineares em zebuínos, no estado de Pernambuco Heritabilities of nonlinear growth curve parameters in zebu breeds, in Pernambuco State, Northeastern Brazil

Directory of Open Access Journals (Sweden)

Kleber Régis Santoro

2005-12-01

Full Text Available Objetivou-se estimar parâmetros genéticos e fenotípicos de curvas de crescimento de modelos não-lineares. Foram analisados dados de pesagem constantes no banco de dados de Controle de Desenvolvimento Ponderal da Associação Brasileira de Criadores de Zebu (ABCZ, referentes a 24.028 animais Zebu, nascidos entre 1960 e 2000, das raças Guzerá, Nelore e Nelore Mocho. As pesagens ocorreram ao nascimento e em intervalos de 90 dias até dois anos de idade. Os seguintes modelos não-lineares foram utilizados na análise dos dados de peso-idade: Brody, Gompertz, Logístico, von Bertalanffy e Richards. Os efeitos fixos estudados no modelo misto foram sexo, rebanho, ano e mês de nascimento e regime de criação. As herdabilidades para os parâmetros foram de baixa a alta magnitude, em geral, para todos os modelos. As correlações genéticas entre peso assintótico e taxa de maturidade e entre peso assintótico e velocidade de crescimento foram negativas, enquanto aquelas entre taxa de maturidade e velocidade de crescimento foram positivas. As correlações fenotípicas foram negativas entre peso assintótico e taxa de crescimento e entre peso assintótico e velocidade de crescimento e positivas entre taxa e velocidade de crescimento. Encontrou-se variabilidade possível de ser explorada em um programa de melhoramento genético, especialmente para a raça Nelore, que apresentou amostra de dados e resultados mais consistentes.Weight records of 24.028 zebu animals from Guzerá, Nelore, and Polled Nelore breeds available from Brazilian Association of Zebu Breeders (ABCZ database were used to estimate heritabilities of growth curve parameters. Non-linear Brody, Gompertz, Logistic, Mitscherlich, von Bertalanffy, Richards, and Double Logistic models including sex, farm, year of birth, month of birth, raising system, and interaction sex*raising system as fixed effects and sire and dam, as random effects were adjusted using weight-age records of animals

Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle

Directory of Open Access Journals (Sweden)

Ali Abdirahman A

2012-07-01

Full Text Available Abstract Background Infectious bovine keratoconjunctivitis (IBK or ‘pinkeye’ is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified species eggs per gram of faeces and growth traits in Australian tropically adapted Bos taurus cattle were estimated. Methods Animals were clinically examined for the presence of IBK infection before and after weaning when the calves were 3 to 6 months and 15 to 18 months old, respectively and were also recorded for tick counts, helminth eggs counts as an indicator of intestinal parasites and live weights at several ages including 18 months. Results Negative genetic correlations were estimated between IBK incidence and weight traits for animals in pre-weaning and post-weaning datasets. Genetic correlations among weight measurements were positive, with moderate to high values. Genetic correlations of IBK incidence with tick counts were positive for the pre-weaning and negative for the post-weaning datasets but negative with helminth eggs counts for the pre-weaning dataset and slightly positive for the post-weaning dataset. Genetic correlations between tick and helminth eggs counts were moderate and positive for both datasets. Phenotypic correlations of IBK incidence with helminth eggs per gram of faeces were moderate and positive for both datasets, but were close to zero for both datasets with tick counts. Conclusions Our results suggest that genetic selection against IBK incidence in tropical cattle is feasible and that calves genetically prone to acquire IBK infection could also be genetically prone to have a slower growth. The positive genetic correlations among weight traits and between tick and helminth eggs counts suggest that they are controlled by common genes (with pleiotropic effects. Genetic correlations between IBK incidence

Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle.

Science.gov (United States)

Ali, Abdirahman A; O'Neill, Christopher J; Thomson, Peter C; Kadarmideen, Haja N

2012-07-27

Infectious bovine keratoconjunctivitis (IBK) or 'pinkeye' is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified species) eggs per gram of faeces and growth traits in Australian tropically adapted Bos taurus cattle were estimated. Animals were clinically examined for the presence of IBK infection before and after weaning when the calves were 3 to 6 months and 15 to 18 months old, respectively and were also recorded for tick counts, helminth eggs counts as an indicator of intestinal parasites and live weights at several ages including 18 months. Negative genetic correlations were estimated between IBK incidence and weight traits for animals in pre-weaning and post-weaning datasets. Genetic correlations among weight measurements were positive, with moderate to high values. Genetic correlations of IBK incidence with tick counts were positive for the pre-weaning and negative for the post-weaning datasets but negative with helminth eggs counts for the pre-weaning dataset and slightly positive for the post-weaning dataset. Genetic correlations between tick and helminth eggs counts were moderate and positive for both datasets. Phenotypic correlations of IBK incidence with helminth eggs per gram of faeces were moderate and positive for both datasets, but were close to zero for both datasets with tick counts. Our results suggest that genetic selection against IBK incidence in tropical cattle is feasible and that calves genetically prone to acquire IBK infection could also be genetically prone to have a slower growth. The positive genetic correlations among weight traits and between tick and helminth eggs counts suggest that they are controlled by common genes (with pleiotropic effects). Genetic correlations between IBK incidence and tick and helminth egg counts were moderate and opposite between pre

Identification of a two-marker-haplotype on Bos taurus autosome 18 associated with somatic cell score in German Holstein cattle

Directory of Open Access Journals (Sweden)

Reinsch Norbert

2009-09-01

Full Text Available Abstract Background The somatic cell score (SCS is implemented in routine sire evaluations in many countries as an indicator trait for udder health. Somatic cell score is highly correlated with clinical mastitis, and in the German Holstein population quantitative trait loci (QTL for SCS have been repeatedly mapped on Bos taurus autosome 18 (BTA18. In the present study, we report a refined analysis of previously detected QTL regions on BTA18 with the aim of identifying marker and marker haplotypes in linkage disequilibrium with SCS. A combined linkage and linkage disequilibrium approach was implemented, and association analyses of marker genotypes and maternally inherited two-marker-haplotypes were conducted to identify marker and haplotypes in linkage disequilibrium with a locus affecting SCS in the German Holstein population. Results We detected a genome-wide significant QTL within marker interval 9 (HAMP_c.366+109G>A - BMS833 in the middle to telomeric region on BTA18 and a second putative QTL in marker interval 12-13 (BB710 - PVRL2_c.392G>A. Association analyses with genotypes of markers flanking the most likely QTL positions revealed the microsatellite marker BMS833 (interval 9 to be associated with a locus affecting SCS within the families investigated. A further analysis of maternally inherited two-marker haplotypes and effects of maternally inherited two-marker-interval gametes indicated haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A to be associated with SCS in the German Holstein population. Conclusion Our results confirmed previous QTL mapping results for SCS and support the hypothesis that more than one locus presumably affects udder health in the middle to telomeric region of BTA18. However, a subsequent investigation of the reported QTL regions is necessary to verify the two-QTL hypothesis and confirm the association of two-marker-haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A with SCS. For this

Cloning the mammoth: a complicated task or just a dream?

Science.gov (United States)

Loi, Pasqualino; Saragusty, Joseph; Ptak, Grazyna

2014-01-01

Recently there has been growing interest in applying the most advanced embryological tools, particularly cloning, to bring extinct species back to life, with a particular focus on the woolly mammoth (Mammuthus primigenius). Mammoth's bodies found in the permafrost are relatively well preserved, with identifiable nuclei in their tissues. The purpose of this chapter is to review the literature published on the topic, and to present the strategies potentially suitable for a mammoth cloning project, with a frank assessment of their feasibility and the ethical issues involved.

The role of nonmagnetic d{sup 0} vs. d{sup 10}B-type cations on the magnetic exchange interactions in osmium double perovskites

Energy Technology Data Exchange (ETDEWEB)

Feng, Hai L., E-mail: Hai.Feng@cpfs.mpg.de [Max Planck Institute for Chemical Physics of Solids, Dresden 01187 (Germany); Yamaura, Kazunari [Research Center for Functional Materials, National Institute for Materials Science, Tsukuba, Ibaraki 305-0044 (Japan); Tjeng, Liu Hao [Max Planck Institute for Chemical Physics of Solids, Dresden 01187 (Germany); Jansen, Martin, E-mail: M.Jansen@fkf.mpg.de [Max Planck Institute for Chemical Physics of Solids, Dresden 01187 (Germany); Max Planck Institute for Solid State Research, Stuttgart 70569 (Germany)

2016-11-15

Polycrystalline samples of double perovskites Ba{sub 2}BOsO{sub 6} (B=Sc, Y, In) were synthesized by solid state reactions. They adopt the cubic double perovskite structures (space group, Fm-3m) with ordered B and Os arrangements. Ba{sub 2}BOsO{sub 6} (B=Sc, Y, In) show antiferromagnetic transitions at 93 K, 69 K, and 28 K, respectively. The Weiss-temperatures are −590 K for Ba{sub 2}ScOsO{sub 6}, −571 K for Ba{sub 2}YOsO{sub 6}, and −155 K for Ba{sub 2}InOsO{sub 6}. Sc{sup 3+} and Y{sup 3+} have the open-shell d{sup 0} electronic configuration, while In{sup 3+} has the closed-shell d{sup 10}. This indicates that a d{sup 0} B-type cation induces stronger overall magnetic exchange interactions in comparison to a d{sup 10}. Comparison of Ba{sub 2}BOsO{sub 6} (B=Sc, Y, In) to their Sr and Ca analogues shows that the structural distortions weaken the overall magnetic exchange interactions. - Graphical abstract: Magnetic properties of osmium double perovskites Ba{sub 2}BOsO{sub 6} (B=Sc, Y, In) were studied. Comparison of Ba{sub 2}BOsO{sub 6}indicates that a d{sup 0} B-type cation induces stronger overall magnetic exchange interactions in comparison to a d{sup 10}. - Highlights: • Magnetic properties of double perovskites Ba{sub 2}BOsO{sub 6} (B=Sc, Y, In) were studied. • A d{sup 0}B-type cation induces stronger magnetic interactions than a d{sup 10}. • Structural distortions weaken the overall Os{sup 5+}-Os{sup 5+} magnetic interactions.

Immune recognition of salivary proteins from the cattle tick Rhipicephalus microplus differs according to the genotype of the bovine host.

Science.gov (United States)

Garcia, Gustavo Rocha; Maruyama, Sandra Regina; Nelson, Kristina T; Ribeiro, José Marcos Chaves; Gardinassi, Luiz Gustavo; Maia, Antonio Augusto Mendes; Ferreira, Beatriz Rossetti; Kooyman, Frans N J; de Miranda Santos, Isabel K F

2017-03-14

Males of the cattle tick Rhipicephalus microplus produce salivary immunoglobulin-binding proteins and allotypic variations in IgG are associated with tick loads in bovines. These findings indicate that antibody responses may be essential to control tick infestations. Infestation loads with cattle ticks are heritable: some breeds carry high loads of reproductively successful ticks, in others, few ticks feed and they reproduce inefficiently. Different patterns of humoral immunity against tick salivary proteins may explain these phenotypes. We describe the profiles of humoral responses against tick salivary proteins elicited during repeated artificial infestations of bovines of a tick-resistant (Nelore) and a tick-susceptible (Holstein) breed. We measured serum levels of total IgG1, IgG2 and IgE immunoglobulins and of IgG1 and IgG2 antibodies specific for tick salivary proteins. With liquid chromatography followed by mass spectrometry we identified tick salivary proteins that were differentially recognized by serum antibodies from tick-resistant and tick-susceptible bovines in immunoblots of tick salivary proteins separated by two-dimensional electrophoresis. Baseline levels of total IgG1 and IgG2 were significantly higher in tick-susceptible Holsteins compared with resistant Nelores. Significant increases in levels of total IgG1, but not of IgG2 accompanied successive infestations in both breeds. Resistant Nelores presented with significantly higher levels of salivary-specific antibodies before and at the first challenge with tick larvae; however, by the third challenge, tick-susceptible Holsteins presented with significantly higher levels of IgG1 and IgG2 tick salivary protein-specific antibodies. Importantly, sera from tick-resistant Nelores reacted with 39 tick salivary proteins in immunoblots of salivary proteins separated in two dimensions by electrophoresis versus only 21 spots reacting with sera from tick-susceptible Holsteins. Levels of tick saliva

Fontes protéicas e energéticas com diferentes degradabilidades ruminais para novilhos de corte = Protein and Energy sources with differing degradabilities for finishing steers

Directory of Open Access Journals (Sweden)

Paola Ranzani Gabarra

2007-04-01

Full Text Available O objetivo deste trabalho foi determinar o efeito da sincronização dadegradação ruminal de fontes de amido (milho moído fino ou milho floculado e proteína (farelo de soja e uréia, no consumo de matéria seca, digestibilidade no trato total e parâmetros ruminais de novilhos Nelore em terminação. Quatro novilhos Nelore (300 kg PV foram utilizados em delineamento do tipo Quadrado Latino 4 x 4, fatorial 2 x 2: dois métodos de processamento do milho (moagem fina x floculação e duas fontes protéicas (farelo de soja x uréia. As rações continham 13% de feno de gramínea e 87% de concentrado. A floculação do milho reduziu a concentração de amido duodenal (p The objective of this study was to determine the effect of synchronization of starch (finely ground or steam-flaked corn and protein (soybean meal or urea rumen degradation on dry matter intake, total tract digestibility and rumen parameters of finishingNelore steers. Four Nelore steers (300 kg LW were utilized in a 4 x 4 Latin Square design, 2 x 2 factorial arragment: two corn processing methods (fine grinding vs. steam flaking and two protein sources (soybean meal vs. urea. The diets contained 13% grass hay and 87%concentrate. Steam flaking decreased (p < 0.01 starch concentration in duodenal digesta, which would explain lower ruminal pH (p < 0.15 and concentration of N-NH3 (p < 0.01, plasma urea-N concentration (p < 0.01; and the increased molar concentration of ruminal propionate (p < 0.01. As compared to fine grinding, steam-flaking corn increased(p < 0.01 total tract digestibility of starch (98.8 vs. 88.6%, but decreased (p < 0.01 NDF digestibility (41.9 vs. 12.1%. Protein sources had no effect on the evaluated variables. Increasing starch degradability through steam-flaking of corn improved dietary proteinutilization by beef steers.

Does aging with a cortical lesion increase fall-risk: Examining effect of age versus stroke on intensity modulation of reactive balance responses from slip-like perturbations.

Science.gov (United States)

Patel, Prakruti J; Bhatt, Tanvi

2016-10-01

We examined whether aging with and without a cerebral lesion such as stroke affects modulation of reactive balance response for recovery from increasing intensity of sudden slip-like stance perturbations. Ten young adults, older age-match adults and older chronic stroke survivors were exposed to three different levels of slip-like perturbations, level 1 (7.75m/s(2)), Level II (12.00m/s(2)) and level III (16.75m/s(2)) in stance. The center of mass (COM) state stability was computed as the shortest distance of the instantaneous COM position and velocity relative to base of support (BOS) from a theoretical threshold for backward loss of balance (BLOB). The COM position (XCOM/BOS) and velocity (ẊCOM/BOS) relative to BOS at compensatory step touchdown, compensatory step length and trunk angle at touchdown were also recorded. At liftoff, stability reduced with increasing perturbation intensity across all groups (main effect of intensity pbalance control, potentially contributing toward a higher fall risk in older stroke survivors. Copyright © 2016 IBRO. Published by Elsevier Ltd. All rights reserved.

Esophageal Dysmotility, Gastro-esophageal Reflux Disease, and Lung Transplantation: What Is the Evidence?

Science.gov (United States)

Wood, Richard K

2015-12-01

Lung transplantation is an effective and life-prolonging therapy for patients with advanced lung disease (ALD). However, long-term patient survival following lung transplantation is primarily limited by development of an inflammatory and fibrotic process involving the lung allograft known as bronchiolitis obliterans syndrome (BOS). Although the precise cause of BOS remains uncertain and is likely multifactorial, chronic aspiration of gastro-duodenal contents is one possible contributing factor. Multiple small, cross-sectional studies performed over the past two decades have reported a high prevalence of gastro-esophageal reflux disease (GERD) and esophageal dysmotility in the ALD population and several investigations suggest the prevalence may increase following lung transplantation. More recent studies evaluating the direct effect of gastro-duodenal contents on airways have demonstrated a possible biologic link between GERD and BOS. Despite the recent advances in our understanding of BOS, further investigations are needed to establish GERD as a causative factor in its development. This review will discuss the existing literature that has identified an association of GERD with ALD and post-transplant populations, with a focus on recent advances in the field.

The effect of dietary rations on the gut morphology of Zebu Cattle ...

African Journals Online (AJOL)

Studies in the Bos taurus cattle have shown the gut morphology to be affected by diet, but there is a paucity of such information in the Bos indicus cattle. A study was conducted to evaluate the morphology of digestive tract of the Tanzanian Short Horn Zebu (TSHZ) cattle under different dietary treatments. A total of 54 TSHZ ...

Factors influencing recalving rate in lactating beef cows in the sweet ...

African Journals Online (AJOL)

goups the majority was also late calving. Recalving rate was high in all other breeding groups and was not influenced by date of calving. In general, Bos taurus type cows calve significantly earlier in the calving season than Bos indicus types (Bonsma &. Skinner, 1969; Holroyd et al., 1979; Gotti el a/., 1985). This is to some ...

Nuclear and mitochondrial DNA markers in traceability of retail beef samples Marcadores de DNA nuclear e mitocondrial para rastreabilidade da carne bovina comercializada

Directory of Open Access Journals (Sweden)

Aline S.M. Cesar

2010-09-01

ém de dados da cadeia produtiva. Em geral, a empresa certificadora dispõe das informações do animal que está sendo abatido, porém não tem condições de garantir se houve erro entre abate, desossa, processamento e a distribuição dos produtos. Existe diferenciação no custo e na qualidade dos produtos cárneos, especialmente no mercado internacional, em virtude do sexo e composição racial dos animais. Os marcadores genéticos permitem identificar as características que são controladas num programa de rastreabilidade bovina tais como sexo e composição racial, permitindo identificar e avaliar corretamente para o consumidor, o produto final. A hipótese deste estudo foi que a maioria das amostras de carne bovina vendida no mercado local seria proveniente de fêmeas e com grande participação de raças Zebu. O objetivo deste trabalho foi caracterizar amostras de carne bovina com marcadores de DNA para identificar o sexo e a composição racial. Em dez pontos comerciais da cidade de Pirasssununga, SP, Brasil, foram coletadas 61 amostras e todas foram genotipadas como possuindo DNA mitocondrial Bos taurus e 18 foram positivos para amplificação do cromossomo Y (macho. Para o marcador sat1711b-Msp I a frequência alélica do A foi 0.278 e para o marcador Lhr-Hha I a frequência alélica do T foi 0.417. Os resultados das frequências alélicas do sat1711b-Msp I e Lhr-Hha I apresentaram menor proporção do genoma Bos indicus em relação ao Bos taurus quando comparado ao rebanho Nelore. Com a metodologia descrita neste trabalho foi possível avaliar o sexo e as características de subespécie das amostras de carne bovina, tendo uma importante aplicação para a certificação de produtos cárneos especialmente, em programas de rastreabilidade animal.

Quantitative trait loci mapping of calving and conformation traits on Bos taurus autosome 18 in the German Holstein population.

Science.gov (United States)

Brand, B; Baes, C; Mayer, M; Reinsch, N; Seidenspinner, T; Thaller, G; Kühn, Ch

2010-03-01

Linkage, linkage disequilibrium, and combined linkage and linkage disequilibrium analyses were performed to map quantitative trait loci (QTL) affecting calving and conformation traits on Bos taurus autosome 18 (BTA18) in the German Holstein population. Six paternal half-sib families consisting of a total of 1,054 animals were genotyped on 28 genetic markers in the telomeric region on BTA18 spanning approximately 30 Mb. Calving traits, body type traits, and udder type traits were investigated. Using univariately estimated breeding values, maternal and direct effects on calving ease and stillbirth were analyzed separately for first- and further-parity calvings. The QTL initially identified by separate linkage and linkage disequilibrium analyses could be confirmed by a combined linkage and linkage disequilibrium analysis for udder composite index, udder depth, fore udder attachment, front teat placement, body depth, rump angle, and direct effects on calving ease and stillbirth. Concurrence of QTL peaks and a similar shape of restricted log-likelihood ratio profiles were observed between udder type traits and for body depth and calving traits, respectively. Association analyses were performed for markers flanking the most likely QTL positions by applying a mixed model including a fixed allele effect of the maternally inherited allele and a random polygenic effect. Results indicated that microsatellite marker DIK4234 (located at 53.3 Mb) is associated with maternal effects on stillbirth, direct effects on calving ease, and body depth. A comparison of effects for maternally inherited DIK4234 alleles indicated a favorable, positive correlation of maternal and direct effects on calving. Additionally, the association of maternally inherited DIK4234 marker alleles with body depth implied that conformation traits might provide the functional background of the QTL for calving traits. For udder type traits, the strong coincidence of QTL peaks and the position of the QTL in a

Demographic consequences of increased winter births in a large aseasonally breeding mammal (Bos taurus) in response to climate change.

Science.gov (United States)

Burthe, Sarah; Butler, Adam; Searle, Kate R; Hall, Stephen J G; Thackeray, Stephen J; Wanless, Sarah

2011-11-01

1. Studies examining changes in the scheduling of breeding in response to climate change have focused on species with well-defined breeding seasons. Species exhibiting year-round breeding have received little attention and the magnitudes of any responses are unknown. 2. We investigated phenological data for an enclosed feral population of cattle (Bos taurus L.) in northern England exhibiting year-round breeding. This population is relatively free of human interference. 3. We assessed whether the timing of births had changed over the last 60 years, in response to increasing winter and spring temperatures, changes in herd density, and a regime of lime fertilisation. 4. Median birth date became earlier by 1·0 days per year. Analyses of the seasonal distribution of calving dates showed that significantly fewer calves were born in summer (decline from 44% of total births to 20%) and significantly more in winter (increase from 12% to 30%) over the study period. The most pronounced changes occurred in winter, with significant increases in both the proportion and number of births. Winter births arise from conceptions in the previous spring, and we considered models that investigated climate and weather variables associated with the winter preceding and the spring of conceptions. 5. The proportion of winter births was higher when the onset of the plant growing season was earlier during the spring of conceptions. This relationship was much weaker during years when the site had been fertilised with lime, suggesting that increased forage biomass was over-riding the impacts of changing plant phenology. When the onset of the growing season was late, winter births increased with female density. 6. Recruitment estimates from a stage-structured state-space population model were significantly negatively correlated with the proportion of births in the preceding winter, suggesting that calves born in winter are less likely to survive than those born in other seasons. 7.�

Diversity and population-genetic properties of copy number variations and multicopy genes in cattle

Science.gov (United States)

The diversity and population-genetics of copy number variation (CNV) in domesticated animals are not well understood. In this study, we analyzed 75 genomes of major taurine and indicine cattle breeds (including Angus, Brahman, Gir, Holstein, Jersey, Limousin, Nelore, Romagnola), sequenced to 11-fold...

Características das carcaças, biometria do trato gastrintestinal, tamanho dos órgãos internos e conteúdo gastrintestinal de bovinos F1 Simental x Nelore alimentados com dietas contendo vários níveis de concentrado

Directory of Open Access Journals (Sweden)

Ferreira Marcelo de Andrade

2000-01-01

Full Text Available A utilização de diferentes níveis de concentrado na ração (25; 37,5; 50; 62,5; e 75% foi avaliada sobre as características da carcaça, o peso dos compartimentos do trato gastrintestinal, o peso dos órgãos internos e o conteúdo do trato gastrintestinal, de 24 bovinos mestiços Simental x Nelore, não-castrados, com 17 meses de idade e peso vivo médio de 354 kg. Os animais foram abatidos quando atingiram 500 kg de peso vivo. Após o resfriamento, as carcaças foram avaliadas qualitativa (área de olho de lombo e quantitativamente (medições, rendimentos e cortes básicos. O rendimento da carcaça e dos cortes básicos, a área de olho de lombo e as proporções de músculo e gordura não foram influenciados pelos níveis de concentrado, enquanto o comprimento de carcaça diminuiu linearmente com o aumento do nível de concentrado. O conteúdo do trato gastrintestinal diminuiu linearmente com a adição de concentrado na ração. Não houve efeito dos níveis de concentrado nos pesos de coração, pulmão e rúmen-retículo. Os pesos de fígado, rins, baço, abomaso, intestino delgado e gordura interna aumentaram e o do omaso diminuiu linearmente com a adição de concentrado na dieta.

NCBI nr-aa BLAST: CBRC-AGAM-04-0111 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-AGAM-04-0111 ref|NP_001029470.1| non imprinted in Prader-Willi/Angelman syndro...me 2 [Bos taurus] sp|Q3SWX0|NIPA2_BOVIN Non-imprinted in Prader-Willi/Angelman syndrome region protein 2 hom...olog gb|AAI04628.1| Non imprinted in Prader-Willi/Angelman syndrome 2 [Bos taurus] NP_001029470.1 2e-72 51% ...

NCBI nr-aa BLAST: CBRC-ACAR-01-0762 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0762 ref|NP_001070374.1| hypothetical protein LOC534616 [Bos taurus] sp|P32749|CHLE_BOVIN Choli...nesterase precursor (Acylcholine acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholi...nesterase) gb|AAI23601.1| Similar to Cholinesterase precursor (Acylcholine acylhydrolase) (Choli...ne esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Bos taurus] NP_001070374.1 2e-97 40% ...

NCBI nr-aa BLAST: CBRC-XTRO-01-3294 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-3294 ref|NP_001070374.1| hypothetical protein LOC534616 [Bos taurus] sp|P32749|CHLE_BOVIN Choli...nesterase precursor (Acylcholine acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholi...nesterase) gb|AAI23601.1| Similar to Cholinesterase precursor (Acylcholine acylhydrolase) (Choli...ne esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Bos taurus] NP_001070374.1 1e-135 48% ...

Antibiogram profile of pathogens isolated from processed cow meat

African Journals Online (AJOL)

2016-06-30

Jun 30, 2016 ... Cow meat or beef is the culinary name for meat from bovines especially cattle. The generic name of cow meat is Bos taurus and the habitable weather of Bos taurus includes temperature of 101.50F (38.60C) and ability to live in a harsh terrains (Li et al., 2006). The processing of cow meat begins from ...

Toxoplasma gondii in experimentally infected Bos taurus and Bos indicus semen and tissues Toxoplasma gondii em semen e tecidos de Bos taurus and Bos indicus experimentalmente infectados

Directory of Open Access Journals (Sweden)

Leslie Scarpelli

2009-01-01

Full Text Available Eighteen young steers were inoculated with Toxoplasma gondii and randomly distributed into three groups of six animals each: GI, 2.5x10(5 "P" strain oocysts, GII, 5.0x10(6 "RH" strain tachyzoites, and GIII (Control. Clinical, serological and parasitemia exams were realized. Parasite investigation by bioassay and PCR was realized on semen and fragments of skeletal musculature, lymph nodes, brain, retina, spleen, liver, lung, testicle, epididymis and seminal vesicle. Blood and semen samples were collected on days -2, -1, 1, 3, 5, 7, 14 and weekly thereafter, up to postinfection day (PID 84. The inoculated steers (GI and GII presented hyperthermia from PID 3 to 16. Antibodies against T. gondii were detected through the indirect fluorescence antibody test (IFAT on PID 5 (1:16 in both inoculated groups (oocysts and tachyzoites, reaching peaks of 1:4096 on PID 7. Parasitemia outbursts occurred in all infected bovines, principally from PID 7 to 28, independent of the strain and inoculate used. Bioassays revealed the presence of parasites in semen samples of animals infected with oocysts (GI and tachyzoites (GII on several experimental days between PID 7 and 84. Tissue parasitism by T. gondii was diagnosed by bioassay and the PCR technique in several organ and tissue fragments. These findings suggest the possibility of sexual transmission of T. gondii in the bovine species.Dezoito bovinos foram inoculados com Toxoplasma gondii e distribuídos aleatoriamente em três grupos de seis bovinos cada: GI (2,5x10(5 oocistos da cepa "P", GII (5,0x10(6 taquizoítos da cepa "RH" e GIII (controle. Exames clínicos, sorológicos e parasitêmicos foram realizados. Pesquisas do parasito, por meio da bioprova e pela técnica de Reação em Cadeia pela Polimerase (PCR, foram realizadas no sêmen e em fragmentos de musculatura esquelética, linfonodos, cérebro, retina, baço, fígado, pulmão, testículo, epidídimo e vesícula seminal. Amostras de sangue e sêmen foram colhidas nos dias -2, -1, 1, 3, 5, 7, 14 e, semanalmente, até o 84º dia pós-infecção (DPI. Os bovinos inoculados (GI e GII apresentaram hipertermia do 3º ao 16º DPI. Anticorpos contra T. gondii foram detectados (IFI no 5º DPI (1:16, em ambos grupos inoculados (oocistos e taquizoítos, atingindo picos de 1:4096 no 7º DPI. Surtos parasitêmicos ocorreram em todos os bovinos infectados, principalmente do 7º ao 28º DPI, independente da cepa e inóculo utilizados. O bioensaio revelou a presença do parasito em amostras seminais dos bovinos infectados com oocistos (GI e taquizoítos (GII, em diversas datas experimentais, entre o 7º e 84º DPI. Parasitismo tissular por T. gondii foi diagnosticado por meio da bioprova e pela técnica da PCR, em vários fragmentos de tecidos e/ou órgãos. Os achados sugerem a possibilidade da ocorrência da transmissão sexual do T. gondii na espécie bovina.

Efeito do período de coleta de urina, dos níveis de concentrado e de fontes protéicas sobre a excreção de creatinina, de uréia e de derivados de purina e a produção microbiana em bovinos Nelore Effect of urinary collection days, concentrate levels and protein sources on creatinine, urea and purine derivatives excretions and microbial protein synthesis in Nellore cattle

Directory of Open Access Journals (Sweden)

Analívia Martins Barbosa

2006-06-01

Full Text Available O efeito do período de coleta de urina sobre a excreção urinária de creatinina, uréia e derivados de purinas (DP, as purinas absorvidas e a produção de compostos nitrogenados microbianos (Nmic foi avaliado em bovinos Nelore de quatro categorias: novilhas, machos castrados, machos não-castrados e vacas em lactação. A produção de Nmic obtida em amostras spot de urina foi comparada àquela obtida via coleta total. Dezesseis animais da raça Nelore mantidos em confinamento foram distribuídos em delineamento inteiramente casualizado em esquema de parcelas subdivididas, tendo nas parcelas os tratamentos em esquema fatorial 2 x 4 (dois níveis de concentrado, 25 ou 50%, e quatro categorias de bovinos, novilhas, machos castrados, machos não-castrados e vacas em lactação e nas subparcelas os seis dias de coleta. Não houve interação entre níveis de concentrado, categorias de animal e dias de coleta para as variáveis avaliadas. O volume urinário não foi influenciado pelos níveis de concentrado e os dias de coleta, contudo, foi significativamente maior para as vacas. A excreção de creatinina não foi afetada pelos tratamentos e dias de coletas, observando-se média de 27,1 mg/kg0,75. As purinas absorvidas e a produção de Nmic também não foram influenciadas pelos tratamentos e os dias de coleta. A produção de Nmic, estimada pela amostra spot de urina, não diferiu daquela obtida pela coleta total, nem entre os níveis de concentrado ou entre as categorias de animal. Concluiu-se que o período de coleta de urina de 24 horas é suficiente para experimentos utilizando animais Nelore, independentemente de serem novilhas, machos castrados ou não-castrados ou vacas, e que a coleta de amostra spot de urina também pode ser usada para estimar a produção de Nmic.The effects of collection days on urinary excretion of creatinine and purine derivatives (PD, absorbed purines and microbial N synthesis (Nmic were evaluated in different

Quality of aged meat from Charolais vs nellore cattleQualidade da carne maturada de bovines Charolês vs nelore

Directory of Open Access Journals (Sweden)

Louise Manha Perez

2012-02-01

Full Text Available The aim of this study was evaluate the physical-chemical changes in aged meat from Charolais x Nellore cattle. For that, 38 male with an average weight of 437.08 ± 15.06 kg, were used. After 24 hours of refrigeration, the half right carcass was cut in the 13ª rib to collect 35cm samples from Longissimus dorsi muscle. The samples were sliced, vacuum packed and aged for zero, seven and fourteen days, after the ageing time, the samples were frozen, to make analysis of exudate water loss, shear force, pressing water loss, pH, color (L, a*, b*, chroma and hue value, sensorial analysis, microbiology, and myofibrillar fragmentation index. The experimental design was completely randomized and the data were submitted to analysis of variance and the means compared by Tukey test in 5%. The microbiological analysis showed that all the bacterium evaluated had their growth period until the aged day seven, and decreased to the aged day 14. The pH decreased with the increasing of time. The water loss and myofibrillar fragmentation index weren’t affected by the ageing period. Shear force and color components (L*, a*, b* chroma and hue value were affected by the ageing, being the 14 days the best result. The sensorial analysis has only show differences to tenderness. The aged cattle beef vacuum packed did not lose the fresh meat characteristics, however improved the tenderness.Com o presente trabalho objetivou-se avaliar as alterações físico-químicas na carne maturada de bovinos Charolês x Nelore. Para isso foram utilizados 38 bovinos inteiros, abatidos com peso médio de 437,08 (± 15,06 kg. Após 24 horas de resfriamento, as meias carcaças direita foram seccionadas na altura da 13ª costela para retirada de uma amostra de 35 cm do músculo longissimus dorsi (contra-filé, em sentido caudal – cranial. As amostras foram fatiadas, embaladas a vácuo e maturadas por zero, sete e quatorze dias. Após o término do período de maturação as carnes foram

Fatores determinantes do desempenho reprodutivo de vacas Nelore na região dos Cerrados do Brasil Central Factors affecting the reproductive performance of Nellore cows on the Cerrado conditions of Central Brazil

Directory of Open Access Journals (Sweden)

Antonio Vieira

2005-12-01

Full Text Available Avaliou-se, durante quatro estações de monta (1/11 a 31/1 do ano seguinte, o efeito da ordem de parto (OP e da condição corporal (CC, segundo escala de 1 (magra a 5 (gorda, sobre o desempenho reprodutivo de 468 fêmeas Nelore, sendo 391 vacas multíparas e 77 primíparas, em pastagem de Brachiaria decumbens Stapf, na região dos Cerrados, no Brasil Central. A OP teve efeito quadrático na taxa de prenhez (TP. Vacas OP1 apresentaram TP de 69%, OP5 a OP8 de 90%, com declínio gradual até 80% de prenhez na OP12. A CC à desmama afetou a TP. Pela análise de regressão, vacas OP1 com CC 2,0 e 3,5 tiveram TP de 52,7 e 82,5%, respectivamente. Observou-se TP DE 96% em vacas com OP4 e OP8 e CC 3,5. A TP de vacas OP1 com parição tardia foi de 37,7%, mas, independentemente da OP, vacas que pariram no início da temporada tiveram TP superiores a 80%. Vacas OP1 pariram 350,12 dias após o início da monta, enquanto aquelas com OP superiores, necessitaram de 328,32 dias. Vacas OP1 apresentaram o mais longo intervalo de partos (IP, com 392,10 dias, ao passo que o IP das OP5 a OP9 foi de 365 dias. O IP foi afetado pelo ano, pela OP, pelo número de dias necessários para parir na estação de parição e pela variação de peso na estação de cobrição. O peso vivo e a CC das vacas à desmama foram afetados pela OP e pelo ano. O peso à desmama (PD do bezerro aumentou da OP1 até a OP4/OP5, de modo que as vacas OP1 proporcionaram PD de 159 kg e a média dos PD das OP foi de 169 kg. Altos índices produtivos e reprodutivos são obtidos entre OP3 e OP8 com CC acima de 3,0 e 3,5 em vacas Nelore multíparas e prímaparas, respectivamente.The objective of this trial was to evaluate the effects of calving order (CO and body condition score (BCS, scale 1(thin to 5 (fat, on reproductive performance of 468 Nellore cows (391 multiparous and 77 primiparous grazing Brachiaria decumbens Stapf at Brazilian Central West (Cerrados region during four breeding seasons

DEFICIÊNCIA DE COBALTO EM BOVINOS EM BARRA DO GARÇA – ESTADO DO MATO GROSSO COBALT DEFICIENCY IN BOVINES IN BARRA DO GARÇA, MATO GROSSO STATE, BRAZIL

Directory of Open Access Journals (Sweden)

Fernando Melgaço da Costa

2007-09-01

Full Text Available

O presente trabalho relata o diagnóstico da deficiência de cobalto em 2 bezerros mestiços de nelore, provenientes de Barra do Garça, Distrito de Xavantina—MT. As alterações clínicas e resultados laboratoriais encontrados permitiram o diagnóstico que foi confirmado pelo resultado do tratamento empregado com sulfato de cobalto e Vitamina B12. Alterações macro e microscópicas foram determinadas em um dos animais.

This paper describes the diagnosis of cobalt deficiency in two Nelore claves from Barra do Garça, district of Xavantina - MT. The diagnosis was possible through clinical and laboratory results, and was confirmed by the treatment with cobalt sulphate and B12 vitamin. The macro and microscopical changes presented in the dead animal are also described in this paper.

Pemodelan Sistem Informasi Untuk Mengukur Kualitas Kinerja Perguruan Tinggi dengan Pendekatan Balanced Scorecard dan Blue Ocean Strategy

Directory of Open Access Journals (Sweden)

Herlinah Baharuddin

2016-01-01

Full Text Available Semakin tingginya persaingan saat ini, khususnya perguruan tinggi bidang pendidikan, memunculkan kebutuhan strategi bisnis untuk bertahan. Pemodelan Sistem Informasi dengan pendekatan Balanced Scorecardkini merupakan salah satu tujuan dalam pencapaian pengukuran hasil kinerja untuk mencapai sasaran perguruan tinggi serta menciptakan inovasi solusi dengan menerapkan Blue Ocean sehingga selaras dengan strategi bisnis yang dijalankan. Pemodelan sistem informasi yang akan dibahas adalah menggunakan strategi bisnis Balanced Scorecard (BSC diintegrasikan dengan Blue Ocean Strategy (BOS. Dengan sifat-sifat pada BSC dan BOS, model ini menjawab kebutuhan Strategi Sistem Informasi pada perguruan tinggi yang berkarakteristik dinamis, inovatif, dan tingkat persaingan tinggi dengan hasil pencapaian kinerja yang terukur. Pemodelan sistem informasi diimplementasikan pada Universitas Pancasakti Makassar. Hasil menunjukkan komponen-komponen perguruan tinggi yang dipetakan ke dalam 4 perspektif BSC, yaitu perspektif pelanggan, finansial, proses bisnis internal, pembelajaran dan pertumbuhan dan kanvas strategi serta kerangka kerja 4 langkah pada BOS yaitu kurangi-tingkatkan-hapus-ciptakan. Hasil penelitian berupa pengukuran penilaian kinerja dengan program aplikasi berbasis web, yang merupakan bagian dari sistem informasi management perguruan tinggi. Sistem ini memberikan informasi kepada seluruh anggota yang terkait tentang kualitas kinerja. Kata kunci : Balanced Scorecard(BSC; Kualitas kinerja; Blue ocean strategy(BOS; Web; Perguruan tinggi

Desempenho e características de carcaça de bovinos Nelore em confinamento alimentados com bagaço de cana-de-açúcar e diferentes fontes energéticas Performance and carcass characteristics of feedlot Nellore fed diets containing sugarcane bagasse and different energy sources

Directory of Open Access Journals (Sweden)

Jane Maria Bertocco Ezequiel

2006-10-01

Full Text Available Avaliaram-se o ganho de peso e as características da carcaça de bovinos Nelore alimentados com bagaço de cana-de-açúcar (in natura ou hidrolisado como volumoso e concentrado contendo farelo de gérmen de milho, casca do grão de soja ou polpa de citrus em substituição parcial (50% ao milho. Quarenta bovinos Nelore (peso médio inicial de 340 kg e idade inicial de 32 meses foram alimentados com quatro dietas fornecidas na proporção volumoso:concentrado 39:61. As fontes substitutivas do milho não afetaram o peso final (470,8; 478,6; 476,4 e 475,3 kg e o ganho médio diário (1,1; 1,1; 1,1 e 1,2 kg/animal/dia. Não houve efeito sobre o rendimento de carcaça (55,3; 55,3; 54,0 e 54,8%, a área de Longissimus (24,2; 23,0; 25,0 e 23,2 cm²/100 kg de carcaça e a espessura de gordura (4,4; 5,6; 4,7 e 4,4 mm. O menor custo por arroba foi observado no tratamento com polpa de citrus (R$ 44,20, seguido do farelo de gérmen de milho (R$ 48,80 e da casca de soja (R$ 50,80, porém, quando utilizado somente o milho, o custo da arroba foi de R$ 51,80. O milho moído pode ser parcialmente substituído pelo farelo de gérmen de milho, pela casca de soja ou pela polpa de citrus em dietas para bovinos em confinamento alimentados com bagaço de cana-de-açúcar (in natura ou hidrolisado como volumoso, pois a substituição não alterou o ganho de peso e as características de carcaça.The objective of this trial was to evaluate weight gain and carcass traits of feedlot Nellore fed diets containing sugarcane bagasse and one of the following concentrate sources: corn germ meal, soybean hulls or citrus pulp that partially (50% DM replaced ground corn in the diet. The four experimental diets were formulated to yield a forage:concentrate ratio of 39:61. Forty Nellore animals averaging 340 kg of body weight and 32 months of age at the beginning of the trial were used. No significant differences on final weight (470.8, 478.6, 476.4, and 475.3 kg, weight gain (1

Análise genética de escores de avaliação visual de bovinos com modelos bayesianos de limiar e linear Genetic analysis for visual scores of bovines with the linear and threshold bayesian models

Directory of Open Access Journals (Sweden)

Carina Ubirajara de Faria

2008-07-01

Full Text Available O objetivo deste trabalho foi comparar as estimativas de parâmetros genéticos obtidas em análises bayesianas uni-característica e bi-característica, em modelo animal linear e de limiar, considerando-se as características categóricas morfológicas de bovinos da raça Nelore. Os dados de musculosidade, estrutura física e conformação foram obtidos entre 2000 e 2005, em 3.864 animais de 13 fazendas participantes do Programa Nelore Brasil. Foram realizadas análises bayesianas uni e bi-características, em modelos de limiar e linear. De modo geral, os modelos de limiar e linear foram eficientes na estimação dos parâmetros genéticos para escores visuais em análises bayesianas uni-características. Nas análises bi-características, observou-se que: com utilização de dados contínuos e categóricos, o modelo de limiar proporcionou estimativas de correlação genética de maior magnitude do que aquelas do modelo linear; e com o uso de dados categóricos, as estimativas de herdabilidade foram semelhantes. A vantagem do modelo linear foi o menor tempo gasto no processamento das análises. Na avaliação genética de animais para escores visuais, o uso do modelo de limiar ou linear não influenciou a classificação dos animais, quanto aos valores genéticos preditos, o que indica que ambos os modelos podem ser utilizados em programas de melhoramento genético.The objective of this work was to compare the estimates of genetic parameters obtained in single-trait and two-trait bayesian analyses, under linear and threshold animal models, considering categorical morphological traits of bovines of the Nelore breed. Data of musculature, physical structure and conformation were obtained between years 2000 and 2005, from 3,864 bovines of the Nelore breed from 13 participant farms of the Nelore Brazil Program. Single-trait and two-trait bayesian analyses were performed under linear and threshold animal models. In general, the linear and threshold

Desempenho de diferentes grupos genéticos de bovinos de corte em confinamento Performance evaluation of different beef cattle genetic groups under feedlot

Directory of Open Access Journals (Sweden)

Kepler Euclides Filho

2003-10-01

Full Text Available Foram utilizadas informações provenientes de 188 animais, pertencentes a dez grupos genéticos, avaliados em confinamento. Para as análises dos dados, os animais foram agrupados em três subconjuntos considerando-se idade, sexo e dieta recebida. Os subconjuntos analisados foram: 1 animais inteiros de sobreano recebendo a dieta "a": 39 Nelore (N, 12 Brangus (BR, 8 1/2 Simental-1/2 Nelore (SN, 8 1/2 Caracu-1/2 Nelore (CCN, 21 1/2 Valdostana-1/2 Nelore (VAN; 2 animais inteiros desmamados recebendo a dieta "b": 12 N, 12 1/2 Canchim-1/4 Angus-1/4 Nelore (CAN, 16 1/2 Canchim-1/4 Simental-1/4 Nelore (CSN, 12 1/2 Braford-1/2 Brangus (BDBR, 12 1/2 Braford-1/4 Angus-1/4 Nelore (BDAN, 7 1/2 Brahman-1/4 Angus-1/4 Nelore (BHAN; 3 fêmeas desmamadas recebendo a dieta "b" em duas formulações, uma em que o concentrado representou 30% da MS e o outro, em que o concentrado correspondeu a 50% da MS total. Neste caso, a análise incluiu 29 fêmeas, 15 CAN e 14 CSN. Para os animais dos subconjuntos 1 e 2, o concentrado foi fornecido para atender 50% da MS total da dieta. Os animais do subconjunto 1 apresentaram desempenhos semelhantes, com ganho de peso diário médio igual a 1,60 kg/dia e com conversão alimentar igual a 6,36 kg de MS ingerida/kg de ganho de peso. Para o ganho de peso diário médio e para a conversão alimentar, somente foram observadas diferenças entre os animais do subconjunto 2. O maior ganho de peso diário médio foi observado para os animais CSN (1,69 kg/dia e as melhores conversões alimentares foram verificadas para os animais CSN e BHAN (4,76 kg de MS ingerida/kg de ganho de peso e 4,67 kg de MS ingerida/kg de ganho de peso, respectivamente. Para o subconjunto 3 não houve diferenças entre os grupos genéticos, mas a formulação da dieta apresentou efeitos significativos importantes, especialmente, para conversão alimentar. Os animais da formulação com menor teor de concentrado apresentaram melhor conversão alimentar (5,58 kg

The Bosnian Train and Equip Program: A Lesson in Interagency Integration of Hard and Soft Power

Science.gov (United States)

2014-03-01

even before Bos- nia officially declared independence. Most of the weaponry and commanders from the former Yugoslav People’s Army in Bosnia, which was...ability, and disposition.” 505 It covers characteristics that research indicates affect team performance including attitudinal, de- mographic, and...The Train and Equip Program reduced foreign influence in the Federation, which helped remove impediments to reconciliation and integration in Bos- nia

Adgang til sundhedsservice i yderområder

DEFF Research Database (Denmark)

Sørensen, Jens Fyhn Lykke; Svendsen, Gunnar Lind Haase

Denne undersøgelse har til formål at belyse motiver bag landlig og urban bosætning. I særdeleshed fokuseres på, om udbuddet af sundhedsydelser har afgørende betydning for bosætningen og - i så fald - om anvendelsen af eHealth løsninger kan modvirke en fraflytning af borgere i egne, der er ramt af...

Functional assays for the assessment of the pathogenicity of variants of GOSR2, an ER-to-Golgi SNARE involved in progressive myoclonus epilepsies

Directory of Open Access Journals (Sweden)

Jörn M. Völker

2017-12-01

Full Text Available Progressive myoclonus epilepsies (PMEs are inherited disorders characterized by myoclonus, generalized tonic-clonic seizures, and ataxia. One of the genes that is associated with PME is the ER-to-Golgi Qb-SNARE GOSR2, which forms a SNARE complex with syntaxin-5, Bet1 and Sec22b. Most PME patients are homo­zygous for a p.Gly144Trp mutation and develop similar clinical presentations. Recently, a patient who was compound heterozygous for p.Gly144Trp and a previously unseen p.Lys164del mutation was identified. Because this patient presented with a milder disease phenotype, we hypothesized that the p.Lys164del mutation may be less severe compared to p.Gly144Trp. To characterize the effect of the p.Gly144Trp and p.Lys164del mutations, both of which are present in the SNARE motif of GOSR2, we examined the corresponding mutations in the yeast ortholog Bos1. Yeasts expressing the orthologous mutants in Bos1 showed impaired growth, suggesting a partial loss of function, which was more severe for the Bos1 p.Gly176Trp mutation. Using anisotropy and gel filtration, we report that Bos1 p.Gly176Trp and p.Arg196del are capable of complex formation, but with partly reduced activity. Molecular dynamics (MD simulations showed that the hydrophobic core, which triggers SNARE complex formation, is compromised due to the glycine-to-tryptophan substitution in both GOSR2 and Bos1. In contrast, the deletion of residue p.Lys164 (or p.Arg196del in Bos1 interferes with the formation of hydrogen bonds between GOSR2 and syntaxin-5. Despite these perturbations, all SNARE complexes stayed intact during longer simulations. Thus, our data suggest that the milder course of disease in compound heterozygous PME is due to less severe impairment of the SNARE function.

Efeitos da seleção para peso pós-desmame sobre medidas corporais e perímetro escrotal de machos Nelore de Sertãozinho (SP Effects of post-weaning weight selection on body measurements and scrotal perimeter in Nellore males of Sertãozinho (SP

Directory of Open Access Journals (Sweden)

Joslaine Noely dos Santos Gonçalves Cyrillo

2000-04-01

Full Text Available O objetivo deste estudo foi avaliar o efeito indireto da seleção para peso pós-desmame sobre medidas corporais e perímetro escrotal de 809 machos Nelore, pertencentes às populações selecionadas (NeS e NeT e controle (NeC, da Estação Experimental de Zootecnia de Sertãozinho. As análises estatísticas foram executadas usando-se modelos de touros, sendo que a fonte de variação aleatória, touro, foi aninhada dentro de rebanho. Os efeitos fixos considerados foram: rebanho, ano de realização da Prova de Ganho de Peso (PGP, idade de vaca em anos e idade do animal em dias como covariável. A mudança genética, obtida como a diferença dos rebanhos selecionados em relação ao rebanho controle, foi 40,2 e 44,3 kg, para peso aos 378 dias (P378, para os rebanhos NeS e NeT, respectivamente. As mudanças para as demais características, na mesma ordem, foram 4,5 e 4,5 cm para altura na garupa (ATPF; 6,2 e 7,0 cm para perímetro torácico (PTOR; 5,8 e 6,3 cm para comprimento do corpo (COM; 2,9 e 2,0 cm para comprimento do dorso (DOR; 1,7 e 2,4 cm para comprimento da garupa, (GAR; 1,0 e 1,3 cm para distância de ísquios (ISQ; 1,8 e 2,6 cm para distância de íleos (ILEO; e 1,3 e 2,2 cm para perímetro escrotal (PE. Os resultados deste estudo mostraram que a seleção direta para peso pós-desmame promoveu respostas positivas correlacionadas nas dimensões de regiões do corpo de machos Nelore.The objective of this study was to evaluate the indirect effects of selection for post-weaning weight on body measures and scrotal perimeter of 809 Nellore males from selected herds (NeS and NeT and control herd (NeC, of the Estação Experimental de Zootecnia de Sertãozinho. The statistical analyses were performed by using a sire mixed model where the random source of variation, sires, was nested within herds. The fixed effects were herds, year of performance test (PGP, age of cow and age of the animal as a covariate. The average genetic change for

Correlações simples entre as medidas de ultra-som e a composição da carcaça de bovinos jovens Correlations between ultrasound measurements and carcass composition of young bulls

Directory of Open Access Journals (Sweden)

Liliane Suguisawa

2006-02-01

Full Text Available Neste estudo avaliaram-se as correlações entre as medidas ultra-sonográficas e as características de carcaça de 115 bovinos jovens (Nelore, ½ Angus Nelore, ½ Simental Nelore e Canchim, com peso inicial médio de 329 kg e dois tamanhos à maturidade (pequeno e grande, em um sistema de produção do novilho superprecoce. Aos 120 dias de confinamento, foram realizadas a pesagem e medida da área de olho-de-lombo (AOL e da gordura subcutânea (ECG, via ultra-sonografia. Após o abate, foram coletadas as medidas de AOL e ECG na carcaça e os pesos de traseiro, dianteiro e cortes cárneos comerciais, determinando-se também a composição corporal dos animais. Foram calculados os rendimentos de carcaça, cortes cárneos, traseiro, da AOL ultra-som por 100 kg de PV e da AOL carcaça por 100 kg de peso de carcaça. Dados da composição da carcaça indicaram alta deposição muscular nos animais ½ Simental Nelore e Canchim e expressiva deposição de tecido adiposo nos animais Nelore. No entanto, os animais ½ Angus Nelore mostraram-se mais apropriados para confinamento no sistema de produção do superprecoce, pois equilibraram musculosidade e gordura de acabamento. Os resultados demonstraram que a AOL tem relação com a musculosidade da carcaça e que, à medida que há seleção para o incremento desta característica, ocorre diminuição da ECG, como resultado da correlação negativa da ECG com a porcentagem de traseiro e AOL. Não foi observada diferença na composição entre os dois grupos de tamanho à maturidade, provavelmente em razão da pequena variação entre eles. Como as correlações envolvendo a AOL e a ECG por ultra-som e as mesmas medidas na carcaça apresentam resultados similares, validou-se a utilização da técnica da ultra-sonografia como alternativa para predição das características da carcaça de bovinos.The objective of this study was to evaluate correlations between ultrasonography measurements and carcass

Avaliação clínico-laboratorial de bovinos Nelore infectados experimentalmente com Trypanosoma vivax Clinical and laboratorial evaluation of Nellore cattle experimentally infected with Trypanosoma vivax

Directory of Open Access Journals (Sweden)

Maria A. M. Schenk

2001-12-01

Full Text Available Avaliaram-se as alterações clínico-laboratoriais de seis bezerros Nelore, de ambos os sexos, inoculados experimentalmente com 10(7 organismos viáveis de Trypanosoma vivax, isolados de bovinos da região de Poconé, Estado de Mato Grosso. Os animais foram observados diariamente, durante 30 dias, quanto aos parâmetros de temperatura retal, volume globular (VG, parasitemia, produção de anticorpos, coloração de mucosas, comportamento e apetite. Determinaram-se os níveis séricos de aspartato aminotransferase (AST, fosfatase alcalina (FA, gama glutamiltransferase (GGT, creatina kinase (CK, colesterol, uréia, creatinina, cálcio, fósforo e o perfil eletroforético das proteínas séricas aos 4, 8, 12, 16, 23 e 30 dias pós-inoculação (DPI. Durante os 6 meses seguintes, os animais foram observados semanalmente, avaliando-se a temperatura retal, o VG e a parasitemia. T. vivax foi evidenciado a partir do terceiro e quarto DPI em todos os bezerros e persistiu até o 30° DPI em cinco dos seis animais em estudo. Ocorreu um decréscimo significativo (pIn order to evaluate the clinical-laboratorial alterations, six Nellore calves were inoculated with 10(7 Trypanosoma vivax isolated from Poconé region, Mato Grosso, Brazil. The animals were evaluated daily for rectal temperature, packed cell volume (PCV, parasitemia, antibody production, color of mucous membranes, behavior and appetite. Blood and serum samples for biochemical evaluation for aspartate aminotransferase (AST, alkaline phosphatase (AF, gamma glutamyltransferase (GGT, cholesterol, urea, creatinine, creatine kinase (CK, calcium, phosphorus and proteinogram were collected on days 4, 8, 12, 16, 23 and 30 post inoculation (DPI. During the following 6 months rectal temperature, PCV and parasitemia were evaluated weekly. T. vivax was evidenced from 1 DPI in all calves and persisted until day 30 in five of six animals. A remarkable decrease (p<0.05 of PCV mean value (25% was observed on 10

Selectivity of thiobencarb between two lettuce (Lactuca sativa, L.) cultivars

International Nuclear Information System (INIS)

Reiners, S.

1987-01-01

Thiobencarb [S-(4-chlorobenzyl)N,N-diethylthiocarbamate] was examined for weed control on muck grown lettuce. Weed control results were erratic though differential lettuce tolerance was observed in the field. This led to the testing of five lettuce cultivars for tolerance to the herbicide. Of the five lettuce cultivars evaluated, two were selected with the widest tolerance differences: Great Lakes 366 (GLA) (tolerant) and Dark Green Boston (BOS) (susceptible). Studies examining the mechanism of thiobencarb tolerance were conducted with these two cultivars. Within four days after the addition of thiobencarb to the nutrient solution, BOS had significant reductions in the foliar dry weight. In addition, growth abnormalities including fused leaves were observed, indicating inhibition early in leaf development. Greater amounts of 14 C-thiobencarb were absorbed from nutrient solution by BOS, likely due to a significantly greater root system at the time of treatment. The greater uptake and accumulation of 14 C-label in the leaves, as well as significantly greater amounts of unmetabolized 14 C-thiobencarb in the foliage of BOS may account for the selectivity observed. A thiobencarb sulfoxide was not identified in these studies. This indicates that the metabolism of thiobencarb in lettuce differs from other members of the thiocarbamate family of herbicides

Limitations in the use of 14C-glycocholate breath and stool bile acid determinations in patients with chronic diarrhea

International Nuclear Information System (INIS)

Ferguson, J.; Walker, K.; Thomson, A.B.

1986-01-01

Analysis of a modified 14 C-glycocholate breath test on 165 consecutive in-patients being investigated for chronic diarrhea showed that the measurement of 14 CO 2 between 3 and 6 h after oral dosing of 5 microCi of 14 C-glycocholic acid was of only limited use to distinguish between patients with Crohn's disease (CD), idiopathic bile salt wastage (IBW), or ileal resection (IR) from those with the irritable bowel syndrome (IBS). Continuing 14 CO 2 collections for up to 24 h was of little more help in establishing the presence of bacterial overgrowth syndrome (BOS) and in distinguishing between BOS and CD. Stool bile acid measurements were of use in differentiating between IBW and IBS, but did not distinguish between CD and BOS or between CD and IR. Since the range of normal values was defined by measurements in the IBS group, a positive test was specific for an organic cause of chronic diarrhea. Even so, the sensitivity of the test was relatively low: CD, 53%; IR, 23%; IBW, 14 %; and BOS, 10%. We believe that the 24-h 14 C-glycocholic breath test combined with the measurement of stool bile acids represents a screening test of only limited use for the identification of organic causes of chronic diarrhea

Low-cost modular array-field designs for flat-panel and concentrator photovoltaic systems

Science.gov (United States)

Post, H. N.; Carmichael, D. C.; Alexander, G.; Castle, J. A.

1982-09-01

Described are the design and development of low-cost, modular array fields for flat-panel and concentrator photovoltaic (PV) systems. The objective of the work was to reduce substantially the cost of the array-field Balance-of-System (BOS) subsystems and site-specific design costs as compared to previous PV installations. These subsystems include site preparation, foundations, support structures, electrical writing, grounding, lightning protection, electromagnetic interference considerations, and controls. To reduce these BOS and design costs, standardized modular (building-block) designs for flat-panel and concentrator array fields have been developed that are fully integrated and optimized for lowest life-cycle costs. Using drawings and specifications now available, these building-block designs can be used in multiples to install various size array fields. The developed designs are immediately applicable (1982) and reduce the array-field BOS costs to a fraction of previous costs.

NCBI nr-aa BLAST: CBRC-STRI-01-2632 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2632 ref|NP_001029470.1| non imprinted in Prader-Willi/Angelman syndro...me 2 [Bos taurus] sp|Q3SWX0|NIPA2_BOVIN RecName: Full=Magnesium transporter NIPA2; AltName: Full=Non-imprint...ed in Prader-Willi/Angelman syndrome region protein 2 homolog gb|AAI04628.1| Non imprinted in Prader-Willi/Angelman syndrome 2 [Bos taurus] NP_001029470.1 1e-140 88% ...

Whole-genome sequencing reveals mutational landscape underlying phenotypic differences between two widespread Chinese cattle breeds

OpenAIRE

Xu, Yao; Jiang, Yu; Shi, Tao; Cai, Hanfang; Lan, Xianyong; Zhao, Xin; Plath, Martin; Chen, Hong

2017-01-01

Whole-genome sequencing provides a powerful tool to obtain more genetic variability that could produce a range of benefits for cattle breeding industry. Nanyang (Bos indicus) and Qinchuan (Bos taurus) are two important Chinese indigenous cattle breeds with distinct phenotypes. To identify the genetic characteristics responsible for variation in phenotypes between the two breeds, in the present study, we for the first time sequenced the genomes of four Nanyang and four Qinchuan cattle with 10 ...

Impact of body condition on pregnancy rate of cows nellore under pasture in fixed time artificial insemination (tai programImpacto da condição corporal sobre a taxa de prenhez de vacas da raça nelore sob regime de pasto em programa de inseminação artificial em tempo fixo (iatf

Directory of Open Access Journals (Sweden)

Marcelle Christine Nascimento Ferreira

2013-09-01

Full Text Available The aim of this study was to evaluate the impact of body condition on pregnancy rate of Nellore cows, commercial herd undergoing artificial insemination programs in fixed time (TAI. 181 cows were used multiparous Nellore, the coastal plains region of the state of Rio de Janeiro, with more than one hundred days after birth, kept on pasture and divided into two groups subjected to the same synchronization protocol for TAI (D0-2 , 0 mg of estradiol benzoate + device with 1.0 g bovine intravaginal progesterone implant removal D8-250?g of cloprostenol + + 300 IU of eCG, D9-Bz 1.0 mg. Estradiol, D10-TAI. The groups were divided according to body condition score (BCS with scale of 1-5 in Group I, n=96: BCS ? 3,0, Group II, n=85: BCS ? 2.5 ? 2.0. All females were exposed to bulls, from 24 hours to pass after TAI, remaining with them until the end of the breeding season. The overall pregnancy rate was 86.5% (83:96 and 65.9% (56:85 for group I and group II, respectively. Data were evaluated by chi-square analysis and the results show a statistically significant difference (P O objetivo deste trabalho foi avaliar o impacto da condição corporal sobre a taxa de prenhez de vacas Nelore, rebanho comercial, submetidas a programas de inseminação artificial em tempo fixo (IATF. Foram utilizadas 181 vacas multíparas da raça Nelore, na região das baixadas litorâneas do estado do RJ, com mais de cem dias decorridos do parto, mantidas em regime de pasto e divididas em dois grupos submetidos ao mesmo protocolo de sincronização para IATF (D0- 2,0mg de benzoato de estradiol + dispositivo intravaginal bovino com 1,0g de progesterona, D8- retirada do implante + 250?g de cloprostenol sódico+ 300 UI de eCG, D9- 1,0mg Bz. Estradiol, D10- IATF. Os grupos foram divididos segundo escore de condição corporal (ECC com escala de 1-5 em: grupo I, n=96: vacas com ECC ? 3,0 e grupo II, n=85: vacas com ECC ? 2,5 ? 2,0. Todas as fêmeas foram expostas aos touros, a partir

Environmental effects on preweaning performance traits in Nellore beef cattleEfeitos ambientais sobre características pré-desmama em bovinos da Raça Nelore Mocha

Directory of Open Access Journals (Sweden)

Ana Maria do Val Santiago Pereira

2013-03-01

Full Text Available The objective of this study was to analyze a data set with 205 records from a Nellore breed cattle, evaluating the influence of environmental factors on weaning weight adjusted to 205 days of age (W205, preweaning average daily gain (ADG and number of days to gain 160 kg (D160. The data came from a farm in São Paulo State and were collected from 2007 to 2010. The statistical analysis was accomplished using the least squares method, with a model that included the fixed effects of contemporary group, sire and cow age at calving, and error as random effect. The same model was used to analyze 124 records of weight adjusted to 90 days of age (W90. The effects of contemporary group and sire were significant. The cow age at calving was not significant for any performance trait analyzed, except for W90 (P O objetivo deste trabalho foi analisar os dados de pesagens de animais da raça Nelore Mocha, provenientes de um rebanho no Estado de São Paulo no período de 2007 a 2010, avaliando a influência de fatores ambientais sobre as características pré-desmama observadas. Foram utilizadas 205 observações de peso à desmama ajustado para 205 dias de idade (P205, ganho médio diário do nascimento à desmama (GMD e dias para o animal ganhar 160 kg do nascimento à desmama (D160 pelo Método dos Quadrados Mínimos, utilizando-se um modelo contendo os efeitos fixos de grupo de contemporâneo (data de nascimento, mês de nascimento, sexo e data juliana de desmama, pai e idade da vaca ao parto e, como efeito aleatório, o erro. Utilizando o mesmo modelo, foram analisadas 124 observações de peso ajustado aos 90 dias de idade (P90. Os efeitos de grupo de contemporâneo (GC e de pai influenciaram significativamente todas as características estudadas. Para P90 verificou-se o efeito da idade da vaca ao parto (P < 0,05. As médias e desvios padrão observados foram de 140,67 ± 20,08 kg, 0,539 ± 0,097 kg/dia e 306,42 ± 55,84 dias, para P205, GMD e D160

Síntese microbiana, pH e concentração de amônia ruminal e balanço de compostos nitrogenados, em novilhos F1 Limousin x Nelore

Directory of Open Access Journals (Sweden)

Cardoso Rodrigo Carvalho

2000-01-01

Full Text Available Os objetivos do experimento foram determinar os efeitos de cinco níveis de concentrados na dieta sobre a eficiência de síntese microbiana, as concentrações de amônia e os valores de pH ruminal, o balanço de compostos nitrogenados e a taxa de passagem da digesta pelo rúmen de novilhos F1 Limousin x Nelore. Utilizaram-se cinco animais fistulados no rúmen, abomaso e íleo, com peso médio de 279 kg, distribuídos em quadrado latino 5 x 5, alimentados à vontade com feno de capim-coastcross e porcentagens de 25,0; 37,5; 50,0; 62,5; e 75,0% de concentrado. Amostras de líquido de rúmen para determinação de amônia e pH foram obtidas antes e 2, 4, 6 e 8 horas após o arraçoamento dos animais. As bases purinas foram o indicador microbiano utilizado e as bactérias do rúmen foram isoladas por centrifugação diferencial. A taxa de passagem foi obtida com infusão de dose única de 20 g de óxido crômico e os tempos avaliados foram imediatamente antes da infusão do indicador e 3, 6, 9, 12, 24, 36 e 48 horas após. O fluxo de nitrogênio bacteriano (Nbact no abomaso e a eficiência microbiana em relação aos carboidratos degradados no rúmen (CHODR não foram influenciados pelos níveis de concentrado, observando-se valores médios de 85,69 g Nbact/dia, 41,09 g Nbact/kgCHODR e 472,44 g MSbact/kgCHODR. As concentrações máximas de amônia de 17,56 mg/100mL de fluido ruminal ocorreram 2,77 horas após a alimentação. O pH do rúmen diminuiu linearmente com os níveis de concentrados e foi influenciado de forma quadrática pelo tempo de coleta. Foram observadas taxas de passagem da digesta ruminal de 0,059; 0,053; 0,073; 0,068; e 0,041.h-1, para os respectivos níveis de 25,0; 37,5; 50,0; 62,5; e 75,0% de concentrado. O aumento do concentrado na dieta não alterou o crescimento microbiano no rúmen.

Breeding programs for the main economically important traits of zebu dairy cattle

Directory of Open Access Journals (Sweden)

Ariosto Ardila Silva

2010-06-01

Full Text Available In tropical regions, Gyr and Guzerat breeds (Bos indicus are most explored for dairy industry and are much more adapted to climate. Gyr and Guzerat are Zebu breeds very common in Brazil and they are being used to generate Bos taurus x Bos indicus crosses in order to combine good production, heat and parasite tolerance on the tropics. Breeding programs for the main economically important traits of Zebu dairy cattle have been recently introduced in Brazil and is based on the use of genetically superior sires in the herds. A major objective of QTL (Quantitative Trait Loci and candidate genes is to find genes and markers that can be implemented in breeding programs across marker assisted selection (MAS. In Zebu dairy cattle MAS could be used to pre-select young candidate bulls to progeny testing, thus increasing selection differentials, shortening generation interval and increasing genetic gain

Imunoidentification of Albumin and Osteopontin in Seminal Plasma of Taurine and Zebuine Bulls/ Imunoidentificação de Albumina e Osteopontina no Plasma Seminal de Reprodutores Taurinos e Zebuínos

Directory of Open Access Journals (Sweden)

Rodrigo Costa Mattos

2002-05-01

Full Text Available Two dimensional polyacrylamide gel electrophoresis was performed in seminal plasma of seven Bos taurus taurus and seven Bos taurus indicus bulls with high semen freezability, from an artificialinsemination center. In a 8% polyacrylamide gels, three bands of 195, 66 and 55 kDa, present in 100% of the samples in both sub-species, were analyzed by their optical densities. In Bos taurus samples, the opticals densities of 55 kDa band, imunoidentified as osteopontin were superior (pAs proteínas do plasma seminal de 14 reprodutores (7 Bos taurus taurus e 7 Bos taurus indicus, foram analisadas por eletroforese bidimensional, em géis de poliacrilamida a 8%, corados por Comassie Blue. Três bandas protéicas, presentes em 100% das amostras de plasma seminal, foram quantificadas de acordo com a densidade óptica exibida: 195 kDa, pI 6,5-7,5 ; 66 kDa, pI 5,4 e 55 kDa, pI 4,5. As amostras de plasma seminal provenientes de taurinos apresentaram densidades ópticas significativamente superiores (p < 0,05 às dos zebuínos na banda de 55 kDa, que foi imunoidentificada como osteopontina. As demais proteínas analisadas não apresentaram variações significativas entre as subespécies. A banda protéica de 66 kDa, foi imunoidentificada como albumina. Nas amostras provenientes de taurinos, as densidades ópticas das três bandas protéicas quantificadas não evidenciaram variação significativa entre os reprodutores. Entretanto, nos zebuínos, as densidades ópticas da albumina apresentaram diferenças significativas entre os touros (p < 0,05.

PECULIARITIES OF THE COURSE OF THE UPPER ALIMENTARY TRACT DISEASES IN CHILDREN WITH BRONCHOOBSTRUCTIVE SYNDROME.

Science.gov (United States)

Vorotnikova, N A; Eiberman, A S; Chernenkov, Yu V; Rodionova, T V

2015-01-01

The aim of the study was to improve the tactics of treatment of bronchoobstructive syndrome (BOS) in associative course with gastroesophageal reflux disease (GERD) in children. 180 children aged 6-16 with diseases of the respiratory organs with BOS and GERD symptoms were examined: 85 of them--with bronchial asthma (BA), 34--with an acute course of pneumonia, 29--with recurrent obstructive bronchitis. Comparison groups were composed of 93 children, the number of practically healthy children (the control group) was 28 persons. The analysis of risk factors of associative pathology development, roentgenographic study, investigation of the function of external respiration (FER) (peak flowmetry, spirometry), intracavitary pH-metry, esophagofibrogastroduodenoscopy (EFGDS) and ultrasonic investigation (USI) of the organs of the gastro-intestinal tract (GIT) were carried out. Diseases of the respiratory organs with BOS in the groups of the patients under investigation in 43.9% of cases on an average associated with GERD. In a severe course of bronchial asthma GERD was detected 3,4 times more frequently in the boys, while in a lengthy course of pneumonia with BOS--1,9 times more frequently in the girls. Chronic gastritis (ChG) and chronic gastroduodenitis (ChGD) in BA were revealed in 40.6% of the patients, in pneumonia--in 45.7%, in recurrent bronchitis--in 33.3% of the patients. Peculiarities of pre-morbid background of BA and GERD associative course were exhibited by gestosis, threat of abortion, intrauterine hypoxia of the fetus, social troubles of the family. Manifestations of BA in children in 36% of cases were observed 6-12 months after the onset of GERD. The designed individual anti-reflux programs in complex therapy of respiratory organs' diseases with BOS associated with GERD reduce the frequency of exacerbations and hospitalizations of patients with BA, improve their life quality.

Description of Mycobacterium chelonae subsp. bovis subsp. nov., isolated from cattle (Bos taurus coreanae), emended description of Mycobacterium chelonae and creation of Mycobacterium chelonae subsp. chelonae subsp. nov.

Science.gov (United States)

Kim, Byoung-Jun; Kim, Ga-Na; Kim, Bo-Ram; Jeon, Che Ok; Jeong, Joseph; Lee, Seon Ho; Lim, Ji-Hun; Lee, Seung-Heon; Kim, Chang Ki; Kook, Yoon-Hoh; Kim, Bum-Joon

2017-10-01

Three rapidly growing mycobacterial strains, QIA-37 T , QIA-40 and QIA-41, were isolated from the lymph nodes of three separate Korean native cattle, Hanwoo (Bos taurus coreanae). These strains were previously shown to be phylogenetically distinct but closely related to Mycobacterium chelonae ATCC 35752 T by taxonomic approaches targeting three genes (16S rRNA, hsp6 and rpoB) and were further characterized using a polyphasic approach in this study. The 16S rRNA gene sequences of all three strains showed 99.7 % sequence similarity with that of the M. chelonae type strain. A multilocus sequence typing analysis targeting 10 housekeeping genes, including hsp65 and rpoB, revealed a phylogenetic cluster of these strains with M. chelonae. DNA-DNA hybridization values of 78.2 % between QIA-37 T and M. chelonae indicated that it belongs to M. chelonae but is a novel subspecies distinct from M. chelonae. Phylogenetic analysis based on whole-genome sequences revealed a 95.44±0.06 % average nucleotide identity (ANI) value with M. chelonae, slightly higher than the 95.0 % ANI criterion for determining a novel species. In addition, distinct phenotypic characteristics such as positive growth at 37 °C, at which temperature M. chelonae does not grow, further support the taxonomic status of these strains as representatives of a novel subspecies of M. chelonae. Therefore, we propose an emended description of Mycobacterium chelonae, and descriptions of M. chelonae subsp. chelonae subsp. nov. and M. chelonae subsp. bovis subsp. nov. are presented; strains ATCC 35752 T (=CCUG 47445 T =CIP 104535 T =DSM 43804 T =JCM 6388 T =NCTC 946 T ) and QIA-37 T (=KCTC 39630 T =JCM 30986 T ) are the type strains of the two novel subspecies.

Relative impact of human leukocyte antigen mismatching and graft ischemic time after lung transplantation.

Science.gov (United States)

Brugière, Olivier; Thabut, Gabriel; Suberbielle, Caroline; Reynaud-Gaubert, Martine; Thomas, Pascal; Pison, Christophe; Saint Raymond, Christel; Mornex, Jean-François; Bertocchi, Michèle; Dromer, Claire; Velly, Jean-François; Stern, Marc; Philippe, Bruno; Dauriat, Gaëlle; Biondi, Giuseppina; Castier, Yves; Fournier, Michel

2008-06-01

Recent data strongly suggest that human leukocyte antigen (HLA) mismatching has a negative impact on development of bronchiolitis obliterans syndrome (BOS) and survival after lung transplantation (LTx). Because HLA matching is sometimes achieved by extending ischemic time in other solid-organ transplantation models and ischemic time is a risk factor per se for death after LTx, we sought to compare the theoretical benefit of HLA matching with the negative impact of lengthened ischemic time. In this collaborative study we compared the relative impact of HLA mismatching and ischemic time on BOS and survival in 182 LTx recipients. Using multivariate analyses, we observed a lower incidence of BOS (hazard ratio [HR] = 1.70, 95% confidence interval [CI]: 1.1 to 2.7, p = 0.03) and enhanced survival (HR = 1.91, 95% CI: 1.24 to 2.92, p = 0.01) in patients with zero or one HLA-A mismatch compared with those having two HLA-A mismatches. This beneficial effect on survival was equivalent to a reduction of ischemic time of 168 minutes. We observed a reduced incidence of BOS and a better survival rate in patients well-matched at the HLA-A locus, associated with an opposite effect of an enhanced ischemic time. This suggests that graft ischemic time should be taken into account in future studies of prospective HLA matching in LTx.

Relationship between Metabolic Syndrome and Ocular Microcirculation Shown by Laser Speckle Flowgraphy in a Hospital Setting Devoted to Sleep Apnea Syndrome Diagnostics

Directory of Open Access Journals (Sweden)

Tomoaki Shiba

2017-01-01

Full Text Available Purpose. To clarify whether the incidence of metabolic syndrome (MetS and the overlap of MetS components are affecting the ocular circulation shown by laser speckle flowgraphy (LSFG. Materials and Methods. We studied 76 consistent patients. Blowout score (BOS and blowout time (BOT, which are the pulse waveform analysis parameters, and mean blur rate (MBR using LSFG in the optic nerve head (ONH and choroid were evaluated. Throughout, the ONH was separated out from the vessels and tissue for analysis and MBRs in the ONH were divided into four sections (superior, temporal, inferior, and nasal. Results. Thirty-two patients were diagnosed having Mets. MBR-Tissue (P=0.003, MBR-All (P=0.01, MBR-Choroid (P=0.04, and BOS-Choroid (P=0.03 were significantly lower in patients with MetS than in the patients without MetS. Multiple-regression analysis revealed the temporal side of MBR-Tissue and BOS-Choroid which were identified as factors contributing independently to the overlap of the MetS components. Multiple-regression analysis also revealed that the MetS components were identified to be factors independently contributing to the BOS-Choroid and temporal side of MBR-Tissue. Conclusion. Our study clarified that the incidence of MetS and the overlap of the MetS components are significantly affecting the ONH and choroidal microcirculation.

Detection and quantification of Duffy antigen on bovine red blood cell membranes using a polyclonal antibody

Directory of Open Access Journals (Sweden)

Ana Teresa B.F. Antonangelo

2012-09-01

Full Text Available Babesiosis is one of the most important diseases affecting livestock agriculture worldwide. Animals from the subspecies Bos taurus indicus are more resistant to babesiosis than those from Bos taurus taurus. The genera Babesia and Plasmodium are Apicomplexa hemoparasites and share features such as invasion of red blood cells (RBC. The glycoprotein Duffy is the only human erythrocyte receptor for Pasmodium vivax and a mutation which abolishes expression of this glycoprotein on erythrocyte surfaces is responsible for making the majority of people originating from the indigenous populations of West Africa resistant to P. vivax. The current work detected and quantified the Duffy antigen on Bos taurus indicus and Bos taurus taurus erythrocyte surfaces using a polyclonal antibody in order to investigate if differences in susceptibility to Babesia are due to different levels of Duffy antigen expression on the RBCs of these animals, as is known to be the case in human beings for interactions of Plasmodium vivax-Duffy antigen. ELISA tests showed that the antibody that was raised against Duffy antigens detected the presence of Duffy antigen in both subspecies and that the amount of this antigen on those erythrocyte membranes was similar. These results indicate that the greater resistance of B. taurus indicus to babesiosis cannot be explained by the absence or lower expression of Duffy antigen on RBC surfaces.

Índices reprodutivos do rebanho Nelore da fazenda Nhumirim, Pantanal da Nhecolândia=Reproductive rates of Nellore herd at Nhumirim farm, Nhecolândia Pantanal

Directory of Open Access Journals (Sweden)

Paulo Bahiense Ferraz Filho

2012-01-01

Full Text Available Avaliaram-se taxas de prenhez de vacas da raça Nelore das categorias nulíparas, primíparas e multíparas, a partir de dados de quatro estações de inseminações de uma fazenda com sistema extensivo de cria, com pastagens nativas típicas do Pantanal. As probabilidades de ocorrência de prenhez foram calculadas por meio de um modelo que incluiu os efeitos de peso final, escore de condição corporal inicial, escore de condição corporal final e ganho médio diário. As taxas de prenhez foram analisadas pelo teste de qui-quadrado e as análises estatísticas foram realizadas por meio de modelos lineares generalizados, empregando-se a função de distribuição binomial e a função de regressão logística. As taxas de prenhez foram 35,29; 40,98; 74,14 e 52% para as estações de inseminações de 2005/2006, de 2006/2007, de 2007/2008 e de 2008/2009, respectivamente. As categorias nulíparas, primíparas e multíparas, apresentaram as médias das taxas de prenhez de 84, 43 e 47%, respectivamente. Os efeitos de peso final, escore de condição corporal inicial, escore de condição corporal final e ganho médio diário foram significativos. As probabilidades de prenhez são elevadas com maior peso ao final (exceto para as nulíparas, com maior escore inicial e final e com maior ganho médio diário. The pregnancy rates of nulliparous, primiparous and multiparous Nellore cows were evaluated from data from four insemination stations at a farm with extensive cow-calf system, based on native pastures typical of the Pantanal. Pregnancy probabilities were calculated by a model that included the effects of final weight, initial and final body condition scores, and average daily daily gain. The pregnancy rates were analyzed by chi-square test and statistical analyses were carried out through generalized linear models, using a binomial distribution function and the logistic regression function. The pregnancy rates were 35.28, 40.98, 74.14 and 52

Market Barriers to Solar in Michigan

Energy Technology Data Exchange (ETDEWEB)

Miller, E.; Nobler, E.; Wolf, C.; Doris, E.

2012-08-01

The solar industry in the United States is at a turning point; the cost of PV hardware has declined substantially in recent years, placing new attention on reducing the balance of system (BOS) costs of solar that now contribute to a growing percentage of installation expenses. How states address these costs through the creation of a favorable policy and regulatory environment is proving to be a critical determinant of a thriving statewide solar market. This report addresses the permitting and tax issues that may stimulate the solar market growth in Michigan. By making PV installations easier to complete through reduced BOS costs, Michigan would become a more attractive location for manufacturers and installers. As PV module costs decline and BOS costs make up a greater share of the cost of solar, action taken today on these issues will prove beneficial in the long term, providing Michigan an opportunity to establish a leadership position in the solar industry.

Assessment of cow and farm level risk factors associated with Ureaplasma diversum in pasture-based dairy systems - A field study

Directory of Open Access Journals (Sweden)

JOSEFA M. NASCIMENTO-ROCHA

2017-08-01

Full Text Available ABSTRACT Potential risk factors for Ureaplasma diversum in the vaginal mucus of 1,238 dairy cows were included in a multivariate logistic regression model, based on the cow level (i.e., granular vulvovaginitis [+GVV], yearly milk production [4500 kg or more], pregnancy, predominance of Bos taurus [+Bos Taurus], score of corporal condition [at least 2.5], concomitant positivity for Escherichia coli [+E.coli], and farm level i.e., milking room hygiene (-Milking room, dunghill location, and replacement female. Ureaplasma diversum was present in 41.1% of the samples. Independent risk factors for U. diversum were +GVV (odds ratio [OR], 1.31; +Mycoplasma spp (OR, 5.67; yearly milk production (4500 kg or more (OR, 1.99; +Bos taurus (OR, 1.68; +E. coli (OR, 4.96; -milking room (OR, 2.31; and replacement females (OR, 1.89. Ureaplasma diversum vaginal colonization was strongly associated with Mycoplasma spp., E. coli, and number of pregnant cows.

Assessment of cow and farm level risk factors associated with Ureaplasma diversum in pasture-based dairy systems - A field study.

Science.gov (United States)

Nascimento-Rocha, Josefa M; Oliveira, Benedito D DE; Arnhold, Emannuel; Pôrto, Regiani N G; Lima, Svetlana F; Gambarini, Maria Lucia

2017-01-01

Potential risk factors for Ureaplasma diversum in the vaginal mucus of 1,238 dairy cows were included in a multivariate logistic regression model, based on the cow level (i.e., granular vulvovaginitis [+GVV], yearly milk production [4500 kg or more], pregnancy, predominance of Bos taurus [+Bos Taurus], score of corporal condition [at least 2.5], concomitant positivity for Escherichia coli [+E.coli]), and farm level i.e., milking room hygiene (-Milking room), dunghill location, and replacement female). Ureaplasma diversum was present in 41.1% of the samples. Independent risk factors for U. diversum were +GVV (odds ratio [OR], 1.31); +Mycoplasma spp (OR, 5.67); yearly milk production (4500 kg or more) (OR, 1.99); +Bos taurus (OR, 1.68); +E. coli (OR, 4.96); -milking room (OR, 2.31); and replacement females (OR, 1.89). Ureaplasma diversum vaginal colonization was strongly associated with Mycoplasma spp., E. coli, and number of pregnant cows.

Estudo genético da precocidade sexual de novilhas em um rebanho Nelore Genetic studies of sexual precocity of heifers in a Nellore herd

Directory of Open Access Journals (Sweden)

Josineudson Augusto II de Vasconcelos Silva

2005-10-01

Full Text Available Objetivou-se, com este trabalho, estimar a herdabilidade (h² para prenhez de novilhas e sua correlação genética (rg com idade ao primeiro parto (IPP, em animais da raça Nelore. A prenhez de novilhas foi definida de três formas: prenhez aos 16 meses (Pr16 - para as novilhas que pariram com menos de 31 meses, atribuiu-se 1 (sucesso e, para aquelas que pariram após 30,99 meses ou que não pariram, atribuiu-se 0 (fracasso; prenhez aos 24 meses (Pr24 - para as novilhas que pariram até 46 meses (incluindo as Pr16, foi atribuído 1 e, para aquelas que não pariram 0; e prenhez da novilha (PrN - atribuiu-se classificação 2 para as que pariram com menos de 31 meses, 1 para as que pariram entre 31 e 46 meses e 0 para as que não pariram. Os arquivos, analisados pelo Método R e Inferência Bayesiana, continham registros de 30.802 novilhas desmamadas. As análises forneceram médias de estimativas de h² de 0,52, 0,12 e 0,16 para Pr16, Pr24 e PrN, respectivamente, pelo Método R. O valor médio obtido por Inferência Bayesiana foi de 0,45 para Pr16. A rg estimada entre Pr16 e IPP foi -0,32. Os resultados indicam que, para selecionar para precocidade sexual, é necessário expor todas as fêmeas em idades jovens e que a mensuração da taxa de prenhez por meio da Pr16 é pertinente, uma vez que esta característica apresenta variabilidade genética alta e deve responder eficientemente à seleção com possibilidades de rápido ganho genético. A análise indicou também que Pr16 e IPP são determinadas em grande parte por genes diferentes.The objectives of this research were to estimate heritability (h2 of heifer pregnancy and its genetic correlation (rg with age at first calving (AFC in a Nellore herd. Heifer pregnancy evaluated as three different definitions: pregnancy at 16 months (Pr16 - heifers calving before 31 months received 1 (success and those calving after 30.99 months or that failed received 0 (failure; pregnancy at 24 months (Pr24

Herdabilidades para ganho de peso da desmama ao sobreano e perímetro escrotal ao sobreano e tendências genética e fenotípica para ganho de peso da desmama ao sobreano em bovinos Nelore-Angus Heritabilities for post-weaning daily gain and scrotal circumference at yearling age and genetic and phenotypic trends for post-weaning daily gain in Nellore-Angus crossbreds

Directory of Open Access Journals (Sweden)

Arione Augusti Boligon

2006-08-01

Full Text Available Com o objetivo de estimar herdabilidades para ganho de peso médio diário da desmama ao sobreano (GMDDS e para perímetro escrotal ao sobreano (PES e tendências genética e fenotípica para GMDDS, foram utilizados 47.668 registros de peso e de ganho de peso de uma população multirracial Nelore-Angus, coletados entre 1991 e 2001 em diversas regiões do Brasil. Os dados foram analisados pelo método REML e as estimativas das (covariâncias foram obtidas por meio de um modelo animal, no qual foram considerados fixos os efeitos da composição racial do animal (obtida pela concatenação do percentual da raça Nelore do próprio animal, de seu pai e de sua mãe e do grupo de contemporâneos pós-desmama (animais nascidos no mesmo rebanho, ano, época e pertencentes ao mesmo sexo e grupo de manejo e, como aleatórios, os efeitos genético aditivo direto e residual. A herdabilidade para PES foi estimada utlizando-se o mesmo modelo, acrescido dos efeitos fixos do peso e da idade do animal ao sobreano (covariáveis. As médias para idade nas pesagens foram 215 e 528 dias para a desmama e o sobreano, respectivamente. A herdabilidade estimada para GMDDS foi 0,44 ± 0,02 e para PES, 0,22 ± 0,08. A tendência genética anual predita para GMDDS foi decrescente até 1996 e crescente a partir desse período. A tendência fenotípica anual foi de 9,4 g/dia/ano.Data consisting of 47.668 records of a Nellore-Angus crossbred population, raised in several regions of Brazil, from 1991 to 2001, were used to estimate heritability for post-weaning daily gain (ADG and for scrotal circumference at yearling age (SCY using REML. Genetic and phenotypic trends for ADG were also estimated. The model used to estimate heritability and breeding values (BVs for ADG included the fixed effects of breed composition (defined by the percentage of contribution of the Nellore breed of the animal and his parents and the contemporary group after weaning (herd, year/season of birth

Efeito do grupo genético sobre as características de carcaça e maciez da carne fresca e maturada de bovinos superprecoces Effect of genetic group on carcass traits and fresh and aged beef tenderness from young cattle

Directory of Open Access Journals (Sweden)

Waldmaryan Bianchini

2007-12-01

Full Text Available Objetivou-se estudar o efeito das diferentes proporções de sangue Simental e Nelore sobre as características da carcaça e da carne de bovinos superprecoces. Foram utilizados 72 bovinos jovens inteiros (18 Nelore; 18 ½ Simental × Nelore; 18 Simbrasil e 18 Simental, com 8 meses de idade e 250 kg PV médio inicial. Os animais foram desmamados aos 8 meses de idade em sistema creep-feeding e posteriormente confinados durante 150 dias até atingirem o peso de abate, acima de 465 kg, e abatidos em frigorífico comercial. Os valores de pH e temperatura durante o resfriamento das carcaças foi semelhante para todos os grupos genéticos. Da mesma forma, as variáveis carcaça fria, dianteiro e traseiro, não apresentaram diferenças entre os grupos genéticos. Os cortes foram bastante homogêneos, com excessão do contrafilé e do filé-mignon, que foram maiores nos animais Simental. Os animais da raça Nelore e ½ Simental apresentaram maior força de cisalhamento (4,98 e 4,45 kgf em relação aos Simental e Simbrasil (3,13 e 3,33 kgf. No entanto, após a maturação da carne durante sete dias, não se constataram diferenças entre os valores de maciez entre os grupos. As perdas por evaporação e gotejamento foram maiores na carne in natura para os animais Simental e Simbrasil, no entanto, aos sete dias de maturação se tornaram semelhantes. O sistema de produção de bovinos superprecoces produz carcaças e cortes semelhantes entre as diferentes raças estudadas. Aos sete dias de maturação, a maciez da carne de animais Nelore foi semelhante à dos demais grupos genéticos utilizados neste estudo.The aim of this work was to study the effect of the different proportions of blood Simmental and Nellore on meat and carcass characteristics of bovine young bulls. Seventy two young bulls were used (18 Nellore; 18 ½ Simmental x Nellore; 18 Simbrasil and 18 Simmental, with medium age of 8 months and with average 250 kg LW initial. The animals were

Ablação cirúrgica dos bulbos olfatórios em coelhos: modelo para estudos de patogenia de infecções por vírus neurotrópicos

Directory of Open Access Journals (Sweden)

Fonseca Erika Toledo da

2006-01-01

Full Text Available Coelhos têm sido utilizados como modelo para o estudo da neuropatogenia da infecção pelo herpesvírus bovino tipo 5 (BHV-5, um importante agente de doença neurológica em bovinos. O sistema olfatório tem sido apontado como a principal via de acesso do vírus ao cérebro após replicação na cavidade nasal. Para investigar a importância da via olfatória na patogenia da infecção neurológica pelo BHV-5, foi elaborada e avaliada uma técnica operatória de craniotomia transfrontal para remoção dos bulbos olfatórios (BOs, definindo-se as órbitas como referência anatômica. Foram utilizados 45 coelhos com 30 dias de idade, sendo 23 submetidos à ablação cirúrgica dos BOs e posteriormente inoculados pela via intranasal (IN ou no saco conjuntival (IC com o BHV-5. Após incisões de pele, tecido subcutâneo e periósteo, a craniotomia foi realizada em um ponto eqüidistante entre os cantos mediais dos olhos, com uma broca sulcada de 3mm acoplada a uma perfuratriz elétrica de baixa rotação. A remoção dos BOs foi realizada com uma sonda uretral ndegrees6 acoplada a um aspirador. O estudo macroscópico de três animais após a cirurgia comprovou que o procedimento foi eficiente na remoção total dos BOs. Isso também foi comprovado pela interrupção do acesso do vírus ao córtex cerebral: apenas um animal (1/11 ou 9,1% no grupo submetido à ablação dos BOs com inoculação IN desenvolveu enfermidade neurológica, contra 100% (10/10 dos coelhos controle. Conclui-se que a técnica de craniotomia transfrontal utilizando a órbita como referência anatômica permite o acesso adequado para localização e remoção dos BOs e pode ser utilizada em estudos de patogenia de infecções por vírus neurotrópicos que exijam a interrupção completa da via olfatória.

Estudo genômico do nível de infecção por Babesia bovis em bovinos da raça angus

OpenAIRE

Santana, Clarissa Helena [UNESP

2016-01-01

A bovinocultura é um setor com importante destaque no agronegócio brasileiro. O carrapato Ripicephalus (Boophilus) microplus é responsável por perdas econômicas significativas aos pecuaristas e é vetor de hemoparasitoses como Anaplasma spp e Babesia spp. Sabe-se que os bovinos Bos taurus taurus são mais susceptíveis à infestação por carrapatos do que Bos taurus indicus. Acredita-se que o mesmo ocorra para a infecção por Babesia bovis. Neste trabalho, foram avaliados, em duas colheitas, 355 bo...

PV experience curves for the Netherlands

International Nuclear Information System (INIS)

Gerwig, R.

2005-01-01

Experience curves are one of several tools used by policy makers to take a look at market development. Numerous curves have been constructed for PV but none specific to the Netherlands. The objective of this report is to take a look at the price development of grid-connected PV systems in the Netherlands using the experience curve theory. After a literature and internet search and attempts to acquire information from PV companies information on 51% of the totally installed capacity was found. Curves for the period 1991-2001 were constructed based on system price, BOS (balance-of-system) price and inverter price. The progress ratio of the locally learning BOS was similar to the globally learning module market. This indicates that the pace of development of the Dutch PV market is similar to the globally followed pace. Improvement of the detail of the data might help to get a better idea of which BOS components have declined most. The similar progress ratio also shows the importance of investing both in module and system research as is the case in the Netherlands

Nosewitness Identification: Effects of Lineup Size and Retention Interval.

Science.gov (United States)

Alho, Laura; Soares, Sandra C; Costa, Liliana P; Pinto, Elisa; Ferreira, Jacqueline H T; Sorjonen, Kimmo; Silva, Carlos F; Olsson, Mats J

2016-01-01

Although canine identification of body odor (BO) has been widely used as forensic evidence, the concept of nosewitness identification by human observers was only recently put to the test. The results indicated that BOs associated with male characters in authentic crime videos could later be identified in BO lineup tests well above chance. To further evaluate nosewitness memory, we assessed the effects of lineup size (Experiment 1) and retention interval (Experiment 2), using a forced-choice memory test. The results showed that nosewitness identification works for all lineup sizes (3, 5, and 8 BOs), but that larger lineups compromise identification performance in similarity to observations from eye- and earwitness studies. Also in line with previous eye- and earwitness studies, but in disagreement with some studies on odor memory, Experiment 2 showed significant forgetting between shorter retention intervals (15 min) and longer retention intervals (1-week) using lineups of five BOs. Altogether this study shows that identification of BO in a forensic setting is possible and has limits and characteristics in line with witness identification through other sensory modalities.

Hubungan Kekerabatan Sapi Aceh dengan Menggunakan Daerah Displacement-loop

Directory of Open Access Journals (Sweden)

Mohd. Agus Nashri Abdullah

2008-10-01

Full Text Available Relationship of aceh cattle using displacement-loop region ABSTRACT. The aims of this study were to describe relationship of D-loop of mtDNA Aceh cattle which is useful database for conducting conservation programme. The whole blood samples were collected (8 samples for D-loop analysis from four locations which were Aceh Besar, Pidie, North Aceh regencies and Banda Aceh city. Out group whole blood samples were collected from two samples from Bali cattles (Bali Island, Madura cattle (Madura Island, Pesisir cattle (West Sumatera respectively and one sample from PO cattle (West Java. Amplification of D-loop sequences of mtDNA with BIDLF and BIDLR primary have PCR product 980 bp. The Data were analyzed using Squint 1.02 and MEGA 4.0 programme. Result of analysis indicate that Aceh cattle have nearer relationship with zebu and there is items inset of genetik Bali cattle (Bos javanicus at the end sequences start ke-354 situs up to 483, so that the origin Aceh cattle was from Bos indicus which have hybridization with Bos javanicus.

Duality, phase structures, and dilemmas in symmetric quantum games

International Nuclear Information System (INIS)

Ichikawa, Tsubasa; Tsutsui, Izumi

2007-01-01

Symmetric quantum games for 2-player, 2-qubit strategies are analyzed in detail by using a scheme in which all pure states in the 2-qubit Hilbert space are utilized for strategies. We consider two different types of symmetric games exemplified by the familiar games, the Battle of the Sexes (BoS) and the Prisoners' Dilemma (PD). These two types of symmetric games are shown to be related by a duality map, which ensures that they share common phase structures with respect to the equilibria of the strategies. We find eight distinct phase structures possible for the symmetric games, which are determined by the classical payoff matrices from which the quantum games are defined. We also discuss the possibility of resolving the dilemmas in the classical BoS, PD, and the Stag Hunt (SH) game based on the phase structures obtained in the quantum games. It is observed that quantization cannot resolve the dilemma fully for the BoS, while it generically can for the PD and SH if appropriate correlations for the strategies of the players are provided

Efeito do colágeno na maciez da carne de bovinos de distintos grupos genéticos - DOI: 10.4025/actascianimsci.v28i1.664 Collagen effects in meat tenderness of bovines of different genetic groups - DOI: 10.4025/actascianimsci.v28i1.664

Directory of Open Access Journals (Sweden)

Henrique Nunes de Oliveira

2006-01-01

Full Text Available O objetivo do trabalho foi avaliar a influência do colágeno na maciez da carne de animais de diferentes grupos genéticos produzidos no sistema de produção do novilho superprecoce. Foram utilizados bezerros machos inteiros da raça Nelore, mestiços ½ Nelore x ½ Aberdeen Angus e mestiços ½ Nelore x ½ Simental. Após abate e resfriamento por 24 horas, foram retiradas amostras do músculo Longissimus dorsi, na região entre a 11a e a 13a costela, sendo que uma amostra foi congelada e as demais maturadas por 7 e 14 dias. Não houve diferença significativa (p > 0,01 entre os grupos genéticos para a quantidade e a solubilidade de colágeno e a força de cisalhamento. A quantidade e a solubilidade do colágeno não comprometeram a maciez da carne, indiferentemente do grupo genético utilizado e do tempo postmortem, tornando vantajosa a opção de se abaterem animais jovens.The aim of work was to analyze the collagen effect in meat tenderness of animals of different genetic groups produced by very young bullock production system. Male calves Nellore purebred, ½ Nellore x ½ Aberdeen Angus and ½ Nellore x ½ Simmental crossbred were used. After slaughter and cooling for 24 hours Longissimus dorsi samples were removed, between 11th and 13th ribs, one sample was frozen and the others ageing for 7 and 14 days. There was no difference (p > 0,01 between genetic groups for amount and heat soluble collagen and shear force values. The amount and solubility collagen don’t compromised the meat tenderness, indifferent of the genetic group used and postmortem period, becoming the early slaughter an advantageous option for meat production with desirable characteristics.

Efeito do colágeno na maciez da carne de bovinos de distintos grupos genéticos = Collagen effects in meat tenderness of bovines of different genetic groups

Directory of Open Access Journals (Sweden)

Daniela Cristina Morales

2006-01-01

Full Text Available O objetivo do trabalho foi avaliar a influência do colágeno na maciez da carne de animais de diferentes grupos genéticos produzidos no sistema de produção do novilho superprecoce. Foram utilizados bezerros machos inteiros da raça Nelore, mestiços ½ Nelore x ½ Aberdeen Angus e mestiços ½ Nelore x ½ Simental. Após abate e resfriamento por 24 horas, foram retiradas amostras do músculo Longissimus dorsi, na região entre a 11a e a 13a costela, sendo que uma amostra foi congelada e as demais maturadas por 7 e 14 dias. Nãohouve diferença significativa (P>0,01 entre os grupos genéticos para a quantidade e a solubilidade de colágeno e a força de cisalhamento. A quantidade e a solubilidade do colágeno não comprometeram a maciez da carne, indiferentemente do grupo genético utilizado e do tempo postmortem, tornando vantajosa a opção de se abaterem animais jovens.The aim of work was to analyze the collagen effect in meat tenderness of animals of different genetic groups produced by very young bullock production system. Male calves Nellore purebred, ½ Nellore x ½ Aberdeen Angus and ½ Nellore x ½ Simmental crossbred were used.After slaughter and cooling for 24 hours Longissimus dorsi samples were removed, between 11th and 13th ribs, one sample was frozen and the others ageing for 7 and 14 days. There was no difference (P>0,01 between genetic groups for amount and heat soluble collagen andshear force values. The amount and solubility collagen don’t compromised the meat tenderness, indifferent of the genetic group used and postmortem period, becoming the early slaughter an advantageous option for meat production with desirable characteristics.

Influência da suplementação com Concentrados nas características de carcaça de bovinos F1 Limousin - Nelore, não-castrados, durante a seca, em pastagens de Brachiaria decumbens

Directory of Open Access Journals (Sweden)

Santos Eduardo Destéfani Guimarães

2002-01-01

Full Text Available Este trabalho foi realizado na Fazenda Experimental de Felixlândia (MG, da EPAMIG, no período de julho a outubro de 1997, com o objetivo de estudar a influência da suplementação com concentrados sobre as características físicas e o rendimento dos cortes da carcaça em 20 novilhos Limousin-Nelore, não-castrados, com 22-23 meses de idade e peso médio de 459 kg ao abate. Retiraram-se, aleatoriamente, quatro animais de cada um dos cinco tratamentos a que foram submetidos durante 112 dias na época seca, em pastagens diferidas de Brachiaria decumbens. No tratamento T1 (referência, os animais nas pastagens receberam apenas sal mineralizado; nos tratamentos T2 (75% milho, T3 (50% milho, T4 (25% milho e T5 (farelo de trigo, foram fornecidas quantidades médias diárias por animal de 3,70 kg de MS de concentrados (equivalente, em matéria natural, a 1% do PV com 24,1% de PB e NDT variando de 67,8% (T5 - farelo de trigo a 85,6% (T2 - 75% milho. Avaliaram-se as características peso, rendimento e comprimento de carcaça, rendimentos de paleta, acém completo, ponta de agulha, alcatra completa e coxão, espessura de gordura subcutânea, área de olho de lombo, porcentagens na carcaça de tecido adiposo, músculos e ossos e a relação músculo/osso. O fornecimento de suplementos proporcionou a obtenção de carcaças mais pesadas (257,0 vs. 203,9 kg, com menor proporção de ossos (15,76 vs. 21,71%, maior relação músculo:osso (3,6 vs. 2,9 e melhor acabamento quando comparado às carcaças dos animais não-suplementados. Os animais suplementados e não-suplementados não diferiram em relação a rendimento e comprimento de carcaça, rendimentos de paleta, acém completo, alcatra completa e coxão, área de olho de lombo (AOL e porcentagem de músculos na carcaça.

The soil physics contributions of Edgar Buckingham

Science.gov (United States)

Nimmo, J.R.; Landa, E.R.

2005-01-01

During 1902 to 1906 as a soil physicist at the USDA Bureau of Soils (BOS), Edgar Buckingham originated the concepts of matric potential, soil-water retention curves, specific water capacity, and unsaturated hydraulic conductivity (K) as a distinct property of a soil. He applied a formula equivalent to Darcy's law (though without specific mention of Darcy's work) to unsaturated flow. He also contributed significant research on quasi-empirical formulas for K as a function of water content, water flow in capillary crevices and in thin films, and scaling. Buckingham's work on gas flow in soils produced paradigms that are consistent with our current understanding. His work on evaporation elucidated the concept of self-mulching and produced sound and sometimes paradoxical generalizations concerning conditions that favor or retard evaporation. Largely overshadowing those achievements, however, is that he launched a theory, still accepted today, that could predict transient water content as a function of time and space. Recently discovered documents reveal some of the arguments Buckingham had with BOS officials, including the text of a two-paragraph conclusion of his famous 1907 report on soil water, and the official letter documenting rejection of that text. Strained interpersonal relations motivated the departure of Buckingham and other brilliant physicists (N.E. Dorsey, F.H. King, and Lyman Briggs) from the BOS during 1903 to 1906. Given that Buckingham and his BOS colleagues had been rapidly developing the means of quantifying unsaturated flow, these strained relations probably slowed the advancement of unsaturated flow theory. ?? Soil Science Society of America.

[Treatment of bronchial obstruction in patients with pulmonary tuberculosis].

Science.gov (United States)

Shmelev, E I; Kuklina, G M; Kalinina, E E

2004-01-01

Whether the main points of treatment for bronchial obstructive syndrome (BOS) in chronic obstructive lung disease (COLD) can be adapted for patients with pulmonary tuberculosis (PT) was studied. For this purpose, 435 patients with PT with signs of BOS (forced expiratory volume at 1 second (FEV1) 70% of the normal values; 2) 229 patients with FEV1 69-50%; 3) 102 patients with FEV1 bronchial obstructive syndrome in patients with pulmonary tuberculosis was highly effective, promotes the amelioration of the degree of respiratory symptoms in patients with IPT by 2 to 8 times, in those with FCPT by more than 2-3 times, and in those with PS by 1.45-10 times. The differences in the efficiency of bronchodilator therapy depend on the baseline level of bronchial obstruction. In patients with pulmonary tuberculosis concurrent with BO, the use of current inhalation bronchodilator therapy results in a substantial increase in FEV1, which differentiates BOS in PT from COLD. The use of the proposed therapy in the multimodality treatment of patients with pulmonary tuberculosis showed no statistically significant differences in the changes in the degree of X-ray symptoms while this therapy permits acceleration of abacillation in patients with IPT by 16.8% and in those with FCPT by 14.8%. Effective bronchodilator therapy considerably enhances life quality in patients. Thus, early systematic and long-term performance of the bronchodilator therapy, based on the principles of bronchodilator therapy for COLD, in patients with PT concurrent with BOS may substantially enhance the efficiency of treatment in this category of patients.

On the Path to SunShot. The Role of Advancements in Solar Photovoltaic Efficiency, Reliability, and Costs

Energy Technology Data Exchange (ETDEWEB)

Woodhouse, Michael [National Renewable Energy Lab. (NREL), Golden, CO (United States); Jones-Albertus, Rebecca [U.S. Dept. of Energy, Washington, DC (United States); Feldman, David [National Renewable Energy Lab. (NREL), Golden, CO (United States); Fu, Ran [National Renewable Energy Lab. (NREL), Golden, CO (United States); Horowitz, Kelsey [National Renewable Energy Lab. (NREL), Golden, CO (United States); Chung, Donald [National Renewable Energy Lab. (NREL), Golden, CO (United States); Jordan, Dirk [National Renewable Energy Lab. (NREL), Golden, CO (United States); Kurtz, Sarah [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2016-05-01

This report examines the remaining challenges to achieving the competitive photovoltaic (PV) costs and large-scale deployment envisioned under the U.S. Department of Energy's SunShot Initiative. Solar-energy cost reductions can be realized through lower PV module and balance-of-system (BOS) costs as well as improved system efficiency and reliability. Numerous combinations of PV improvements could help achieve the levelized cost of electricity (LCOE) goals because of the tradeoffs among key metrics like module price, efficiency, and degradation rate as well as system price and lifetime. Using LCOE modeling based on bottom-up cost analysis, two specific pathways are mapped to exemplify the many possible approaches to module cost reductions of 29%-38% between 2015 and 2020. BOS hardware and soft cost reductions, ranging from 54%-77% of total cost reductions, are also modeled. The residential sector's high supply-chain costs, labor requirements, and customer-acquisition costs give it the greatest BOS cost-reduction opportunities, followed by the commercial sector, although opportunities are available to the utility-scale sector as well. Finally, a future scenario is considered in which very high PV penetration requires additional costs to facilitate grid integration and increased power-system flexibility--which might necessitate even lower solar LCOEs. The analysis of a pathway to 3-5 cents/kWh PV systems underscores the importance of combining robust improvements in PV module and BOS costs as well as PV system efficiency and reliability if such aggressive long-term targets are to be achieved.

Dual Origins of Dairy Cattle Farming – Evidence from a Comprehensive Survey of European Y-Chromosomal Variation

DEFF Research Database (Denmark)

Edwards, Ceiridwen J; Genja, Catarina; Kantanen, Juha

2011-01-01

, with limited breed panels, identified two Bos taurus (taurine) haplogroups (Y1 and Y2; both composed of several haplotypes) and one Bos indicus (indicine/zebu) haplogroup (Y3), as well as a strong phylogeographic structuring of paternal lineages. Methodology and Principal Findings: Haplogroup data were......, the Nordic region and Russia, with the highest Ychromosomal diversity seen in the Iberian Peninsula. Conclusions: We propose that the homogeneous Y1 and Y2 regions reflect founder effects associated with the development and expansion of two groups of dairy cattle, the pied or red breeds from the North Sea...

Genome variability in European and American bison detected using the BovineSNP50 BeadChip

DEFF Research Database (Denmark)

Pertoldi, C.; Wójcik, Jan M; Tokarska, Małgorzata

2010-01-01

 The remaining wild populations of bison have all been through severe bottlenecks. The genomic consequences of these bottlenecks present an interesting area to study. Using a very large panel of SNPs developed in Bos taurus we have carried out a genome-wide screening on the European bison (Bison...... bonasus; EB) and on two subspecies of American bison: the plains bison (B. bison bison; PB) and the wood bison (B. bison athabascae; WB). One hundred bison samples were genotyped for 52,978 SNPs along with seven breeds of domestic bovine Bos taurus. Only 2,209 of the SNPs were polymorphic in the bison...

Modelo de gestão em bancos de olhos e seu impacto no resultado destas organizações

Directory of Open Access Journals (Sweden)

Christiana Velloso Rebello Hilgert

2012-02-01

Full Text Available OBJETIVO: Avaliar a eficácia do modelo de gestão adotado pelo Banco de Olhos de Sorocaba (BOS e Banco de Olhos da Santa Casa de Campo Grande (BOSC, segundo os critérios do Prêmio Nacional de Gestão em Saúde (PNGS e demonstrar as características comuns e discordantes entre os dois Bancos de Olhos e um paralelo entre a efetividade do modelo de gestão adotado e o resultado destas organizações na doação de córneas. MÉTODOS: Foi aplicado o questionário "Como estamos progredindo?", disponibilizado pela Fundação Malcolm Baldrige, composto por 40 questões fechadas agrupadas nos sete critérios do PNGS (Liderança, Planejamento Estratégico, Foco no Cliente e no Mercado, Foco em Recursos Humanos, Critério Gestão de Informações, Gestão de Processos, e Resultados em toda a força de trabalho das duas instituições (21 funcionários do BOS e 8 do BOSC. Os resultados foram analisados utilizando o Teste Exato de Fischer e Teste não-paramétrico U de Mann-Whitney para comparação das médias entre as duas instituições. RESULTADOS: Foram entrevistados 21 funcionários do BOS e 8 funcionários do BOSC. O teste de Mann-Whitney mostrou uma maior concordância às proposições do questionário pelos respondentes do BOS em 6 dos 7 itens estudados (Liderança, Planejamento Estratégico, Foco no Cliente e no Mercado, Foco em Recursos Humanos, Gestão de Processos, e Resultados. Não houve diferença estatisticamente significativa no Critério Gestão de Informações. A maior diferença entre as duas instituições foi encontrada no critério Gestão de Processos (p<0.001. CONCLUSÃO: O modelo de gestão presente no BOS apresenta aspectos distintos e estatisticamente significantes comparados ao BOSC, em 6 dos 7 critérios estudados pelo questionário aplicado. O BOS é o que mais se aproxima de conceitos internacionalmente aceitos de excelência em gestão baseados nos critérios do PNGS do que o BOSC, sendo um dos motivos prováveis do