WorldWideScience

Sample records for boron enrichment plant

  1. Significance of ICPMS in performance evaluation of Boron Enrichment Plant and elemental boron plant at Heavy Water Plant, Manuguru - an indigenization effort

    International Nuclear Information System (INIS)

    Boron has two naturally occurring stable isotopes viz. 10B (natural abundance ∼ 20%) and 11B. Due to very high neutron absorption cross section, 10B has important applications in the nuclear field. It is used in neutron detector (10B ≅90%) and as control material in fast breeder reactor (10B ≅65%). Heavy Water Board is involved in production of enriched boron (10B) using Ion Exchange Chromatography technique and Exchange Distillation technique. For boron isotope ratio measurement, properly tuned ICPMS gives quick analysis with good precision. During Plant operation, monitoring of each stage is essential. As sample load is very high, therefore a quick analysis technique is required. Though boron isotope ratio measurement on ICPMS has some limitation in terms of its low mass, memory effect etc., if proper care, in terms of plasma stability, can be taken, then ICPMS is the best choice. As ICPMS covers the full isotope concentration range, boron samples from Boron Enrichment Plant have been analysed on the above mentioned ICPMS routinely

  2. Application of ICPMS for performance evaluation of boron enrichment plant at HWP, Manuguru

    International Nuclear Information System (INIS)

    10B enriched compounds are used in neutron control rod in Fast Breeder Reactors (FBR), Neutron Detector, Neutron Capture Therapy, and Neutron Shielding. Heavy Water Board (HWB) is given a mandate to produce enriched elemental boron which is being produced using Ion exchange chromatography and BF3 - ether complex distillation methods. Ion Exchange Chromatography based Boron Enrichment Plant is operating at HWP, Manuguru. Ion Exchange Chromatography based process depends, besides other process parameters, on column run time and movement of band length. For effective process and quality control, it is necessary to analyze 10B/11B ratio in feed, process stream, waste and the product. 10B/11B ratio measurements are possible by Thermal Ionization Mass Spectrometer (TIMS) and Inductively Coupled Plasma Mass Spectrometer (ICPMS), the former offers better accuracy but takes longer analysis time whereas the later offers quick analysis of isotopic ratios and as well as trace metal impurities in the Boric acid

  3. Boron isotopic enrichment by displacement chromatography

    International Nuclear Information System (INIS)

    10B enriched boron is used in applications requiring high volumetric neutron absorption (absorption cross section- 3837 barn for thermal and 1 barn for 1 MeV fast neutron). It is used in fast breeder reactor (as control rod material), in neutron counter, in Boron Neutron Capture Therapy etc. Owing to very small separation factor, boron isotopic enrichment is a complex process requiring large number of separation stages. Heavy Water Board has ventured in industrial scale production of 10B enriched boron using Exchange Distillation Process as well as Ion Displacement Chromatography Process. Ion Displacement Chromatography process is used in Boron Enrichment Plant at HWP, Manuguru. It is based on isotopic exchange between borate ions (B(OH)4-) on anion exchange resin and boric acid passing through resin. The isotopic exchange takes place due to difference in zero point energy of 10B and 11B

  4. Boron Enrichment in Martian Clay

    OpenAIRE

    James D Stephenson; Lydia J Hallis; Kazuhide Nagashima; Freeland, Stephen J.

    2013-01-01

    We have detected a concentration of boron in martian clay far in excess of that in any previously reported extra-terrestrial object. This enrichment indicates that the chemistry necessary for the formation of ribose, a key component of RNA, could have existed on Mars since the formation of early clay deposits, contemporary to the emergence of life on Earth. Given the greater similarity of Earth and Mars early in their geological history, and the extensive disruption of Earth's earliest minera...

  5. Boron enrichment in martian clay.

    Directory of Open Access Journals (Sweden)

    James D Stephenson

    Full Text Available We have detected a concentration of boron in martian clay far in excess of that in any previously reported extra-terrestrial object. This enrichment indicates that the chemistry necessary for the formation of ribose, a key component of RNA, could have existed on Mars since the formation of early clay deposits, contemporary to the emergence of life on Earth. Given the greater similarity of Earth and Mars early in their geological history, and the extensive disruption of Earth's earliest mineralogy by plate tectonics, we suggest that the conditions for prebiotic ribose synthesis may be better understood by further Mars exploration.

  6. Boron enrichment in martian clay.

    Science.gov (United States)

    Stephenson, James D; Hallis, Lydia J; Nagashima, Kazuhide; Freeland, Stephen J

    2013-01-01

    We have detected a concentration of boron in martian clay far in excess of that in any previously reported extra-terrestrial object. This enrichment indicates that the chemistry necessary for the formation of ribose, a key component of RNA, could have existed on Mars since the formation of early clay deposits, contemporary to the emergence of life on Earth. Given the greater similarity of Earth and Mars early in their geological history, and the extensive disruption of Earth's earliest mineralogy by plate tectonics, we suggest that the conditions for prebiotic ribose synthesis may be better understood by further Mars exploration. PMID:23762242

  7. Boron-isotope fractionation in plants

    International Nuclear Information System (INIS)

    Naturally-occurring variations in the abundance of stable isotopes of carbon, nitrogen, oxygen, and other elements in plants have been reported and are now used to understand various physiological processes in plants. Boron (B) isotopic variation in several plant species have been documented, but no determination as to whether plants fractionate the stable isotopes of boron, 11B and 10B, has been made. Here, we report that plants with differing B requirements (wheat, corn and broccoli) fractionated boron. The whole plant was enriched in 11B relative to the nutrient solution, and the leaves were enriched in 10B and the stem in 11B relative to the xylem sap. Although at present, a mechanistic role for boron in plants is uncertain, potential fractionating mechanisms are discussed. (author)

  8. Depletion modeling of integral burnable absorbers containing enriched boron

    International Nuclear Information System (INIS)

    Depletion modeling of fuel assembly with different integral fuel burnable absorber loadings containing enriched boron has been performed by WIMSD transport code. Equivalent boron concentration that represents depletion of the integral fuel burnable absorbers containing enriched boron has been calculated using modified PSU/LEOPARD code. The calculated equivalent boron concentrations have been introduced into FUMACS computer code package master files, upgrading the code package with new global calculation feature for core modeling with different integral fuel burnable absorber loadings containing enriched boron. This new feature of FUMACS/FEEC2001 code package has been verified and validated on 12-month and 18-month operating cycle core loading patterns of NPP Krsko.(author)

  9. Boron enrichment by ion exchange with Dowex 1X8 anion resin

    International Nuclear Information System (INIS)

    An isotopic separation pilot plant with five ion exchange columns interconnected in series were designed and built in the IEN. The boric acid solution is introduced in the separation columns until it reaches a absorbing zone lenght which is sufficient to obtain the desired boron-10 isotopic concentration. The boric acid absorbing zone movement is provided by the injection of a diluted hydrochloric acid solution, which replces the boric acid troughout the columns to its total lenght. The enriched boron-10 and the depleted boron are located in the final boundary and in the initial position of the absorbing zones, respectively. (author). 6 refs

  10. R and D studies at IGCAR on boron enrichment using ion exchange chromatography process. Contributed Paper IT-10

    International Nuclear Information System (INIS)

    Boron Carbide enriched in 10B isotope is used as control rod material for fast reactors. The natural abundance of 10B isotope of boron is about 20%. In addition to the use in control rods for fast reactors, enriched boron compounds find many other applications in nuclear industry such as in neutron detection, shielding and burnable poison in moderators of thermal reactors and also in neutron capture therapy. To meet the growing demand for 10B enriched materials, it has become necessary to develop efficient processes to enrich this isotope of boron. Among the known processes, ion exchange chromatography is a viable option for the industrial enrichment of this isotope of boron. Pilot scale experiments were carried out to study the band velocity, influence of complexing agent, variation of HETP with time, influence of initial eed enrichment and particle size of the resin. A Model for ion exchange chromatography was developed and validated to predict HETP for different operating conditions. This model is effective in analysing plant operation and also design of new boron enrichment plants

  11. DOE enrichment plant hums ahead

    International Nuclear Information System (INIS)

    The Department of Energy's $10-billion gas centrifuge uranium enrichment plant, after three years of construction, is rising on schedule near Piketon, Ohio. A detailed conceptual design, smart management, liberal design fees, hungry contractors and cooperative unions are combining to get the job done. One reason for completing the task is that this will be a far more efficient process - 135 MW will be required to operate the centrifuge plant vs more than 2100 MW to produce the same amount of fuel at the mile-square diffusion plant near Portsmouth, Ohio

  12. Enrichment planting without soil treatment

    Energy Technology Data Exchange (ETDEWEB)

    Hagner, Mats

    1998-12-31

    Where enrichment planting had been carried out with either of the two species Picea abies and Pinus contorta, the survival of the planted seedlings was at least as good as after planting in a normal clear cut area treated with soil scarification. This was in spite of the fact that the seedlings were placed shallow in the humus layer without any soil treatment. However, they were sheltered from insects by treatment before planting. Where enrichment planting was carried out with Pinus sylvestris the survival in dense forest was poor, but in open forest the survival was good. The growth of planted seedlings was enhanced by traditional clearing and soil treatment. However, this was for Pinus sylvestris not enough to compensate for the loss of time, 1-2 years, caused by arrangement of soil scarification. The growth of seedlings planted under crown cover was directly related to basal area of retained trees. However, the variation in height growth among individual seedlings was very big, which meant that some seedlings grow well also under a fairly dense forest cover. The pioneer species Pinus sylvestris reacted more strongly to basal area of retained trees than did the shade tolerant species Picea abies. Enrichment planting seems to be a necessary tool for preserving volume productivity, at places where fairly intensive harvest of mature trees has been carried out in stands of ordinary forest type in central Sweden. If double seedlings, with one Picea abies and one Pinus sylvestris, are used, the probability for long term establishment is enhanced 13 refs, 20 figs, 4 tabs

  13. Uranium enrichment plant risk analysis

    International Nuclear Information System (INIS)

    A method for risk analysis of enrichment facilities is presented and applied to a small scale ultracentrifuge plant. Internal events are identified and the consequences of accidental releases of U F6 are quantified in terms of its toxicological and radiological impact. It is shown that releases in the feed and the cascade areas offers no hazards to the public . Releases of liquefied U F6 in the withdrawal areas, associated with failures in the building isolation systems, may cause undesirable consequences. (author). 11 refs, 4 figs, 3 tabs

  14. Inverse-Frontal Chromatography studies on enrichment of Boron-10 using quaternery 4-vinylpyridine-divinylbenzene resin

    International Nuclear Information System (INIS)

    In order to enrich 10B, band migration of boric acid-mannitol with hydrochloric acid solution was performed by inverse frontal chromatography on a porous, 25% crosslinked, 38% quaternized 4-vinylpyridine-divinylbenzene resin (py-resin). The work was initiated to replace the existing strong base anion exchange resin type-II (SBA-II) which is used in Boron Enrichment Plant (BEP) of heavy water plant Manuguru. Before its application in BEP, it is mandatory to evaluate py-resin for its performance. The studies showed that maximum of 40% 10B enrichment observed after 13 m band movement and there was no further improvement, hence profile sampling carried out after 28 m. (author)

  15. Boron in Plants: Deficiency and Toxicity

    Institute of Scientific and Technical Information of China (English)

    Juan J. Camacho-Crist6bal; Jesus Rexach; Agustin González-Fontess

    2008-01-01

    Boron (B) is an essential nutrient for normal growth of higher plants, and B availability in soil and irrigation water is an important determinant of agricultural production. To date, a primordial function of B is undoubtedly its structural role in the cell wall; however, there is increasing evidence for a possible role of B in other processes such as the maintenance of plasma membrane function and several metabolic pathways. In recent years, the knowledge of the molecular basis of B deficiency and toxicity responses in plants has advanced greatly. The aim of this review is to provide an update on recent findings related to these topics, which can contribute to a better understanding of the role of B in plants.

  16. Radiological analysis of plutonium glass batches with natural/enriched boron

    International Nuclear Information System (INIS)

    The disposition of surplus plutonium inventories by the US Department of Energy (DOE) includes the immobilization of certain plutonium materials in a borosilicate glass matrix, also referred to as vitrification. This paper addresses source terms of plutonium masses immobilized in a borosilicate glass matrix where the glass components include both natural boron and enriched boron. The calculated source terms pertain to neutron and gamma source strength (particles per second), and source spectrum changes. The calculated source terms corresponding to natural boron and enriched boron are compared to determine the benefits (decrease in radiation source terms) for to the use of enriched boron. The analysis of plutonium glass source terms shows that a large component of the neutron source terms is due to (a, n) reactions. The Americium-241 and plutonium present in the glass emit alpha particles (a). These alpha particles interact with low-Z nuclides like B-11, B-10, and O-17 in the glass to produce neutrons. The low-Z nuclides are referred to as target particles. The reference glass contains 9.4 wt percent B2O3. Boron-11 was found to strongly support the (a, n) reactions in the glass matrix. B-11 has a natural abundance of over 80 percent. The (a, n) reaction rates for B-10 are lower than for B-11 and the analysis shows that the plutonium glass neutron source terms can be reduced by artificially enriching natural boron with B-10. The natural abundance of B-10 is 19.9 percent. Boron enriched to 96-wt percent B-10 or above can be obtained commercially. Since lower source terms imply lower dose rates to radiation workers handling the plutonium glass materials, it is important to know the achievable decrease in source terms as a result of boron enrichment. Plutonium materials are normally handled in glove boxes with shielded glass windows and the work entails both extremity and whole-body exposures. Lowering the source terms of the plutonium batches will make the handling of

  17. NRC licensing of uranium enrichment plants

    International Nuclear Information System (INIS)

    The US Nuclear Regulatory Commission (NRC) is preparing a rule making that establishes the licensing requirements for low-enriched uranium enrichment plants. Although implementation of this rule making is timed to correspond with receipt of a license application for the Louisiana Energy Services centrifuge enrichment plant, the rule making is applicable to all uranium enrichment technologies. If ownership of the US gaseous diffusion plants and/or atomic vapor laser isotope separation is transferred to a private or government corporation, these plants also would be licensable under the new rule making. The Safeguards Studies Department was tasked by the NRC to provide technical assistance in support of the rule making and guidance preparation process. The initial and primary effort of this task involved the characterization of the potential safeguards concerns associated with a commercial enrichment plant, and the licensing issues associated with these concerns. The primary safeguards considerations were identified as detection of the loss of special nuclear material, detection of unauthorized production of material of low strategic significance, and detection of production of uranium enriched to >10% 235U. The primary safeguards concerns identified were (1) large absolute limit of error associated with the material balance closing, (2) the inability to shutdown some technologies to perform a cleanout inventory of the process system, and (3) the flexibility of some technologies to produce higher enrichments. Unauthorized production scenarios were identified for some technologies that could prevent conventional material control and accounting programs from detecting the production and removal of 5 kg 235U as highly enriched uranium. Safeguards techniques were identified to mitigate these concerns

  18. Safety aspects of gas centrifuge enrichment plants

    International Nuclear Information System (INIS)

    Uranium enrichment by gas centrifuge is a commercially proven, viable technology. Gas centrifuge enrichment plant operations pose hazards that are also found in other industries as well as unique hazards as a result of processing and handling uranium hexafluoride and the handling of enriched uranium. Hazards also found in other industries included those posed by the use of high-speed rotating equipment and equipment handling by use of heavy-duty cranes. Hazards from high-speed rotating equipment are associated with the operation of the gas centrifuges themselves and with the operation of the uranium hexafluoride compressors in the tail withdrawal system. These and related hazards are discussed. It is included that commercial gas centrifuge enrichment plants have been designed to operate safely

  19. Relationship Between Soil Boron Adsorption Kinetics and Rape Plant Boron Response

    Institute of Scientific and Technical Information of China (English)

    ZHUDUANWEI; PIMEIMEI; 等

    1997-01-01

    The boron adsorption kinetic experiment in soil by means a flow displacement technique showed that the kinetic data could be described with some mathematic equations.The average values of the coorealtion coefficeint for zero-order,first-order,parabolic diffusion ,Elovich,power function and eponential equations were 0.957,0.982,0.981,0.984,0.981 and 0.902 ,respectively,The correlation between adsorbed boron or its other expression form and time were the highest for first-order ,parabloic diffusion Elovich,and pwer function equations,the second for the zeroorder equation,and the tlowest for the exponential equation.The parabloic diffusion equation fitted well the expermiental results,with the least standard error among the six kinetic equation,showing that the monvemetn of boron from soil solution to soil colloid surface may be controlled by boron diffusion speed.The boron content of rape seedling obtained from soil cultvation was correlated with the rate constants of the kinetic equations.The constants of first-order ,parabloic diffusion,and exponential equaitions were significanlty correlated with the boron content of the crop of NPK treatment at a 95% probaility level ,with correation coeffecients being 0.686,0.691 and 0.64 and 0.641,respectively.In the case of zero-order equation,it Was significant at 99% probability level(r=0.736),These results showed that the adsorption kinetic constants of soil boron were closely related with the rape plant response to boron.

  20. Unattended safeguards instrumentation at centrifuge enrichment plants

    International Nuclear Information System (INIS)

    As global uranium enrichment capacity under international safeguards expands, the International Atomic Energy Agency (IAEA) is challenged to develop effective safeguards approaches at gaseous centrifuge enrichment plants, particularly high‑capacity plants, while working within budgetary constraints. New safeguards approaches should meet the high‑level verification objectives for such facilities (i.e., timely detection of: diversion of declared material, excess production beyond declared amounts, and production of enrichment levels higher than declared), but should also strive for efficiency advantages in implementation, for both the IAEA and operators. Under the Agency’s State- level approach to safeguards implementation, the Agency needs a flexible toolbox of technologies, allowing tailoring of safeguards measures for each individual enrichment facility. In this paper, the potential roles and development status for three different types of unattended measurement instrumentation are discussed. On‑Line Enrichment Monitors (OLEM) could provide continuous enrichment measurement for 100% of the declared gas flowing through unit header pipes. Unattended Cylinder Verification Stations (UCVS) could provide unattended verification of the declared uranium mass and enrichment of 100% of the cylinders moving through the plant, but also apply and verify an ‘NDA Fingerprint’ to preserve verification knowledge on the contents of each cylinder throughout its life in the facility. Sharing of the operator’s load cell signals from feed and withdrawal stations could count all cylinders introduced to the process and provide periodic monitoring of the uranium mass balance for in‑process material. The integration of load cell, OLEM and UCVS data streams offers the possibility for 100% verification of declared cylinder flow, and enables the periodic verification of the declared 235U mass balance in the plant. These new capabilities would enhance the IAEA’s effectiveness

  1. Integrated design of SIGMA uranium enrichment plants

    International Nuclear Information System (INIS)

    In the present work, we describe a preliminary analysis of the design feedbacks in a Uranium Enrichment Plant, using the SIGMA concept. Starting from the result of this analysis, a computer code has been generated, which allows finding the optimal configurations of plants, for a fixed production rate. The computer code developed includes the model of the Thermohydraulic loop of a SIGMA module. The model contains numerical calculations of the main components of the circuit. During the calculations, the main components are dimensioned, for a posterior cost compute. The program also makes an estimation of the enrichment gain of the porous membrane, for each separation stage. Once the dimensions of the main components are known, using the enrichment cascade calculation, the capital and operation costs of the plant could be determined. At this point it is simple to calculate a leveled cost of the Separative Work Unit (SWU). A numerical optimizer is also included in the program. This optimizer finds the optimal cascade configuration, for a given set of design parameters. The whole-integrated program permits to investigate in detail the feedback in the component design. Therefore, the sensibility of the more relevant parameters can be computed, with respect of the economical variables of the plant. (author)

  2. Separation of boron isotopes in anion exchange resin column. Isotopic enrichment of 10 B

    International Nuclear Information System (INIS)

    The separation of boron isotopes (10 B and 11 B) was carried out by isotopic exchange reaction between boric acid in solution and borate/poly borate anions adsorbed on an ammonium quaternary (Dowex 1 X 8 and 2 X 8) anion exchange resin packed in columns. Each resin column had 100 cm length and 1.4 cm in diameter. The columns were connected in series during displacement of boric bands. The enrichment line used pressure ranging from 2.5 to 3.0 Kg f.cm-2. N2 gas was used as in inert atmosphere in order to prevent C O2 formation. Enrichments in 10 B of 43% were obtained using Dowex 1 X 8 resin, 0.1 eq.L-1 H3 B O3 solution and band displacement of 1,876 cm. With Dowex 2 X 8 the enrichment was 40% with 1,330 cm of band displacement and 0.1 eq. L-1 H3 B O3. The boron isotopes were analysed, as methyl borate, by mass spectrometry. (author). 13 refs, 5 figs, 2 tabs

  3. Reprocessing of the irradiated boron carbide enriched by boron-10 isotope and its reuse in the control rods of the fast breeder reactors

    International Nuclear Information System (INIS)

    The present paper discusses the development of technology for reprocessing of irradiated boron carbide, which provides complete removal of radionuclides from irradiated materials. This technology allows the repeated use of B10 enriched with B4C in fast reactors. (author). 4 figs, 1 tab

  4. Boron

    International Nuclear Information System (INIS)

    The trace element boron (B) is of interest in reclamation situations for several reasons. It plays an essential through largely unidentified role in the growth of higher plants. In argronomic situations B deficiencies are common, and deficiencies in reclamation situations have been suggested but not documented. Among micronutrients, B is unique because the range from deficient concentrations to toxic concentrations either in the soil solution or in plant tissue is narrower than for any other micronutrient. In reclamation situations excessive amounts of B can occur in the soil or in near-surface mining wastes and thus interfere with reclamation objectives, especially in arid and semiarid regions. Also, B is mobile and appears subject to both upward transport (and possible contamination of overlying material) and downward transport (and possible contamination of surface water and groundwater)

  5. Evaluation of economical at a uranium enrichment demonstration plant

    International Nuclear Information System (INIS)

    In this report, the economy of technical achievement apply in the uranium enrichment demonstration plant is evaluated. From the evaluation, it can be concluded that the expected purpose was achieved because there was a definite economic prospect to commercial plant. The benefit analysis of thirteen years operation of the uranium enrichment demonstration plant also provides a financial aspect of the uranium enrichment business. Therefore, the performance, price and reliability of the centrifuge is an important factor in the uranium enrichment business. And the continuous development of a centrifuge while considering balance with the development cost is necessary for the business in the future. (author)

  6. Proposed physiologic functions of boron in plants pertinent to animal and human metabolism.

    OpenAIRE

    Blevins, D G; Lukaszewski, K M

    1994-01-01

    Boron has been recognized since 1923 as an essential micronutrient element for higher plants. Over the years, many roles for boron in plants have been proposed, including functions in sugar transport, cell wall synthesis and lignification, cell wall structure, carbohydrate metabolism, RNA metabolism, respiration, indole acetic acid metabolism, phenol metabolism and membrane transport. However, the mechanism of boron involvement in each case remains unclear. Recent work has focused on two majo...

  7. Tripartite enrichment project: Safeguards at enrichment plants equipped with Russian centrifuges

    International Nuclear Information System (INIS)

    This Paper describes major results of the work undertaken in the Tripartite Enrichment Project carried out under an Agreement between the IAEA the Ministry of the Russian Federation on Atomic Energy (Minatom), and under a Contract between the IAEA and the China Atomic Energy Authority (CAEA). The complete results of the work are published by the Agency in Tripartite Enrichment Project Summary and Task Reports. In 1993, the Government of the People's Republic of China informed the Agency that China had decided on a voluntary basis to add the Shaanxi Uranium Enrichment Plant to the list of eligible facilities under the Voluntary Offer Safeguards Agreement (INFCIRC/369). The Plant was under construction at the time. After consultations, the Agency selected the Shaanxi Plant in September of 1997 for the implementation of safeguards. The Agency realized that the safeguards approach used at gas centrifuge uranium enrichment facilities in other States would not be fully applicable. Chief among the reasons for this conclusion were the observations that enrichment plants incorporating Russian gas centrifuges are designed for a much greater degree of operational flexibility than other plants, and that travel conditions to the Shaanxi Plant at least at present are not compatible with requirements for unannounced access at the facility for the performance of unannounced inspections in the cascade area. The Tripartite Enrichment Project was conceived as a means to develop a safeguards approach for any plant equipped with Russian centrifuge technology. The Project was created through a cooperative arrangement involving specialists from Minatom, CAEA and the IAEA. It comprised seven tasks, the salient products of which are summarized in the following paragraphs. As the work proceeded, progress meetings were held in Vienna, Beijing and Moscow, and critical discussions were held at the Angarsk Enrichment Plant in the Russian Federation and at the Shaanxi Enrichment Plant in the

  8. Alleviation of Boron Stress through Plant Derived Smoke Extracts in Sorghum bicolor

    Directory of Open Access Journals (Sweden)

    Pirzada Khan

    2014-08-01

    Full Text Available Boron is an essential micronutrient necessary for plant growth at optimum concentration. However, at high concentrations boron affects plant growth and is toxic to cells. Aqueous extract of plant-derived smoke has been used as a growth regulator for the last two decades to improve seed germination and seedling vigor. It has been established that plant-derived smoke possesses some compounds that act like plant growth hormones. The present research was the first comprehensive attempt to investigate the alleviation of boron stress with plant-derived smoke aqueous extract on Sorghum (Sorghum bicolor seed. Smoke extracts of five plants, i.e. Cymbopogon jwarancusa, Eucalyptus camaldulensis, Peganum harmala, Datura alba and Melia azedarach each with six dilutions (Concentrated, 1:100, 1:200, 1:300, 1:400 and 1:500 were used. While boron solutions at concentrations of 5, 10, 15, 20 and 25 ppm were used for stress. Among the dilutions of smoke, 1:500 of E. camaldulensis significantly increased germination percentage, root and shoot length, number of secondary roots and fresh weight of root and shoot while, boron stress reduced growth of Sorghum. It was observed that combined effect of boron solution and E. camaldulensis smoke extract overcome inhibition and significantly improved plant growth. Present research work investigated that the smoke solution has the potential to alleviate boron toxicity by reducing the uptake of boron by maintaining integrity of plant cell wall. The present investigation suggested that plant derived smoke has the potential to alleviate boron stress and can be used to overcome yield losses caused by boron stress to plants.

  9. Genetic engineering of syringyl-enriched lignin in plants

    Science.gov (United States)

    Chiang, Vincent Lee; Li, Laigeng

    2004-11-02

    The present invention relates to a novel DNA sequence, which encodes a previously unidentified lignin biosynthetic pathway enzyme, sinapyl alcohol dehydrogenase (SAD) that regulates the biosynthesis of syringyl lignin in plants. Also provided are methods for incorporating this novel SAD gene sequence or substantially similar sequences into a plant genome for genetic engineering of syringyl-enriched lignin in plants.

  10. Boron deficiency in woody plants: various responses and tolerance mechanisms.

    Science.gov (United States)

    Wang, Nannan; Yang, Chengquan; Pan, Zhiyong; Liu, Yongzhong; Peng, Shu'ang

    2015-01-01

    Boron (B) is an essential microelement for higher plants, and its deficiency is widespread around the world and constrains the productivity of both agriculture and forestry. In the last two decades, numerous studies on model or herbaceous plants have contributed greatly to our understanding of the complex network of B-deficiency responses and mechanisms for tolerance. In woody plants, however, fewer studies have been conducted and they have not well been recently synthesized or related to the findings on model species on B transporters. Trees have a larger body size, longer lifespan and more B reserves than do herbaceous plants, indicating that woody species might undergo long-term or mild B deficiency more commonly and that regulation of B reserves helps trees cope with B deficiency. In addition, the highly heterozygous genetic background of tree species suggests that they may have more complex mechanisms of response and tolerance to B deficiency than do model plants. Boron-deficient trees usually exhibit two key visible symptoms: depression of growing points (root tip, bud, flower, and young leaf) and deformity of organs (root, shoot, leaf, and fruit). These symptoms may be ascribed to B functioning in the cell wall and membrane, and particularly to damage to vascular tissues and the suppression of both B and water transport. Boron deficiency also affects metabolic processes such as decreased leaf photosynthesis, and increased lignin and phenol content in trees. These negative effects will influence the quality and quantity of wood, fruit and other agricultural products. Boron efficiency probably originates from a combined effect of three processes: B uptake, B translocation and retranslocation, and B utilization. Root morphology and mycorrhiza can affect the B uptake efficiency of trees. During B translocation from the root to shoot, differences in B concentration between root cell sap and xylem exudate, as well as water use efficiency, may play key roles in

  11. Extractability, plant yield and toxicity thresholds for boron in compost

    Energy Technology Data Exchange (ETDEWEB)

    Brinton, W.F.; Evans, E.; Blewett, C. [Woods End Labs Inc., Mt. Vernon, ME (United States)

    2008-04-01

    Boron (B) is a trace element essential to crop growth in small soil concentrations (0.2-1.5ppm), yet may produce plant toxicity symptoms readily as the amount in the soil solution increases over 2ppm. Our study examined commercial compost made with coal fly-ash used to prepare growing media for cultivars of varying sensitivity (corn, beans, cucumber, peas). We examined total vs. extractable boron content and relate final visual symptoms of B-toxicity to yields and tissue concentrations. Visual toxicity effects included tip burn (corn), leaf mottling and necrosis (beans and peas) and leaf mottling and cupping (cucumbers). Fly ash added to compost increased hot-water soluble (HWS) B in proportion to rate and in dependence on pH, with 30% and 10% of total-B expressed as HWS-B at a media pH of 6 and 7.5, respectively. Biomass for bean and cucumber was significantly reduced by 45 to 55%, respectively, by addition of 33% fly-ash compost to growing media (28ppm total-B) while plant tissue-B increased by 6- to 4-fold, respectively. Economic yield depressions in compost media are evident for all crops and appeared at levels of HWS-B in compost media exceeding 5 ppm. The study underscores the need for careful management of exogenous factors that may be present in composts and suggests detailed understanding of media-pH and cultivar preferences may be required in preparation of growing media in order to reduce potential negative growth effects.

  12. Boron Plays an Important Role in the Regulation of Plant Cell Growth

    Institute of Scientific and Technical Information of China (English)

    1999-01-01

    Boron is an essential nutrition for higher plants.However, the primary function of boron remains a matter of discussion.Boron may function by forming complexes with compounds having cis-hydroxyl groups(diols), e.g., pectic materials in cell walls, glycoproteins or glycolipids in membranes and o-diphenols.The well-defined functions of boron are its involvement in maintaining cell wall structure and both the structural and the functional integrity of plasma membrane.Lack of boron causes an increase in the leakage of ions and compounds which reflects the impairment of plasma membrane.Boron is functionally important in forming a pectic network in cell wall which is responsible for the extensibility of cell wall and consequently regulates cell growth.

  13. Description of the Portsmouth Gas Centrifuge Enrichment Plant

    International Nuclear Information System (INIS)

    The Portsmouth Gas Centrifuge Enrichment Plant (GCEP) will be located at the site of the Portsmouth Gaseous Diffusion Plant in Piketon, Ohio. The purpose of the facility is to provide enriching services for the production of low assay enriched uranium for civilian nuclear power reactors. The construction and operation of the GCEP is administered by the US Department of Energy. The facility will be operated under contract from the US Government. Control of the GCEP rests solely with the US Government, which holds and controls access to the technology. Construction of GCEP is expected to be completed in the mid-1990's. Many facility design and operating procedures are subject to change. Nonetheless, the design described in this report does reflect current thinking. Descriptions of the general facility and major buildings such as the process buildings, feed and withdrawal building, cylinder storage and transfer, recycle/assembly building, and a summary of the centrifuge uranium enriching process are provided in this report

  14. Measurement of the enrichment of uranium in the pipework of a gas centrifuge enrichment plant

    International Nuclear Information System (INIS)

    The US and UK have been separately working on the development of a NDA instrument to determine the enrichment of gaseous UF6 at low pressures in cascade header pipework in line with the conclusions of the Hexapartite Safeguards Project viz. the instrument is capable of making a ''go/no go'' decision of whether the enrichment is less than/greater than 20%. Recently, there has been a series of very useful technical exchanges of ideas and information between the two countries. This has led to a technical formulation for such an instrumentation based on γ-ray spectrometry which, although plant-specific in certain features, nevertheless is based on the same physical principles. Experimental results from commercially operating enrichment plants are very encouraging and indicate that a complete measurement including set up time on the pipe should be attainable in about 30 minutes when measuring pipes of diameter around 110 mm. 5 refs., 4 figs

  15. Electroextraction of boron from boron carbide scrap

    Energy Technology Data Exchange (ETDEWEB)

    Jain, Ashish [Chemistry Group, Indira Gandhi Centre for Atomic Research, Kalpakkam – 603102 (India); Anthonysamy, S., E-mail: sas@igcar.gov.in [Chemistry Group, Indira Gandhi Centre for Atomic Research, Kalpakkam – 603102 (India); Ghosh, C. [Physical Metallurgy Group, Indira Gandhi Centre for Atomic Research, Kalpakkam – 603102 (India); Ravindran, T.R. [Materials Science Group, Indira Gandhi Centre for Atomic Research, Kalpakkam – 603102 (India); Divakar, R.; Mohandas, E. [Physical Metallurgy Group, Indira Gandhi Centre for Atomic Research, Kalpakkam – 603102 (India)

    2013-10-15

    Studies were carried out to extract elemental boron from boron carbide scrap. The physicochemical nature of boron obtained through this process was examined by characterizing its chemical purity, specific surface area, size distribution of particles and X-ray crystallite size. The microstructural characteristics of the extracted boron powder were analyzed by using scanning electron microscopy and transmission electron microscopy. Raman spectroscopic examination of boron powder was also carried out to determine its crystalline form. Oxygen and carbon were found to be the major impurities in boron. Boron powder of purity ∼ 92 wt. % could be produced by the electroextraction process developed in this study. Optimized method could be used for the recovery of enriched boron ({sup 10}B > 20 at. %) from boron carbide scrap generated during the production of boron carbide. - Highlights: • Recovery of {sup 10}B from nuclear grade boron carbide scrap • Development of process flow sheet • Physicochemical characterization of electroextracted boron • Microscopic examination of electroextracted boron.

  16. Electroextraction of boron from boron carbide scrap

    International Nuclear Information System (INIS)

    Studies were carried out to extract elemental boron from boron carbide scrap. The physicochemical nature of boron obtained through this process was examined by characterizing its chemical purity, specific surface area, size distribution of particles and X-ray crystallite size. The microstructural characteristics of the extracted boron powder were analyzed by using scanning electron microscopy and transmission electron microscopy. Raman spectroscopic examination of boron powder was also carried out to determine its crystalline form. Oxygen and carbon were found to be the major impurities in boron. Boron powder of purity ∼ 92 wt. % could be produced by the electroextraction process developed in this study. Optimized method could be used for the recovery of enriched boron (10B > 20 at. %) from boron carbide scrap generated during the production of boron carbide. - Highlights: • Recovery of 10B from nuclear grade boron carbide scrap • Development of process flow sheet • Physicochemical characterization of electroextracted boron • Microscopic examination of electroextracted boron

  17. Perimeter safeguards techniques for uranium-enrichment plants

    International Nuclear Information System (INIS)

    In 1972, a working group of the International Atomic Energy Agency identified a goal to develop and evaluate perimeter safeguards for uranium isotope enrichment plants. As part of the United State's response to that goal, Los Alamos Detection and Verification personnel studied gamma-ray and neutron emissions from uranium hexafluoride. They developed instruments that use the emissions to verify uranium enrichment and to monitor perimeter personnel and shipping portals. Unattended perimeter monitors and hand-held verification instruments were evaluated in field measurements and, when possible, were loaned to enrichment facilities for trials. None of the seven package monitoring techniques that were investigated proved entirely satisfactory for an unattended monitor. They either revealed proprietary information about centrifuge design or were subject to interference by shielding materials that could be present in a package. Further evaluation in a centrifuge facility may help in developing an acceptable attended package monitor. 34 figures, 9 tables

  18. LISSAT Analysis of a Generic Centrifuge Enrichment Plant

    Energy Technology Data Exchange (ETDEWEB)

    Lambert, H; Elayat, H A; O?Connell, W J; Szytel, L; Dreicer, M

    2007-05-31

    The U.S. Department of Energy (DOE) is interested in developing tools and methods for use in designing and evaluating safeguards systems for current and future plants in the nuclear power fuel cycle. The DOE is engaging several DOE National Laboratories in efforts applied to safeguards for chemical conversion plants and gaseous centrifuge enrichment plants. As part of the development, Lawrence Livermore National Laboratory has developed an integrated safeguards system analysis tool (LISSAT). This tool provides modeling and analysis of facility and safeguards operations, generation of diversion paths, and evaluation of safeguards system effectiveness. The constituent elements of diversion scenarios, including material extraction and concealment measures, are structured using directed graphs (digraphs) and fault trees. Statistical analysis evaluates the effectiveness of measurement verification plans and randomly timed inspections. Time domain simulations analyze significant scenarios, especially those involving alternate time ordering of events or issues of timeliness. Such simulations can provide additional information to the fault tree analysis and can help identify the range of normal operations and, by extension, identify additional plant operational signatures of diversions. LISSAT analyses can be used to compare the diversion-detection probabilities for individual safeguards technologies and to inform overall strategy implementations for present and future plants. Additionally, LISSAT can be the basis for a rigorous cost-effectiveness analysis of safeguards and design options. This paper will describe the results of a LISSAT analysis of a generic centrifuge enrichment plant. The paper will describe the diversion scenarios analyzed and the effectiveness of various safeguards systems alternatives.

  19. Determination of Boron in soils and plants samples using spectrophotometric method

    International Nuclear Information System (INIS)

    In this work, the concentration of boron in soil and plant samples was determined with UV-vis spectrophotometer by using azomethine-H as a complex reagent. The calibration curve for boron determination in the range of (0μ3 g.mL-1) was constructed by plotting the measured absorption of the yellow azomethine-H-B complex at λmax = 412.6 nm against boron concentration in the aqueous phase. The detection limit, repeatability limit, intermediate precision, accuracy, and recovery coefficient of this method were calculated and found to be 0.021 μg.mL-1, 0.335% , 0.81%, 2.93%, (98.4-101.5)% respectively. The influence of some foreign ions on the determination of boron were also investigated in detail, most of the studied ions, like iron, iodide, and calcium can be tolerated within the ranges of (20-35μg.mL-1), (3000-5000μg.mL-1) , (15000-30000μg.mL-1) respectively. This is due to the fact, that ascorbic acid and EDTA in the buffer masking reagent reaction system can be very effective in masking these ions. This method was found to be economic and suitable for boron determination in standard and local samples (soil, plant) and requires small amount of sample (1g). This method can also be applied for boron determination in water samples (drinking and industrial waste water).(author)

  20. Sensitive method for the spectrophotometric determination of boron in plants and waters using crystal violet

    International Nuclear Information System (INIS)

    A sensitive and rapid spectrophotometric method for the determination of boron is described, which is based on the formation of a blue complex at pH 1 to 2 between the anionic complex of boric acid with 2,6-dihydroxybenzoic acid and crystal violet; the colour is stabilised with poly(vinyl alcohol). At 600 nm the calibration graph is linear in the range 0.3 to 4.5 μg of boron per 25 ml of final solution with a relative standard deviation of +- 2.6% for 0.069 μg ml-1 of boron. The molar absorptivity is 3.75 x 104 l mol-1 cm-1. The method has been applied to the determination of boron in plants and natural waters. (author)

  1. Solar enriched methane production: Assessment of plant potentialities and applications

    Directory of Open Access Journals (Sweden)

    Vincenzo Piemonte

    2010-04-01

    Full Text Available The crucial environmental issue due to fossil fuel use in our society and industries and more and more perceived by the communities is stimulating the development of innovative technologies with the scope of reducing GHGs and pollutants emissions, improving plants efficiency and exploiting renewable energy sources. The idea proposed in the present work links this context: a novel hybrid plant for the production of a mixture of methane and hydrogen (20%vol, called enriched-methane, from a steam reforming reactor whose heat duty is supplied by a concentrating solar power (CSP plant by means of a molten salt stream is here conceived, modelled and assessed. The enriched-methane mixture can be applied in methane internal combustion engines (ICE reducing CO, CO2, unburned emissions and improving engine efficiency. Moreover, the residual sensible heat of solar-heated molten salt stream can be used to generate medium-pressure steam and to produce electricity by a steam-turbine. Therefore, the plant proposed is co-generative, producing both hydrogen and electricity from a solar source. The behaviour of methane steam reforming reactor is simulated by means of a 2D mathematical model and the design of a cogenerative solar plant is proposed, evaluating its potentialities in terms of MWh of electricity produced and number of vehicles fed by enriched-methane. A single CSP module (surface requirement = 1.5 hectares coupled with a 4-tubes-and-shell shaped reactor is able to produce 686 tons/year of hydrogen, equivalent to 3.430 tons/year of 20%vol H2-CH4 mixture and 3.097 MWh/year of clean electricity.

  2. Exploring the Physiological Basis for High Reproduction Sensitivity to Boron Deficiency in Plants

    OpenAIRE

    Huang, Longbin; Bell, Richard William; Dell, Bernard

    2009-01-01

    Plant reproduction has higher boron (B) requirements than vegetative growth and generally reproductive plant parts contain more B, but the form and function of the extra B remains unexplained. In this paper we review the literature on B in plant reproductive development and add to it recent results on B distribution and forms in reproductive parts (silks, pollen) and vegetative parts (youngest open leaves) of maize grown in B-buffered solution culture. Cell wall binding of B in the silk and p...

  3. Seismic vulnerability study of the nation's uranium enrichment plants

    International Nuclear Information System (INIS)

    The US Department of Energy's uranium enrichment production is accomplished with three gaseous diffusion plants located at Oak Ridge, Tennessee; Paducah, Kentucky; and Portsmouth, Ohio. The plants were built in the 1940's and 1950's with no seismic design requirements and are located in three different seismic zones. Paducah is in the New Madrid seismic zone (UBC-Zone 3), Oak Ridge is in the Southern Appalachian seismic zone (UBC-Zone 2) and Portsmouth is near the Anna, Ohio seismic zone (UBC-Zone 1). This paper discusses the approach that was used to determine the seismic vulnerability of each of the plants in response to safety and operability analysis studies. Using state-of-the-art seismic evaluation methods, the study showed that the plants are more resistant to seismic excitation than previously thought. However, the study also showed that small seismic excitations could cause any one of the plants to shut down because of weak links in the process systems. It was determined that for about $6 million each, the Oak Ridge and Paducah plants could be upgraded to provide continuity of operation and operational safety at the evaluation basis earthquake levels. At Portsmouth the upgrade costs were determined to be about $1 million, much less than Paducah or Oak Ridge because of process equipment uniqueness

  4. Safeguards approaches for conversion and gas centrifuge enrichment plants

    International Nuclear Information System (INIS)

    This paper describes recent studies and investigations of new safeguards measures and inspection tools to strengthen international safeguards at GCEPs (Gas Centrifuge Enrichment Plants) and conversion plants. The IAEA has indicated that continuous, unattended process monitoring should play a central role in future safeguards approaches for conversion plants and GCEPs. Monitoring safeguards relevant information from accountancy scales, process load cells, and unit header pipes can make existing safeguards approaches more efficient by replacing repetitive, routine, labor-intensive inspection activities with automated systems. These systems can make the safeguards approach more effective by addressing more completely the safeguards objectives at these facilities. Automated collection and analysis of the data can further enable the IAEA to move towards a fully-information driven inspection regime with randomized (from the operator's perspective), short-notice inspections. The reduction in repetitive on-site inspection activities would also be beneficial to plant operators, but only if sensitive and proprietary information can be protected and the new systems prove to be reliable. New facilities that incorporate Safeguards by Design into the earliest design stages can facilitate the effective DIV (Design Information Verification) of the plant to allow the inspectors to analyze the capacity of the plant, to project maximum production from the plant, and to provide a focus on the areas in the plant where credible diversion scenarios could be attempted. Facilitating efficient nuclear material accountancy by simplifying process pipework and making flow measurement points more accessible can allow for easier estimation of plant holdup and a potential reduction in the number of person-days of inspection. Lastly, a universal monitoring standard that tracks the location, movement, and use of UF6 cylinders may enhance the efficiency of operations at industry sites and would

  5. Improvement of the safeguards approach at Rokkasho Enrichment Plant

    International Nuclear Information System (INIS)

    Rokkasho Enrichment Plant (REP) has been operated since 1992 with implementing the safeguards-based on the Hexapartite Safeguards Project (HSP) concept. In order to improve confidence on safeguards at REP, Japan Safeguards Office (JSGO), IAEA and JNFL have established the task force meeting to discuss the safeguards improvement plans including concepts of integrated safeguards approach at REP. This paper presents accountancy method, outline of current inspection activities, group seals on tails cylinders, UF6 tracking system based on optical surveillance cameras under trial use as part of improvement plan, and integrated safeguards approach under study with issue to be solved. (author)

  6. Inspection support system at the Rokkasho Enrichment Plant (REP)

    International Nuclear Information System (INIS)

    At Rokkasho Enrichment Plant (REP), location map, itemized list and inspection seals information had been prepared for inventory and inventory change verification by paper basis. Therefore lots of documents were needed at the job site, and time was required for information retrieval. In order to provide efficient inspection, REP has developed and implemented inspection support system based on mobile computer and Microsoft Access, which can provide all necessary information retrieval for the inspection in timely. This paper describes outline of inspection support system. (author)

  7. Nitrogen enrichment, boron depletion and magnetic fields in slowly-rotating B-type dwarfs

    CERN Document Server

    Morel, T; Briquet, M

    2008-01-01

    Evolutionary models for massive stars, accounting for rotational mixing effects, do not predict any core-processed material at the surface of B dwarfs with low rotational velocities. Contrary to theoretical expectations, we present a detailed and fully-homogeneous, NLTE abundance analysis of 20 early B-type dwarfs and (sub)giants that reveals the existence of a population of nitrogen-rich and boron-depleted, yet intrinsically slowly-rotating objects. The low-rotation rate of several of these stars is firmly established, either from the occurrence of phase-locked UV wind line-profile variations, which can be ascribed to rotational modulation, or from theoretical modelling in the pulsating variables. The observational data presently available suggest a higher incidence of chemical peculiarities in stars with a (weak) detected magnetic field. This opens the possibility that magnetic phenomena are important in altering the photospheric abundances of early B dwarfs, even for surface field strengths at the one hund...

  8. Development of TIMS for isotopic ratio analysis of boron

    International Nuclear Information System (INIS)

    A magnetic sector based Thermal Ionisation Mass Spectrometer (TIMS) has been developed at Technical Physics Division, for high precision isotope ratio analysis of Boron (in the form of Sodium Meta-borate) at the Boron enrichment facility, Heavy Water Plant, Manuguru. The performance of this indigenously developed TIMS has been tested for sensitivity, isotope ratio precision and accuracy for different levels of enrichment in the plant samples. The sensitivity of this instrument was found to be 1 ion per 200 atoms. The internal and external precision for natural concentration levels Boron isotopes were better than 0.05%. (author)

  9. Material surveillance and verification program at a uranium enriching plant

    International Nuclear Information System (INIS)

    A license for a nuclear facility in the United States is approved only after a licensee demonstrates by procedure or practice that an adequate material control system exists. A license can specify acceptable material control practices. Therefore, processors in the United States receiving uranium hexafluoride (UF6) from a U. S. Government-owned enriching plant can accept shipper's values for nuclear material accounting purposes if: there is surveillance during withdrawal of the UF6, an independent sample is obtained, and certain measurement verification is subsequently performed by the receiver or the receiver's agent. Because of the high equipment and operating costs, essentially all UF6 processors have adopted a surveillance and verification program. A resident observer is employed to perform surveillance, obtain samples, and tamper-safe the shipping cylinders. Samples are analyzed by the receiver or by an independent laboratory. The observer determines by surveillance that withdrawals, or transfers of material, weighings, and sampling are accomplished in accordance with accepted procedures. Surveillance of the withdrawals includes observing the transfer of UF6 from the enriching plant cylinder to the shipping cylinder(s) and the withdrawal of samples. In addition, it inclu

  10. Qualitative analysis for reactivity accidents due to the boron dilution of the Korea Standard Nuclear Power Plant

    Energy Technology Data Exchange (ETDEWEB)

    Park, J. K.; Park, J. H.; Lim, H. K.; Han, S. J.; Kim, T. W

    2003-03-01

    Researches for reactivity accidents due to local or rapid boron dilution in the reactor core have been recently performed in France, United States of America and Germany. As the result, core damage probability due to boron dilution is relatively high when nuclear power plants are in the low power or shutdown conditions. Nevertheless, few research activities to reveal reactivity accidents originated from local or rapid boron dilution have been performed in Korea. Thus, in order to identify possible boron dilution scenarios that can result in reactivity accidents and to suggest alternatives or remedies that can enhance the safety of a nuclear power plant, this study is carried out. As the results, it was revealed that YGN 5 and 6 have been designed and maintained so as to minimize the possibility of boron dilution accident. However, in the case of boron dilution scenarios that result from human error, not only various types of human error should be considered but also detailed human error probabilities are insufficient. Thus, in-depth researches for the human-induced boron dilution accidents could be performed to get more meaningful results. Nevertheless, characteristics of each boron dilution scenarios that are addressed from this report will be helpful for the safety enhancement of nuclear power plants, if they are supplementally added to plant operating procedures including normal, abnormal and emergency operating procedures.

  11. Systems approach used in the Gas Centrifuge Enrichment Plant

    Energy Technology Data Exchange (ETDEWEB)

    Rooks, W.A. Jr.

    1982-01-01

    A requirement exists for effective and efficient transfer of technical knowledge from the design engineering team to the production work force. Performance-Based Training (PBT) is a systematic approach to the design, development, and implementation of technical training. This approach has been successfully used by the US Armed Forces, industry, and other organizations. The advantages of the PBT approach are: cost-effectiveness (lowest life-cycle training cost), learning effectiveness, reduced implementation time, and ease of administration. The PBT process comprises five distinctive and rigorous phases: Analysis of Job Performance, Design of Instructional Strategy, Development of Training Materials and Instructional Media, Validation of Materials and Media, and Implementation of the Instructional Program. Examples from the Gas Centrifuge Enrichment Plant (GCEP) are used to illustrate the application of PBT.

  12. Ion exchange separation for decontamination of centrifuge enrichment plant

    International Nuclear Information System (INIS)

    Ion exchange separation of uranyl ion (UO22+) from metal cations has been carried out by the columnar operation using ion exchange resins in 0.1 mol/dm3 sulfuric acid medium. Uranyl ion was adsorbed in an anion exchange resin and the rest metal cations, Fe(III), Al(III), Cr(III), Ni(II) and Cu(II) ions, were adsorbed in a cation exchange resin in this system. Desorption of uranyl ion and metal cations adsorbed in the resins were tested by 2 mol/dm3 sulfuric acid solution. Desorbed elements were confirmed to be precipitated by appropriate alkaline solutions. On the basis of the results obtained, a concept was made on a decontamination system for uranium-contaminated waste solution from centrifuge enrichment plant. (author)

  13. Gas Centrifuge Enrichment Plant seismic time history development

    International Nuclear Information System (INIS)

    The objective of this study is to generate a number of artificial-spectrum consistent-time histories for use in the seismic analysis of the Gas Centrifuge Enrichment Plant (GCEP) service modules (SM). The method used in the generation of the artificial time histories presented in this report makes use of the fast Fourier transform (FFT) algorithm to modify the Fourier frequency spectrum of a recorded accelerogram. The response spectrum of the generated accelerogram is consistent with the spectrum specification given by USAEC Regulatory Guide 1.60. Five statistically independent time histories have been developed. These accelerograms are based on recorded West Coast accelerations that meet specific requirements associated with the location of the recording station with regard to the epicenter. The acceleration time history, Fourier and response spectras, and integrated velocity and displacement records are presented

  14. Systems approach used in the Gas Centrifuge Enrichment Plant

    International Nuclear Information System (INIS)

    A requirement exists for effective and efficient transfer of technical knowledge from the design engineering team to the production work force. Performance-Based Training (PBT) is a systematic approach to the design, development, and implementation of technical training. This approach has been successfully used by the US Armed Forces, industry, and other organizations. The advantages of the PBT approach are: cost-effectiveness (lowest life-cycle training cost), learning effectiveness, reduced implementation time, and ease of administration. The PBT process comprises five distinctive and rigorous phases: Analysis of Job Performance, Design of Instructional Strategy, Development of Training Materials and Instructional Media, Validation of Materials and Media, and Implementation of the Instructional Program. Examples from the Gas Centrifuge Enrichment Plant (GCEP) are used to illustrate the application of PBT

  15. Material surveillance and verification programme at a uranium enriching plant

    International Nuclear Information System (INIS)

    A licence for a nuclear facility in the United States of America is approved only after a licencee demonstrates by procedure or practice that an adequate material control system exists. A licence can specify acceptable material control practices. Therefore, processors in the United States receiving uranium hexafluoride (UF6) from a United States Government-owned enriching plant can accept shipper's values for nuclear material accounting purposes if: (1) there is surveillance during withdrawal of the UF6; (2) an independent sample is obtained; and (3) certain measurement verification is subsequently performed by the receiver or the receiver's agent. Because of the high equipment and operating costs, essentially all UF6 processors have adopted a surveillance and verification programme. A resident observer is employed to perform surveillance, obtain samples, and make the shipping cylinders tamper-safe. Samples are analysed by the receiver or by an independent laboratory. The observer determines by surveillance that withdrawals, or transfers of material, weighings, and sampling are accomplished in accordance with accepted procedures. Surveillance of the withdrawals includes observing the transfer of UF6 from the enriching plant cylinder to the shipping cylinder(s) and the withdrawal of samples. In addition, it includes observing the weighing of all cylinders associated with a sample lot of UF6. Following the surveillance of withdrawals, weighings, and sampling, the cylinders are made tamper-safe by the application of tamper-indicating devices. Statistics for the verification programme have shown shipper and receiver measurements to be within the limits acceptable for adequate material control. (author)

  16. Centrifuge enrichment plants. January 1970-October 1988 (Citations from the NTIS data base). Report for January 1970-October 1988

    International Nuclear Information System (INIS)

    This bibliography contains citations concerning the design, control, monitoring, and safety of centrifuge enrichment plants. Power supplies, enrichment plant safeguards, facility design, cascade heater test loops to monitor the enrichment process, inspection strategies, and the socio-economic effects of centrifuge enrichment plants are examined. Radioactive waste disposal problems are briefly considered. (Contains 151 citations fully indexed and including a title list.)

  17. New Measures to Safeguard Gas Centrifuge Enrichment Plants

    Energy Technology Data Exchange (ETDEWEB)

    Whitaker, Jr., James [ORNL; Garner, James R [ORNL; Whitaker, Michael [ORNL; Lockwood, Dunbar [U.S. Department of Energy, NNSA; Gilligan, Kimberly V [ORNL; Younkin, James R [ORNL; Hooper, David A [ORNL; Henkel, James J [ORNL; Krichinsky, Alan M [ORNL

    2011-01-01

    As Gas Centrifuge Enrichment Plants (GCEPs) increase in separative work unit (SWU) capacity, the current International Atomic Energy Agency (IAEA) model safeguards approach needs to be strengthened. New measures to increase the effectiveness of the safeguards approach are being investigated that will be mutually beneficial to the facility operators and the IAEA. One of the key concepts being studied for application at future GCEPs is embracing joint use equipment for process monitoring of load cells at feed and withdrawal (F/W) stations. A mock F/W system was built at Oak Ridge National Laboratory (ORNL) to generate and collect F/W data from an analogous system. The ORNL system has been used to collect data representing several realistic normal process and off-normal (including diversion) scenarios. Emphasis is placed on the novelty of the analysis of data from the sensors as well as the ability to build information out of raw data, which facilitates a more effective and efficient verification process. This paper will provide a progress report on recent accomplishments and next steps.

  18. Effects of foliar boron application on seed composition, cell wall boron, and seed δ15N and δ13C isotopes in water-stressed soybean plants

    OpenAIRE

    Bellaloui, Nacer; Hu, Yanbo; Mengistu, Alemu; Kassem, My A.; Abel, Craig A.

    2013-01-01

    Limited information is available on the effects of foliar boron (B) application on soybean seed composition. The objective of this research was to investigate the effects of foliar B on seed composition (protein, oil, fatty acids, and sugars). Our hypothesis was that since B is involved in nitrogen and carbon metabolism, it may impact seed composition. A repeated greenhouse experiment was conducted where half of the soybean plants was exposed to water stress (WS) and the other half was well-w...

  19. New targets in plant boron deficiency response: Nglycosylation and regulation of root developement

    OpenAIRE

    Abreu Sánchez, Isidro

    2016-01-01

    Tesis Doctoral inédita leída en la Universidad Autónoma de Madrid, Facultad de Ciencias, Departamento de Biología   Since Warington described in 1923 for first time boron (B) essentiality in plants, many authors have tried to understand what the micronutrient is doing, how the micronutrient is acquired, and what happens when the micronutrient is absent. First studies on B nutrition focused on physiological processes and biochemical pathways which appeared altered as a consequence of B d...

  20. 78 FR 65389 - United States Enrichment Corporation, Paducah Gaseous Diffusion Plant

    Science.gov (United States)

    2013-10-31

    ... for a 5-year period with an expiration date of December 31, 2018. On May 22, 2013 (78 FR 30342), the... COMMISSION United States Enrichment Corporation, Paducah Gaseous Diffusion Plant AGENCY: Nuclear Regulatory... review. SUMMARY: On April 2, 2013, the United States Enrichment Corporation (USEC) filed an...

  1. Nitrogen enrichment of soil and plant by Rhizobium phaseoli - Phaseolus vulgaris symbiosis

    International Nuclear Information System (INIS)

    Incubation of 25 and 30 day old nodulated plants of Phaseolus vulgaris for periods of 24h and 72h under 15-dinitrogen atmosphere indicated nitrogen enrichment of soil compared with soil free of plants and with other plants under the same experimental conditions. This indication of realease from the root-nodule system is discussed. (Auth.)

  2. Evaluation of processes controlling the geochemical constituents in deep groundwater in Bangladesh: Spatial variability on arsenic and boron enrichment

    International Nuclear Information System (INIS)

    Forty-six deep groundwater samples from highly arsenic affected areas in Bangladesh were analyzed in order to evaluate the processes controlling geochemical constituents in the deep aquifer system. Spatial trends of solutes, geochemical modeling and principal component analysis indicate that carbonate dissolution, silicate weathering and ion exchange control the major-ion chemistry. The groundwater is dominantly of Na-Cl type brackish water. Approximately 17% of the examined groundwaters exhibit As concentrations higher than the maximum acceptable limit of 10 μg/L for drinking water. Strong correlation (R2 = 0.67) of Fe with dissolved organic carbon (DOC) and positive saturation index of siderite suggests that the reductive dissolution of Fe-oxyhydroxide in presence of organic matter is considered to be the dominant process to release high content of Fe (median 0.31 mg/L) in the deep aquifer. In contrast, As is not correlated with Fe and DOC. Boron concentration in the 26% samples exceeds the standard limit of 500 μg/L, for water intended for human consumption. Negative relationships of B/Cl ratio with Cl and boron with Na/Ca ratio demonstrate the boron in deep groundwater is accompanied by brackish water and cation exchange within the clayey sediments.

  3. Implementation of Low Boron Core for APR1400 Initial Cycle

    International Nuclear Information System (INIS)

    Low boron capability of a nuclear power plant is rather a qualitative specification requiring the nuclear power plant to be shut down by control rods alone at any time of a plant cycle according to EUR. The reduction of soluble boron is beneficial since it gives the reduction of the corrosive effects in the plant system and improves plant safety giving more negative MTC. Thus, it is necessary to reduce the amount of soluble boron for the criticality to achieve the low boron capability. However, the reduction of soluble boron has its own set of specific challenges that must be overcome. There are two methods to enable the reduction of soluble boron without modifying plant system significantly. The goal of this study is to investigate the loading pattern to achieve the soluble boron reduction for Shin-Kori Unit 5 APR1400 initial core using the low and high content gadolinia burnable absorbers with standard fuel rod enrichment and to verify the feasibility of low boron core with conventional gadolinia burnable absorbers only. For this study, KARMA has been employed to solve 2-D Transport equation, and ASTRA is used for full core analysis. It was possible to achieve the low boron core for APR1400 Cycle 1 using extended usage of two types of gadolinia burnable absorbers sacrificing fuel cycle economy a little bit while enhancing plant safety significantly. Gd rod patterns within an assembly were optimized through geometrical weighting and loading pattern was developed based on these patterns. The amount of soluble boron reduction achieved is 45.4%. The improvement in plant safety is significant resulting in the reduction of least negative best-estimate MTC by about 4 pcm. Also shutdown margin is increased slightly for low boron core. However, the behavior of axial power shape turns out to be undesirable showing a relatively large fluctuation caused by the more negative MTC. It was found that the low boron core might impose kind of operational difficulty. It is usually

  4. Effects of mono- and intercropping on growth and boron uptake of wheat plant (triticum aestivum l.) cultivated on boron-contaminated media

    International Nuclear Information System (INIS)

    Wheat plant (Triticum aestivum L.) was grown as main crop while clover (Medicago sativa L.) and sunflower (Helianthus annuus L.) were used as intercrops. Boron was applied in the form of Boric Acid (25, 50, and 75 mg L-1). The amount of chlorophyll, carotenoid, proline, B, Ca, K, and P were determined together with % DW and % EC. % DW, total chlorophyll, and carotenoid contents in monocrop and intercrop leaves grown wheat plants decreased in comparison with the control group. However, increases in mentioned parameters were observed in wheat-clover intercrops. Additionally, % EC values and proline contents in the leaves of mono-cultivated wheat plant were higher compared to the control group. Intercropping of wheat plant with clover and sunflower resulted in decreased values. Furthermore, element contents of the mono-cultivated wheat leaves decreased while these values increased when intercropping with clover. (author)

  5. Antioxidant activities of plants enriched in rosmarinic acid

    OpenAIRE

    Pereira, Olívia R.; Perez, María J.; Macias, Rócio I.R.; Domingues, M. R. M.; Marín, Jose J. G.; Cardoso, Susana M.

    2012-01-01

    The present study aims to evaluate the in vitro antioxidant potential of Lavandula dentata and Mentha aquatica plant extracts. For that, ethanolic extracts of the two plants were prepared and their phenolic composition was determined through combined methods of HPLC-DAD and ESI-MS. Moreover, the antioxidant activity of the plant extracts was estimated by: i) evaluation of DPPH scavenging potential and ii) monitoring the protective effects against the generation of reactive oxygen species (ROS...

  6. Biochemical attributes, plant growth and yield of tomato as affected by boron application rates

    International Nuclear Information System (INIS)

    A glass house pot experiment, with two tomato cultivars VCT-1 and Riogrande, was 1) in carried out to assess the effects of four levels of soil application of B (0, 0.5, 1.0 and 1.5 mg kg/sup -1/ in the form of borax on plant growth, biochemical content, antioxidant activity and fruit yield. Higher -1 plant growth and fruit yield in both cultivars were achieved by the B 1.0 and 1.5 mg kg/sup -1/ soil application respectively. Application of 0.5 mg B kg/sup -1/ had lower dry matter production as well as fruit yield when compared with B 1.0 and 1.5 mg kg/sup -1/. The percent increase of fruit yield at 0.5 mg B kg/sup -1/ was 12 and 10, in VCT-1 and Riogrande respectively. In the same cultivars, B application at the rate of 1.0 mg B kg/sup -1/ caused fruit yield by 23 and 21% while 1.5 mg B kg/sup -1/ enhanced by 22 and 20% respectively. Boron concentration in leaf, fruit and root increased with the increasing level of B. Boron application at 1.0 and 1.5 mg kg/sup -1/ significantly increased chlorophyll, sugar and protein content in both cultivars. Superoxide dismutase and catalase activity was significantly increased by the soil application of 1.5 mg B kg/sup -1/ in both cultivars of tomato. Results showed that soil application of 1.0 mg B kg soil have a positive effect on plant growth, yield and biochemical attributes of both the tomato cultivars. (author)

  7. High enriched lead-206 for small nuclear power plants

    International Nuclear Information System (INIS)

    In modern projects of perspective NPP the preference is returned to fast reactors (FR) with heavy liquid metal coolants. Internal self-hardening, absence of poisoning effects, compensation of uranium fuel burn-out by produced plutonium fuel and other positive features of FR will allow in the long term to lengthen operating campaign of the reactor till 10-12 of years, and service life of FR - till 30-60 of years. As is known, the coolant, circulating through the core of FR, is activated and accumulates long-lived radionuclides. Taking in account the masses of coolant materials in considered FR (20-200 tons) and the scales of an introduction of small NPP in the future, it can be problems with handling a completed coolant after FR removal from exploitation and at realization of repair and emergency activities. There, it is desirable to have a low-activation coolant with low contents of long-lived radionuclides - products of nuclear reactions. In paper, presented at the ICONE-8 conference, it is offered to use lead enriched with isotope Pb-206 as a low-activation coolant for FR. Its contents in a natural mix of lead isotopes make 24 %, and the demanded enrichment of isotope does not exceed 95-98 %. However, usage of a coolant from enriched lead can result in advancing the price of power, owing to what NPP can become noncompetitive in relation to other power sources. The purpose of the present paper - to point that interval of the prices of the product lead-206, at which one it can be demanded for nuclear engineering in large quantities. In the paper possible ways to ease the costs of obtaining the product lead-206 for the need of small nuclear engineering are also considered. (author)

  8. Responses of plant rhizosphere to atmospheric CO2 enrichment

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Plant root growth is generally stimulated under elevated CO2. This will bring more carbon to the below-ground through root death and exudate. This potential increase in below-ground carbon sink may lead to changes in long-term soil sequestration and relationship between host plants and symbions. On the other hand, changes in litter components due to the changes in plant chemical composition may also affect soil processes, such as litter decomposition, soil organic matter sequestration and hetero-nutritional bacteria activities. These issues are discussed.

  9. Gypsophila sphaerocephala Fenzl ex Tchihat.: A Boron Hyperaccumulator Plant Species That May Phytoremediate Soils with Toxic B Levels

    OpenAIRE

    BABAOĞLU, Mehmet

    2004-01-01

    Analyses were carried out to identify boron (B) hyperaccumulating plant species in an actively B- mined area of Kırka, Eskişehir, Turkey. Only 4 plant species, Gypsophila sphaerocephala Fenzl ex Tchihat. var. sphaerocephala (Caryophyllaceae), Gypsophila perfoliata L. (Caryophyllaceae), Puccinellia distans (Jacq.) Parl. subsp. distans (Gramineae) and Elymus elongatus (Host) Runemark subsp. turcicus (McGuire) Melderis (Gramineae), were identified in the highest B- containing sections of the min...

  10. FACE: Free-Air CO{sub 2} Enrichment for plant research in the field

    Energy Technology Data Exchange (ETDEWEB)

    Hendrey, G.R. [ed.

    1992-08-01

    Research programs concerning the effects of Carbon Dioxide(CO){sub 2} on cotton plants are described. Biological responses studied include foliage response to CO{sub 2} fluctuations; yield of cotton exposed to CO{sub 2} enrichment; responses of photosynthesis and stomatal conductance to elevated CO{sub 2} in field-grown cotton; cotton leaf and boll temperatures; root response to CO{sub 2} enrichment; and evaluations of cotton response to CO{sub 2} enrichment with canopy reflectance observations.

  11. FACE: Free-Air CO[sub 2] Enrichment for plant research in the field

    Energy Technology Data Exchange (ETDEWEB)

    Hendrey, G.R. (ed.)

    1992-08-01

    Research programs concerning the effects of Carbon Dioxide(CO)[sub 2] on cotton plants are described. Biological responses studied include foliage response to CO[sub 2] fluctuations; yield of cotton exposed to CO[sub 2] enrichment; responses of photosynthesis and stomatal conductance to elevated CO[sub 2] in field-grown cotton; cotton leaf and boll temperatures; root response to CO[sub 2] enrichment; and evaluations of cotton response to CO[sub 2] enrichment with canopy reflectance observations.

  12. Influence of sediment organic enrichment and water alkalinity on growth of aquatic isoetid and elodeid plants

    DEFF Research Database (Denmark)

    Raun, Ane-Marie Løvendahl; Borum, Jens; Jensen, Kaj Sand

    2010-01-01

    ) increasing alkalinity (from 0.17 to 3.20 meq. L-1) enhances growth and reduces inhibition of organic sediment enrichment for elodeids but not for isoetids. 2. In low organic sediments, higher oxygen release from roots of isoetids than elodeids generated oxic conditions to greater sediment depth for Lobelia...... two elodeids (Potamogeton crispus and P. perfoliatus), we test whether organic enrichment of lake sediments has a long-lasting influence by: (i) reducing plant growth because of oxygen stress on plant roots and (ii) inhibiting growth more for isoetids than elodeids. We also test whether (iii...... because of greater CO2 supply from sediments being their main CO2 source. At higher organic enrichment, isoetid biomass was reduced, leaf chlorophyll declined up to 10-fold, root length declined from 7 to <2 cm and mortality rose (up to 50%) signalling high plant stress. 4. Lobelia was not affected by HCO...

  13. Genotypic Difference of Plants in K—Enrichment Capability and the Distribution of K in Plant Rhizosphere

    Institute of Scientific and Technical Information of China (English)

    YANWEIDONG; SHIWEIMNG; 等

    1997-01-01

    Plant genotypic difference of potassium-enrichment capalbility and potassium(K) distribution at root-soil interace of different plant genotypes were studied by using seven plant species and eight varieties of tobacco(Nicotiana tabacum L.) The results indicated that K enrichment capability was: Ethiopian guizotia(Guizotia abyssinica Cass.)>feather cockscomb(Celosia argentea L.)>alligator alternanthera(Alternathera philoxeroides (Mart.) Griseb.)>tobacco>sesbania(Sesbania cannabina(Retz.)Pers.)>wheat(Triticum aestivum L.)>broadbean(Vicia faba L.).Ethiopian guizotia showed very high K-enrichment capability at different soil K levles,and the K content in its dry matter was over 110 mg kg-1 when soil K was fully supplied ,and about 60 mg kg-1 when no K fertilizer was applied.For alligator alternanthera,the capabiltiy to accumulate K was closely related with its growth medium,When it was grown on soils ,both the K content and K uptake rate of the plant were similar to whose of tobacco.Evident K depletion was observed in the rhizospere of all plant species,and the depletion rate was related to the capability of enrichment of plant .

  14. Criteria for the safe storage of enriched uranium at the Y-12 Plant

    Energy Technology Data Exchange (ETDEWEB)

    Cox, S.O.

    1995-07-01

    Uranium storage practices at US Department of Energy (DOE) facilities have evolved over a period spanning five decades of programmatic work in support of the nuclear deterrent mission. During this period, the Y-12 Plant in Oak Ridge, Tennessee has served as the principal enriched uranium facility for fabrication, chemical processing, metallurgical processing and storage. Recent curtailment of new nuclear weapons production and stockpile reduction has created significant amounts of enriched uranium available as a strategic resource which must be properly and safely stored. This standard specifies criteria associated with the safe storage of enriched uranium at the Y-12 Plant. Because programmatic needs, compliance regulations and desirable materials of construction change with time, it is recommended that these standards be reviewed and amended periodically to ensure that they continue to serve their intended purpose.

  15. Highly Boron Deficiency-Tolerant Plants Generated by Enhanced Expression of NIP5;1, a Boric Acid Channel

    OpenAIRE

    Kato, Yuichi; Miwa, Kyoko; Takano, Junpei; Wada, Motoko; Fujiwara, Toru

    2008-01-01

    Boron (B) is an essential element for plants, and B deficiency is a worldwide agricultural problem. In B-deficient areas, B is often supplied as fertilizer, but excess B can be toxic to both plants and animals. Generation of B deficiency-tolerant plants could reduce B fertilizer use. Improved fertility under B-limiting conditions in Arabidopsis thaliana by overexpression of BOR1, a B transporter, has been reported, but the root growth was not improved by the BOR1 overexpression. In this study...

  16. Socioeconomic effects of the DOE Gas Centrifuge Enrichment Plant. Volume 1: methodology and analysis

    International Nuclear Information System (INIS)

    The socioeconomic effects of the Gas Centrifuge Enrichment Plant being built in Portsmouth, Ohio were studied. Chapters are devoted to labor force, housing, population changes, economic impact, method for analysis of services, analysis of service impacts, schools, and local government finance

  17. Long-term disposal of enrichment plant tails

    Energy Technology Data Exchange (ETDEWEB)

    Leone, S.M.; Richardson, E.W.; Knight, R.G.; McGinnis, C.P.; Pashley, J.H.

    1978-12-18

    It was assumed that a water insoluble uranium compound essentially free of fluorides would be the desired form for the final storage of cascade tails. UO/sub 2/ produced in a two-step process in which the UF/sub 6/ is reduced to UF/sub 4/ with hydrogen in a tower reactor, followed by pyrohydrolysis to UO/sub 2/ with steam in a screw reactor, has been selected as a suitable compound for storage. The UO/sub 2/ would be stored in 55-gallon steel drums holding approximately 900 kg, and the drums would be warehoused until a permanent storage facility could be developed. Approximately one-third of the fluoride content of the UF/sub 6/ will be recovered as anhydrous HF with potential for industrial sale, while the remaining fluoride content will be reacted with limestone and disposed of in landfills. The magnitude of the conversion process is illustrated by considering a typical electrical generation rate of 50 GW(e) per year. At this level, two plants nominally sized at 10 metric tons of uranium per day will be required.

  18. Axial enrichment profile in advance nuclear energy power plant at supercritical-pressures

    Energy Technology Data Exchange (ETDEWEB)

    Tashakor, S. [Nuclear Science and Technology Research Institute (NSTRI), Tehran (Iran, Islamic Republic of). Reactor Research School; Islamic Azad Univ., Shiraz (Iran, Islamic Republic of). Dept. of Nuclear Engineering; Zarifi, E. [Nuclear Science and Technology Research Institute (NSTRI), Tehran (Iran, Islamic Republic of). Reactor Research School; Salehi, A.A. [Sharif University of Technology, Tehran (Iran, Islamic Republic of). Dept. of Nuclear Energy

    2015-12-15

    The High-Performance Light Water Reactor (HPLWR) is the European version of the advance nuclear energy power plant at Supercritical-pressure. A light water reactor at supercritical pressure, being currently under design, is the new generation of nuclear reactors. The aim of this study is to predict the HPLWR neutronic behavior of the axial enrichment profile with an average enrichment of 5 w/o U-235. Neutronic calculations are performed using WIMS and CITATION codes. Changes in neutronic parameter, such as Power Peaking Factor (PPF) are discussed in this paper.

  19. Gas centrifuge enrichment plants inspection frequency and remote monitoring issues for advanced safeguards implementation

    Energy Technology Data Exchange (ETDEWEB)

    Boyer, Brian David [Los Alamos National Laboratory; Erpenbeck, Heather H [Los Alamos National Laboratory; Miller, Karen A [Los Alamos National Laboratory; Ianakiev, Kiril D [Los Alamos National Laboratory; Reimold, Benjamin A [Los Alamos National Laboratory; Ward, Steven L [Los Alamos National Laboratory; Howell, John [GLASGOW UNIV.

    2010-09-13

    Current safeguards approaches used by the IAEA at gas centrifuge enrichment plants (GCEPs) need enhancement in order to verify declared low enriched uranium (LEU) production, detect undeclared LEU production and detect high enriched uranium (BEU) production with adequate probability using non destructive assay (NDA) techniques. At present inspectors use attended systems, systems needing the presence of an inspector for operation, during inspections to verify the mass and {sup 235}U enrichment of declared cylinders of uranium hexafluoride that are used in the process of enrichment at GCEPs. This paper contains an analysis of how possible improvements in unattended and attended NDA systems including process monitoring and possible on-site destructive analysis (DA) of samples could reduce the uncertainty of the inspector's measurements providing more effective and efficient IAEA GCEPs safeguards. We have also studied a few advanced safeguards systems that could be assembled for unattended operation and the level of performance needed from these systems to provide more effective safeguards. The analysis also considers how short notice random inspections, unannounced inspections (UIs), and the concept of information-driven inspections can affect probability of detection of the diversion of nuclear material when coupled to new GCEPs safeguards regimes augmented with unattended systems. We also explore the effects of system failures and operator tampering on meeting safeguards goals for quantity and timeliness and the measures needed to recover from such failures and anomalies.

  20. Determination of plant available boron in agricultural soil by using voltammetric method

    Directory of Open Access Journals (Sweden)

    Ebru Çetinkaya

    2014-08-01

    Full Text Available In this study, a novel voltammetric method has been developed to determine the amount of boron in soil. 50 soil samples were collected from 5 typical sites of agricultural area. After hot water extraction of available boron in the soil samples, all boron is complexed by addition of Alizarin Red S (ARS to the extraction solutions.Differential pulse anodic stripping voltammetry was used to determine the amount of the boron complexes. The electrochemical parameters have been optimized according to the experimental results. The optimum scan rate, stirring rate, deposition potential, deposition time and pH values were determined as 5 mVs-1 , 200 rpm, -0.5 V (vs. Ag/AgCl, sat., 15sec. and 7.5, respectively. An oxidation peak was occurred at the peak potential of -0.45 V for Boron-Alizarin complex. The limit of detection, limit of quantification and linear working range were determined for the voltammetric soil-boron analysis. In addition, the interference effects of coexisting ions were successfully investigated. Comparison of the analytical data for analyzing real samples was carried out between the differential pulse anodic stripping voltammetric method and the Azometine H spectrophotometric method have shown good agreement. A great advantage of voltammetry over the spectrophotometric method is found to be simplicity, selectivity and shortening of the analysis time.

  1. International safeguards at the feed and withdrawal area of a gas centrifuge uranium enrichment plant

    International Nuclear Information System (INIS)

    This paper discusses the application of International Atomic Energy Agency (IAEA) safeguards at a model gas centrifuge uranium enrichment plant designed for the production of low-enriched uranium; particular emphasis is placed upon the verification by the IAEA of the facility material balance accounting. After reviewing the IAEA safeguards objectives and concerns at such a plant, the paper describes the material accountancy performed by the facility operator, and discusses strategies by which the operator might attempt to divert a portion of the declared nuclear materials. Finally, the paper discusses the verification of the declared material balance, including sampling strategies, attributes and variables measurements, and nondestructive measurements to improve the efficiency of the inspection measures

  2. Development of a computer systems for operational data acquisition of uranium isotopic enrichment pilot plant

    International Nuclear Information System (INIS)

    A pilot plant for uranium enrichment using the jet nozzle process was transfered from Federal Republic of Germany to Brazil, to train Brazilian technicist in its operation and to improve the process. This pilot plant is monitored by a data acquisition system and the possibility of faulty events would cause serious dificulties, as far as maintenance is concerned (for instance, unvailable special components). It is described the development of a new system, which is proposed in order to minimize difficulties with maintenance that utilizes in the assembling integrated circuits of large scale of integration. It is controlled by a microcomputer. (Author)

  3. Irradiation program of slightly enriched fuel elements at the Atucha I nuclear power plant

    International Nuclear Information System (INIS)

    An irradiation program of fuel elements with slightly enriched uranium is implemented, tending to the homogenization of core at Atucha I nuclear power plant. The main benefits of the enrichment program are: a) to extend the average discharge burnup of fuel elements, reducing the number of elements used to generate the same amount of energy. This implies a smaller annual consumption of elements and consequently the reduction of transport and replacement operations and of the storage pool systems as well as that of radioactive wastes; b) the saving of uranium and structural materials (Zircaloy and others). In the initial stage of program an homogeneous core enrichment of 0.85% by weight of U-235 is anticipated. The average discharge burnup of fuel elements, as estimated by previous studies, is approximately 11.6 MW d/kg U. The annual consumption of fuel elements is reduced from 396 of natural uranium to 205, with a load factor of 0.85. It is intended to reach the next equilibrium steps with an enrichment of 1.00 and 1.20% in U-235. (Author)

  4. Nutrient enrichment effects on photosynthesis in the wetland plants Typha orientalis and Phormium tenax

    DEFF Research Database (Denmark)

    Sorrell, Brian Keith; Brix, Hans; Tanner, Chris;

    Anthropogenic nutrient enrichment can allow fast-growing species with high photosynthetic capacity to out-compete less vigorous species in freshwater wetlands. We compared the effect of nutrient enrichment on photosynthetic gas exchange in two tall canopy dominants, the inherently fast-growing sp....... The maximum photosynthetic rates achieved by raupo in this study (up to 60 µmolCO2 m-2 s-1) are amongst the highest ever recorded for C3 plants.......Anthropogenic nutrient enrichment can allow fast-growing species with high photosynthetic capacity to out-compete less vigorous species in freshwater wetlands. We compared the effect of nutrient enrichment on photosynthetic gas exchange in two tall canopy dominants, the inherently fast...... chlorophyll in its leaf tissue than flax. Photosynthetic rates were significantly higher in raupo than flax in both field and experimental situations, except at very low nutrient availability, where they were similar. Photosynthesis in raupo increased strongly with N availability, whereas there was only a...

  5. Air strikes on uranium enrichment plants as potential sources of radioecological danger

    Directory of Open Access Journals (Sweden)

    Živanov Dragan

    2007-01-01

    Full Text Available According to the Non Proliferation Treaty (NPT, the signatory countries are not forbidden to preform uranium enrichment for peaceful purposes. However, if there is a justified doubt that the uranium enrichment is performed with the aim to produce nuclear weapons, this certainly causes great concern. In this case, the international community can apply pressure to a certain country if it determines that the country does not want to cease activities of making its own nuclear weapons. The international community pressure on the country can be intesified until its political leadership is not made to question and cease all activities of producing nuclear weapons. This pressure can be political, economic, and as a last resort-military. As a gesture of goodwill the country can stop the uranium enrichment process. In this way, the country shows that it finally gives up the intention to produce nuclear weapons. However, when military pressure is applied, i.e. military strikes (air strikes for example on nuclear plants used for uranium enrichment, this certainly creates a risk of releasing radioactivity into the environment. That is why the aim of this paper is to signal this very fact. Using military force in these cases leads to additional radioactive contamination of the environment, so this way of solving conflicts should be avoided within the international community.

  6. [Selective enrichment of Pseudomonas spp. in the rhizoplane of different plant species].

    Science.gov (United States)

    Marrero, Mariana A; Agaras, Betina; Wall, Luis G; Valverde, Claudio

    2015-01-01

    In contrast to rhizobia-legume symbiosis, the specificity for root colonization by pseudomonads seems to be less strict. However, several studies about bacterial diversity in the rhizosphere highlight the influence of plant species on the selective enrichment of certain microorganisms from the bulk soil community. In order to evaluate the effect that different crops have on the structure of pseudomonad community on the root surface, we performed plant trap experiments, using surface-disinfected maize, wheat or soybean seeds that were sown in pots containing the same pristine soil as substrate. Rhizoplane suspensions were plated on a selective medium for Pseudomonas, and pooled colonies served as DNA source to carry out PCR-RFLP community structure analysis of the pseudomonads-specific marker genes oprF and gacA. PCR-RFLP profiles were grouped by plant species, and were distinguished from those of bulk soil samples. Partial sequencing of 16S rDNA genes of some representative colonies of Pseudomonas confirmed the selective enrichment of distinctive genotypes in the rhizoplane of each plant species. These results support the idea that the root systems of agricultural crops such as soybean, maize and wheat, select differential sets of pseudomonads from the native microbial repertoire inhabiting the bulk soil. PMID:26054776

  7. DOE-ARN proposed method to verify uranium inventory at the Pilcaniyeu Gaseous Diffusion Enrichment Plant

    International Nuclear Information System (INIS)

    The Pilcaniyeu Gaseous Diffusion Plant is located near San Carlos de Bariloche, Argentina, in the Province of Rio Negro. It is designed to enrich uranium to a nominal level of 5% 235U and a nominal capacity of 20,000 separative work units per year. Since 1993, this facility has been under international safeguards. New measurement methods were required to accurately verify Pilcaniyeu's uranium inventory, because this is the first gaseous diffusion enrichment plant to come under International Atomic Energy Agency (IAEA) safeguards. In 1992, the United States and Argentina embarked on a cooperative effort to accomplish this task. Several nondestructive measurement experiments were performed at gaseous diffusion plants in the United State and at the Pilcaniyeu plant in Argentina. It was determined that passive gamma-ray measurement is the technique of choice for Pilcaniyeu. Mathematical algorithms were developed that accurately estimate the uranium inventory of the facility. This paper summarizes the measurement activities conducted under Argentine- US cooperation, discusses the proposed methods, and proposes a process to validate the procedure for IAEA use. (author)

  8. Removal of boron from geothermal power plant wastewater in Kizildere, Turkey

    Energy Technology Data Exchange (ETDEWEB)

    Beker, U.G.; Cergel, A.; Recepoglu, O. [Istanbul Technical Univ. (Turkey). Faculty of Chemical and Metallurgical Engineering

    1996-09-01

    Geothermal energy is an alternative renewable energy resource that has proven itself technically and economically feasible as a nonpollutant electric power source. The Denizli-Kizildere geothermal energy region is the first major geothermal energy resource project in Turkey, with an estimated potential of 200 MW. The use of the geothermal potential of the region depends on removal of its high boron content, since waste brine is discharged into the nearby Bueyuek Menderes River. This article represents a study for removing boron from Kizildere/Turkey geothermal wastewater using the boron selective resin Amberlite IRA-743. The effect of regenerant type and regeneration conditions has been investigated to find the optimal operational conditions for minimizing the regenerant consumption.

  9. Enrichment of By-Product Materials from Steel Pickling Acid Regeneration Plants (TRP 9942)

    Energy Technology Data Exchange (ETDEWEB)

    Lu Swan, Delta Ferrites LLC

    2009-09-30

    A new process for manufacturing an enriched, iron-based product (strontium hexaferrite) in existing steel pickling acid regeneration facilities was evaluated. Process enhancements and equipment additions were made to an existing acid regeneration plant to develop and demonstrate (via pilot scale testing and partial-capacity production trials) the viability of a patented method to produce strontium-based compounds that, when mixed with steel pickling acid and roasted, would result in a strontium hexaferrite powder precursor which could then be subjected to further heat treatment in an atmosphere that promotes rapid, relatively low-temperature formation of discrete strontium hexaferrite magnetic domains yielding an enriched iron-based product, strontium hexaferrite, that can be used in manufacturing hard ferrite magnets.

  10. Subtle Gardeners: Inland Predators Enrich Local Topsoils and Enhance Plant Growth.

    Directory of Open Access Journals (Sweden)

    José M Fedriani

    Full Text Available Inland vertebrate predators could enrich of nutrients the local top soils in the area surrounding their nests and dens by depositing faeces, urine, and prey remains and, thus, alter the dynamics of plant populations. Surprisingly, and in contrast with convincing evidence from coastal habitats, whether and how this phenomenon occurs in inland habitats is largely uncertain even though these habitats represent a major fraction of the earth's surface. We investigated during two consecutive breeding seasons the potential enrichment of the top-soils associated with inland ground-nesting eagle owls Bubo bubo, as well as its possible consequences in the growth of two common annual grasses in southern Spain. Top-soils associated with owl nests differed strongly and significantly from control top-soils in chemical parameters, mainly fertility-related properties. Specifically, levels of available phosphorus, total nitrogen, organic matter, and available potassium were 49.1, 5.6, 3.1, and 2.7 times higher, respectively, in top-soils associated with owl nests as compared to control top-soils. Germination experiments in chambers indicated that nutrient enrichment by nesting owls enhanced seedling growth in both annual grasses (Phalaris canariensis and Avena sativa, with seedling size being 1.4-1.3 times higher in owl nest top-soils than in control top-soils. Our experimental study revealed that pervasive inland, predatory birds can profoundly enrich the topsoil around their nests and, thus, potentially enhance local vegetation growth. Because diverse inland vertebrate predators are widespread in most habitats they have a strong potential to enhance spatial heterogeneity, impinge on plant communities, and exert an overlooked effect on primary productivity worldwide.

  11. Design of an Unattended Environmental Aerosol Sampling and Analysis System for Gaseous Centrifuge Enrichment Plants

    International Nuclear Information System (INIS)

    The resources of the IAEA continue to be challenged by the rapid, worldwide expansion of nuclear energy production. Gaseous centrifuge enrichment plants (GCEPs) represent an especially formidable dilemma to the application of safeguard measures, as the size and enrichment capacity of GCEPs continue to escalate. During the early part of the 1990's, the IAEA began to lay the foundation to strengthen and make cost-effective its future safeguard regime. Measures under Part II of 'Programme 93+2' specifically sanctioned access to nuclear fuel production facilities and environmental sampling by IAEA inspectors. Today, the Additional Protocol grants inspection and environmental sample collection authority to IAEA inspectors at GCEPs during announced and low frequency unannounced (LFUA) inspections. During inspections, IAEA inspectors collect environmental swipe samples that are then shipped offsite to an analytical laboratory for enrichment assay. This approach has proven to be an effective deterrence to GCEP misuse, but this method has never achieved the timeliness of detection goals set forth by IAEA. Furthermore it is questionable whether the IAEA will have the resources to even maintain pace with the expansive production capacity of the modern GCEP, let alone improve the timeliness in reaching current safeguards conclusions. New safeguards propositions, outside of familiar mainstream safeguard measures, may therefore be required that counteract the changing landscape of nuclear energy fuel production. A new concept is proposed that offers rapid, cost effective GCEP misuse detection, without increasing LFUA inspection access or introducing intrusive access demands on GCEP operations. Our approach is based on continuous onsite aerosol collection and laser enrichment analysis. This approach mitigates many of the constraints imposed by the LFUA protocol, reduces the demand for onsite sample collection and offsite analysis, and overcomes current limitations associated with

  12. Seed harvesting of a threatened African tree dispersed by rodents: Is enrichment planting a solution?

    Directory of Open Access Journals (Sweden)

    Carrie E. Seltzer

    2015-01-01

    Full Text Available Non-timber forest products (NTFPs provide income to local communities with less ecological harm than timber extraction. Yet overharvesting can still influence the regeneration and sustainability of these resources. Developing sustainable harvesting practices for emerging NTFPs depends on the biology of the NTFP species, the ecological context in which management occurs, and its cost in terms of effort and resources. Allanblackia stuhlmannii (Clusiaceae is a canopy tree species whose seeds are a source of vegetable oil and an important food for rodents. In an experiment within the Amani Nature Reserve (Tanzania, we studied how enrichment planting of A. stuhlmannii seeds affected germination and establishment rates under varying local levels of seed abundance and rodent activity. Overall, germination and establishment rates were high (4.8% and 2.2%, respectively, after 11 months, while local ecological conditions had a short lived (1–2 weeks and unexpectedly small influence on the persistence of planted seeds. Given these rates, we estimate a cost of approximately US$0.14 per seedling. Enrichment planting of seeds, across a range of local ecological conditions, appears to be a viable and cost effective management strategy for increasing A. stuhlmannii recruitment in harvested areas.

  13. PGPR BACILLUS SPECIES ISOLATED FROM TOMATO PLANT –A COMPARATIVE STUDY ON COCONUT WATER ENRICHMENT

    Directory of Open Access Journals (Sweden)

    OS Aysha, P Vinothkumar*, S Vasuki, S Valli, P Nirmala, A Reena

    2012-10-01

    Full Text Available Plant growth promoting rhizobacteria (PGPR are bacteria that colonize plant roots, they promote plant growth and reduce disease or insect damage. PGPR have been identified within many different bacterial taxa, most commercially developed PGPR for agricultural crops are species of Bacillus which form endospores that confer population stability during formulation and storage of products. Here the rhizobacteria Bacillus sp has been isolated from tomato plant and characterized with routine biochemical tests. Then the isolated rhizobacteria was enriched by inoculating with coconut water as carrier medium. The growth pattern was studied with the bacterial strain that was aseptically inoculated within coconut water in flask, coconut water within intact coconut and in nutrient broth.  The rhizobacterial culture inoculated within coconut water in coconut has multiplied to the tune of 10.0×10-6cfu ml-1within a period of 24 hrs. The bacterial strain developed mucoidal colonies on coconut water agar medium as a result of increased polysaccharide production. Seed colonization and plant growth promotion of tomato plant was more when culture was grown in coconut water was used for seed treatment.

  14. Postprandial plasma oxyphytosterol concentrations after consumption of plant sterol or stanol enriched mixed meals in healthy subjects.

    Science.gov (United States)

    Baumgartner, Sabine; Mensink, Ronald P; Konings, Maurice; Schött, Hans-F; Friedrichs, Silvia; Husche, Constanze; Lütjohann, Dieter; Plat, Jogchum

    2015-07-01

    Epidemiological studies have reported inconsistent results on the relationship between increased plant sterol concentrations with cardiovascular risk, which might be related to the formation of oxyphytosterols (plant sterol oxidation products) from plant sterols. However, determinants of oxyphytosterol formation and metabolism are largely unknown. It is known, however, that serum plant sterol concentrations increase after daily consumption of plant sterol enriched products, while concentrations decrease after plant stanol consumption. Still, we have earlier reported that fasting oxyphytosterol concentrations did not increase after consuming a plant sterol- or a plant stanol enriched margarine (3.0g/d of plant sterols or stanols) for 4weeks. Since humans are in a non-fasting state for most part of the day, we have now investigated effects on oxyphytosterol concentrations during the postprandial state. For this, subjects consumed a shake (50g of fat, 12g of protein, 67g of carbohydrates), containing no, or 3.0g of plant sterols or plant stanols. Blood samples were taken up to 8h and after 4h subjects received a second shake (without plant sterols or plant stanols). Serum oxyphytosterol concentrations were determined in BHT-enriched EDTA plasma via GC-MS/MS. 7β-OH-campesterol and 7β-OH-sitosterol concentrations were significantly higher after consumption of a mixed meal enriched with plant sterol esters compared to the control and plant stanol ester meal. These increases were seen only after consumption of the second shake, illustrative for a second meal effect. Non-oxidized campesterol and sitosterol concentrations also increased after plant sterol consumption, in parallel with 7β-OH concentrations and again only after the second meal. Apparently, plant sterols and oxyphytosterols follow the same second meal effect as described for dietary cholesterol. However, the question remains whether the increase in oxyphytosterols in the postprandial phase is due to

  15. NEW ADVANCES IN BORON SOIL CHEMISTRY

    Science.gov (United States)

    Boron is an essential micronutrient element required for plant growth. Boron deficiency is wide-spread in crop plants throughout the world especially in coarse-textured soils in humid areas. Boron toxicity can also occur, especially in arid regions under irrigation. Plants respond directly to the...

  16. Development of simulator for the uranium enrichment plant using a real-time expert system

    International Nuclear Information System (INIS)

    The uranium enrichment plant simulator of the new material centrifuge cascade for intelligent process monitoring and alarm generation has been developed by applying an artificial intelligence technology. The real time expert shell, G2 has been used for the system development. The UF6 supply system and cascade equipment was modeled using G2. For a detailed calculation of the cascade, the cascade static characteristic FORTRAN program has been used. These calculation results have been used for the diagnosis of a suspicious behavior in measurement data. Especially, when the deviation of the product uranium concentration was detected, the cause of the deviation was inferred from the knowledge base. (author)

  17. Investigation into potential international safeguards for the Gronau uranium enrichment plant

    International Nuclear Information System (INIS)

    Measurements carried out in the SP4 GUZ enrichment plant at Almelo/Netherlands were intended to verify the applicability of the gamma spectroscopy on UF6 transporting pipes for nondestructive assessment of uranium enrichment, a method already adopted by the IAEA. The measuring point had to be installed at the pipes between the top section and the first valve, i.e. within the cascades. Taking into consideration the results of the Hexapartite Safeguards Project, the measurements were to be used to define a 'go/no go' decision with regard to a running or just finished production process. The report explains the measuring method applied and the subsequent evaluations, discusses the results and presents conclusions to be drawn. The applicability of the method to safeguards purposes is denied. The activities reported further include studies of the electronic seal system VACOSS 3, and of alternatives such as the available metal cap seal and an adhesive seal currently under review for improvement. The technical aspects of sealing methods and sealing tool efficiencies with a view to safeguarding intentions are discussed. The metal cap seal is shown to be better than the VACOSS seal in technical terms for purposes such as sealing of containers for enriched material, whereas the sealing of cases for safe enclosure of documents or devices is best achieved by the VACOSS seal. (orig./HP)

  18. Natural phenomena hazards evaluation of equipment and piping of Gaseous Diffusion Plant Uranium Enrichment Facility

    International Nuclear Information System (INIS)

    In support of the Gaseous Diffusion Plant Safety Analysis Report Upgrade program (GDP SARUP), a natural phenomena hazards evaluation was performed for the main process equipment and piping in the uranium enrichment buildings at Paducah and Portsmouth gaseous diffusion plants. In order to reduce the cost of rigorous analyses, the evaluation methodology utilized a graded approach based on an experience data base collected by SQUG/EPRI that contains information on the performance of industrial equipment and piping during past earthquakes. This method consisted of a screening walkthrough of the facility in combination with the use of engineering judgment and simple calculations. By using these screenings combined with evaluations that contain decreasing conservatism, reductions in the time and cost of the analyses were significant. A team of experienced seismic engineers who were trained in the use of the DOE SQUG/EPRI Walkdown Screening Material was essential to the success of this natural phenomena hazards evaluation

  19. The enrichment behavior of natural radionuclides in pulverized oil shale-fired power plants

    International Nuclear Information System (INIS)

    The oil shale industry is the largest producer of NORM (Naturally Occurring Radioactive Material) waste in Estonia. Approximately 11–12 million tons of oil shale containing various amounts of natural radionuclides is burned annually in the Narva oil shale-fired power plants, which accounts for approximately 90% of Estonian electricity production. The radionuclide behavior characteristics change during the fuel combustion process, which redistributes the radionuclides between different ash fractions. Out of 24 operational boilers in the power plants, four use circulating fluidized bed (CFB) technology and twenty use pulverized fuel (PF) technology. Over the past decade, the PF boilers have been renovated, with the main objective to increase the efficiency of the filter systems. Between 2009 and 2012, electrostatic precipitators (ESP) in four PF energy blocks were replaced with novel integrated desulphurization technology (NID) for the efficient removal of fly ash and SO2 from flue gases. Using gamma spectrometry, activity concentrations and enrichment factors for the 238U (238U, 226Ra, 210Pb) and 232Th (232Th, 228Ra) family radionuclides as well as 40K were measured and analyzed in different PF boiler ash fractions. The radionuclide activity concentrations in the ash samples increased from the furnace toward the back end of the flue gas duct. The highest values in different PF boiler ash fractions were in the last field of the ESP and in the NID ash, where radionuclide enrichment factors were up to 4.2 and 3.3, respectively. The acquired and analyzed data on radionuclide activity concentrations in different PF boiler ashes (operating with an ESP and a NID system) compared to CFB boiler ashes provides an indication that changes in the fuel (oil shale) composition and boiler working parameters, as well as technological enhancements in Estonian oil shale fired power plants, have had a combined effect on the distribution patterns of natural radionuclides in the oil

  20. RADIO FREQUENCY IDENTIFICATION DEVICES: EFFECTIVENESS IN IMPROVING SAFEGUARDS AT GAS-CENTRIFUGE URANIUM-ENRICHMENT PLANTS.

    Energy Technology Data Exchange (ETDEWEB)

    JOE,J.

    2007-07-08

    Recent advances in radio frequency identification devices (RFIDs) have engendered a growing interest among international safeguards experts. Potentially, RFIDs could reduce inspection work, viz. the number of inspections, number of samples, and duration of the visits, and thus improve the efficiency and effectiveness of international safeguards. This study systematically examined the applications of RFIDs for IAEA safeguards at large gas-centrifuge enrichment plants (GCEPs). These analyses are expected to help identify the requirements and desirable properties for RFIDs, to provide insights into which vulnerabilities matter most, and help formulate the required assurance tests. This work, specifically assesses the application of RFIDs for the ''Option 4'' safeguards approach, proposed by Bruce Moran, U. S. Nuclear Regulatory Commission (NRC), for large gas-centrifuge uranium-enrichment plants. The features of ''Option 4'' safeguards include placing RFIDs on all feed, product and tails (F/P/T) cylinders, along with WID readers in all FP/T stations and accountability scales. Other features of Moran's ''Option 4'' are Mailbox declarations, monitoring of load-cell-based weighing systems at the F/P/T stations and accountability scales, and continuous enrichment monitors. Relevant diversion paths were explored to evaluate how RFIDs improve the efficiency and effectiveness of safeguards. Additionally, the analysis addresses the use of RFIDs in conjunction with video monitoring and neutron detectors in a perimeter-monitoring approach to show that RFIDs can help to detect unidentified cylinders.

  1. Links between Plant Invasion, Anthropogenic Nitrogen Enrichment, and Wildfires: A Systematic Review

    Science.gov (United States)

    Felker-Quinn, E.; Gooding Lassiter, M.; Maxwell, A.; Housego, R.; Young, B.

    2014-12-01

    Wildfires can become positive feedbacks in climate change scenarios, because wildfires release large amounts of carbon sequestered in plants and soil to the atmosphere, and because their frequency increases with increasing temperatures. Invasive plants represent an important biotic link between anthropogenic activity and wildfire, as many of these species benefit from human disturbance while increasing fire frequency and severity. A robust body of literature addresses the response of invasive species to nitrogen enrichment, and a separate body of research assesses the feedbacks between invasive plant species and wildfire. We have undertaken a systematic review of these fields in order to evaluate the hypothesis that anthropogenic nitrogen loading contributes to increasing wildfires by promoting the growth and spread of fire-adapted invasive plant species. We identified invasive plant species using the Fire Effects Information System (FEIS), a Forest Service database that evaluates fire ecology of species identified as being of concern by land managers. We used information contained in the FEIS as well as more recent studies to characterize species on a continuum from fire-adapted to fire-intolerant based on traits related to interactions of fire with survival, reproduction, and spread. Of the 107 invasive plant species with fire ecology reports in the FEIS, we have initially classified 18 as fire-adapted, possessing traits that intensify fire regimes. Additionally, 33 species are fire-tolerant, benefiting from fire primarily because it creates a high-resource, low-competition environment. In continuing work, we are evaluating the responses of the invasive plant species to increased anthropogenic nitrogen with a focus on traits such as germination, productivity, and survival, as these traits contribute to wildfire frequency and severity. The views expressed in this abstract are those of the authors and do not necessarily represent the views or policies of the U

  2. Experience with in-operation physical inventory-taking (PIT) in Japan's Uranium Enrichment Pilot Plant

    International Nuclear Information System (INIS)

    For a stable energy supply in Japan it is necessary to produce domestically a reasonable amount of low enriched uranium. This led to the construction of the first-stage gas-centrifuge cascade (OP-1) in the Uranium Enrichment Pilot Plant, Ningyo Toge Works, PNC, in July 1979, followed by the second-stage cascade (OP-2) in October 1981. Although the pilot plant involves a variety of sensitive information, it is essential to provide it with adequate safeguards measures and physical protection systems to follow the Nuclear Non-proliferation Treaty. This paper describes the development of materials accountancy in the pilot plant, stressing the in-operation PIT, i.e. the physical inventory-taking while the plant is in operation. According to INFCIRC-153, all nuclear material handling facilities must close their material balances at least once a year. For closing material balances, the temporary suspension of facility operations is required, but for the economical production of low enriched uranium, continuous operation for an extended period of time is essential. Thus, it is necessary to develop in-operation PIT. Therefore, PNC tentatively carried out in-operation PIT at the end of 1981 by using OP-1. The simultaneous changeover in the feed, product and tail lines, which was necessary for conducting the in-operation PIT, took only three minutes. The material balance period for this PIT started at the beginning of 1981 and continued to the end of that year. The material balance areas (MBA) consisted of the storage MBA (inventory KMP-A and B) and the process MBA (inventory KMP-C and F). After measuring weights, volumes, temperatures, pressures etc., the inventories of the storage and process MBAs were calculated, followed by evaluation of the amounts of MUFs and σsub(MUF). As a result, the value of MUF per annual throughput was 0.05% which is far lower than the expected MUF value of 0.2% specified by the IAEA

  3. The enrichment behavior of natural radionuclides in pulverized oil shale-fired power plants.

    Science.gov (United States)

    Vaasma, Taavi; Kiisk, Madis; Meriste, Tõnis; Tkaczyk, Alan Henry

    2014-12-01

    The oil shale industry is the largest producer of NORM (Naturally Occurring Radioactive Material) waste in Estonia. Approximately 11-12 million tons of oil shale containing various amounts of natural radionuclides is burned annually in the Narva oil shale-fired power plants, which accounts for approximately 90% of Estonian electricity production. The radionuclide behavior characteristics change during the fuel combustion process, which redistributes the radionuclides between different ash fractions. Out of 24 operational boilers in the power plants, four use circulating fluidized bed (CFB) technology and twenty use pulverized fuel (PF) technology. Over the past decade, the PF boilers have been renovated, with the main objective to increase the efficiency of the filter systems. Between 2009 and 2012, electrostatic precipitators (ESP) in four PF energy blocks were replaced with novel integrated desulphurization technology (NID) for the efficient removal of fly ash and SO2 from flue gases. Using gamma spectrometry, activity concentrations and enrichment factors for the (238)U ((238)U, (226)Ra, (210)Pb) and (232)Th ((232)Th, (228)Ra) family radionuclides as well as (40)K were measured and analyzed in different PF boiler ash fractions. The radionuclide activity concentrations in the ash samples increased from the furnace toward the back end of the flue gas duct. The highest values in different PF boiler ash fractions were in the last field of the ESP and in the NID ash, where radionuclide enrichment factors were up to 4.2 and 3.3, respectively. The acquired and analyzed data on radionuclide activity concentrations in different PF boiler ashes (operating with an ESP and a NID system) compared to CFB boiler ashes provides an indication that changes in the fuel (oil shale) composition and boiler working parameters, as well as technological enhancements in Estonian oil shale fired power plants, have had a combined effect on the distribution patterns of natural radionuclides

  4. Selenium accumulation, distribution and speciation in spineless prickly pear cactus: a salt, boron, and drought tolerant, selenium-enriched nutraceutical fruit crop.

    Science.gov (United States)

    Prickly pear cactus (Opuntia) may be an alternative crop to grow in drainage-impacted regions of the westside of California, where high levels of salinity, selenium (Se), and boron (B) are present. Preliminary trials have demonstrated that Opuntia can tolerate the adverse soil conditions, while accu...

  5. LABORATORY DEMONSTRATION OF A MULTISENSOR UNATTENDED CYLINDER VERIFICATION STATION FOR URANIUM ENRICHMENT PLANT SAFEGUARDS

    Energy Technology Data Exchange (ETDEWEB)

    Goodman, David I [Univ. of Michigan, Ann Arbor, MI (United States); Rowland, Kelly L [Univ. of California, Berkeley, CA (United States); Smith, Sheriden [Colorado State Univ., Fort Collins, CO (United States); Miller, Karen A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Flynn, Eric B. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-01-10

    The objective of safeguards is the timely detection of the diversion of a significant quantity of nuclear materials, and safeguarding uranium enrichment plants is especially important in preventing the spread of nuclear weapons. The IAEA’s proposed Unattended Cylinder Verification Station (UCVS) for UF6 cylinder verification would combine the operator’s accountancy scale with a nondestructive assay system such as the Passive Neutron Enrichment Meter (PNEM) and cylinder identification and surveillance systems. In this project, we built a laboratory-scale UCVS and demonstrated its capabilities using mock UF6 cylinders. We developed a signal processing algorithm to automate the data collection and processing from four continuous, unattended sensors. The laboratory demonstration of the system showed that the software could successfully identify cylinders, snip sensor data at the appropriate points in time, determine the relevant characteristics of the cylinder contents, check for consistency among sensors, and output the cylinder data to a file. This paper describes the equipment, algorithm and software development, laboratory demonstration, and recommendations for a full-scale UCVS.

  6. Issues and recommendations related to replacement of CFC-114 at the uranium enrichment gaseous diffusion plant

    International Nuclear Information System (INIS)

    The operating uranium enrichment gaseous diffusion plants (GDPs) in Portsmouth, Ohio and Paducah, Kentucky, which are operated for the United States Department for Energy by Martin Marietta Energy Systems (MMES), currently use a chlorofluorocarbon (CFC-114) as the primary process stream coolant. Due to recent legislation embodied in the Clean Air Act, the production of this and other related chlorofluorocarbons (CFCS) are to be phased out with no production occurring after 1995. Since the plants lose approximately 500,000 pounds per year of this process stream coolant through various leaks, the GDPs are faced with the challenge of identifying a replacement coolant that will allow continued operation of the plants. MMES formed the CFC Task Team to identify and solve the various problems associated with identifying and implementing a replacement coolant. This report includes a review of the work performed by the CFC Task Team, and recommendations that were formulated based on this review and upon original work. The topics covered include; identifying a replacement coolant, coolant leak detection and repair efforts, coolant safety concerns, coolant level sensors, regulatory issues, and an analytical decision analysis

  7. Plant diversity effects on grassland productivity are robust to both nutrient enrichment and drought

    Science.gov (United States)

    Isbell, Forest; Manning, Pete; Connolly, John; Bruelheide, Helge; Ebeling, Anne; Roscher, Christiane; van Ruijven, Jasper; Weigelt, Alexandra; Wilsey, Brian; Beierkuhnlein, Carl; de Luca, Enrica; Griffin, John N.; Hautier, Yann; Hector, Andy; Jentsch, Anke; Kreyling, Jürgen; Lanta, Vojtech; Loreau, Michel; Meyer, Sebastian T.; Mori, Akira S.; Naeem, Shahid; Palmborg, Cecilia; Polley, H. Wayne; Reich, Peter B.; Schmid, Bernhard; Siebenkäs, Alrun; Seabloom, Eric; Thakur, Madhav P.; Tilman, David; Vogel, Anja; Eisenhauer, Nico

    2016-01-01

    Global change drivers are rapidly altering resource availability and biodiversity. While there is consensus that greater biodiversity increases the functioning of ecosystems, the extent to which biodiversity buffers ecosystem productivity in response to changes in resource availability remains unclear. We use data from 16 grassland experiments across North America and Europe that manipulated plant species richness and one of two essential resources—soil nutrients or water—to assess the direction and strength of the interaction between plant diversity and resource alteration on above-ground productivity and net biodiversity, complementarity, and selection effects. Despite strong increases in productivity with nutrient addition and decreases in productivity with drought, we found that resource alterations did not alter biodiversity–ecosystem functioning relationships. Our results suggest that these relationships are largely determined by increases in complementarity effects along plant species richness gradients. Although nutrient addition reduced complementarity effects at high diversity, this appears to be due to high biomass in monocultures under nutrient enrichment. Our results indicate that diversity and the complementarity of species are important regulators of grassland ecosystem productivity, regardless of changes in other drivers of ecosystem function. PMID:27114579

  8. Plant diversity effects on grassland productivity are robust to both nutrient enrichment and drought.

    Science.gov (United States)

    Craven, Dylan; Isbell, Forest; Manning, Pete; Connolly, John; Bruelheide, Helge; Ebeling, Anne; Roscher, Christiane; van Ruijven, Jasper; Weigelt, Alexandra; Wilsey, Brian; Beierkuhnlein, Carl; de Luca, Enrica; Griffin, John N; Hautier, Yann; Hector, Andy; Jentsch, Anke; Kreyling, Jürgen; Lanta, Vojtech; Loreau, Michel; Meyer, Sebastian T; Mori, Akira S; Naeem, Shahid; Palmborg, Cecilia; Polley, H Wayne; Reich, Peter B; Schmid, Bernhard; Siebenkäs, Alrun; Seabloom, Eric; Thakur, Madhav P; Tilman, David; Vogel, Anja; Eisenhauer, Nico

    2016-05-19

    Global change drivers are rapidly altering resource availability and biodiversity. While there is consensus that greater biodiversity increases the functioning of ecosystems, the extent to which biodiversity buffers ecosystem productivity in response to changes in resource availability remains unclear. We use data from 16 grassland experiments across North America and Europe that manipulated plant species richness and one of two essential resources-soil nutrients or water-to assess the direction and strength of the interaction between plant diversity and resource alteration on above-ground productivity and net biodiversity, complementarity, and selection effects. Despite strong increases in productivity with nutrient addition and decreases in productivity with drought, we found that resource alterations did not alter biodiversity-ecosystem functioning relationships. Our results suggest that these relationships are largely determined by increases in complementarity effects along plant species richness gradients. Although nutrient addition reduced complementarity effects at high diversity, this appears to be due to high biomass in monocultures under nutrient enrichment. Our results indicate that diversity and the complementarity of species are important regulators of grassland ecosystem productivity, regardless of changes in other drivers of ecosystem function. PMID:27114579

  9. Characterization of Oxidative Stability of Fish Oil- and Plant Oil-Enriched Skimmed Milk

    DEFF Research Database (Denmark)

    Saga, Linda C.; Kristinova, Vera; Kirkhus, Bente;

    2013-01-01

    The objective of this research was to determine the oxidative stability of fish oil blended with crude plant oils rich in naturally occurring antioxidants, camelina oil and oat oil, respectively, in bulk and after supplementation of 1 wt% of oil blends to skimmed milk emulsions. Ability of crude...... oat oil and camelina oil to protect fish oil in bulk and as fish oil-enriched skimmed milk emulsions was evaluated. Results of oxidative stability of bulk oils and blends assessed by the Schaal oven weight gain test and by the rancimat method showed significant increase in oxidative stability when oat...... oil was added to fish oil in only 5 and 10 %, whereas no protective effect of camelina oil was observed when evaluated by these methods. Moreover, fish oil blended with oat oil conferred the lowest PV and lower amounts of volatile compounds during the storage period of 14 days at 4 °C. Surprisingly...

  10. SNM monitor applications: diversion safeguards for emergency exits and detection of undeclared feed in enrichment plants

    International Nuclear Information System (INIS)

    A new monitor for special nuclear material (SNM) uses wide plastic scintillators and digital logic to achieve a higher sensitivity for detecting uranium than is found in conventional personnel SNM monitors. With its detectors spaced 2 m apart, the new monitor meets the DOE requirement to detect a 10-g metal 235U sphere of 93% 235U whose total mass is 10.8 g. This capability suits the monitor to scan people who may have to pass quickly through emergency exits. In yet another application, the monitor meets detection goals for detecting freshly separated, natural UF6 that is brought into enrichment plants through personnel portals. To determine the performance of the new monitor for these applications, laboratory source scans and measurements of the growth of uranium daughter activity in freshly separated UF6 were used

  11. Application to non-destructive assay of 2nd layer tail cylinder at Rokkasho Enrichment plant

    International Nuclear Information System (INIS)

    International Atomic Energy Agency (IAEA) safeguards criteria 93+2 requirement stipulates that depleted uranium under the single C/S (Metal or Camera) is re-verified with 10% coverage (β=0.9) once a year, normally during physical inventory verification. In order to maintain the continuity of knowledge, the entire depleted uranium cylinders transferred from the processing area are sealed by inspectorates (the state and the IAEA) after sufficient verification with 50% coverage (β=0.5). At Rokkasho Enrichment plant, the depleted uranium cylinder (0.2∼0.3% enrichment of tail cylinder centrifuged by cascade) separated at the processing area is stored in the cylinder storage. The 2nd layer tail cylinder pile-up has been adopted for efficient-use of the storage; one block is comprised of four cylinders on the lower, three on the upper. The capacity of the specific cylinder crane is limited to as low as height of the upper cylinder. Current lifter with germanium detector is applied to the lower cylinder. However, it is highly possible that inspectorate selects random for the upper tail cylinder at the physical inventory verification. Therefore, at the verification, the operators corporate to lift down the 2nd layer tail cylinder to ground floor so that inspectorate is able to verify it. The Nuclear Material Control Center (NMCC) has designed and manufactured the specific detector lifter capable of the 2nd layer measurement and the potable detector's collimator. Afterwards, we conducted a site test in the plant and inspection efficiency and reduced operator's burden. (author)

  12. UF6 cylinder tracking system for a gaseous centrifuge enrichment plant

    International Nuclear Information System (INIS)

    Full text: During the uranium enrichment process, all UF6 material handling and storage in a gaseous centrifuge enrichment plant (GCEP) is accomplished by the use of UF6 cylinders. This includes UF6 that is delivered to an enrichment facility, entered as feed material to the cascade, withdrawn as product, shipped to the customer, withdrawn as tails and stored, and all material that is sampled and analyzed. The accounting of nuclear material relies upon tracking these cylinders throughout the enrichment process. A system providing a reliable, accurate, and immediate cylinder status is critical to maintaining a facility's inventory of nuclear material. Potential problems exist with the methods currently used to track these cylinders because they require extensive manual entry by the operator. Implementation of an improved tracking system will result in an ability to more rapidly detect UF6 diversion and undeclared production activities. Therefore, there is a need for the development of dynamic, real-time systems that mitigate the risk of data being incorrectly entered or improperly manipulated. The key component required to implement these dynamic systems is the development of a reliable, automated, tamper-resistant process for tracking and monitoring the location and status of the cylinders. This proposed system will greatly reduce the risk of false or misreported cylinder tare weights, diversion of nuclear material, concealment of excess production, utilization of undeclared cylinders, and misrepresentation of the contents of cylinders. It would have the ability to track the UF6 cylinders throughout their entire life cycle within the facility. The automated tracking of cylinders will provide for more effective safeguards and accountability of material and could additionally be designed to provide alarms which indicate abnormal operational conditions. Use of radio frequency identification devices (RFIDs) could be a viable option. These could either actively or

  13. The taking and verification of a physical inventory in a Low Enriched Uranium Fabrication Plant

    International Nuclear Information System (INIS)

    The paper contains a description of a Low Enriched Uranium Fabrication Plant making fuel elements for Light Water Reactors in Europe and is subject to Euratom and IAEA Safeguards. The process starts from UO-2 powder and ends with the finished elements and has an inventory of about 500 Te. The operators' actions to clean up the plant in order to establish the inventory and to prepare the material in a form so that the inspectors can verify it are described together with an estimate of the cost. A short description of the computerised quasi-real time system of accountancy and control which enables the operator to prepare a list of inventory items from which the sampling plans are made is included. The inspection activities are described in some detail including the basis of the sampling plans used and the selection of the samples. This is followed by the results of the measurements made using a neutron interrogation device for bulk materials and an active neutron coincidence collar for the finished fuel elements. The results and conclusions are surveyed including the calculation of the LEMUF

  14. Nitrogen control of 13C enrichment in heterotrophic organs relative to leaves in a landscape-building desert plant species

    Science.gov (United States)

    Zhang, J.; Gu, L.; Bao, F.; Cao, Y.; Hao, Y.; He, J.; Li, J.; Li, Y.; Ren, Y.; Wang, F.; Wu, R.; Yao, B.; Zhao, Y.; Lin, G.; Wu, B.; Lu, Q.; Meng, P.

    2015-01-01

    A longstanding puzzle in isotope studies of C3 plant species is that heterotrophic plant organs (e.g., stems, roots, seeds, and fruits) tend to be enriched in 13C compared to the autotrophic organ (leaves) that provides them with photosynthate. Our inability to explain this puzzle suggests key deficiencies in understanding post-photosynthetic metabolic processes. It also limits the effectiveness of applications of stable carbon isotope analyses in a variety of scientific disciplines ranging from plant physiology to global carbon cycle studies. To gain insight into this puzzle, we excavated whole plant architectures of Nitraria tangutorum Bobrov, a C3 species that has an exceptional capability of fixing sands and building sand dunes, in two deserts in northwestern China. We systematically and simultaneously measured carbon isotope ratios and nitrogen and phosphorous contents of different parts of the excavated plants. We also determined the seasonal variations in leaf carbon isotope ratios on nearby intact plants of N. tangutorum. We found, for the first time, that higher nitrogen contents in heterotrophic organs were significantly correlated with increased heterotrophic 13C enrichment compared to leaves. However, phosphorous contents had no effect on the enrichment. In addition, new leaves had carbon isotope ratios similar to roots but were progressively depleted in 13C as they matured. We concluded that a nitrogen-mediated process, hypothesized to be the refixation of respiratory CO2 by phosphoenolpyruvate (PEP) carboxylase, was responsible for the differences in 13C enrichment among different heterotrophic organs, while processes such as fractionating foliar metabolism and preferentially loading into phloem of 13C-enriched sugars may contribute to the overall autotrophic-heterotrophic difference in carbon isotope compositions.

  15. Involvement of auxin and CKs in boron deficiency induced changes in apical dominance of pea plants (Pisum sativum L.).

    Science.gov (United States)

    Wang, Guoying; Römheld, Volker; Li, Chunjian; Bangerth, Fritz

    2006-04-01

    It has previously been shown that boron (B) deficiency inhibits growth of the plant apex, which consequently results in a relatively weak apical dominance, and a subsequent sprouting of lateral buds. Auxin and cytokinins (CKs) are the two most important phytohormones involved in the regulation of apical dominance. In this study, the possible involvement of these two hormones in B-deficiency-induced changes in apical dominance was investigated by applying B or the synthetic CK CPPU to the shoot apex of pea plants grown in nutrient solution without B supply. Export of IAA out of the shoot apex, as well as the level of IAA, Z/ZR and isopentenyl-adenine/isopentenyl-adenosine (i-Ade/i-Ado) in the shoot apex were assayed. In addition, polar IAA transport capacity was measured in two internodes of different ages using 3H-IAA. In B-deficient plants, both the level of auxin and CKs were reduced, and the export of auxin from the shoot apex was considerably decreased relative to plants well supplied with B. Application of B to the shoot apex restored the endogenous Z/ZR and IAA level to control levels and increased the export of IAA from the shoot apex, as well as the 3H-IAA transport capacity in the newly developed internodes. Further, B application to the shoot apex inhibited lateral bud growth and stimulated lateral root formation, presumably by stimulated polar IAA transport. Applying CPPU to the shoot apex, a treatment that stimulates IAA export under adequate B supply, considerably reduced the endogenous Z/ZR concentration in the shoot apex, but had no stimulatory effect on IAA concentration and transport in B-deficient plants. A similar situation appeared to exist in lateral buds of B-deficient plants as, in contrast to plants well supplied with B, application of CKs to these plants did not stimulate lateral bud growth. In contrast to the changes of Z/ZR levels in the shoot apex, which occurred after application of B or CPPU, the levels of i-Ade/i-Ado stayed more or

  16. Containment and storage of uranium hexafluoride at US Department of Energy uranium enrichment plants

    International Nuclear Information System (INIS)

    Isotopically depleted UF6 (uranium hexafluoride) accumulates at a rate five to ten times greater than the enriched product and is stored in steel vessels at the enrichment plant sites. There are approximately 55,000 large cylinders now in storage at Paducah, Kentucky; Portsmouth, Ohio; and Oak Ridge, Tennessee. Most of them contain a nominal 14 tons of depleted UF6. Some of these cylinders have been in the unprotected outdoor storage environment for periods approaching 40 years. Storage experience, supplemented by limited corrosion data, suggests a service life of about 70 years under optimum conditions for the 48-in. diameter, 5/16-in.-wall pressure vessels (100 psi working pressure), using a conservative industry-established 1/4-in.-wall thickness as the service limit. In the past few years, however, factors other than atmospheric corrosion have become apparent that adversely affect the serviceability of small numbers of the storage containers and that indicate the need for a managed program to ensure maintenance ofcontainment integrity for all the cylinders in storage. The program includes periodic visual inspections of cylinders and storage yards with documentation for comparison with other inspections, a group of corrosion test programs to permit cylinder life forecasts, and identification of (and scheduling for remedial action) situations in which defects, due to handling damage or accelerated corrosion, can seriously shorten the storage life or compromise the containment integrity of individual cylinders. The program also includes rupture testing to assess the effects of certain classes of damage on overall cylinder strength, aswell as ongoing reviews of specifications, procedures, practices, and inspection results to effect improvements in handling safety, containment integrity, and storage life

  17. Cholesterol lowering effect of a soy drink enriched with plant sterols in a French population with moderate hypercholesterolemia

    Directory of Open Access Journals (Sweden)

    Bard Jean-Marie

    2008-10-01

    Full Text Available Abstract Background Plant sterols are an established non-pharmacological means to reduce total and LDL blood cholesterol concentrations and are therefore recommended for cholesterol management by worldwide-renown health care institutions. Their efficacy has been proven in many types of foods with the majority of trials conducted in spreads or dairy products. As an alternative to dairy products, soy based foods are common throughout the world. Yet, there is little evidence supporting the efficacy of plant sterols in soy-based foods. The objective of this study was to investigate the effect of a soy drink enriched with plant sterols on blood lipid profiles in moderately hypercholesterolemic subjects. Methods In a randomized, placebo-controlled double-blind mono-centric study, 50 subjects were assigned to 200 ml of soy drink either enriched with 2.6 g plant sterol esters (1.6 g/d free plant sterol equivalents or without plant sterols (control for 8 weeks. Subjects were instructed to maintain stable diet pattern and physical activity. Plasma concentrations of lipids were measured at initial visit, after 4 weeks and after 8 weeks. The primary measurement was the change in LDL cholesterol (LDL-C. Secondary measurements were changes in total cholesterol (TC, non-HDL cholesterol (non-HDL-C, HDL cholesterol (HDL-C and triglycerides. Results Regular consumption of the soy drink enriched with plant sterols for 8 weeks significantly reduced LDL- C by 0.29 mmol/l or 7% compared to baseline (p 96%, and products were well tolerated. Conclusion Daily consumption of a plant sterol-enriched soy drink significantly decreased total, non-HDL and LDL cholesterol and is therefore an interesting and convenient aid in managing mild to moderate hypercholesterolemia.

  18. 10 CFR Appendix G to Part 110 - Illustrative List of Plasma Separation Enrichment Plant Equipment and Components Under NRC Export...

    Science.gov (United States)

    2010-01-01

    ... Equipment and Components Under NRC Export Licensing Authority G Appendix G to Part 110 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND MATERIAL Pt. 110, App. G Appendix G to Part 110—Illustrative List of Plasma Separation Enrichment Plant Equipment and...

  19. 10 CFR Appendix H to Part 110 - Illustrative List of Electromagnetic Enrichment Plant Equipment and Components Under NRC Export...

    Science.gov (United States)

    2010-01-01

    ... Equipment and Components Under NRC Export Licensing Authority H Appendix H to Part 110 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND MATERIAL Pt. 110, App. H Appendix H to Part 110—Illustrative List of Electromagnetic Enrichment Plant Equipment and Components...

  20. Analysis of boron concentration deviation and 10B abundance evolution in primary loop of pressurized nuclear plants

    International Nuclear Information System (INIS)

    The 10B abundance evolution under two conditions, i.e., with and without boronizing, is calculated and analyzed with theoretical derivation method, and the evolution pattern of 10B abundance for one cycle in PWR is provided. The comparison of the calculated and measured 10B abundance shows that the abundance equation considering the boronizing is accurate. With this, the theoretical boron concentration provided by the fuel management software can be corrected and validated. According to the equation and analysis method, the boron concentration deviation problem could be well understood or even solved. (authors)

  1. Studies on thermal stability and enrichment performance of type I and type II anion exchange resins for separation of isotopes of boron

    International Nuclear Information System (INIS)

    The results of experiments carried out to study the thermal stability and enrichment performance of type I and type II resin samples obtained from indigenous suppliers are reported in this paper. (author)

  2. Enhanced binding capacity of boronate affinity adsorbent via surface modification of silica by combination of atom transfer radical polymerization and chain-end functionalization for high-efficiency enrichment of cis-diol molecules

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Wei; He, Maofang; Wang, Chaozhan; Wei, Yinmao, E-mail: ymwei@nwu.edu.cn

    2015-07-30

    Boronate affinity materials have been widely used for specific separation and preconcentration of cis-diol molecules, but most do not have sufficient capacity due to limited binding sites on the material surface. In this work, we prepared a phenylboronic acid-functionalized adsorbent with a high binding capacity via the combination of surface-initiated atom transfer radical polymerization (SI-ATRP) and chain-end functionalization. With this method, the terminal chlorides of the polymer chains were used fully, and the proposed adsorbent contains dense boronic acid polymers chain with boronic acid on the chain end. Consequently, the proposed adsorbent possesses excellent selectivity and a high binding capacity of 513.6 μmol g{sup −1} for catechol and 736.8 μmol g{sup −1} for fructose, which are much higher than those of other reported adsorbents. The dispersed solid-phase extraction (dSPE) based on the prepared adsorbent was used for extraction of three cis-diol drugs (i.e., epinephrine, isoprenaline and caffeic acid isopropyl ester) from plasma; the eluates were analyzed by HPLC-UV. The reduced amount of adsorbent (i.e., 2.0 mg) could still eliminate interferences efficiently and yielded a recovery range of 85.6–101.1% with relative standard deviations ranging from 2.5 to 9.7% (n = 5). The results indicated that the proposed strategy could serve as a promising alternative to increase the density of surface functional groups on the adsorbent; thus, the prepared adsorbent has the potential to effectively enrich cis-diol substances in real samples. - Highlights: • Boronate adsorbent is prepared via ATRP and chain-end functionalization. • The adsorbent has quite high binding capacity for cis-diols. • Binding capacity is easily manipulated by ATRP condition. • Chain-end functionalization can improve binding capacity significantly. • Reduced adsorbent is consumed in dispersed solid-phase extraction of cis-diols.

  3. Enhanced binding capacity of boronate affinity adsorbent via surface modification of silica by combination of atom transfer radical polymerization and chain-end functionalization for high-efficiency enrichment of cis-diol molecules

    International Nuclear Information System (INIS)

    Boronate affinity materials have been widely used for specific separation and preconcentration of cis-diol molecules, but most do not have sufficient capacity due to limited binding sites on the material surface. In this work, we prepared a phenylboronic acid-functionalized adsorbent with a high binding capacity via the combination of surface-initiated atom transfer radical polymerization (SI-ATRP) and chain-end functionalization. With this method, the terminal chlorides of the polymer chains were used fully, and the proposed adsorbent contains dense boronic acid polymers chain with boronic acid on the chain end. Consequently, the proposed adsorbent possesses excellent selectivity and a high binding capacity of 513.6 μmol g−1 for catechol and 736.8 μmol g−1 for fructose, which are much higher than those of other reported adsorbents. The dispersed solid-phase extraction (dSPE) based on the prepared adsorbent was used for extraction of three cis-diol drugs (i.e., epinephrine, isoprenaline and caffeic acid isopropyl ester) from plasma; the eluates were analyzed by HPLC-UV. The reduced amount of adsorbent (i.e., 2.0 mg) could still eliminate interferences efficiently and yielded a recovery range of 85.6–101.1% with relative standard deviations ranging from 2.5 to 9.7% (n = 5). The results indicated that the proposed strategy could serve as a promising alternative to increase the density of surface functional groups on the adsorbent; thus, the prepared adsorbent has the potential to effectively enrich cis-diol substances in real samples. - Highlights: • Boronate adsorbent is prepared via ATRP and chain-end functionalization. • The adsorbent has quite high binding capacity for cis-diols. • Binding capacity is easily manipulated by ATRP condition. • Chain-end functionalization can improve binding capacity significantly. • Reduced adsorbent is consumed in dispersed solid-phase extraction of cis-diols

  4. Boron contamination in drinking - irrigation water and boron removal methods

    Directory of Open Access Journals (Sweden)

    Meltem Bilici Başkan

    2014-03-01

    Full Text Available Boron presents in IIIA group of periodic table and has high ionization capacity. Therefore it is classified as a metalloid. Average boron concentration in earth's crust is 10 mg/kg. It presents in the environment as a salts of Ca, Na, and Mg. Boron reserves having high concentration and economical extent are found mostly in Turkey and in arid, volcanic and high hydrothermal activity regions of U.S. as compounds of boron attached to oxygen. Boron is an essential micronutrient for plants, although it may be toxic at higher levels. The range in which it is converted from a nutrient to a contaminant is quite narrow. Boron presents in water environment as a boric acid and rarely borate salts. The main boron sources, whose presence is detected in surface waters, are urban wastes and industrial wastes, which can come from a wide range of different activities as well as several chemical products used in agriculture. In Turkey, the most pollutant toxic element in drinking and irrigation water is boron. Therefore boron removal is very important in terms of human health and agricultural products in high quality. Mainly boron removal methods from drinking water and irrigation water are ion exchange, ultrafiltration, reverse osmosis, and adsorption.

  5. Verification of nuclear material balances: General theory and application to a highly enriched uranium fabrication plant

    International Nuclear Information System (INIS)

    In the theoretical part it is shown that under the assumption, that in case of diversion the operator falsifies all data by a class specific amount, it is optimal in the sense of the probability of detection to use the difference MUF-D as the test statistics. However, as there are arguments for keeping the two tests separately, and furthermore, as it is not clear that the combined test statistics is optimal for any diversion strategy, the overall guaranteed probability of detection for the bivariate test is determined. A numerical example is given applying the theoretical part. Using the material balance data of a Highly Enriched Uranium fabrication plant the variances of MUF, D (no diversion) and MUF-D are calculated with the help of the standard deviations of operator and inspector measurements. The two inventories of the material balance are stratified. The samples sizes of the strata and the total inspection effort for data verification are determined by game theoretical methods (attribute sampling). On the basis of these results the overall detection probability of the combined system (data verification and material accountancy) is determined both for the MUF-D test and the bivariate (D,MUF) test as a function of the goal quantity. The results of both tests are evaluated for different diversion strategies. (orig./HP)

  6. In-Born Radio Frequency Identification Devices for Safeguards Use at Gas-Centrifuge Enrichment Plants

    International Nuclear Information System (INIS)

    Global expansion of nuclear power has made the need for improved safeguards measures at Gas Centrifuge Enrichment Plants (GCEPs) imperative. One technology under consideration for safeguards applications is Radio Frequency Identification Devices (RFIDs). RFIDs have the potential to increase IAEA inspector's efficiency and effectiveness either by reducing the number of inspection visits necessary or by reducing inspection effort at those visits. This study assesses the use of RFIDs as an integral component of the 'Option 4' safeguards approach developed by Bruce Moran, U.S. Nuclear Regulatory Commission (NRC), for a model GCEP [1]. A previous analysis of RFIDs was conducted by Jae Jo, Brookhaven National Laboratory (BNL), which evaluated the effectiveness of an RFID tag applied by the facility operator [2]. This paper presents a similar evaluation carried out in the framework of Jo's paper, but it is predicated on the assumption that the RFID tag is applied by the manufacturer at the birth of the cylinder, rather than by the operator. Relevant diversion scenarios are examined to determine if RFIDs increase the effectiveness and/ or efficiency of safeguards in these scenarios. Conclusions on the benefits offered to inspectors by using in-born RFID tagging are presented.

  7. Russian ElectroKhimPribor integrated plant - producer and supplier of enriched stable isotopes

    International Nuclear Information System (INIS)

    Russian ElectroKhimPribor Integrated Plant, as well as ORNL, is a leading production which manufactures and supplied to the world market such specific products as stable isotopes. More than 200 isotopes of 44 elements can be obtained at its electromagnetic separator. Changes being underway for a few last years in Russia affected production and distribution of stable isotopes. There arose a necessity in a new approach to handling work in this field so as to create favourable conditions for both producers and customers. As a result, positive changes in calutron operation at ElectroKhimPribor has been reached; quality management system covering all stages of production has been set up; large and attractive stock of isotopes has been created; prospective scientific isotope-based developments are taken into account when planning separation F campaigns; executing the contracts is guaranteed; business philosophy has been changed to meet maximum of customer needs. For more than forty years ElectroKhimPribor have had no claim from customers as to quality of products or implementing contracts. Supplying enriched stable isotopes virtually to all the world's leading customers, ElectroKhimPribor cooperates successfully with Canadian company Trace Science since 1996

  8. A novel ammonia-oxidizing archaeon from wastewater treatment plant: Its enrichment, physiological and genomic characteristics

    Science.gov (United States)

    Li, Yuyang; Ding, Kun; Wen, Xianghua; Zhang, Bing; Shen, Bo; Yang, Yunfeng

    2016-03-01

    Ammonia-oxidizing archaea (AOA) are recently found to participate in the ammonia removal processes in wastewater treatment plants (WWTPs), similar to their bacterial counterparts. However, due to lack of cultivated AOA strains from WWTPs, their functions and contributions in these systems remain unclear. Here we report a novel AOA strain SAT1 enriched from activated sludge, with its physiological and genomic characteristics investigated. The maximal 16S rRNA gene similarity between SAT1 and other reported AOA strain is 96% (with “Ca. Nitrosotenuis chungbukensis”), and it is affiliated with Wastewater Cluster B (WWC-B) based on amoA gene phylogeny, a cluster within group I.1a and specific for activated sludge. Our strain is autotrophic, mesophilic (25 °C–33 °C) and neutrophilic (pH 5.0–7.0). Its genome size is 1.62 Mb, with a large fragment inversion (accounted for 68% genomic size) inside. The strain could not utilize urea due to truncation of the urea transporter gene. The lack of the pathways to synthesize usual compatible solutes makes it intolerant to high salinity (>0.03%), but could adapt to low salinity (0.005%) environments. This adaptation, together with possibly enhanced cell-biofilm attachment ability, makes it suitable for WWTPs environment. We propose the name “Candidatus Nitrosotenuis cloacae” for the strain SAT1.

  9. Safeguards Guidance for Designers of Commercial Nuclear Facilities - International Safeguards Requirements for Uranium Enrichment Plants

    International Nuclear Information System (INIS)

    For the past two years, the United States National Nuclear Security Administration, Office of International Regimes and Agreements (NA-243), has sponsored the Safeguards-by-Design Project, through which it is hoped new nuclear facilities will be designed and constructed worldwide more amenable to nuclear safeguards. In the course of this project it was recognized that commercial designer/builders of nuclear facilities are not always aware of, or understand, the relevant domestic and international safeguards requirements, especially the latter as implemented by the International Atomic Energy Agency (IAEA). To help commercial designer/builders better understand these requirements, a report was prepared by the Safeguards-by-Design Project Team that articulated and interpreted the international nuclear safeguards requirements for the initial case of uranium enrichment plants. The following paper summarizes the subject report, the specific requirements, where they originate, and the implications for design and construction. It also briefly summarizes the established best design and operating practices that designer/builder/operators have implemented for currently meeting these requirements. In preparing the subject report, it is recognized that the best practices are continually evolving as the designer/builder/operators and IAEA consider even more effective and efficient means for meeting the safeguards requirements and objectives.

  10. Safeguards Guidance for Designers of Commercial Nuclear Facilities – International Safeguards Requirements for Uranium Enrichment Plants

    Energy Technology Data Exchange (ETDEWEB)

    Philip Casey Durst; Scott DeMuth; Brent McGinnis; Michael Whitaker; James Morgan

    2010-04-01

    For the past two years, the United States National Nuclear Security Administration, Office of International Regimes and Agreements (NA-243), has sponsored the Safeguards-by-Design Project, through which it is hoped new nuclear facilities will be designed and constructed worldwide more amenable to nuclear safeguards. In the course of this project it was recognized that commercial designer/builders of nuclear facilities are not always aware of, or understand, the relevant domestic and international safeguards requirements, especially the latter as implemented by the International Atomic Energy Agency (IAEA). To help commercial designer/builders better understand these requirements, a report was prepared by the Safeguards-by-Design Project Team that articulated and interpreted the international nuclear safeguards requirements for the initial case of uranium enrichment plants. The following paper summarizes the subject report, the specific requirements, where they originate, and the implications for design and construction. It also briefly summarizes the established best design and operating practices that designer/builder/operators have implemented for currently meeting these requirements. In preparing the subject report, it is recognized that the best practices are continually evolving as the designer/builder/operators and IAEA consider even more effective and efficient means for meeting the safeguards requirements and objectives.

  11. Highly boron deficiency-tolerant plants generated by enhanced expression of NIP5;1, a boric acid channel.

    Science.gov (United States)

    Kato, Yuichi; Miwa, Kyoko; Takano, Junpei; Wada, Motoko; Fujiwara, Toru

    2009-01-01

    Boron (B) is an essential element for plants, and B deficiency is a worldwide agricultural problem. In B-deficient areas, B is often supplied as fertilizer, but excess B can be toxic to both plants and animals. Generation of B deficiency-tolerant plants could reduce B fertilizer use. Improved fertility under B-limiting conditions in Arabidopsis thaliana by overexpression of BOR1, a B transporter, has been reported, but the root growth was not improved by the BOR1 overexpression. In this study, we report that enhanced expression of NIP5;1, a boric acid channel for efficient B uptake, resulted in improved root elongation under B-limiting conditions in A. thaliana. An NIP5;1 activation tag line, which has a T-DNA insertion with enhancer sequences near the NIP5;1 gene, showed improved root elongation under B limitation. We generated a construct which mimics the tag line: the cauliflower mosaic virus 35S RNA promoter was inserted at 1,357 bp upstream of the NIP5;1 transcription initiation site. Introduction of this construct into the nip5;1-1 mutant and the BOR1 overexpresser resulted in enhanced expression of NIP5;1 and improved root elongation under low B supply. Furthermore, one of the transgenic lines exhibited improved fertility and short-term B uptake. Our results demonstrate successful improvement of B deficiency tolerance and the potential of enhancing expression of a mineral nutrient channel gene to improve growth under nutrient-limiting conditions. PMID:19017629

  12. Enriching Production: Perspectives on Volvo's Uddevalla plant as an alternative to lean production

    OpenAIRE

    Sandberg, Åke

    1995-01-01

    Enriching Production was first published by Avebury in 1995. The book was quickly sold out and is now made available again. Enriching Production was edited by professor Åke Sandberg, Arbetslivsinstitutet/ National Institute for Working Life and KTH The Royal Institute of Technology, Stockholm. Enriching Production was followed up by a symposium on the general theme of ‘Good work and productivity’. The papers were collected in a special issue of Economic and Industrial Democracy, Vol. 19, ...

  13. Synthesis and characterization of ammonium phosphate fertilizers with boron

    OpenAIRE

    ANGELA MAGDA; RODICA PODE; CORNELIA MUNTEAN; MIHAI MEDELEANU; ALEXANDRU POPA

    2010-01-01

    The concentration of boron, an essential micronutrient for plants, presents a narrow range between deficiency and toxicity. In order to provide the boron requirement for plants, and to avoid toxicity problems, boron compounds are mixed with basic fertilizers. Sodium borate pentahydrate was used as a boron source. Ammonium orthophosphates fertilizers with boron were prepared by neutralizing phosphoric acid with ammonia and addition of variable amounts of sodium tetraborate pentahydrate to the ...

  14. Application of Cycloaddition Reactions to the Syntheses of Novel Boron Compounds

    OpenAIRE

    John A. Maguire; Hosmane, Narayan S; Yinghuai Zhu; Xiao Siwei

    2010-01-01

    This review covers the application of cycloaddition reactions in forming the boron-containing compounds such as symmetric star-shaped boron-enriched dendritic molecules, nano-structured boron materials and aromatic boronic esters. The resulting boron compounds are potentially important reagents for both materials science and medical applications such as in boron neutron capture therapy (BNCT) in cancer treatment and as drug delivery agents and synthetic intermediates for carbon-carbon cross-c...

  15. Toxicity assessment of boron (B) by Lemna minor L. and Lemna gibba L. and their possible use as model plants for ecological risk assessment of aquatic ecosystems with boron pollution.

    Science.gov (United States)

    Gür, Nurcan; Türker, Onur Can; Böcük, Harun

    2016-08-01

    As many of the metalloid-based pollutants, the boron (B) toxicity issues have aroused more and more global attentions, especially concerning drinking water sources which flow through boron-rich areas. Therefore, feasible and innovative approaches are required in order to assess B toxicity in aquatic ecosystems. In this study, the toxic effects of B on Lemna minor L. and Lemna gibba L. were investigated using various endpoints including number of fronds, growth rates, dry biomass and antioxidants enzymatic activities. Lemna species were exposed to B concentrations of 2 (control), 4, 8, 16, 32, 64 and 128 mg L(-1) for a test period of 7 days. The results demonstrated that plant growth was significantly reduced when the B concentration reached 16 mg L(-1). Furthermore, our results also concluded that among the antioxidative enzymes, SOD, APX and GPX can serve as important biomarkers for B-rich environment. The present results suggested that L. minor and L. gibba are very useful model plants for phytoremediation of low-B contaminated wastewater and they are also suitable options for B biomonitoring due to high phototoxic sensitivity against B. In this respect, the scientific insight of the present study is to fill the gaps in the research about the use of L. minor and L. gibba in ecotoxicological research associated with B toxicity. PMID:27192627

  16. Implementation trial of high performance trace analysis/environmental sampling (HPTA/ES) in uranium centrifuge enrichment plants

    International Nuclear Information System (INIS)

    Field trials have demonstrated that the analysis of particles upon swipes obtained from inside nuclear installations provides clear signatures of past operations in that installation. This can offer a valuable tool for gaining assurance regarding the compliance with declared activities and the absence of undeclared activities (e.g. enrichment, reprocessing, and reactor operation) at such sites. This method, known as 'Environmental Sampling' (ES) or 'High Performance Trace Analysis' (HPTA) in EURATOM terminology, is at present being evaluated by the EURATOM Safeguards Directorate (ESD) in order to assess its possible use in nuclear installations within the European Union. It is expected that incorporation of HPTA/ES of sample collection and analysis into routine inspection activities will allow EURATOM to improve the effectiveness of safeguards in these installations and hopefully save inspection resources as well. The EURATOM Safeguards Directorate has therefore performed implementation trials involving the collection of particles by the so-called swipe sampling method in uranium centrifuge enrichment plants and hot cells in the European Union. These samples were subsequently analysed by the Joint Research Centre, Institute for Transuranium Elements (ITU) in Karlsruhe. Sampling points were chosen on the basis of the activities performed in the vicinity and by considering the possible ways through which particles are released, diffused and transported. The aim was to test the efficiency of the method as regards: the collection of enough representative material; the identification of a large enough number of uranium particles; the accurate measurement of the enrichment of the uranium particles found on the swipe; the representativity of the results in respect of past activities in the plant; the capability of detecting whether highly enriched uranium has been produced, used or occasionally transported in a location where low enriched uranium is routinely produced in

  17. PAPE (Prefractionation-Assisted Phosphoprotein Enrichment: A Novel Approach for Phosphoproteomic Analysis of Green Tissues from Plants

    Directory of Open Access Journals (Sweden)

    Ines Lassowskat

    2013-12-01

    Full Text Available Phosphorylation is an important post-translational protein modification with regulatory roles in diverse cellular signaling pathways. Despite recent advances in mass spectrometry, the detection of phosphoproteins involved in signaling is still challenging, as protein phosphorylation is typically transient and/or occurs at low levels. In green plant tissues, the presence of highly abundant proteins, such as the subunits of the RuBisCO complex, further complicates phosphoprotein analysis. Here, we describe a simple, but powerful, method, which we named prefractionation-assisted phosphoprotein enrichment (PAPE, to increase the yield of phosphoproteins from Arabidopsis thaliana leaf material. The first step, a prefractionation via ammonium sulfate precipitation, not only depleted RuBisCO almost completely, but, serendipitously, also served as an efficient phosphoprotein enrichment step. When coupled with a subsequent metal oxide affinity chromatography (MOAC step, the phosphoprotein content was highly enriched. The reproducibility and efficiency of phosphoprotein enrichment was verified by phospho-specific staining and, further, by mass spectrometry, where it could be shown that the final PAPE fraction contained a significant number of known and additionally novel (potential phosphoproteins. Hence, this facile two-step procedure is a good prerequisite to probe the phosphoproteome and gain deeper insight into plant phosphorylation-based signaling events.

  18. Opportunities to more fully utilize safeguards information reported to the IAEA at Gas Centrifuge Enrichment Plants

    Energy Technology Data Exchange (ETDEWEB)

    Garner, James R [ORNL; Whitaker, J Michael [ORNL

    2015-01-01

    In an effort to increase transparency and to strengthen IAEA safeguards, more countries are adopting practices that provide the IAEA with more timely, safeguards-relevant information to confirm nuclear operations are as declared. At Gas Centrifuge Enrichment Plants (GCEPs) potential examples include installing unattended IAEA instruments that transmit selected information back to Vienna, instruments that collect and store measurement information on-site, and daily facility operator submissions of material receipts, shipments, or utilization of key operational systems (e.g., UF6 feed stations) to on-site mail boxes. Recently the IAEA has implemented the use of on-site mailbox systems supplemented with short notice or unannounced inspections to maintain effectiveness without significantly increasing the number of inspection days. While these measures significantly improves the IAEA’s effectiveness, we have identified several opportunities for how the use of this information could be improved and how some additional information would further improve safeguards. This paper presents concepts for how the safeguards information currently collected at GCEPs could be more effectively utilized through enhancing the way that raw data is displayed visually so that it is more intuitive to the inspector and provides for more effective inspection planning and execution, comparing information with previous IAEA inspection activities (lists of previous verified inventory), through comparing data with operator supplied data when inspectors arrive (notional inventory change reports), and through evaluating the data over time to provide even greater confidence in the data and operations as declared in between inspections. This paper will also discuss several potential improvements to the submissions themselves, such as including occupancy information about product and tails stations and including weight information for each station.

  19. Enrichment Planting in Secondary Forests: a Promising Clean Development Mechanism to Increase Terrestrial Carbon Sinks

    Directory of Open Access Journals (Sweden)

    Catherine Potvin

    2009-06-01

    Full Text Available With the increasing need to reduce greenhouse gas concentrations, afforestation and reforestation (A/R projects are being implemented under the Kyoto Clean Development Mechanism (CDM and under the voluntary carbon (C market. The specific objective of A/R C projects is to enhance terrestrial sinks. They could also provide low-income communities in developing countries with a source of revenue, as well as a number of ecological and social services. However, feasibility issues have hindered implementation of A/R CDMs. We propose enrichment planting (EP in old fallow using high-value native timber species as a land-use alternative and a small-scale C projects opportunity. We present EP in the context of ongoing work in a poor indigenous community in eastern Panama. We consider economic risks and advantages and concordance with existing modalities under the compliance market. The potential storage capacity for EP at the site of our study was ~113 Mg C ha-1, which is comparable to other land uses with high C storage, such as industrial teak plantations and primary forest. Because secondary forests show high aboveground biomass production, C projects using EP could harness large amounts of atmospheric C while improving diversity. Carbon projects using EP can also provide high levels of social, cultural, and ecological services by planting native tree species of traditional importance to local communities and preserving most of the secondary forest’s ecological attributes. Therefore, EP planting could be considered as a way to promote synergies between two UN Conventions: climate change and biodiversity. SÍNTESIS Con la necesidad apremiante de reducción de los gases de efecto invernadero, proyectos de aforestación y reforestación (A/R pueden implementarse bajo el Mecanismo de Desarrollo Limpio del Protocolo de Kyoto (MDL o en el contexto del mercado voluntario. El objetivo especifico de los mercados de carbono, voluntario o de compromiso, es de

  20. The boron trifluoride nitromethane adduct

    Science.gov (United States)

    Ownby, P. Darrell

    2004-02-01

    The separation of the boron isotopes using boron trifluoride·organic-donor, Lewis acid·base adducts is an essential first step in preparing 10B enriched and depleted crystalline solids so vital to nuclear studies and reactor applications such as enriched MgB 2, boron carbide, ZrB 2, HfB 2, aluminum boron alloys, and depleted silicon circuits for radiation hardening and neutron diffraction crystal structure studies. The appearance of this new adduct with such superior properties demands attention in the continuing search for more effective and efficient means of separation. An evaluation of the boron trifluoride nitromethane adduct, its thermodynamic and physical properties related to large-scale isotopic separation is presented. Its remarkably high separation factor was confirmed to be higher than the expected theoretical value. However, the reportedly high acid/donor ratio was proven to be an order of magnitude lower. On-going research is determining the crystal structure of deuterated and 11B enriched 11BF 3·CD 3NO 2 by X-ray and neutron diffraction.

  1. Efficient and Selective Enrichment of Ultratrace Cytokinins in Plant Samples by Magnetic Perhydroxy-Cucurbit[8]uril Microspheres.

    Science.gov (United States)

    Zhang, Qianchun; Li, Gongke; Xiao, Xiaohua; Zhan, Song; Cao, Yujuan

    2016-04-01

    Cytokinins play a critical role in controlling plant growth and development, but it is difficult to be determined in plant samples due to the extremely low concentration level of picomole/gram. So it is important for efficient sample preparation with selective enrichment and rapid separation for accurate analysis of cytokinins. Herein, a supramolecular perhydroxy-cucurbit[8]uril (PCB[8]) was fabricated into the Fe3O4 magnetic particles via chemical bonding assembly and magnetic perhydroxy-cucurbit[8]uril (MPC) materials were obtained. The MPC had good enrichment capability to cytokinins and the enrichment factors were more than 208. The interaction of MPC and cytokinins was investigated by adsorption test and density functional theory (DFT) calculation, the results showed that the main drive forces were the host-guest interaction and hydrogen-bonding interaction between the perhydroxy-cucurbit[8]uril with analytes. Combined with ultra performance liquid chromatography-tandem mass spectrometry (UPLC-MS/MS), the MPC was used as a sorbent of magnetic solid-phase extraction for the analysis of cytokinins in plant samples. A sensitive and selective UPLC-MS/MS method was developed with low detection limits of 0.14-0.32 ng/L for cytokinins analysis. Five cytokinins including zeatin riboside, meta-topolin, kinetin, kinetin riboside, and zip with 6.12-87.3 ng/kg were determined in the soybean sprout and Arabidopsis thaliana. The recoveries were in the range of 76.2-110% with relative standard deviations (n = 5) of 2.3-9.7%. On the basis of these results, magnetic perhydroxy-cucurbit[8]uril materials with selective enrichment capability have good potential on the analysis of ultratrace targets from complicated sample matrixes. PMID:26977773

  2. Selection of potential IAEA inspection strategies involving cascade access at the Portsmouth Gas Centrifuge Enrichment Plant (GCEP)

    International Nuclear Information System (INIS)

    This report has been prepared as a US contribution to Team 4 of the Hexapartite Safeguards Project. It provides to the Team 4 participants one example of an approach, which has been used in the United States, to developing a range of safeguards strategies involving differing degrees of access to cascade areas of centrifuge enrichment plants. Its purpose is to facilitate the work of other Hexapartite participants in completing Task II of Team 4's terms of reference. The scope of this report is limited to identifying safeguards approaches for the Portsmouth Gas Centrifuge Enrichment Plant (GCEP) which involve differing degrees of access to the cascade area. This report provides a method for selecting cascade access inspection strategies at GCEP which appear promising for more detailed evaluation. It is quite important to note, however, that the effectiveness and practicability of these strategies have not been established at the present. In addition, some strategies have been included on the basis of very preliminary calculations and considerations which have not been validated. Thus, some of these strategies may ultimately be rejected because they prove to be impracticable. Considerations of cost and the possible transfer of information and technology related to the production of enriched uranium will also be pertinent in considering the degrees and frequency of access to the cascade areas of centrifuge enrichment plants. This report describes the process for combining technical measures, implementation approaches and objectives to arrive at the total number of theoretically possible combinations. It then describes how these combinations may be reduced in a series of steps to a number that is more manageable for detailed evaluation. The process is shown schematically

  3. Uranium enrichment

    International Nuclear Information System (INIS)

    Canada is the world's largest producer and exporter of uranium, most of which is enriched elsewhere for use as fuel in LWRs. The feasibility of a Canadian uranium-enrichment enterprise is therefore a perennial question. Recent developments in uranium-enrichment technology, and their likely impacts on separative work supply and demand, suggest an opportunity window for Canadian entry into this international market. The Canadian opportunity results from three particular impacts of the new technologies: 1) the bulk of the world's uranium-enrichment capacity is in gaseous diffusion plants which, because of their large requirements for electricity (more than 2000 kW·h per SWU), are vulnerable to competition from the new processes; 2) the decline in enrichment costs increases the economic incentive for the use of slightly-enriched uranium (SEU) fuel in CANDU reactors, thus creating a potential Canadian market; and 3) the new processes allow economic operation on a much smaller scale, which drastically reduces the investment required for market entry and is comparable with the potential Canadian SEU requirement. The opportunity is not open-ended. By the end of the century the enrichment supply industry will have adapted to the new processes and long-term customer/supplier relationships will have been established. In order to seize the opportunity, Canada must become a credible supplier during this century

  4. Communication dated 19 May 2011 received from the Resident Representative of the United Kingdom of Great Britain and Northern Ireland to the Agency regarding Assurance of Supply of Enrichment Services and Low Enriched Uranium for Use in Nuclear Power Plants

    International Nuclear Information System (INIS)

    The Secretariat has received a letter dated 19 May 2011 from the Resident Representative of the United Kingdom of Great Britain and Northern Ireland to the Agency, attaching the Proposal for the Assurance of Supply of Enrichment Services and Low Enriched Uranium for Use in Nuclear Power Plants, as described in document GOV/2011/10. As requested by the Resident Representative, the letter and its attachment are circulated herewith for information of all Member States

  5. Use of 15N enriched plant material for labelling of soil nitrogen in legume dinitrogen fixation experiments

    International Nuclear Information System (INIS)

    The soil nitrogen in a field plot was labelled with nitrogen-15 (15N) by incorporating labelled plant material derived from previous experiments. The plot was used the following 3 years for determination of the amount of N2 fixed by different leguminous plants. The atom % 15N excess in grains of cereals grown as reference crops was 0.20, 0.05 and 0.03 in the 3 years, respectively. In the first year the level of enrichment was adequate for estimating symbiotic nitrogen fixation. In the second and third year lack of precision in determination of the 15N/14N ratios of legume N, may have caused an error in estimates of nitrogen fixation. About 23% of the labelled N was taken up by plants during the 3 years of cropping; after 4 years about 44% of the labelled N was found still to be present in the top soil. The labelling of the soil nitrogen with organic bound 15N, compared to adding mineral 15N at sowing, is advantageous because the labelled N is released by mineralization so that the enrichment of the plant available soil N pool become more uniform during the growth season; and high levels of mineral N, which may depress the fixation process, is avoided. (author) 7 tabs., 1 ill., 30 refs

  6. The elimination of chlorinated, chlorofluorocarbon, and other RCRA hazardous solvents from the Y-12 Plant's enriched uranium operations

    International Nuclear Information System (INIS)

    A major driving force in waste minimization within the plant is the reduction of mixed radioactive wastes associated with operations on highly enriched uranium. High enriched uranium has a high concentration of the uranium-235 isotope (up to 97.5% enrichment) and is radioactive, giving off alpha and low level gamma radiation. The material is fissionable with as little as two pounds dissolved in water being capable of producing a spontaneous chain reaction. For these reasons the material is processed in small batches or small geometries. Additionally, the material is completely recycled because of its strategic and monetary value. Since the early eighties, the plant has had an active waste minimization program which has concentrated on substitution of less hazardous solvents wherever possible. The following paper summarizes efforts in two areas - development of a water-based machining coolant to replace perchloroethylene and substitution of an aliphatic solvent to replace solvents producing hazardous wastes as defined by the Resource, Conservation, and Recovery Act (RCRA)

  7. The Cascade Design For The Uranium Enrichment Plant Using Centrifuge Technique

    International Nuclear Information System (INIS)

    A cascade containing few number of stages is simply outlined by development of cascade theory. This technique is applied to determine the feed streams and isotopic mass balances calculations for each stage at a cascade using stage cut 1/2. The enriched streams is contacted with the depleted streams is a simple countercurrent mode. An example of the enriched and depleted streams determination and isotopic mass balances calculation at each stage is given to obtained 3% of U-235 as the product. The results show that the optimal number of stages is 13 where 2 stages at the stripping section and 11 stages at the enriching section. The large the number of stages at the stripping section the smaller the U-235 content in the tails, whilst the smaller the separation factor the large the number of stages required. This cascade design can also be used separate a gas mixture other than UF6 gas where its separation factor is large

  8. Economical benefits for the use of slightly enriched fuel elements at the Atucha-I nuclear power plant

    International Nuclear Information System (INIS)

    The fuel represents a very important factor in the operative cost of the Atucha I nuclear power plant. This cost is drastically reduced with the use of fuel elements of slightly enriched uranium. The annual saving is analyzed with actual values for fuel elements with an enrichment of 0.85% by weight of U-235. With the reactor core in equilibrium state the annual saving achieved is approximately 7.5-10 u$s. According to the present irradiation plan, the benefit for the transition period is studied. An analysis of the sensitivity to differential increments in factors determining the cost of fuel elements or to changes in manufacturing losses is also performed, calculating its effect on the waste, the storage of irradiated elements and the amount of UO2 required. (Author)

  9. Approach to IAEA verification of the nuclear-material balance at the Portsmouth Gas Centrifuge Enrichment Plant (GCEP)

    International Nuclear Information System (INIS)

    This paper describes a potential approach by which the International Atomic Energy Agency (IAEA) might verify the nuclear-material balance at the Portsmouth Gas Centrifuge Enrichment Plant (GCEP), should that plant be placed under IAEA safeguards. The strategy makes use of the attributes and variables measurement verification approach, whereby the IAEA would perform independent measurements on a randomly selected subset of the items comprising the U-235 flows and inventories at the plant. In addition, the MUF-D statistic is used as the test statistics for the detection of diversion. The paper includes descriptions of the potential verification activities, as well as calculations of (a) attributes and variables sample sizes for the various strata, (b) standard deviations of the relevant test statistics, and (c) the sensitivity for detection of diversion which the IAEA might achieve by this verification strategy at GCEP

  10. Uranium enrichment

    International Nuclear Information System (INIS)

    This paper reports that in 1990 the Department of Energy began a two-year project to illustrate the technical and economic feasibility of a new uranium enrichment technology-the atomic vapor laser isotope separation (AVLIS) process. GAO believes that completing the AVLIS demonstration project will provide valuable information about the technical viability and cost of building an AVLIS plant and will keep future plant construction options open. However, Congress should be aware that DOE still needs to adequately demonstrate AVLIS with full-scale equipment and develop convincing cost projects. Program activities, such as the plant-licensing process, that must be completed before a plant is built, could take many years. Further, an updated and expanded uranium enrichment analysis will be needed before any decision is made about building an AVLIS plant. GAO, which has long supported legislation that would restructure DOE's uranium enrichment program as a government corporation, encourages DOE's goal of transferring AVLIS to the corporation. This could reduce the government's financial risk and help ensure that the decision to build an AVLIS plant is based on commercial concerns. DOE, however, has no alternative plans should the government corporation not be formed. Further, by curtailing a planned public access program, which would have given private firms an opportunity to learn about the technology during the demonstration project, DOE may limit its ability to transfer AVLIS to the private sector

  11. Benefits of Low Boron Core Design Concept for PWR

    Energy Technology Data Exchange (ETDEWEB)

    Daing, Aung Tharn; Kim, Myung Hyun [Kyung Hee University, Yongin (Korea, Republic of)

    2009-10-15

    Nuclear design study was carried out to develop low boron core (LBC) based on one of current PWR concepts, OPR-1000. Most of design parameters were the same with those of Ulchin unit-5 except extensive utilization of burnable poison (BP) pins in order to compensate reactivity increase in LBC. For replacement of reduced soluble boron concentration, four different kinds of integral burnable absorbers (IBAs) such as gadolinia, integral fuel burnable absorber (IFBA), erbia and alumina boron carbide were considered in suppressing more excess reactivity. A parametric study was done to find the optimal core options from many design candidates for fuel assemblies and cores. Among them, the most feasible core design candidate was chosen in accordance with general design requirements. In this paper, the feasibility and design change benefits of the most favorable LBC design were investigated in more detail through the comparison of neutronic and thermal hydraulic design parameters of LBC with the reference plant (REF). As calculation tools, the HELIOS/MASTER code package and the MATRA code were utilized. The main purpose of research herein is to estimate feasibility and capability of LBC which was mainly designed to mitigate boron dilution accident (BDA), and for reduction of corrosion products. The LBC design concept using lower boron concentration with an elevated enrichment in {sup 10}B allows a reduction in the concentration of lithium in the primary coolant required to maintain the optimum coolant pH. All in all, LBC with operation at optimum pH is expected to achieve some benefits from radiation source reduction of reduced corrosion product, the limitation of the Axial Offset Anomaly (AOA) and fuel cladding corrosion. Additionally, several merits of LBC are closely related to fluid systems and system related aspects, reduced boron and lithium costs, equipment size reduction for boric acid systems, elimination of heat tracing, and more aggressive fuel design concepts.

  12. Critical and sub-critical measurements with 3.0% enriched uranium oxide pins in a boron-steel walled CAGR skip

    International Nuclear Information System (INIS)

    At the request of BNFL, a series of sub-critical assemblies, related to the long-term storage of dismantled CAGR fuel clusters, was included in a programme of experiments with 3.0% enriched uranium oxide pins in a CAGR skip in the Dimple reactor. The Modified Source Multiplication technique (MSM) was used to obtain the negative reactivity of each sub-critical assembly relative to a small negative reactivity imposed on a critical configuration. Neutron sources were placed at or near the centre of the skip and count rates were measured with neutron detectors at a range of locations. Eigen-value and source-mode calculations were used to predict the corrections for each detector to allow for the departure from the point-model approximation

  13. 78 FR 30342 - United States Enrichment Corporation, Paducah Gaseous Diffusion Plant

    Science.gov (United States)

    2013-05-22

    ... existing CoC (No. GDP-1) authorizes operation of a uranium enrichment facility in Paducah, Kentucky. The... documents online in the NRC Library at http://www.nrc.gov/reading-rm/adams.html . To begin the search... the Code of Federal Regulations (10 CFR). The existing CoC (No. GDP-1) authorizes operation of...

  14. PGPR BACILLUS SPECIES ISOLATED FROM TOMATO PLANT –A COMPARATIVE STUDY ON COCONUT WATER ENRICHMENT

    OpenAIRE

    OS Aysha, P Vinothkumar*, S Vasuki, S Valli, P Nirmala, A Reena

    2012-01-01

    Plant growth promoting rhizobacteria (PGPR) are bacteria that colonize plant roots, they promote plant growth and reduce disease or insect damage. PGPR have been identified within many different bacterial taxa, most commercially developed PGPR for agricultural crops are species of Bacillus which form endospores that confer population stability during formulation and storage of products. Here the rhizobacteria Bacillus sp has been isolated from tomato plant and characterized with routine bioch...

  15. Developing new techniques for detecting undeclared nuclear material and activities: UF6 cylinder tracking system for uranium enrichment plants

    International Nuclear Information System (INIS)

    During the uranium enrichment processes conducted in a gas centrifuge or gaseous diffusion enrichment plant, handling and storage of uranium hexafluoride (UF6) is accomplished through the use of cylinders. This includes all UF6 delivered to an enrichment facility, introduced into the cascade, withdrawn as product and shipped to the customer, withdrawn as tails and stored, and material that is sampled for analysis. Current methods used to track UF6 cylinders require extensive manual entry of tracking/accountability data by operators. This manual entry is subject to transcription error and delays in timeliness and requires labor-intensive inventory procedures. Therefore, a need exists for real-time systems to automate this function to improve efficiency and effectiveness and to mitigate the risk of incorrectly entered or improperly manipulated data. A system that provided reliable, accurate, and automated cylinder identification could greatly improve the efficiency in maintaining a facility's inventory of nuclear material, support international safeguards, and increase the probability of earlier detection of UF6 diversion and undeclared production activities. The key to a more effective and efficient material accountability system is the development of a reliable, automated, tamper-resistant process for tagging and monitoring the location and status of UF6 cylinders. This document proposes the use of a cylinder tracking system (CTS) to reduce the risk of false or incorrectly reported cylinder tare weights, diversion of nuclear material, concealment of excess production, use of undeclared cylinders, and misrepresentation of cylinder contents. The suggested system should include the capability to track UF6 cylinders within uranium enrichment process areas. Additionally, a CTS could have the flexibility to incorporate other process data points as well as alarms and/or processing interlocks to detect and prevent abnormal operational conditions that are indicators of

  16. Migration and Enrichment of Arsenic in the Rock-Soil-Crop Plant System in Areas Covered with Black Shale, Korea

    Directory of Open Access Journals (Sweden)

    Ji-Min Yi

    2003-01-01

    Full Text Available The Okchon black shale, which is part of the Guryongsan Formation or the Changri Formation of Cambro-Ordovician age in Korea provides a typical example of natural geological materials enriched with potentially toxic elements such as U, V, Mo, As, Se, Cd, and Zn. In this study, the Dukpyung and the Chubu areas were selected to investigate the migration and enrichment of As and other toxic elements in soils and crop plants in areas covered with black shale. Rock and soil samples digested in 4-acid solution (HCl+HNO3+HF+HClO4 were analyzed for As and other heavy metals by ICP-AES and ICP-MS, and plant samples by INAA. Mean concentration of As in Okchon black shale is higher than those of both world average values of shale and black shale. Especially high concentration of 23.2 mg As kg-1 is found in black shale from the Dukpyung area. Mean concentration of As is highly elevated in agricultural soils from the Dukpyung (28.2 mg kg-1 and the Chubu areas (32.6 mg kg-1. As is highly elevated in rice leaves from the Dukpyung (1.14 mg kg-1 and the Chubu areas (1.35 mg kg-1. The biological absorption coefficient (BAC of As in plant species decreases in the order of rice leaves > corn leaves > red pepper = soybean leaves = sesame leaves > corn stalks > corn grains. This indicates that leafy plants tend to accumulate As from soil to a greater degree than cereal products such as grains.

  17. Application of Cycloaddition Reactions to the Syntheses of Novel Boron Compounds

    Directory of Open Access Journals (Sweden)

    John A. Maguire

    2010-12-01

    Full Text Available This review covers the application of cycloaddition reactions in forming the boron-containing compounds such as symmetric star-shaped boron-enriched dendritic molecules, nano-structured boron materials and aromatic boronic esters. The resulting boron compounds are potentially important reagents for both materials science and medical applications such as in boron neutron capture therapy (BNCT in cancer treatment and as drug delivery agents and synthetic intermediates for carbon-carbon cross-coupling reactions. In addition, the use of boron cage compounds in a number of cycloaddition reactions to synthesize unique aromatic species will be reviewed briefly.

  18. Prospecting plant growth promoting bacteria and cyanobacteria as options for enrichment of macro- and micronutrients in grains in rice–wheat cropping sequence

    OpenAIRE

    Anuj Rana; Soumya Ranjan Kabi; Shikha Verma; Anurup Adak; Madan Pal; Yashbir Singh Shivay; Radha Prasanna; Lata Nain

    2015-01-01

    The influence of plant growth promoting bacteria (PGPB) and cyanobacteria, alone and in combination, was investigated on micronutrient enrichment and yield in rice–wheat sequence, over a period of two years. Analysis of variance (ANOVA) in both crops indicated significant differences in soil dehydrogenase activity and micronutrient enrichment in grains (Fe, Zn in rice, and Cu, Mn in wheat). The combined inoculation of Anabaena oscillarioides CR3, Brevundimonas diminuta PR7, and Ochrobactrum a...

  19. Mercury enrichment and its effects on atmospheric emissions in cement plants of China

    Science.gov (United States)

    Wang, Fengyang; Wang, Shuxiao; Zhang, Lei; Yang, Hai; Wu, Qingru; Hao, Jiming

    2014-08-01

    The cement industry is one of the most significant anthropogenic sources of atmospheric mercury emissions worldwide. In this study of three typical Chinese cement plants, mercury in kiln flue gas was sampled using the Ontario Hydro Method (OHM), and solid samples were analyzed. Particulate matter recycling, preheating of raw materials, and the use of coal and flue gas desulfurization derived gypsum contributed to emissions of Hg in the air and to accumulation in cement. Over 90% of the mercury input was emitted into the atmosphere. Mercury emission factors were 0.044-0.072 g/t clinker for the test plants. The major species emitted into the atmosphere from cement plants is oxidized mercury, accounting for 61%-91% of the total mercury in flue gas. The results of this study help improve the accuracy of the mercury emission inventory in China and provide useful information for developing mercury controls.

  20. Evaluation of a RF-Based Approach for Tracking UF6 Cylinders at a Uranium Enrichment Plant

    International Nuclear Information System (INIS)

    Approved industry-standard cylinders are used globally to handle and store uranium hexafluoride (UF6) feed, product, tails, and samples at uranium enrichment plants. The International Atomic Energy Agency (IAEA) relies on time-consuming physical inspections to verify operator declarations and detect possible diversion of UF6. Development of a reliable, automated, and tamper-resistant system for near real-time tracking and monitoring UF6 cylinders (as they move within an enrichment facility) would greatly improve the inspector function. This type of system can reduce the risk of false or misreported cylinder tare weights, diversion of nuclear material, concealment of excess production, utilization of undeclared cylinders, and misrepresentation of the cylinders contents. This paper will describe a proof-of-concept approach that was designed to evaluate the feasibility of using radio frequency (RF)-based technologies to track individual UF6 cylinders throughout a portion of their life cycle, and thus demonstrate the potential for improved domestic accountability of materials, and a more effective and efficient method for application of site-level IAEA safeguards. The evaluation system incorporates RF-based identification devices (RFID) which provide a foundation for establishing a reliable, automated, and near real-time tracking system that can be set up to utilize site-specific, rules-based detection algorithms. This paper will report results from a proof-of-concept demonstration at a real enrichment facility that is specifically designed to evaluate both the feasibility of using RF to track cylinders and the durability of the RF equipment to survive the rigors of operational processing and handling. The paper also discusses methods for securely attaching RF devices and describes how the technology can effectively be layered with other safeguard systems and approaches to build a robust system for detecting cylinder diversion. Additionally, concepts for off

  1. XPS analysis of boron doped heterofullerenes

    Energy Technology Data Exchange (ETDEWEB)

    Schnyder, B.; Koetz, R. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Muhr, H.J.; Nesper, R. [ETH Zurich, Zurich (Switzerland)

    1997-06-01

    Boron heterofullerenes were generated through arc-evaporation of doped graphite rods in a helium atmosphere. According to mass spectrometric analysis only mono-substituted fullerenes like C{sub 59}B, C{sub 69}B and higher homologues together with a large fraction of higher undoped fullerenes were extracted and enriched when pyridine was used as the solvent. XPS analysis of the extracts indicated the presence of two boron species with significantly different binding energies. One peak was assigned to borid acid. The second one corresponds to boron in the fullerene cage, which is mainly C{sub 59}B, according to the mass spectrum. This boron is in a somewhat higher oxidation state than that of ordinary boron-carbon compounds. The reported synthesis and extraction procedure opens a viable route for production of macroscopic amounts of these compounds. (author) 2 figs., 1 tab., 7 refs.

  2. Soil-Plant Nutrient Interactions on Manure-Enriched Calcareous Soils

    Science.gov (United States)

    Nutrient accumulations on heavily manured soils can trigger soil and plant nutrient interactions. The goal of the study was to determine the current impact of dairy manure applications on nutrient concentrations in soil and tissue for irrigated corn silage crops grown in Southern Idaho. At harvest,...

  3. Assessment of phosphopeptide enrichment/precipitation method for LC-MS/MS based phosphoproteomic analysis of plant tissue

    DEFF Research Database (Denmark)

    Ye, Juanying; Rudashevskaya, Elena; Hansen, Thomas Aarup;

    stardand sample preparation protocols. Here, we combine 3 phosphpeptide enrichment methods (IMAC, TiO2 and Calcium Phosphate Precipitation (CPP)), and apply them to phosphoproteomic analysis of Arabidopsis thaliana plasma membrane preparation. Method Plant plasma membranes were isolated from Arabidopsis...... thaliana (Col-0) leaves using a two-phase partitioning system. The concentration of plasma membrane protein was determined by Bradford assay. Protein was digested with Lys-C for 4 hours and then by trypsin overnight. The peptide mixture was purified with IMAC, TiO2, CPP, SIMAC (IMAC+TiO2), the combination...... of CPP and IMAC, and the combination of CPP and TiO2, respectively. Nano-LC-MS was performed using LTQ-Orbitrap XL and LTQ-Orbitrap-XL/ETD mass spectrometer (Thermo Electron, Bremen, Germany) connected to an EASY nano-LC system (Proxeon Biosystems, Odense, Denmark). In CID mode, multi...

  4. Internal safeguards for centrifuge enrichment plants. Concepts and procedures for safeguards and the international Hexapartite Safeguards Project (HSP)

    International Nuclear Information System (INIS)

    These papers were elaborated partly as annexes to the HSP and partly within a BMFT research programme. Chapter 2 shows how the HSP is to be proceeded with and describes the inspection activities agreed upon. Chapters 3 and 4 deal with the nuclear materials accountancy in a uranium enrichment plant; the conception of a computer-aided safeguards system (chapter 4) can only be given in condensed form owing to its size. Chapter 5 is a general evaluation of now available NDA and C/S systems whereas chapters 6 and 7 indicate fields of application for specialized technologies. Even though the inspection model agreed upon as a result of the HSP discussions is to include limited frequency unannounced access to separating rooms for inspectors, theoretical and experimental studies have been carried out in the meantime assuming the non-access model. (orig./HP)

  5. Intraspecific trait variation drives functional responses of old-field plant communities to nutrient enrichment.

    Science.gov (United States)

    Siefert, Andrew; Ritchie, Mark E

    2016-05-01

    Environmental changes are expected to shift the distribution of functional trait values in plant communities through a combination of species turnover and intraspecific variation. The strength of these shifts may depend on the availability of individuals with trait values adapted to new environmental conditions, represented by the functional diversity (FD) of existing community residents or dispersal from the regional species pool. We conducted a 3-year nutrient- and seed-addition experiment in old-field plant communities to examine the contributions of species turnover and intraspecific variation to community trait shifts, focusing on four key plant functional traits: vegetative height, leaf area, specific leaf area (SLA), and leaf dry matter content (LDMC). We further examined the influence of initial FD and seed availability on the strength of these shifts. Community mean height, leaf area, and SLA increased in response to fertilization, and these shifts were driven almost entirely by intraspecific variation. The strength of intraspecific shifts in height and leaf area was positively related to initial intraspecific FD in these traits. Intraspecific trait responses to fertilization varied among species, with species of short stature displaying stronger shifts in SLA and LDMC but weaker shifts in leaf area. Trait shifts due to species turnover were generally weak and opposed intraspecific responses. Seed addition altered community taxonomic composition but had little effect on community trait shifts. These results highlight the importance of intraspecific variation for short-term community functional responses and demonstrate that the strength of these responses may be mediated by community FD. PMID:26826004

  6. Determination of boron content in boron carbide, boron nitride and amorphous boron

    International Nuclear Information System (INIS)

    In the present article an analyzing method of determination of boron content in boron carbide, boron nitride and amorphous boron described. Examined samples were digested with potassium hydroxide and potassium nitrate in nickel crucible and the boron contents determined subsequently by an alcalimetric titration of boric acid in presence of mannite resp. sorbite. (author)

  7. [Relocation of Espeletia grandiflora (Asteraceae) plants as a strategy for enrichment of disturbed paramo areas (PNN Chingaza, Colombia)].

    Science.gov (United States)

    Rojas-Zamora, Oscar; Insuasty-Torres, Jennyfer; de Cardenas, Camilo los Angeles; Ríos, Orlando Vargas

    2013-03-01

    Ecological restoration of the Andean paramos faces several ecological barriers mainly at the phase of dispersal and establishment of native species. With the aim to contribute to the enrichment of degraded areas, different strategies have to be developed to overcome those barriers. In this work we studied the response of individuals of Espeletia grandiflora (Asteraceae) to the relocation as a strategy for ecological restoration programs. We also evaluated the effect of size of relocated individuals on their survival and development. The work was carried out in an experimental plot at 3 424m altitude in the sector "Lagunas de Siecha" of Chingaza National Park, Colombia. We relocated 200 plants that belonged to three different size classes: 5, 10 and 15cm of initial height. The following variables were registered: survival, plant height, number of living leaves and stem diameter of each individual. We also evaluated the differences between individuals in survival and development. In terms of survival the most efficient size classes corresponded to 15cm high; the survival was 85% after two years. The relative growth rates for height and stem diameter decreases with the increase in size, but the absolute increase in height did not show significant differences between the three sizes tested. Since the stem diameter was found the strongest survival predictor after two years of relocation activities, we suggest its use as a criterion for selection of relocation individuals. The relocation of individuals of E. grandiflora had a positive side effect, carrying other species that may contribute to the enrichment and restoration of degraded areas. Among these, we found species of the genus Hypericum, as well as Arcytophyllum nitidum and Calamagrostis effusa, which should be evaluated in terms of survival and development for the subsequent implementation of the relocation strategy. In this study we verified the successful relocation of individuals of E. grandiflora as a

  8. 13 C enrichment by cryogenic distillation of carbon monoxide on experimental pilot plant

    International Nuclear Information System (INIS)

    The isotope 13 C is used in many scientific fields such as: biology, medicine, chemistry and environmental studies. The recent advances in analytical techniques have determined an important demand for this isotope. The most used method for 13 C separation in large quantities is the cryogenic distillation of carbon monoxide at 81 K. The single stage separation factor (α) for 13 C is 1.01 - 1.007 at 70 - 81 K. A 13 C separation plant by cryogenic distillation of CO was built in the Separation Laboratory of ITIM Cluj-Napoca.The carbon monoxide used as a feed gas for the 13 C separation plant was produced by reaction of CO2 with charcoal at 1300 K. CO was purified in a plant which has a reactor filled with Pd/Al2O3 and adsorbers with 5 mA molecular sieve. The purity of the carbon monoxide thus obtained was 99.9%. A cryogenic distillation column was used for high purification and the resulting CO, with less of 10 vol. ppm H2O and CO2, was stored in tanks. The main components of the experimental plant for the distillation of carbon monoxide at 81 K are: the condenser, a cascade with two distillation columns, boilers and thermal insulation. The condenser provides the reflux at the top of the first column by total liquefaction of CO vapours at 81 K. The used refrigerant is liquid nitrogen. The first column is 2.5 m high and 26 mm inside diameter. It is filled with Helipack type packing 2 x 2 x 0.2 mm. The reflux at the bottom of the first column is provided by an electrically heated boiler. The second column, 4.25 m high and 16 mm inside diameter, is filled with Helipack type packing 1.8 x 1.8 x 0.2 mm and has also an electrically heated boiler at the bottom. The columns have several locations for feed lines, sampling lines, pressure and temperature control. Inside the vacuum jacket, the low temperature components were wrapped in multi-layers of aluminized plastic foils, as radiation shields. A vacuum of 10-5 mm Hg was obtained. The purpose of these experiments was to

  9. Effect of the enriched filter pie with natural phosphate and microorganisms on soil and plant in a Vermelho-Distrófico Latossolo

    Directory of Open Access Journals (Sweden)

    Leónides Castellanos González

    2016-03-01

    Full Text Available The objective of the research was to evaluate the use of filter pie and phosphate rock enriched with biofertilizer microorganisms on the population of microorganisms and phosphorus tenor in the soil and on plants. The experiment was conducted in a vegetation house with corn plants with Latossolo Red-Distrófico, containing seven treatments disposed in an entirely randomized design, where the treatments were: soil samples and filter pie with additions of phosphate of Araxá rock enriched with microorganisms coming from Biopack (1, Embrafos (2 and Azotofos (3, and without enrichment with microorganisms (4, and three controls, soil just with filter pie (5, soil just with phosphate rock (6 and only soil (7, with three repetitions. Height, stem diameter and number of leaves for plants were evaluated at 14, 28 and 42 days. At the 45 days the dry matters of leafs and roots were evaluated, as the same as populations of the microorganisms and phosphorus tenor in the soil and in the aerial part of the plant. The tenor of soluble phosphorus in the soil and accumulated phosphorous in the aerial part of corn plan were increased by the treatments with filter pie but not higher with filter pie enriched with biofertilizers, so its use isn’t justified. The pie treatments increase the fungus, total and solubilizers bacterial populations in the soil, provoking an increase of the height, diameter, number of leaves and dry matter of corn plants in a Red-Distrófico Latossolo.

  10. Determination of isotopic composition of boron in boron carbide by TIMS and PIGE: an inter-comparison study

    International Nuclear Information System (INIS)

    The paper reports a comparison of results on the determination of isotopic composition of boron in boron carbide (B4C) samples by Thermal Ionisation Mass Spectrometry (TIMS) and Particle Induced Gamma ray Spectrometry (PIGE). B4C samples having varying boron isotopic composition (natural, enriched with respect to 10B) and their synthetic mixtures) have been analysed by both the techniques. The 10B atom% was found to be in the range of 20-67%. (author)

  11. A holdup measurement system for enriched uranium at the Oak Ridge Y-12 plant

    International Nuclear Information System (INIS)

    There are increasing requirements in today's nuclear industry to conduct extensive radiation surveys on a repeated basis. There is also a growing need to analyze, trend, and document the results of these surveys in such a way that ensures any anomalies will be identified and corrected. A fundamental key to the success of these surveys is the type of portable instrumentation that is used to make the measurements. There are many excellent types of radiation meters available, but few have the ability to store the results internally. Without data storage capabilities, it is necessary to use lengthy, hand written log sheets for each survey and then requires manual input of the data later into a database to be analyzed. At the Oak Ridge Y-12 Plant, a system has been developed to overcome these shortcomings and meet the current radiation monitoring demands. The basic hardware of the system is a portable bar code reader and a portable radiation monitor that work together as a unit. The hardware, along with a specially designed database management package, allows for the automated collection of monitoring point identification numbers and the corresponding radiation levels. Besides radiation surveys, there are other possible uses of this bar code reader and a radiation meter combination. The basic radiation meter can be used with a number of different types of detector probes. With this equipment combination, Heath Physics monitoring surveys could be automated. In the realm of Nuclear Materials Control and Accountability, the equipment combination has the potential of automating semi-quantitative analysis of uranium holdup in all process equipment. The Safeguard and Security organization could use this new combination of equipment to record radiation monitoring data at the Plant's material transfer stations. The basic bar code reader is almost a micro-mini computer

  12. Response of vegetation to carbon dioxide. Growth, yield and plant water relationships in sweet potatoes in response to carbon dioxide enrichment 1986

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-08-01

    In the summer of 1985, under the joint program of US Department of Energy, Carbon Dioxide Division, and Tuskegee University, experiments were conducted to study growth, yield, photosynthesis and plant water relationships in sweet potato plants growth in an enriched CO{sub 2} environment. The main experiment utilized open top chambers to study the effects of CO{sub 2} and soil moisture on growth, yield and photosynthesis of field-grown plants. In addition, potted plants in open top chambers were utilized in a study of the effects of different CO{sub 2} concentrations on growth pattern, relative growth rate, net assimilation rate and biomass increment at different stages of development. The interaction effects of enriched CO{sub 2} and water stress on biomass production, yield, xylem potential, and stomatal conductance were also investigated. The overall results of the various studies are described.

  13. Results from uranium deposition studies for development of a limited frequency-unannounced access inspection strategy for gas centrifuge enrichment plants

    International Nuclear Information System (INIS)

    Uranium deposition studies were performed on a test loop system designed to simulate process gas flow through the header piping of a gas centrifuge enrichment plant. The objectives of these studies were to investigate the effectiveness of an in-line gaseous cleaning agent in removing uranium in pipe deposits and to analyze long-term deposition growth and isotopic exchange under simulated centrifuge plant operating conditions. The test loop studies are described, the results are reported, and the implications for analyzing actual plant data are discussed. Results indicate that (1) 93% of the uranium deposit is removed within 15 min when a pipe is pressurized with gaseous ClF3, (2) the isotopic abundance of a highly enriched uranium deposit remains unchanged when UF6 of a lower assay is introduced into the pipe, and (3) air inleakage will be the cause of the largest deposits in centrifuge plant process header pipes

  14. The benefits of enriched boric acid in PWRs

    International Nuclear Information System (INIS)

    The economics of operating pressurized water reactors (PWRs) demand increased fuel economy which in turn places increasing demands on the primary coolant chemistry. Higher energy production can be achieved by using increased enrichment of the nuclear fuel, higher fuel burn up and longer fuel cycles, which in turn requires increased amounts of neutron poison to maintain reactivity control. In addition, greater amounts of chemical shim are required when utilizing alternative, high-reactivity fuels such as mixed uranium/plutonium oxide (MOX) fuels. The B-10 isotope of boron has a high cross section for the absorption of thermal neutrons. However, this isotope comprises only ∼19.6% to 20 % of natural boron. If the boric acid is enriched in the 10B isotope, then the maximum amount of chemical shim can be increased without exceeding the chemistry limits set by the acidity of boric acid or the concentration limit of lithium (PWR) or potassium (VVER). With sufficient isotopic enrichment, it therefore becomes possible to operate the entire PWR fuel cycle with constant pH300C at the favored value of 7.2-7.4. The use of Enriched Boric Acid (with ∼40% 10B instead of ∼ 20% in natural boron) consequently provides many advantages in enhancing operational safety and life time of several components, as well as facilitating dose rate reduction programs in PWRs and VVER Nuclear Power Plants. When lowering the total boron concentration in the primary coolant, it is possible to minimize: - dose rates during maintenance activities - optimal pHT from the beginning of the fuel cycle (BOC) can mitigate corrosion products that become activated; - the risk of corrosion of various materials of the Reactor Coolant System - allowing a lower lithium (or potassium) concentration mainly at BOC; the sensitive materials are fuel cladding (zirconium alloy), stainless steels (AISI 304 type), nickel-based Alloy 600; - the risk of Axial Offset Anomalies - resulting from precipitation of boron

  15. A 'Proof-of-Concept' Demonstration of RF-Based Technologies for UF6 Cylinder Tracking at Centrifuge Enrichment Plant

    International Nuclear Information System (INIS)

    This effort describes how radio-frequency (RF) technology can be integrated into a uranium enrichment facility's nuclear materials accounting and control program to enhance uranium hexafluoride (UF6) cylinder tracking and thus provide benefits to both domestic and international safeguards. Approved industry-standard cylinders are used to handle and store UF6 feed, product, tails, and samples at uranium enrichment plants. In the international arena, the International Atomic Energy Agency (IAEA) relies on time-consuming manual cylinder inventory and tracking techniques to verify operator declarations and to detect potential diversion of UF6. Development of a reliable, automated, and tamper-resistant process for tracking and monitoring UF6 cylinders would greatly reduce the risk of false or misreported cylinder tare weights, diversion of nuclear material, concealment of excess production, utilization of undeclared cylinders, and misrepresentation of the cylinders contents. This paper will describe a 'proof-of concept' system that was designed show the feasibility of using RF based technologies to track individual UF6 cylinders throughout their entire life cycle, and thus ensure both increased domestic accountability of materials and a more effective and efficient method for application of IAEA international safeguards at the site level. The proposed system incorporates RF-based identification devices, which provide a mechanism for a reliable, automated, and tamper-resistant tracking network. We explore how securely attached RF tags can be integrated with other safeguards technologies to better detect diversion of cylinders. The tracking system could also provide a foundation for integration of other types of safeguards that would further enhance detection of undeclared activities

  16. Nitrogen control of 13C enrichment in heterotrophic organs relative to leaves in a landscape-building desert plant species

    OpenAIRE

    Zhang, J.; Gu, L; F. Bao; Cao, Y.; Hao, Y.; He, J.; Li, J.; Li, Y.; Ren, Y.; Wang, F.; Wu, R; B. Yao; Zhao, Y.; Lin, G.; Wu, B

    2014-01-01

    A longstanding puzzle in isotope studies of C3 plant species is that heterotrophic plant organs (e.g., stems, roots, seeds, and fruits) tend to be enriched in 13C compared to the autotrophic organ (leaves) that provides them with photosynthate. Our inability to explain this puzzle suggests key deficiencies in understanding post-photosynthetic metabolic processes. It also limits the effectiveness of applications of stable carbon isotope analyses in a variety of scientific dis...

  17. Nitrogen control of 13C enrichment in heterotrophic organs relative to leaves in a landscape-building desert plant species

    OpenAIRE

    Zhang, J.; Gu, L; F. Bao; Cao, Y.; Hao, Y.; He, J.; Li, J.; Li, Y.; Ren, Y.; Wang, F.; Wu, R; B. Yao; Zhao, Y.; Lin, G.; Wu, B

    2015-01-01

    A longstanding puzzle in isotope studies of C3 plant species is that heterotrophic plant organs (e.g., stems, roots, seeds, and fruits) tend to be enriched in 13C compared to the autotrophic organ (leaves) that provides them with photosynthate. Our inability to explain this puzzle suggests key deficiencies in understanding post-photosynthetic metabolic processes. It also limits the effectiveness of applications of stable carbon isotope analyses in a variety of scientific dis...

  18. Assessment of enriched uranium storage safety issues at the Oak Ridge Y-12 Plant

    International Nuclear Information System (INIS)

    This document is an assessment of the technical safety issues pertaining to the storage of EU at the Oak Ridge Y-12 Plant. The purpose of the assessment is to serve as the basis for defining the technical standards for storage of EU at Y-12. A formal assessment of the Y-12 materials acceptance criteria for EU is currently being conducted by a task force cochaired by B. G. Eddy of DOE Oak Ridge Operations and S. 0. Cox of Y-12 Defense Programs. The mission of this technical assessment for storage is obviously dependent on results of the acceptance assessment. Clearly, the two efforts require coordination to avoid inconsistencies. In addition, both these Assessments must be consistent with the Environmental Assessment for EU storage at Y-12.1 Both the Storage Assessment and the Criteria for Acceptance must take cognizance of the fact that a portion of the EU to be submitted for storage in the future is expected to be derived from foreign sources and to include previously irradiated uranium containing significant levels of transuranics, radioactive daughter products, and unstable uranium isotopes that do not occur in the EU stream of the DOE weapons complex. National security considerations may dictate that these materials be accepted despite the fact that they fail to conform to the Acceptance Criteria. This document will attempt to address the complexities inherent in this situation

  19. Assessment of enriched uranium storage safety issues at the Oak Ridge Y-12 Plant

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-08-01

    This document is an assessment of the technical safety issues pertaining to the storage of EU at the Oak Ridge Y-12 Plant. The purpose of the assessment is to serve as the basis for defining the technical standards for storage of EU at Y-12. A formal assessment of the Y-12 materials acceptance criteria for EU is currently being conducted by a task force cochaired by B. G. Eddy of DOE Oak Ridge Operations and S. 0. Cox of Y-12 Defense Programs. The mission of this technical assessment for storage is obviously dependent on results of the acceptance assessment. Clearly, the two efforts require coordination to avoid inconsistencies. In addition, both these Assessments must be consistent with the Environmental Assessment for EU storage at Y-12.1 Both the Storage Assessment and the Criteria for Acceptance must take cognizance of the fact that a portion of the EU to be submitted for storage in the future is expected to be derived from foreign sources and to include previously irradiated uranium containing significant levels of transuranics, radioactive daughter products, and unstable uranium isotopes that do not occur in the EU stream of the DOE weapons complex. National security considerations may dictate that these materials be accepted despite the fact that they fail to conform to the Acceptance Criteria. This document will attempt to address the complexities inherent in this situation.

  20. Evolutionary divergence of plant borate exporters and critical amino acid residues for the polar localization and boron-dependent vacuolar sorting of AtBOR1

    KAUST Repository

    Wakuta, Shinji

    2015-01-24

    Boron (B) is an essential micronutrient for plants but is toxic when accumulated in excess. The plant BOR family encodes plasma membrane-localized borate exporters (BORs) that control translocation and homeostasis of B under a wide range of conditions. In this study, we examined the evolutionary divergence of BORs among terrestrial plants and showed that the lycophyte Selaginella moellendorffii and angiosperms have evolved two types of BOR (clades I and II). Clade I includes AtBOR1 and homologs previously shown to be involved in efficient transport of B under conditions of limited B availability. AtBOR1 shows polar localization in the plasma membrane and high-B-induced vacuolar sorting, important features for efficient B transport under low-B conditions, and rapid down-regulation to avoid B toxicity. Clade II includes AtBOR4 and barley Bot1 involved in B exclusion for high-B tolerance. We showed, using yeast complementation and B transport assays, that three genes in S. moellendorffii, SmBOR1 in clade I and SmBOR3 and SmBOR4 in clade II, encode functional BORs. Furthermore, amino acid sequence alignments identified an acidic di-leucine motif unique in clade I BORs. Mutational analysis of AtBOR1 revealed that the acidic di-leucine motif is required for the polarity and high-B-induced vacuolar sorting of AtBOR1. Our data clearly indicated that the common ancestor of vascular plants had already acquired two types of BOR for low- and high-B tolerance, and that the BOR family evolved to establish B tolerance in each lineage by adapting to their environments. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists.

  1. Boron toxicity in oil palm (Elaeis guineensis)

    Energy Technology Data Exchange (ETDEWEB)

    Rajaratnam, J.A.

    1973-01-01

    Potted oil palms were treated with fertilizer of borate-46 at several concentrations and the plants were observed for boron toxicity effects. Toxicity symptoms were apparent at high rates but not at rates equivalent to typical Malaysian soils.

  2. Boron affects the growth and ultrastructure of castor bean plants Boro afeta o crescimento e a ultra-estrutura da mamoneira

    Directory of Open Access Journals (Sweden)

    Denis Herisson da Silva

    2008-12-01

    Full Text Available The cultivation of oleaginous plants like the castor bean guarantees employment for agricultural families and can contribute in energy and chemical sectors, especially in the northeastern semi-arid regions of Brazil. Boron (B deficiency is a widespread nutritional disorder despite the fact that various anthropogenic sources with high B content may increase soil B to toxic levels for plants. The present study was designed to investigate the ultrastructural effects of boron deficiency and toxicity on castor bean plants which were grown under greenhouse condition using plastic containers with 10 L of nutrient solution. Boron treatments comprised: control (no B; 0.27 mg L-1, 5.40 mg L-1 B pots (one plant per pot, tested in a completely randomized design with three replicates. The dry matter of all plant parts and B concentration were determined. Cellular ultrastructure was evaluated by transmission and scanning electron microscopy on samples of leaves and petioles. Dry matter yield was affected by the B absence treatment but there was no difference for the 5.4 mg L-1 B (toxic conditions treatment. A marginal leaf burn at edge and tips of oldest leaves and absence of starch granules in chloroplasts were noted for the B toxicity treatment. The deformation of the youngest leaves, the death of the apical meristem as well as the swelling of the middle lamella, absence of starch granules in chloroplasts and petiole vessels untidily were observed in the B absent treatment. It is concluded that the production and development of castor bean plants is affected by boron deficiency, but not for boron toxicity conditions.A mamoneira é uma oleaginosa com grande potencial para a geração de renda na agricultura familiar e para produção de matéria prima para a indústria química e setor energético brasileiro, especialmente em regiões do semi-árido nordestino. A deficiência de boro (B ocorre de forma generalizada no Brasil e a aplicação excessiva deste

  3. Impact of Long-Term Forest Enrichment Planting on the Biological Status of Soil in a Deforested Dipterocarp Forest in Perak, Malaysia

    Directory of Open Access Journals (Sweden)

    D. S. Karam

    2012-01-01

    Full Text Available Deforestation leads to the deterioration of soil fertility which occurs rapidly under tropical climates. Forest rehabilitation is one of the approaches to restore soil fertility and increase the productivity of degraded areas. The objective of this study was to evaluate and compare soil biological properties under enrichment planting and secondary forests at Tapah Hill Forest Reserve, Perak after 42 years of planting. Both areas were excessively logged in the 1950s and left idle without any appropriate forest management until 1968 when rehabilitation program was initiated. Six subplots (20 m × 20 m were established within each enrichment planting (F1 and secondary forest (F2 plots, after which soil was sampled at depths of 0–15 cm (topsoil and 15–30 cm (subsoil. Results showed that total mean microbial enzymatic activity, as well as biomass C and N content, was significantly higher in F1 compared to F2. The results, despite sample variability, suggest that the rehabilitation program improves the soil biological activities where high rate of soil organic matter, organic C, N, suitable soil acidity range, and abundance of forest litter is believed to be the predisposing factor promoting higher population of microbial in F1 as compared to F2. In conclusion total microbial enzymatic activity, biomass C and biomass N evaluation were higher in enrichment planting plot compared to secondary forest. After 42 years of planting, rehabilitation or enrichment planting helps to restore the productivity of planted forest in terms of biological parameters.

  4. Soil-Derived Microbial Consortia Enriched with Different Plant Biomass Reveal Distinct Players Acting in Lignocellulose Degradation.

    Science.gov (United States)

    de Lima Brossi, Maria Julia; Jiménez, Diego Javier; Cortes-Tolalpa, Larisa; van Elsas, Jan Dirk

    2016-04-01

    Here, we investigated how different plant biomass, and-for one substrate-pH, drive the composition of degrader microbial consortia. We bred such consortia from forest soil, incubated along nine aerobic sequential - batch enrichments with wheat straw (WS1, pH 7.2; WS2, pH 9.0), switchgrass (SG, pH 7.2), and corn stover (CS, pH 7.2) as carbon sources. Lignocellulosic compounds (lignin, cellulose and xylan) were best degraded in treatment SG, followed by CS, WS1 and WS2. In terms of composition, the consortia became relatively stable after transfers 4 to 6, as evidenced by PCR-DGGE profiles obtained from each consortium DNA. The final consortia differed by ~40 % (bacteria) and ~60 % (fungi) across treatments. A 'core' community represented by 5/16 (bacteria) and 3/14 (fungi) bands was discerned, next to a variable part. The composition of the final microbial consortia was strongly driven by the substrate, as taxonomically-diverse consortia appeared in the different substrate treatments, but not in the (WS) different pH one. Biodegradative strains affiliated to Sphingobacterium kitahiroshimense, Raoultella terrigena, Pseudomonas putida, Stenotrophomonas rhizophila (bacteria), Coniochaeta ligniaria and Acremonium sp. (fungi) were recovered in at least three treatments, whereas strains affiliated to Delftia tsuruhatensis, Paenibacillus xylanexedens, Sanguibacter inulus and Comamonas jiangduensis were treatment-specific. PMID:26487437

  5. Recent ORNL experience in site performance prediction: the Gas Centrifuge Enrichment Plant and the Oak Ridge Central Waste Disposal Facility

    International Nuclear Information System (INIS)

    The suitability of the Portsmouth Gas Centrifuge Enrichment Plant Landfill and the Oak Ridge, Tennessee, Central Waste Disposal Facility for disposal of low-level radioactive waste was evaluated using pathways analyses. For these evaluations, a conservative approach was selected; that is, conservatism was built into the analyses when assumptions concerning future events had to be made or when uncertainties concerning site or waste characteristics existed. Data from comprehensive laboratory and field investigations were used in developing the conceptual and numerical models that served as the basis for the numerical simulations of the long-term transport of contamination to man. However, the analyses relied on conservative scenarios to describe the generation and migration of contamination and the potential human exposure to the waste. Maximum potential doses to man were calculated and compared to the appropriate standards. Even under this conservative framework, the sites were found to provide adequate buffer to persons outside the DOE reservations and conclusions concerning site capacity and site acceptability were drawn. Our experience through these studies has shown that in reaching conclusions in such studies, some consideration must be given to the uncertainties and conservatisms involved in the analyses. Analytical methods to quantitatively assess the probability of future events to occur and to quantitatively determine the sensitivity of the results to data uncertainty may prove useful in relaxing some of the conservatism built into the analyses. The applicability of such methods to pathways analyses is briefly discussed

  6. Dynamic simulation and verification of a compression-liquefaction system for material withdrawal from a uranium-enrichment plant

    International Nuclear Information System (INIS)

    Dynamic simulation was used to evaluate the design of the Tails (depleted 235U assay) Withdrawal System for an uranium enrichment plant. Desirability of a simulation to check the design was indicated by requirements for a very high system reliability (99.95% availability) over a wide range of system throughput (85:1). Objective of the simulation included: evaluate alternate compressor anti-surge schemes, identify control system sensitivities, examine start-up and shut-down procedures, identify system limitations and testing of proposed design changes, and provide an understanding of system behavior. Three levels of process complexity were modeled: (1) compressions system, (2) combined compressor and liquefaction system, and (3) parallel operation of two compression/liquefaction trains. Two compressor train configurations were evaluated with the simulation mode. A FORTRAN based simulation methodology was used to implement and solve the mathematical models and plot the time history behavior for each test run. Results included discovery that that initial process steady state design would not operate stably. A new steady state was formulated which required some modifications to equipment sizing and control system philosophy. This new design was tested and proven with the simulation. Simulation objectives were achieved. Based on the simulation results, recommendations were made regarding: best compressor configuration, most effective anti-surge control scheme, changes to enhance system reliability and operability, control system sensitivities, control system design to achieve load sharing for parallel trains, and overall system operability with existing design

  7. Evolutionary Divergence of Plant Borate Exporters and Critical Amino Acid Residues for the Polar Localization and Boron-Dependent Vacuolar Sorting of AtBOR1.

    Science.gov (United States)

    Wakuta, Shinji; Mineta, Katsuhiko; Amano, Taro; Toyoda, Atsushi; Fujiwara, Toru; Naito, Satoshi; Takano, Junpei

    2015-05-01

    Boron (B) is an essential micronutrient for plants but is toxic when accumulated in excess. The plant BOR family encodes plasma membrane-localized borate exporters (BORs) that control translocation and homeostasis of B under a wide range of conditions. In this study, we examined the evolutionary divergence of BORs among terrestrial plants and showed that the lycophyte Selaginella moellendorffii and angiosperms have evolved two types of BOR (clades I and II). Clade I includes AtBOR1 and homologs previously shown to be involved in efficient transport of B under conditions of limited B availability. AtBOR1 shows polar localization in the plasma membrane and high-B-induced vacuolar sorting, important features for efficient B transport under low-B conditions, and rapid down-regulation to avoid B toxicity. Clade II includes AtBOR4 and barley Bot1 involved in B exclusion for high-B tolerance. We showed, using yeast complementation and B transport assays, that three genes in S. moellendorffii, SmBOR1 in clade I and SmBOR3 and SmBOR4 in clade II, encode functional BORs. Furthermore, amino acid sequence alignments identified an acidic di-leucine motif unique in clade I BORs. Mutational analysis of AtBOR1 revealed that the acidic di-leucine motif is required for the polarity and high-B-induced vacuolar sorting of AtBOR1. Our data clearly indicated that the common ancestor of vascular plants had already acquired two types of BOR for low- and high-B tolerance, and that the BOR family evolved to establish B tolerance in each lineage by adapting to their environments. PMID:25619824

  8. Mechanisms of the boron carbide and boron nitride preferred sputtering by low energy ions bombardment

    International Nuclear Information System (INIS)

    The ion irradiation of BN and B4C leads to enriching of the materials with the lighter component - borons as the experiment shows . With a view to explain this effect sputtering of BN and B4C under the irradiation by the He+ and Ar+ ions with the energy E0=0,5-5 keV has been calculated with computer modelling and the real structure of BN has been considered. In the case of B4C the calculations have been carried with Monte-Carlo code. It was shown that enriching of BN by boron may be accounted for building up the molecules N2 on the irradiated surface and their desorbing. The enriching of B4C with boron results from the difference of the binding energy of the B and C atoms. (author). 10 refs., 5 tabs

  9. Uranium enrichment in South Africa: from the world-unique Z-plant to the use of high-technology lasers

    International Nuclear Information System (INIS)

    A historical discussion of the technology used in South Africa for the enrichment of uranium, as well as other technological spin-offs for the country that followed from the construction of the Z-plant. The national energy strategy and objectives of the government during the Apartheid years resulted in the development of several large-scale energy projects. The pressure of sanctions forced the Z-plant to be rushed into operation at an uneconomical capacity of 250 000 SWU per annum. In 1994 this implied that enriched uranium was produced at a cost of $200 per SWU while the world market price was below $90. While the production of enriched uranium at the Z-plant ceased early in 1995, the expertise gained will not be lost entirely. As a result of the high energy and financial capital intensive current methods of producing enriched uranium, research started in the early 1970's into alternative production processes making use of lasers. South Africa has opted for the MLIS (molecular laser isotope separation) process, as a result of its vast experience gained from the Z-plant in the handling of the molecular input gas UF6 (uranium hexafluoride), and this has been under development since the early 1980's. During 1994 significant progress was made with MLIS, in particular with single-step enrichment from natural uranium to better than 4% uranium 235 on a macro scale. The Atomic Energy Corporation of South Africa's strategy is to licence the process internationally. 3 tabs., 3 figs

  10. Elementary boron and metal-boron compounds

    International Nuclear Information System (INIS)

    Elementary boron is of interest for its peculiar and difficult bonding behaviour in solids. Due to its high oxygen affinity we find no elementary boron in nature. For the same reason it is difficult to isolate pure, elementary boron, and much confusion about 'boron crystals' has been the result of more than 100 years of research. The polymorphic forms of elementary boron and its closely related higher carbides and higher metal borides as well as the simple metal borides, B3C and BN are reported. The quantum-mechanical background responsible for structure and stoichiometry of these crystals is given. (orig.)

  11. Uranium conversion and enrichment

    International Nuclear Information System (INIS)

    A description is given of the Atomic Energy Corporation's uranium conversion and enrichment plants at Valinda ba, including a brief discussion of problems encountered and plans for future developments. (author)

  12. Reclamation of abandoned ash pond of Neyveli thermal power plant by enrichment and its effect on growth and yield of gingelly

    Energy Technology Data Exchange (ETDEWEB)

    Sheela, A.M.; Shanmugasundaram, R.; Sundaram, M.D. [Annamalai Nagar University, Annamalai, Nagar (India). Dept. of Microbiology

    2003-07-01

    Ash ponds are the common disposal sites of ash generated from India's thermal power stations. An attempt was made to enrich the ash pond of Neyveli Lignite Corporation Ltd., Neyveli, using organic amendments and microbial inoculants to promote crop growth. The oil seed crop gingelly was grown in two seasons and more growth and yield was recorded in the second crop, which was enriched in the second time also. The inoculation effect of the crop with VAM fungus Glomus mosseae and the acid-tolerant Azospirillum isolate, A. lipoferum PAI-1 was studied. The co-inoculation of Azospirillum with VAM enhanced the rhizosphere dehydrogenase enzyme activity, growth, yield, N, and P content of the plant in the enriched ash pond. Hence, the nutritionally and biologically poor medium like ash ponds could be enriched successively to increase in the nutrient contents and microbial activity. Prolonged enrichment would be providing favourable conditions for the establishment of vegetation and the environmental pollution is greatly reduced by the vegetative cover on barren land. 30 refs., 6 tabs.

  13. A Laser-Based Method for On-site Analysis of UF6 and Environmental Samples at Enrichment Plants

    International Nuclear Information System (INIS)

    The International Atomic Energy Agency's (IAEA) long-term R&D plan calls for more cost-effective and efficient safeguard methods to detect and deter misuse of gaseous centrifuge enrichment plant (GCEPs). The IAEA's current safeguards approaches at GCEPs are based on a combination of routine and random inspections that include environmental sampling (ES) and destructive assay (DA) sample collection from UF6 in-process material and selected cylinders. Samples are then shipped off-site for subsequent laboratory analysis. On-site analysis could provide timely screening of ES samples, and help to meet challenges in transportation and chain of custody for UF6 DA samples. PNNL's development of the Laser Ablation, Laser Absorbance Ratio Spectrometry (LAARS) method is aimed at these two applications. For both ES and DA samples, a LAARS analysis instrument could be temporarily or permanently deployed in the IAEA control room of the facility, for example in the IAEA data acquisition cabinet. Sample collection concepts include a PNNL-designed handheld DA sampler with a small sampling planchet to collect microgrammes of adsorbed UF6 gas directly from a process line tap and potentially, from a cylinder headspace. The sample planchet could then be assayed on-site by LAARS; some portion of the sample could be reserved for laboratory analysis (low sample activity should mitigate shipping restrictions). A second sampling concept collects aerosol particles from facility surfaces using a small backpack aerosol collector based on a PNNL rotating drum impactor design, which offers the possibility of sample segregation by sampling location and particle size. Some portions of the collector drums could be characterized on-site by LAARS to provide early sample screening and to guide additional sampling. The remaining drum samples could be transported to off-site laboratories for comprehensive analysis need to confirm or refute initial on-site findings. (author)

  14. Carbon assimilation characteristics of plants in oasis-desert ecotone and their response to CO2 enrichment

    Institute of Scientific and Technical Information of China (English)

    SU; Peixi; CHEN; Huaishun; AN; Lizhe; LIU; Xinmin

    2004-01-01

    Six species of more than 20-year-old desert woody plants in the oasis-desert ecotone were selected for study. The results showed that: (1) in different growing seasons δ13 C values of assimilating organ varied between -14‰ and -16‰ for Haloxylon ammodendron (HA),-14‰ - -15‰ for Calligonum mongolicum (CM) and -25‰ - -28‰ for Caragana korshinskii (CK), Nitraria sphaerocarpa (NS) and Hedysarum scoparium (HS). (2) The net photosynthetic rate (Pn) of HA and CM was significantly higher than those of the other species. With the decrease in Pn for the six species, their intercellular CO2 concentration increased, but stomatal limitation value decreased under the intensive light. At the same time, the photochemical efficiency of PS Ⅱ dropped to different degrees. (3) The CO2 enrichment experiment demonstrated that, Pn of HA and CM increased to different extent under 450 μmol/mol, but their Pn reduced or approximated to the current condition under 650 μmol/mol. Under 450 μmol/mol the efficiency for solar energy utilization of CK and HS significantly reduced and under 650 μmol/mol their respiration rate exceeded photosynthesis rate. It can be concluded that HA and CM have some function of pathway for C4, but the other three species have the function for C3. The decline in their Pn is mainly caused by non-stomatal factors. HA, CM, CK and HS exhibited photoinhibition, which disappeared in a short time. This is a kind of positive readjustment to adapting to the desert environment. HA and CM can adapt to the high CO2 environment, but CKand HS cannot. With the rise in atmospheric CO2 concentration and climate warming, the latter two species in the oasis-desert ecotone may be gradually degraded or even disappear.

  15. Development of On-line Uranium Enrichment Monitor of Gaseous UF6 for Uranium Enrichment Plant%铀浓缩厂铀丰度在线监测装置研制

    Institute of Scientific and Technical Information of China (English)

    吕学升; 刘国荣; 金惠民; 赵永刚; 郝学元; 李井怀; 应斌; 俞兆飞

    2013-01-01

    An on-line enrichment monitor was developed to measure the enrichment of UF6 flowing through the processing pipes in uranium enrichment plant.A NaI(Tl) detector was used to measure the count rates of the 185.7 keV γ-ray emitted from 235U,and the total quantity of uranium was determined from thermodynamic characteristics of gaseous uranium hexafluoride.The results show that the maximum relative standard deviation is less than 1% when the measurement time is 120 s or more and the pressure is more than 2 kPa in the measurement chamber.Uranium enrichment of gaseous uranium hexafluoride in the output end of cascade can be monitored continuously by using the device.It should be effective for nuclear materials accountability verifications and materials balance verification at uranium enrichment plant.%研制了铀浓缩厂产品端UF6气体235U丰度在线实时监测装置.该装置由NaI(Tl)探测器、脉冲处理器、压力和温度传感器、管道阀门系统等组成,利用NaI(Tl)探测器对测量容器内气态UF6中235U发射的特征γ射线进行测量来得到235U的量,利用传感器对气体温度、压力进行测量,根据理想气体状态方程得到UF6气体中U的总量,从而得到235U丰度.该装置现场应用实验表明:铀丰度在线监测结果相对标准偏差小于1%,与气体质谱计测量结果相对偏差小于1%.

  16. Transportation environmental safety analysis of the commercial movement of low enriched uranium (LEU) from DOE sites to the Oak Ridge Y-12 Plant

    International Nuclear Information System (INIS)

    This report documents the technical basis for evaluating the environmental impacts of transporting three metric tons (MTU) of Low Enriched Uranium (LEU) by commercial carrier from DOE sites to the Oak Ridge Y-12 Plant located in Tennessee. The RADTRAN 4 computer code and the HIGHWAY 3.1 computer routing program developed by Sandia National Laboratories and Oak Ridge National Laboratory respectively, were the primary tools utilized in this analysis. The information contained within this report is supplemental to the transportation analysis conducted in the Environmental Assessment for the Proposed Interim Storage of Enriched Uranium Above the Maximum Historical Storage Level at the Y-12 Plant Oak Ridge, Tennessee (DOE-EA/0929). The results of this analysis indicate that the radiological consequences imposed under both incident-free and accident conditions are extremely small and readily meet the goals as set forth in SEN-35-91

  17. Promotion of uranium enrichment business

    International Nuclear Information System (INIS)

    The Committee on Nuclear Power has studied on the basic nuclear power policy, establishing its five subcommittees, entrusted by the Ministry of Nternational Trade and Industry. The results of examination by the subcommittee on uranium enrichment business are given along with a report in this connection by the Committee. In order to establish the nuclear fuel cycle, the aspect of uranium enrichment is essential. The uranium enrichment by centrifugal process has proceeded steadily in Power Reactor and Nuclear Fuel Development Corporation. The following matters are described: the need for domestic uranium enrichment, the outlook for overseas enrichment services and the schedule for establishing domestic enrichment business, the current state of technology development, the position of the prototype enrichment plant, the course to be taken to establish enrichment business the main organization operating the prototype and commercial plants, the system of supplying centrifuges, the domestic conversion of natural uranium the subsidies for uranium enrichment business. (J.P.N.)

  18. Centrifugal enrichment of zinc isotopes, their application in medicine and in increasing radiation safety in nuclear power plants

    International Nuclear Information System (INIS)

    This paper contains the results of our research on the complete cycle of centrifuge enrichment of all zinc isotopes. The centrifuge cascade that was used to obtain the world's first zinc isotope, 7Zn, with an enrichment of more than 99.3% in gram quantities, is described. As a result of this work, gram quantities of all highly enriched zinc isotopes and hundreds of grams of depleted zinc (in the form of ZnO) with concentrations of less than 0.5% 64Zn were obtained

  19. 南美硫酸镁型硼锂盐湖综合利用技术评述%Comprehensive Utilization Review of Magnesium Sulfate Type Salt Lake which Enrich in Boron and Lithium in South America

    Institute of Scientific and Technical Information of China (English)

    刘海明; 李宏灿; 杨建元; 李陇岗

    2011-01-01

    Development of sulfate type saline resource is mainly potassium-based resources in the world, the other resources is supplemented by the comprehensive development such as boron,bromine, lithium. South America Salt Lake to develop the most representative. The distribution of magnesium sulfate type salt lake of boron and lithium resources was described in south America in this paper, especially boron and lithium resource was elaborated in detail. The current status of comprehensive development and utilization of magnesium sulfate type saline resource were reviewed.At last, several suggestions on rational resource allocation and sustainable utilization Magnesium sulfate subtype saline resource were put forward.%世界硫酸镁型盐湖资源的开发是以钾资源利用为主,硼、溴、锂等其它资源综合开采为辅,以南美盐湖开发最具代表性.概述了南美硫酸镁型硼锂盐湖资源的分布特征,对其含硼锂盐湖资源进行了详细的阐述,并对目前综合开发利用技术做了评述,最后为硫酸镁型盐湖资源的合理配置、综合开发利用等问题提出了一些建议.

  20. Assessment of phosphopeptide enrichment/precipitation method for LC-MS/MS based phosphoproteomic analysis of plant tissue

    OpenAIRE

    Ye, Juanying; Rudashevskaya, Elena; Hansen, Thomas Aarup; Fuglsang, Anja T.; Palmgren, Michael G.; Jensen, Ole Nørregaard

    2009-01-01

      IntroductionMass spectrometry (MS) is a powerful technology for study of PTMs, including protein phosphorylation. Due to the low abundance of many phosphoproteins and the relatively poor ionization efficiency of phosphopeptides, specific enrichment of phosphopeptides prior to MS analysis is necessary. At present, numerous phosphopeptide enrichment approaches have been established and applied to complex biological samples. We and others have reported that multi-step phosphopeptide purificati...

  1. Simultaneous determination of boron-10 and boron-11 under proton bombardment

    International Nuclear Information System (INIS)

    The isotopic analysis of boron gained importance with increased use of boron-10 in nuclear technology. Former techniques for determining the stable boron isotope either were limited to the determination of a single isotope or required tedious experimental prodecure. The use of proton induced reactions was therefore investigated as an alternative method for the simultaneous analysis of both stable isotopes of boron through a relatively simple experimental procedure. Aqueous solutions of natural boric acid (19,78 at. % 10B) and enriched boric acid (92,41 at. % 10B) were mixed and evaporated to dryness in order to obtain samples in which the isotopic concentration of boron was known. Thin targets were produced by evaporating boron oxide, converted by heat from the boric acid mixture, onto tantalum backing material. Standard samples with known contents of boron oxide were prepared by dry mixing standard reference boron-containing glass powers in a ball mill. Thick targets containing boron of different isotopic compositions were prepared in matrices of potassium bromide and of ion-exchange resins by mixing the matrix with aqueous solutions of boric acid and of sodium carbonate by fusion with boric oxide. The most intense prompt gamma-rays emitted from boron isotopes under irradiation with protons up to 4,5 MeV were the 428-KeV 10B α(1,0), 718-KeV 10B p(1,0) and the 2124-KeV 11B p(1,0) gamma-rays. Excitation functions for the production of each of these were measured using both thick and thin targets

  2. CO{sub 2} enrichment and carbon partitioning to phenolics: do plant responses accord better with the protein competition or the growth differentiation balance models?

    Energy Technology Data Exchange (ETDEWEB)

    Mattson, W.J. [Forestry Sciences Lab., Rhinelander, WI (United States); Julkunen-Tiitto, R. [Univ. of Joensuu, Biology Dept., Joensuu (Finland); Herms, D.A. [Ohio State Univ., Dept. of Entmology, Wooster, OH (United States)

    2005-11-01

    Rising levels of atmospheric CO{sub 2} can alter plant growth and partitioning to secondary metabolites. The protein competition model (PCM) and the extended growth/differentiation balance model (GDB{sub e}) are similar but alternative models that address ontogenetic and environmental effects on whole-plant carbon partitioning to the phenylpropanoid biosynthetic pathway, making many divergentpredictins. To test the validity of the models, we compare plant responses to one key prediction: if CO{sub 2} enrichment simultaneously stimulates both photosynthesis and growth, then PCM predicts that partitioning to phenolic compounds will decline, whereas GDB{sub e} generally predicts the opposite. Elevated CO{sub 2} (at 548 ppm) increased the biomass growth (ca 23%) as well as the net photosynthesis (ca 13%) of 1-year-old potted paper birch, Betula papyrifera Marsch., in a free air carbon dioxide enrichment study (FACE) in northern Wisconsin. Concomitantly, elevated CO{sub 2} increased carbon partitioning to all measured classes of phenolics (Folin-Denis phenolics, HPLC low molecular weight phenolics (i.e. cinnamic acid derivatives, flavonol flycosides, and flavon-3-ols), condensed tannins, and acid-detergent lignin) in leaves. In stem tissues, tannins and lignin increased, but F-D phenolics did not. In root tissues, F-D phenolics, and tannins increased, but lignin did not. The data suggest that CO{sub 2} enrichment stimulated pathway-wide increase in carbon partitioning to phenylpropanoids. High CO{sub 2} plants had 11.8% more F-D phenolics, 19.3% more tannin, and 10% more lignin than ambient plants after adjusting for plant mass via analysis of covariance. In general, the results unequivocally support the predictions of the GDB{sub e} model. By way of contrast, results from many parallel studies on FACE trembling aspen, Populus tremuloides Michx., suggest that although 2 enrichment has consistently stimulated both photosynthesis and growth, it apparently did not

  3. Blueprint for domestic uranium enrichment

    International Nuclear Information System (INIS)

    The AEC advisory committee on domestic production of uranium enrichment has studied for more than a year how to achieve the domestic enrichment of uranium by the construction and operation of a commercial enriching plant using centrifugal separation method, and the report was submitted to the Atomic Energy Commission on August 18, 1980. Japan has depended wholly on overseas services for her uranium enrichment needs, but the development of domestic enrichment has been carried on in parallel. The AEC decided to construct a uranium enrichment pilot plant using centrifuges, and it has been forwarded as a national project. The plant is operated by the Power Reactor and Nuclear Fuel Development Corp. since 1979. The capacity of the plant will be raised to approximately 75 ton SWU a year. The centrifuges already operated have provided the first delivery of fuel of about 1 ton for the ATR ''Fugen''. The demand-supply balance of uranium enrichment service, the significance of the domestic enrichment of uranium, the evaluation of uranium enrichment technology, the target for domestic enrichment plan, the measures to promote domestic uranium enrichment, and the promotion of the construction of a demonstration plant are reported. (Kako, I.)

  4. Synthesis and characterization of ammonium phosphate fertilizers with boron

    Directory of Open Access Journals (Sweden)

    ANGELA MAGDA

    2010-07-01

    Full Text Available The concentration of boron, an essential micronutrient for plants, presents a narrow range between deficiency and toxicity. In order to provide the boron requirement for plants, and to avoid toxicity problems, boron compounds are mixed with basic fertilizers. Sodium borate pentahydrate was used as a boron source. Ammonium orthophosphates fertilizers with boron were prepared by neutralizing phosphoric acid with ammonia and addition of variable amounts of sodium tetraborate pentahydrate to the reaction mixture at a NH3:H3PO4 molar ratio of 1.5. The fertilizers obtained with boron contents ranging from 0.05 to 1 % (w/w were fully characterized by chemical analysis, thermal analysis, X-ray diffraction and infrared spectrophotometry. The studies showed that up to 500 °C, regardless of the boron content, no significant changes concerning thermal stability and nutritional properties occurred. Above 500 °C, an increase of thermal stability with an increase of the boron content was observed. X-Ray diffraction of a heat-treated sample containing 5 % (w/w boron indicated the appearance of boron orthophosphate, BPO4, as a new crystalline phase, and the disappearance of the previous structures above 500 °C, which explains the increase in thermal stability.

  5. Combustion synthesis of boron carbide - a spectroscopic studies

    International Nuclear Information System (INIS)

    Boron Carbide is one of the hardest materials known, ranking third behind diamond and cubic boron nitride. It is the hardest material produced in tonnage quantities. Boron carbide (BxCx) enriched in the 10B isotope is used as a control rod material in the nuclear industry due to its high neutron absorption cross section and other favorable physico-chemical properties. Conventional methods of preparation of boron carbide are energy intensive processes accompanied by huge loss of boron. Attempts were made at IGCAR Kalpakkam to develop energy efficient and cost effective methods to prepare boron carbide. Nuclear applications of boron carbide include shielding, control rod and shut down pellets. Within control rods, boron carbide is often powdered, to increase its surface area. The products of the gel combustion and microwave synthesis experiments were characterized for phase purity by X-ray diffraction (XRD). The carbide formation was ascertained using finger-print spectroscopy of Fourier transform infrared (FTIR). Samples of pyrolized/microwave heated powder were characterized for surface morphology using electron microscope (SEM). The present work shows the recent advances in understanding of structural and chemical variation in boron carbide and their influence on morphology, optical and vibrational property result discussed in details. (author)

  6. Boron Poisoning of Plutonium Solutions

    International Nuclear Information System (INIS)

    The results of a theoretical investigation into the possible relaxation of criticality concentration limits in wet chemical reprocessing plants, due to the introduction of boron poisoning, are reported. The following systems were considered: 1. 1 in. stainless steel tubes filled with boron carbide at various pitches in homogeneous mixtures of 239Pu (NO3)4, 5H2O and water. 2. 1 in. and 2 in borosilicate glass Raschig rings in homogeneous mixtures of 239Pu (NO3)4, 5H2O and water. 3. The concentration of natural boron required for k∞ = 1 in homogeneous mixtures of 239Pu-B-H2O. The method of calculation was Monte Carlo using the GEM code with Nuclear Data File cross-sections. The Raschig rings used are those commercially available. The core model consisted of a cubic arrangement of unit cubes of solution within each of which a Raschig ring was centrally placed. The arrangement was such that the rings were regularly stacked with axes parallel, but the side of the unit cube was fixed to preserve the random packing density. Comparison is made with other reported results on boron poisoning. (author)

  7. Boron sorption characteristics in resins

    International Nuclear Information System (INIS)

    The purpose of boron addition in a nuclear power plant is to control the reactivity. In PHWRs, it is injected into the moderator system in the form of boric anhydride solution, while in PHWRs, it is added to the primary heat transport system in the form of boric acid solution. The required boron levels in PHWRs are controlled by valving in strong base anion exchangers having exchangeable species in OD- form while in PHWRs, the same can be achieved by restoring to the use of Boron Thermal Regeneration System (BTRS). This system operates on the principle of existence of different amounts of various polyborate ions at different temperatures, solution pH's and the boric acid concentrations and on the reversible sorption of these polyions on strong base anion exchange resins. This report describes the salient features of boron sorption characteristics on four types of anion exchange resins, based on experimental data generated in the chemical laboratories of Reactor Engineering Division of the Bhabha Atomic Research Centre, Bombay. The report further makes an attempt to calculate the pH of the resin and solution phases and the percentages of different polyborates and undissociated boric acid, under the experimental conditions investigated. (author). 30 refs., 4 figs., 20 tables

  8. Has the Impact of Rising CO2 on Plants been Exaggerated by Meta-Analysis of Free Air CO2 Enrichment Studies?

    Science.gov (United States)

    Haworth, Matthew; Hoshika, Yasutomo; Killi, Dilek

    2016-01-01

    Meta-analysis is extensively used to synthesize the results of free air CO2 enrichment (FACE) studies to produce an average effect size, which is then used to model likely plant response to rising [CO2]. The efficacy of meta-analysis is reliant upon the use of data that characterizes the range of responses to a given factor. Previous meta-analyses of the effect of FACE on plants have not incorporated the potential impact of reporting bias in skewing data. By replicating the methodology of these meta-analytic studies, we demonstrate that meta-analysis of FACE has likely exaggerated the effect size of elevated [CO2] on plants by 20 to 40%; having significant implications for predictions of food security and vegetation response to climate change. Incorporation of the impact of reporting bias did not affect the significance or the direction of the [CO2] effect. PMID:27536310

  9. Sputtering behavior of boron and boron carbide

    International Nuclear Information System (INIS)

    Sputtering yields of boron were measured with D+ and B+ ions for normal and oblique angles of incidence. Self-sputtering data of boron carbide were simulated in the experiment by using Ne+ ions. The energies of the impinging ions were between 20 eV and 10 keV. The measured data are compared with computer simulated values calculated with the TRIMSP program. The boron data for normal ion impact are higher than the calculated values, whereas those for oblique ion incidence are smaller than the calculation predicts. This discrepancy is explained by the surface roughness and supported by SEM micrographs. The comparison of the boron carbide data with TRIMSP calculations shows much better agreement than the boron data. In this case the target surface was much smoother. (orig.)

  10. Does boron affect hormone levels of barley cultivars?

    Directory of Open Access Journals (Sweden)

    Muavviz Ayvaz

    2012-11-01

    Full Text Available Background: When mineral nutrients are present in excess or in inadequate amounts, their effects can be severe in plants and can be considered as abiotic stress. In this study, we report how hormonal levels in barley cultivars respond to the toxic effect of boron, an essential plant micronutrient. Material and methods: Two different barley (Hordeum vulgare cultivars (Vamik Hoca and Efes 98 were used as a study material. Boron was applied in three different concentrations (0, 10, 20 ppm to plants that had grown from seeds for four weeks. Plants were harvested, stem-root length and stem-root dry-fresh weight content were determined. For further analysis, chlorophyll, total protein, endogenic IAA and ABA content analyses were carried out. Results: According to the data obtained, plant growth and development decreased with increasing boron concentrations. With increasing boron concentrations, soluble total protein increased in both cultivars. Boron application led to increased endogenic IAA content in both cultivars. 10 and 20 ppm boron application led to increased endogenic ABA content in Vamik Hoca cultivar whereas endogenic ABA content decreased in Efes 98. Absence of boron application led to increased endogenic IAA and ABA content in both cultivars. Conclusion: As a result, the response to boron is different in the two cultivars and Efes 98 may be more resistant to the toxicity than Vamik Hoca cultivar.

  11. The enrichment of natural radionuclides in oil shale-fired power plants in Estonia--the impact of new circulating fluidized bed technology.

    Science.gov (United States)

    Vaasma, Taavi; Kiisk, Madis; Meriste, Tõnis; Tkaczyk, Alan Henry

    2014-03-01

    Burning oil shale to produce electricity has a dominant position in Estonia's energy sector. Around 90% of the overall electric energy production originates from the Narva Power Plants. The technology in use has been significantly renovated - two older types of pulverized fuel burning (PF) energy production units were replaced with new circulating fluidized bed (CFB) technology. Additional filter systems have been added to PF boilers to reduce emissions. Oil shale contains various amounts of natural radionuclides. These radionuclides concentrate and become enriched in different boiler ash fractions. More volatile isotopes will be partially emitted to the atmosphere via flue gases and fly ash. To our knowledge, there has been no previous study for CFB boiler systems on natural radionuclide enrichment and their atmospheric emissions. Ash samples were collected from Eesti Power Plant's CFB boiler. These samples were processed and analyzed with gamma spectrometry. Activity concentrations (Bq/kg) and enrichment factors were calculated for the (238)U ((238)U, (226)Ra, (210)Pb) and (232)Th ((232)Th, (228)Ra) family radionuclides and for (40)K in different CFB boiler ash fractions. Results from the CFB boiler ash sample analysis showed an increase in the activity concentrations and enrichment factors (up to 4.5) from the furnace toward the electrostatic precipitator block. The volatile radionuclide ((210)Pb and (40)K) activity concentrations in CFB boilers were evenly distributed in finer ash fractions. Activity balance calculations showed discrepancies between input (via oil shale) and output (via ash fractions) activities for some radionuclides ((238)U, (226)Ra, (210)Pb). This refers to a situation where the missing part of the activity (around 20% for these radionuclides) is emitted to the atmosphere. Also different behavior patterns were detected for the two Ra isotopes, (226)Ra and (228)Ra. A part of (226)Ra input activity, unlike (228)Ra, was undetectable in the

  12. Boron nitride converted carbon fiber

    Energy Technology Data Exchange (ETDEWEB)

    Rousseas, Michael; Mickelson, William; Zettl, Alexander K.

    2016-04-05

    This disclosure provides systems, methods, and apparatus related to boron nitride converted carbon fiber. In one aspect, a method may include the operations of providing boron oxide and carbon fiber, heating the boron oxide to melt the boron oxide and heating the carbon fiber, mixing a nitrogen-containing gas with boron oxide vapor from molten boron oxide, and converting at least a portion of the carbon fiber to boron nitride.

  13. Combined effects of CO2 enrichment, diurnal light levels and water stress on foliar metabolites of potato plants grown in naturally sunlit controlled environment chambers.

    Science.gov (United States)

    Barnaby, Jinyoung Y; Fleisher, David; Reddy, Vangimalla; Sicher, Richard

    2015-02-01

    Experiments were conducted in outdoor, naturally sunlit, soil-plant-atmosphere research (SPAR) chambers using plants grown in pots. Drought treatments were imposed on potato plants (Solanum tuberosum cv. Kennebec) beginning 10 days after tuber initiation. A total of 23 out of 37 foliar metabolites were affected by drought when measured 11 days after initiating water stress treatments. Compounds that accumulated in response to drought were hexoses, polyols, branched chain amino acids (BCAAs) and aromatic amino acids, such as proline. Conversely, leaf starch, alanine, aspartate and several organic acids involved in respiratory metabolism decreased with drought. Depending upon harvest date, a maximum of 12 and 17 foliar metabolites also responded to either CO2 enrichment or diurnal treatments, respectively. In addition, about 20% of the measured metabolites in potato leaflets were simultaneously affected by drought, CO2 enrichment and diurnal factors combined. This group contained BCAAs, hexoses, leaf starch and malate. Polyols and proline accumulated in response to water stress but did not vary diurnally. Water stress also amplified diurnal variations of hexoses and starch in comparison to control samples. Consequently, specific drought responsive metabolites in potato leaflets were dramatically affected by daily changes of photosynthetic carbon metabolism. PMID:24888746

  14. Mass spectrometric determination of boron isotope in boron carbide

    International Nuclear Information System (INIS)

    Boron isotopes in boron carbide are measured by thermionic ionization mass spectrometry with no prior chemical separation. Boron is converted to sodium borate by fusion of the boron carbide with sodium hydroxide (or sodium carbonate) directly on the rhenium filament. The boron isotopic ratios are measured by using the Na2BO2+ ion

  15. Study on the application of enriched boric acid in PWR primary water chemistry

    International Nuclear Information System (INIS)

    Natural boric acid is used in PWRs as chemical shim to control excess reactivity. After the implement of long-cycle fuel management, boron concentration will be increased, and water chemistry controlling will become more difficult. The paper analyzes the feasibility of enriched boric acid (EBA) used in the primary system of the nuclear power plants (NPPs) and the influence to correlative water chemical treatment systems. The study shows the EBA can reduce the corrosion rate of the primary system materials and radiation field, improve the economy of the in-service NPPs. It will be important to improve the technology of NPP primary water treatment. (authors)

  16. Efeitos do boro em algodoeiro cultivado em condições de casa de vegetação Effects of boron application to cotton plant in a greenhouse study

    Directory of Open Access Journals (Sweden)

    Nelson M. da Silva

    1979-01-01

    Full Text Available Visando obter subsídios para a instalação de futuros ensaios de campo com adubação boratada do algodoeiro, foi conduzido estudo em casa de vegetação, utilizando-se solo comprovadamente carente em boro para essa cultura. Foram usadas doses de 0, 133, 266 e 532mg de bórax por vaso contendo 5,0kg de terra. Em vasos extras, estudaram-se níveis mais elevados do produto. O efeito de boro sobre a altura média das plantas, peso de capulho, peso de sementes e comprimento de fibra foi significativo estatisticamente e de natureza quadrática. A concentração de B na matéria seca da parte aérea da planta ou da folha cresceu em proporção à dose utilizada. No caso da análise de folhas de plantas carentes, a concentração variou de 10 a 39ppm, com média de 19pmm de B, enquanto em plantas com grave sintoma de toxicidade foi obtido índice superior a 590ppm de B. Em plantas com carência de boro foi observado um ou vários dos seguintes sintomas: paralisação de crescimento, superbrotamento, intumescimento de nós com escurecimento de tecido, deformações do limbo e do pecíolo de cotilédones e de folhas verdadeiras, anéis concêntricos com necroses correspondentes da medula de pecíolos foliares e deformações das flores. Como sintoma de toxicidade, observou-se clorose marginal e internerval do cotilédone e/ou da folha verdadeira, que evoluiu ou não para necrose do tecido, permanecendo as nervuras com coloração verde normal.A greenhouse experiment of borax application to cotton cultivated on a boron deficient soil, was conducted in order to obtain data for development of future field trials. Borax was applied to pot containing 5,0kg of soil in amounts of 0, 133, 266 e 532mg. Additional treatments with higher levels of boron was applied to extra pots. The influence of boron on plant height, weight of bolls and seeds and on fiber lenght was statistically significant and of quadratic nature. The content of boron, determined either in

  17. Grade A boron-stainless steel: your flexible friend

    International Nuclear Information System (INIS)

    Boron-containing stainless steels were first used for neutron flux control in reactors. Today they are also used as neutron absorbing materials for spent fuel storage pools and transportation casks. These boron-enriched stainless steels provide a higher thermal neutron absorption cross section than conventional Type 304. Up to 2.25% boron may be added, depending upon attenuation requirements. While adding boron increases neutron attenuation, it has an adverse effect on the alloy's ductility and impact resistance. In the past this has limited the use of borated stainless steels as a structural material for the storage and transportation of spent fuel. Growing needs in the industry, along with improvements in speciality steel processing, led to the development of an advanced type of boron stainless steel which combines neutron absorption capability with the ductility and impact resistance needed for structural applications. It is available with total boron contents up to 2.25% of natural boron, the enriched B-10 isotope, or a combination of these. (author)

  18. Influence of boron on the morphological and physiological growth parameters of bean

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, S.A. de (Brasilia Univ. (Brazil). Dept. de Engenharia Agronomica); Blanco, S.A.; Engleman, E.M. (Colegio de Post-graduados, Chapingo (Mexico))

    1982-05-01

    Effect of boron on Phaseolus vulgaris L. var. Cacahuate was studied in nutrient solutions containing 0.000; 0.005; 0.050 and 0.500 ppm of the element. The deficiency of boron affected root growth, leaf development and plant growth. Lower values of net assimilation rate (NAR) indicated reduced photosynthetic activity in the case of boron deficiency.

  19. Enrichment of {sup 210}Po and {sup 210}Pb in ash samples from oil shale-fired power plants in Estonia

    Energy Technology Data Exchange (ETDEWEB)

    Ozden, B. [University of Tartu, Institute of Physics/Ege University, Institute of Nuclear Sciences (Estonia); Vaasma, T.; Kiisk, M.; Suursoo, S.; Tkaczyk, A.H. [University of Tartu,Institute of Physics (Estonia)

    2014-07-01

    Energy production in Estonia is largely dependent on the oil shale industry. Oil shale is a fossil fuel typically characterized by relatively high mineral composition, modest organic fraction (varying between 10 and 65%), high ash content (usually 45% to 50%), and average lower heating value of 8.4 MJ/kg{sup -1}. Oil shale-fired power plants account for 85% of Estonian electricity production and produce up to 6 million tons of oil shale ash annually. This ash contains elevated amounts of natural radionuclides (from the {sup 238}U and {sup 232}Th series and {sup 40}K), which were bound to oil shale during its formation. These radionuclides become enriched in ash fractions during the combustion process and are partially emitted to the atmosphere via fly ash and flue gases. Oil shale-fired electricity production is foreseen to remain a dominant trend in Estonia, suggesting that the radionuclide emissions to the atmosphere will continue in the future. The natural radionuclides {sup 210}Po and {sup 210}Pb, with half-lives of 138 days and 22.3 years respectively, originate from the radioactive decay of radionuclides of {sup 238}U series present in the earth's crust. These radionuclides are also built up artificially in the environment due to waste discharge from phosphate, oil, and gas industries, combustion of fossil fuels and other energy production as technically enhanced natural radionuclides. There are few studies on oil shale power plants influence on the levels of natural radioactivity in the surrounding areas. Realo, et al. reported that the annual doses from fly ash depositions over a 30 year period are in the range 90 - 200 μSv a{sup -1}. A study previously initiated by the University of Tartu, Institute of Physics (IPh) evaluated enrichment in the activity concentrations of {sup 238}U, {sup 226}Ra, {sup 210}Pb, {sup 232}Th, {sup 228}Ra and {sup 40}K in ash samples collected from Eesti Power Plant's circulating fluidized bed (CFB) boiler. According

  20. Prospecting plant growth promoting bacteria and cyanobacteria as options for enrichment of macro- and micronutrients in grains in rice–wheat cropping sequence

    Directory of Open Access Journals (Sweden)

    Anuj Rana

    2015-12-01

    Full Text Available The influence of plant growth promoting bacteria (PGPB and cyanobacteria, alone and in combination, was investigated on micronutrient enrichment and yield in rice–wheat sequence, over a period of two years. Analysis of variance (ANOVA in both crops indicated significant differences in soil dehydrogenase activity and micronutrient enrichment in grains (Fe, Zn in rice, and Cu, Mn in wheat. The combined inoculation of Anabaena oscillarioides CR3, Brevundimonas diminuta PR7, and Ochrobactrum anthropi PR10 (T6 significantly increased nitrogen, phosphorus, and potassium (NPK content and improved rice yield by 21.2%, as compared to the application of recommended dose of NPK fertilizers (T2. The treatment T5 (Providencia sp. PR3 + B. diminuta PR7 + O. anthropi PR10 recorded an enhancement of 13–16% in Fe, Zn, Cu, and Mn concentrations, respectively, in rice grains. In wheat, Providencia sp. PW5 (T6 recorded the highest yield (5.23 Mg ha−1 and significantly higher enrichment of Fe and Cu (44–45% in the grains. This study highlighted the promise of combinations of cyanobacteria/bacteria and their synergistic action in biofortification and providing savings of 40–60 kg N ha−1. Future focus needs to be towards integrating such promising environment-friendly and environmentally sustainable options in nutrient management strategies for this cropping sequence.

  1. The enrichment of natural radionuclides in oil shale-fired power plants in Estonia – The impact of new circulating fluidized bed technology

    International Nuclear Information System (INIS)

    Burning oil shale to produce electricity has a dominant position in Estonia's energy sector. Around 90% of the overall electric energy production originates from the Narva Power Plants. The technology in use has been significantly renovated – two older types of pulverized fuel burning (PF) energy production units were replaced with new circulating fluidized bed (CFB) technology. Additional filter systems have been added to PF boilers to reduce emissions. Oil shale contains various amounts of natural radionuclides. These radionuclides concentrate and become enriched in different boiler ash fractions. More volatile isotopes will be partially emitted to the atmosphere via flue gases and fly ash. To our knowledge, there has been no previous study for CFB boiler systems on natural radionuclide enrichment and their atmospheric emissions. Ash samples were collected from Eesti Power Plant's CFB boiler. These samples were processed and analyzed with gamma spectrometry. Activity concentrations (Bq/kg) and enrichment factors were calculated for the 238U (238U, 226Ra, 210Pb) and 232Th (232Th, 228Ra) family radionuclides and for 40K in different CFB boiler ash fractions. Results from the CFB boiler ash sample analysis showed an increase in the activity concentrations and enrichment factors (up to 4.5) from the furnace toward the electrostatic precipitator block. The volatile radionuclide (210Pb and 40K) activity concentrations in CFB boilers were evenly distributed in finer ash fractions. Activity balance calculations showed discrepancies between input (via oil shale) and output (via ash fractions) activities for some radionuclides (238U, 226Ra, 210Pb). This refers to a situation where the missing part of the activity (around 20% for these radionuclides) is emitted to the atmosphere. Also different behavior patterns were detected for the two Ra isotopes, 226Ra and 228Ra. A part of 226Ra input activity, unlike 228Ra, was undetectable in the solid ash fractions of the

  2. Salinity’s influence on boron toxicity in broccoli: II. Impacts on boron uptake, uptake mechanisms and tissue ion relations.

    Science.gov (United States)

    Limited research has been conducted on the interactive effects of salinity and boron stresses on plants despite their common occurrence in natural systems. The purpose of this research was to determine and quantify the interactive effects of salinity, salt composition and boron on broccoli (Brassica...

  3. Yield and seed oil content response of dwarf, rapid-cycling Brassica to nitrogen treatments, planting density, and carbon dioxide enrichment

    Science.gov (United States)

    Frick, J.; Nielsen, S. S.; Mitchell, C. A.

    1994-01-01

    Effects of N level (15 to 30 mM), time of N increase (14 to 28 days after planting), and planting density (1163 to 2093 plants/m2) were determined for crop yield responses of dwarf, rapid-cycling brassica (Brassica napus L., CrGC 5-2, Genome: ACaacc). Crops were grown in solid-matrix hydroponic systems and under controlled-environment conditions, including nonsupplemented (ambient) or elevated CO2 concentrations (998 +/- 12 micromoles mol-1). The highest seed yield rate obtained (4.4 g m-2 day-1) occurred with the lowest N level (15 mM) applied at the latest treatment time (day 28). In all trials, CO2 enrichment reduced seed yield rate and harvest index by delaying the onset of flowering and senescence and stimulating vegetative shoot growth. The highest shoot biomass accumulation rate (55.5 g m-2 day-1) occurred with the highest N level (30 mM) applied at the earliest time (day 14). Seed oil content was not significantly affected by CO2 enrichment. Maximum seed oil content (30% to 34%, dry weight basis) was obtained using the lowest N level (15 mM) initiated at the latest treatment time (day 28). In general, an increase in seed oil content was accompanied by a decrease in seed protein. Seed carbohydrate, moisture, and ash contents did not vary significantly in response to experimental treatments. Effects of N level and time of N increase were consistently significant for most crop responses. Planting density was significant only under elevated CO2 conditions.

  4. High-internal-phase-emulsion polymeric monolith coupled with liquid chromatography-electrospray tandem mass spectrometry for enrichment and sensitive detection of trace cytokinins in plant samples.

    Science.gov (United States)

    Du, Fuyou; Sun, Lin; Zhen, Xian; Nie, Honggang; Zheng, Yanjie; Ruan, Guihua; Li, Jianping

    2015-08-01

    High-internal-phase-emulsion polymers (polyHIPEs) show great promise as solid-phase-extraction (SPE) materials because of the tremendous porosity and highly interconnected framework afforded by the high-internal-phase-emulsion (HIPE) technique. In this work, polyHIPE monolithic columns as novel SPE materials were prepared and applied to trace enrichment of cytokinins (CKs) from complex plant samples. The polyHIPE monoliths were synthesized via the in-situ polymerization of the continuous phase of a HIPE containing styrene (STY) and divinylbenzene (DVB) in a stainless column, and revealed highly efficient and selective enrichment ability for aromatic compounds. Under the optimized experimental conditions, a method using a monolithic polyHIPE column combined with liquid chromatography-electrospray tandem mass spectrometry (LC-MS-MS) was developed for the simultaneous extraction and sensitive determination of trans-zeatin (tZ), meta-topolin (mT), kinetin (K), and kinetin riboside (KR). The proposed method had good linearity, with correlation coefficients (R (2)) from 0.9957 to 0.9984, and low detection limits (LODs, S/N = 3) in the range 2.4-47 pg mL(-1) for the four CKs. The method was successfully applied to the determination of CKs in real plant samples, and obtained good recoveries ranging from 68.8 % to 103.0 % and relative standard deviations (RSDs) lower than 16 %. PMID:26025552

  5. Is Job Enrichment Really Enriching?

    OpenAIRE

    Robert D. Mohr; Cindy Zoghi

    2006-01-01

    This study uses a survey of Canadian workers with rich, matched data on job characteristics to examine whether “enriched” job design, with features like quality circles, feedback, suggestion programs, and task teams, affects job satisfaction. We identify two competing hypotheses on the relationship between enriched jobs and job satisfaction. The “motivation hypothesis,” implies that enrichment will generally increase satisfaction and the “intensification hypothesis,” implies that enrichment m...

  6. Uranium enrichment

    International Nuclear Information System (INIS)

    GAO was asked to address several questions concerning a number of proposed uranium enrichment bills introduced during the 100th Congress. The bill would have restructured the Department of Energy's uranium enrichment program as a government corporation to allow it to compete more effectively in the domestic and international markets. Some of GAO's findings discussed are: uranium market experts believe and existing market models show that the proposed DOE purchase of a $750 million of uranium from domestic producers may not significantly increase production because of large producer-held inventories; excess uranium enrichment production capacity exists throughout the world; therefore, foreign producers are expected to compete heavily in the United States throughout the 1990s as utilities' contracts with DOE expire; and according to a 1988 agreement between DOE's Offices of Nuclear Energy and Defense Programs, enrichment decommissioning costs, estimated to total $3.6 billion for planning purposes, will be shared by the commercial enrichment program and the government

  7. Resposta de brócolis, couve-flor e repolho à adubação com boro em solo arenoso Response of boron fertilization on broccoli, cauliflower and cabbage planted in sandy soil

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Pizetta

    2005-03-01

    Full Text Available Foram avaliados em condições de campo, em solo arenoso, com baixo teor de boro, os efeitos da adubação com cinco doses de boro (0; 2; 4; 6 e 8 kg ha-1 de B na forma de bórax na produção de brócolis, couve-flor e repolho. O experimento obedeceu a um esquema fatorial com delineamento experimental de blocos ao acaso com três repetições. As adubações orgânica e química, inclusive o bórax, foram feitas no sulco antes do transplantio das mudas e a colheita foi feita entre 63 e 93 dias após o transplantio. A produtividade de brócolis variou de 16,9 a 20,5 t ha-1; a de couve-flor de 21,6 a 29,6 t ha-1 e a de repolho de 40,5 a 46,4 t ha-1. O aumento observado na produtividade de brócolis e de repolho foi linear e o efeito das doses de boro na produtividade de couve-flor foi quadrático, sendo necessários 5,1 kg ha-1 de B para atingir a produtividade máxima de 30 t ha-1. Brócolis e repolho mostraram-se menos sensíveis do que a couve-flor tanto à deficiência quanto ao excesso de boro. No caso da couve-flor, com a aplicação de 2 kg ha-1 ou de 6 kg ha-1 de B houve significativa perda de qualidade do produto.The effects of boron fertilization on yield of broccoli, cauliflower and cabbage were evaluated through a field experiment carried out on a sandy soil low in available boron. Five boron levels (0; 2; 4; 6; and 8 kg ha-1 B as borax were applied in broccoli, cauliflower and cabbage using a factorial scheme and a randomized block design with three replicates. Organic manure and chemical fertilizers, including borax, were applied in the planting furrow before seedlings transplant and plants were harvested 63 to 93 days after planting date. The yield intervals obtained with broccoli, cauliflower and cabbage varied according to the following intervals: 16.9 to 20.5 t ha-1, 21.6 to 29.6 t ha-1 and 40.5 to 46.3 t ha-1, respectively. The increase in production observed in broccoli and cabbage yield was linear with boron levels and the

  8. Bulk and Rhizosphere Soil Bacterial Communities Studied by Denaturing Gradient Gel Electrophoresis: Plant-Dependent Enrichment and Seasonal Shifts Revealed

    OpenAIRE

    Smalla, K.; Wieland, G.; Buchner, A.; A. Zock; Parzy, J.; Kaiser, S; Roskot, N.; Heuer, H.; Berg, G

    2001-01-01

    The bacterial rhizosphere communities of three host plants of the pathogenic fungus Verticillium dahliae, field-grown strawberry (Fragaria ananassa Duch.), oilseed rape (Brassica napus L.), and potato (Solanum tuberosum L.), were analyzed. We aimed to determine the degree to which the rhizosphere effect is plant dependent and whether this effect would be increased by growing the same crops in two consecutive years. Rhizosphere or soil samples were taken five times over the vegetation periods....

  9. Does boron affect hormone levels of barley cultivars?

    OpenAIRE

    Muavviz Ayvaz; Mesut Koyuncu; Avni Guven; FAGERSTEDT, KURT V.

    2012-01-01

    Background: When mineral nutrients are present in excess or in inadequate amounts, their effects can be severe in plants and can be considered as abiotic stress. In this study, we report how hormonal levels in barley cultivars respond to the toxic effect of boron, an essential plant micronutrient. Material and methods: Two different barley (Hordeum vulgare) cultivars (Vamik Hoca and Efes 98) were used as a study material. Boron was applied in three different concentrations (0, 10, 20 ppm) ...

  10. Colorimetric determination of Boron-10 in macromolecular delivery agents

    International Nuclear Information System (INIS)

    A polyglycerol with dendritic structure (PGLD) was synthesized by the ring opening polymerization of deprotonated glycidol using a polyglycerol as core functionality in a step-growth process denominated divergent synthesis. After PGLD reaction with 10B-enriched boric acid there was a marked increase in the bulk viscosity of the PGLD dendrimer evidencing the polyester formation. Gel permeation chromatography (GPC) analysis was used to characterize the molecular weight and the polydispersivity of the synthesized PGLD dendrimer. A dendritic polyglycerol structure with Mn value of 16.7 kDa and a narrow polydispersivity (Mw/Mn = 1.05) was obtained in this work. 1H-NMR and 13C-NMR measurements were employed to assess the degree of branching (DB) in PGLD. The DB of 0.85 indicates the tendency of a dentritic structure for the PGLD synthesized in this work. The boron-10 concentration was dependent of the PGLD generation. A selective reagent, curcumine, was studied for spectrophotometric determination of boron in polyglycerol dendrimers. Boron reacts with curcumine to form a complex, which has a maximum absorption peak at 552 nm. Under the optimal conditions, Beer's law was obeyed over the range 0∼20 μg of boron in 25 mL of solution. The biological assays indicate the PGLD-B with boron-10 concentration of 25 mg10B/gPGLD as the most promising macromolecule enriched with boron-10 for the BNCT therapy. (author)

  11. Uranium enrichment. 1980 annual report

    International Nuclear Information System (INIS)

    This report contains data and related information on the production of enriched uranium at the gaseous diffusion plants and an update on the construction and project control center for the gas centrifuge plant. Power usage at the gaseous diffusion plants is illustrated. The report contains several glossy color pictures of the plants and processes described. In addition to gaseous diffusion and the centrifuge process, three advanced isotope separation process are now being developed. The business operation of the enrichment plants is described; charts on revenue, balance sheets, and income statements are included

  12. Effect of boron fertilization of apple trees (Malus domestica Borth. on yield and fruit quality

    Directory of Open Access Journals (Sweden)

    Paweł Wójcik

    2013-12-01

    Full Text Available Aim of this work was to examine effect of boron fertilization on yield of apple trees and fruit quality. The experiment was carried out during 1994-1996 in Dąbrowice Experimental Orchard belonging to Research Institute of Pomology and Floriculture in Skiemiewice, on Š a m p i o n cultivar, grafted on M26 rootstock. Trees were planted in the autumn of 1991 at the distance 4 x 2,5 m, on sandy-loam soil. Before starting and during carrying out the study there were not visual symptoms of boron deficiency. In the experiment applied boron fertilization to the soil at the dose 2 g B per tree or three times boron sprays before or after bloom at the dose 0,67 g B per tree. Apple trees without any boron fertilization were served as a control. Results of experiment showed that only boron sprays after bloom increased fruit set and yield. There were no significant differences between treatments in fruit maturity at harvest, fruit weight losses dunng storage, apple number infected by Penicillium, Monilina and Botrytis cinerea. Boron sprays after bloom increased firmness of apples after storage and decreased sensibility to bitter pit, internal breakdown and Gloeosporium-rot. All boron treatments increased boron concentration in apples in comparison with control ones. However, the highest increase of boron concentration in apples was observed when boron sprays were done after bloom and soil boron application. Only boron sprays applied after bloom increased calcium concentration in apples.

  13. Determination of boron and silicon in boron carbide

    International Nuclear Information System (INIS)

    A sodium carbonate fusion technique for the dissolution of boron carbide followed by the determination of boron by alkalimetric titration and silicon impurity by spectrophotometry is described. The elemental boron content in the commercially available boron carbide ranged from 77.2 to 77.60 % and the silicon in the range 1170 to 2500 ppm. (author)

  14. Enrichment and Broad Representation of Plant Biomass-Degrading Enzymes in the Specialized Hyphal Swellings of Leucoagaricus gongylophorus, the Fungal Symbiont of Leaf-Cutter Ants

    Energy Technology Data Exchange (ETDEWEB)

    Aylward, Frank O.; Khadempour, Lily; Tremmel, Daniel; McDonald, Bradon R.; Nicora, Carrie D.; Wu, Si; Moore, Ronald J.; Orton, Daniel J.; Monroe, Matthew E.; Piehowski, Paul D.; Purvine, Samuel O.; Smith, Richard D.; Lipton, Mary S.; Burnum-Johnson, Kristin E.; Currie, Cameron R.

    2015-08-28

    Leaf-cutter ants are prolific and conspicuous Neotropical herbivores that derive energy from specialized fungus gardens they cultivate using foliar biomass. The basidiomycetous cultivar of the ants, Leucoagaricus gongylophorus, produces specialized hyphal swellings called gongylidia that serve as the primary food source of ant colonies. Gongylidia also contain lignocellulases that become concentrated in ant digestive tracts and are deposited within fecal droplets onto fresh foliar material as it is foraged by the ants. Although the enzymes concentrated by L. gongylophorus within gongylidia are thought to be critical to the initial degradation of plant biomass, only a few enzymes present in these hyphal swellings have been identified. Here we use proteomic methods to identify proteins present in the gongylidia of three Atta cephalotes colonies. Our results demonstrate that a diverse but consistent set of enzymes is present in gongylidia, including numerous lignocellulases likely involved in the degradation of polysaccharides, plant toxins, and proteins. Overall, gongylidia contained over three-quarters of all lignocellulases identified in the L. gongylophorus genome, demonstrating that the majority of the enzymes produced by this fungus for biomass breakdown are ingested by the ants. We also identify a set of 23 lignocellulases enriched in gongylidia compared to whole fungus garden samples, suggesting that certain enzymes may be particularly important in the initial degradation of foliar material. Our work sheds light on the complex interplay between leaf-cutter ants and their fungal symbiont that allows for the host insects to occupy an herbivorous niche by indirectly deriving energy from plant biomass.

  15. Field test of short-notice random inspections for inventory-change verification at a low-enriched-uranium fuel-fabrication plant

    International Nuclear Information System (INIS)

    An approach of short-notice random inspections (SNRIs) for inventory-change verification can enhance the effectiveness and efficiency of international safeguards at natural or low-enriched uranium (LEU) fuel fabrication plants. According to this approach, the plant operator declares the contents of nuclear material items before knowing if an inspection will occur to verify them. Additionally, items about which declarations are newly made should remain available for verification for an agreed time. Then a statistical inference can be made from verification results for items verified during SNRIs to the entire populations, i.e. the entire strata, even if inspectors were not present when many items were received or produced. A six-month field test of the feasibility of such SNRIs took place at the Westinghouse Electric Corporation Commercial Nuclear Fuel Division during 1993. Westinghouse personnel made daily declarations about both feed and product items, uranium hexafluoride cylinders and finished fuel assemblies, using a custom-designed computer ''mailbox''. Safeguards inspectors from the IAEA conducted eight SNRIs to verify these declarations. They arrived unannounced at the plant, in most cases immediately after travel from Canada, where the IAEA maintains a regional office. Items from both strata were verified during the SNRIs by meant of nondestructive assay equipment

  16. Plant growth-promoting rhizobacteria strain Bacillus amyloliquefaciens NJN-6-enriched bio-organic fertilizer suppressed Fusarium wilt and promoted the growth of banana plants.

    Science.gov (United States)

    Yuan, Jun; Ruan, Yunze; Wang, Beibei; Zhang, Jian; Waseem, Raza; Huang, Qiwei; Shen, Qirong

    2013-04-24

    Bacillus amyloliquefaciens strain NJN-6 is an important plant growth-promoting rhizobacteria (PGPR) which can produce secondary metabolites antagonistic to several soil-borne pathogens. In this study, the ability of a bio-organic fertilizer (BIO) containing NJN-6 strain to promote the growth and suppress Fusarium wilt of banana plants was evaluated in a pot experiment. The results showed that the application of BIO significantly decreased the incidence of Fusarium wilt and promoted the growth of banana plants compared to that for the organic fertilizer (OF). To determine the beneficial mechanism of the strain, the colonization of NJN-6 strain on banana roots was evaluated using scanning electron microscopy (SEM). The plant growth-promoting hormones indole-3-acetic acid (IAA) and gibberellin A3 (GA3), along with antifungal lipopeptides iturin A, were detected when the NJN-6 strain was incubated in both Landy medium with additional l-tryptophan and in root exudates of banana plants. In addition, some antifungal volatile organic compounds and iturin A were also detected in BIO. In summary, strain NJN-6 could colonize the roots of banana plants after the application of BIO and produced active compounds which were beneficial for the growth of banana plants. PMID:23541032

  17. Bulk and rhizosphere soil bacterial communities studied by denaturing gradient gel electrophoresis: plant-dependent enrichment and seasonal shifts revealed.

    Science.gov (United States)

    Smalla, K; Wieland, G; Buchner, A; Zock, A; Parzy, J; Kaiser, S; Roskot, N; Heuer, H; Berg, G

    2001-10-01

    The bacterial rhizosphere communities of three host plants of the pathogenic fungus Verticillium dahliae, field-grown strawberry (Fragaria ananassa Duch.), oilseed rape (Brassica napus L.), and potato (Solanum tuberosum L.), were analyzed. We aimed to determine the degree to which the rhizosphere effect is plant dependent and whether this effect would be increased by growing the same crops in two consecutive years. Rhizosphere or soil samples were taken five times over the vegetation periods. To allow a cultivation-independent analysis, total community DNA was extracted from the microbial pellet recovered from root or soil samples. 16S rDNA fragments amplified by PCR from soil or rhizosphere bacterium DNA were analyzed by denaturing gradient gel electrophoresis (DGGE). The DGGE fingerprints showed plant-dependent shifts in the relative abundance of bacterial populations in the rhizosphere which became more pronounced in the second year. DGGE patterns of oilseed rape and potato rhizosphere communities were more similar to each other than to the strawberry patterns. In both years seasonal shifts in the abundance and composition of the bacterial rhizosphere populations were observed. Independent of the plant species, the patterns of the first sampling times for both years were characterized by the absence of some of the bands which became dominant at the following sampling times. Bacillus megaterium and Arthrobacter sp. were found as predominant populations in bulk soils. Sequencing of dominant bands excised from the rhizosphere patterns revealed that 6 out of 10 bands resembled gram-positive bacteria. Nocardia populations were identified as strawberry-specific bands. PMID:11571180

  18. PWR core response to boron dilution transient

    International Nuclear Information System (INIS)

    This paper illustrates the steps followed in order to set up a tool (composed of a plant model and of a procedure) that allows accounting for boron reactivity feedbacks during plant transients. The procedure that has been developed allows to find out the values of the boron feedback coefficients, given the differential boron worth, and to properly initialize the Thermal Hydraulic and the Neutronic (TH/NEU) system. Once the tool has been developed, it has been used to analyze different scenarios, resulting from deborated water injection from the reactor make-up system. The most important parameter, during this Reactivity Insertion Accidents (RIAs), is the Energy Released to the Fuel (ERF) and it has been monitored, in order to identify the situations when the fuel might be damaged (ERF > 250 kJ/kg, for high burnup fuel). The analyses have been performed using the RELAP5-3D computer code. The conclusion of the study is that the limited capability of modeling mixing phenomena provided by most common plant codes (such as RELAP5-3D) is not suitable to perform BE analyses of RIAs, since those accidents are so sensitive to boron concentration changes that the effect of uncertainties cannot be neglected. The use of Computational Fluid Dynamics (CFD) codes could reduce uncertainties enough to perform BE analyses and thus it should be recommended. (author)

  19. First boronization in KSTAR

    Energy Technology Data Exchange (ETDEWEB)

    Hong, S.H., E-mail: sukhhong@nfri.re.kr [National Fusion Research Institute, 113 Gwahangno, Yusung-Gu, Daejeon 305-333 (Korea, Republic of); Center for Edge Plasma Science (cEps), Hanyang University, Seoul 133-791 (Korea, Republic of); Lee, K.S.; Kim, K.M.; Kim, H.T.; Kim, G.P. [National Fusion Research Institute, 113 Gwahangno, Yusung-Gu, Daejeon 305-333 (Korea, Republic of); Sun, J.H.; Woo, H.J. [Department of Electrical Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Center for Edge Plasma Science (cEps), Hanyang University, Seoul 133-791 (Korea, Republic of); Park, J.M.; Kim, W.C.; Kim, H.K.; Park, K.R.; Yang, H.L.; Na, H.K. [National Fusion Research Institute, 113 Gwahangno, Yusung-Gu, Daejeon 305-333 (Korea, Republic of); Chung, K.S. [Department of Electrical Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Center for Edge Plasma Science (cEps), Hanyang University, Seoul 133-791 (Korea, Republic of)

    2010-11-15

    First boronization in KSTAR is reported. KSTAR boronization system is based on a carborane (C{sub 2}B{sub 10}H{sub 12}) injection system. The design, construction, and test of the system are accomplished and it is tested by using a small vacuum vessel before it is mounted to a KSTAR port. After the boronization in KSTAR, impurity levels are significantly reduced by factor of 3 (oxygen) and by 10 (carbon). Characteristics of a-C/B:H thin films deposited by carborane vapor are investigated. Re-condensation of carborane vapor during the test phase has been reported.

  20. Tracing fly ash emitted from a coal-fired power plant with enriched rare-earth isotopes: an urban scale test

    International Nuclear Information System (INIS)

    Artificially enriched isotopes of neodymium (Nd) were released from a 100 MW(e) coal-fired power plant at rates ranging from 40 to 61 mg h-1 in an experiment designed to test a new intentional particulate tracer technique. During each release, ambient samples of airborne particles with diameters o arc 20 km from the plant on 47-mm diameter Teflon filters operated at nominal flow rates of 130 ι min-1. Samples collected when estimates of the meteorological dispersion parameter, X/Q, ranged from 0.3 x 10-10 to 350 x 10-10 s m-3, were analysed for total Nd mass and excess 148Nd, the tracer isotope, by thermal-ionization mass spectrometry. Measured concentrations were in good agreement with predictions of ambient tracer concentrations made with a Gaussian plume model in which lateral and vertical plume dispersion parameters were derived from the standard deviation of the horizontal wind direction. The observed tracer concentrations correspond to signal-to-noise ratios (S:N) of 150-450. The concentration of 148Nd measured in particles < 0.65 μm in diameter corresponds to an S:N in excess of 4500. (Author)

  1. AEC determines uranium enrichment policy

    International Nuclear Information System (INIS)

    The Advisory Committee on Uranium Enrichment of the Atomic Energy Commission (AEC) has submitted a report to AEC chairman concerning the promotion of the introduction of advanced material, high performance centrifuges to replace conventional metallic drum centrifuges, and the development of next generation advanced centrifuges. The report also called for the postponement until around 1997 of the decision whether the development should be continued or not on atomic vapor laser isotope separation (AVLIS) and molecular laser isotope separation (MLIS) processes, as well as the virtual freezing of the construction of a chemical process demonstration plant. The report was approved by the AEC chairman in August. The uranium enrichment service market in the world will continue to be characterized by oversupply. The domestic situation of uranium enrichment supply-demand trend, progress of the expansion of Rokkasho enrichment plant, the trend in the development of gas centrifuge process and the basic philosophy of commercializing domestic uranium enrichment are reported. (K.I.)

  2. Job Enrichment

    Science.gov (United States)

    Sanders, Rick

    1970-01-01

    Job enrichment means giving people more decision-making power, more responsibility, more grasp of the totality of the job, and a sense of their own importance in the company. This article presents evidence of the successful working of this approach (Donnelly Mirrors), and the lack of success with an opposing approach (General Motors). (NL)

  3. Enrichment of AOB and NOB Population by Applying a BABE Reactor in an Activated Sludge Pilot Plant.

    Science.gov (United States)

    Gatti, Marcela N; Giménez, Juan B; Carretero, Laura; Ruano, María V; Borrás, Luis; Serralta, Joaquín; Seco, Aurora

    2015-04-01

    This paper deals with the effect of a bioaugmentation batch enhanced (BABE) reactor implementation in a biological nutrient removal pilot plant on the populations of ammonia-oxidizing bacteria (AOB) and nitrite-oxidizing bacteria (NOB). The results of fluorescence in situ hybridization (FISH) technique showed that AOB and NOB populations were significantly enhanced, from 4 to 8% and from 2 to 9%, respectively, as a result of the BABE reactor implementation. Regarding AOB, the percentage of Nitrosomonas oligotropha was mainly increased (3 to 6%). Regarding NOB, Nitrospirae spp was greatly enhanced (1 to 7%). Both species are considered K-strategist (high affinity to the substrate, low maximum growth rates) and they usually predominate in reactors with low ammonium and nitrite concentrations, respectively. PMID:26462081

  4. Efeitos da aplicação de bórax em cultura de batatinha, em várzea irrigada, no Vale do Paraíba Effects of addition of boron on potato plant production

    Directory of Open Access Journals (Sweden)

    Norberto Leite

    1970-01-01

    Full Text Available São relatados os efeitos produzidos pela aplicação de bórax na cultura da batatinha (Solatium tuberosum L., em solos de várzea irrigada do Vale do Paraíba. Quatro doses de bórax - 10, 20, 30 e 40 kg/ha - foram aplicadas de três maneiras distintas: no sulco de plantio, em cobertura (vinte dias após a germinação e parceladamente em 4 pulverizações foliares semanais. As melhores doses de bórax foram as de 10 e 20 kg/ha, aplicadas no sulco de plantio, em mistura com os demais adubos. As aplicações em pulverização provocaram sintomas de toxidez nas folhas, notadamente as de maiores doses.The production of potato plants (Solatium tuberosum L. grown in alluvial soils of the Rio Paraíba Valey in the State of São Paulo, is not always correlated with high N-P-K fertilization. This has been reported to be due to boron deficiency in these soils. The effect of addition of boron at different rates (10, 20, 30 and 40 kg of borax / ha applied in mixture with common NPK formulation in the furrow at planting time, as side dressing or by spraying, was studied in an area where symptoms of deficiency was observed in Aquila potato variety, in the previous year. An increase in the production of about 20 % was obtained with the addition of 10 or 20 kg of borax / ha in mixtures with NPK fertilizing formulation but not with the two higher doses. The same amount of borax applied by spraying also increased yield but at a lesser extent and the side dressing technique was less effective than the other two methods of application of borax.

  5. Mathematical modeling based evaluation and simulation of boron removal in bioelectrochemical systems.

    Science.gov (United States)

    Ping, Qingyun; Abu-Reesh, Ibrahim M; He, Zhen

    2016-11-01

    Boron removal is an arising issue in desalination plants due to boron's toxicity. As an emerging treatment concept, bioelectrochemical systems (BES) can achieve potentially cost-effective boron removal by taking advantage of cathodic-produced alkali. Prior studies have demonstrated successful removal of boron in microbial desalination cells (MDCs) and microbial fuel cells (MFCs), both of which are representative BES. Herein, mathematical models were developed to further evaluate boron removal by different BES and understand the key operating factors. The models delivered very good prediction of the boron concentration in the MDC integrated with Donnan Dialysis (DD) system with the lowest relative root-mean-square error (RMSE) of 0.00%; the predication of the MFC performance generated the highest RMSE of 18.55%. The model results of salt concentration, solution pH, and current generation were well fitted with experimental data for RMSE values mostly below 10%. The long term simulation of the MDC-DD system suggests that the accumulation of salt in the catholyte/stripping solution could have a positive impact on the removal of boron due to osmosis-driven convection. The current generation in the MDC may have little influence on the boron removal, while in the MFC the current-driven electromigration can contribute up to 40% of boron removal. Osmosis-induced convection transport of boron could be the major driving force for boron removal to a low level 22.2 in order to avoid boron accumulation in the anolyte effluent. PMID:27387806

  6. Safety assessment of boron in aquatic and terrestrial environments.

    Science.gov (United States)

    Butterwick, L; de Oude, N; Raymond, K

    1989-06-01

    Boron is a naturally occurring material and is used in industrial and domestic products. Its major release into the environment is through weathering processes and wastewater discharge. Boron is an essential nutrient for plants, but can above certain concentrations be toxic to aquatic and terrestrial organisms. This paper assesses the ecotoxicology and environmental safety of boron. It draws together the data for toxicological effects of boron and compares these with environmental concentrations of boron, measured in Europe and the U.S.A. Generally, environmental concentrations of boron found in surface water are below levels identified as toxic to aquatic organisms. Concentrations high enough to produce toxic effects in laboratory tests are found in areas where weathering of boron-rich formations and deposits occurs, such as in the southwestern United States. However, reproducing populations of the most sensitive species, rainbow trout, have been observed in surface waters in these regions, indicating no cause for concern. The prime concern for effects on terrestrial plants centers on the use of irrigation water with elevated levels of boron. At present, there is no evidence of widespread damage to crops resulting from this practice. In some areas, wastewater is used for irrigation and crops grown under these conditions are generally confined to those relatively insensitive to boron toxicity. Good irrigation practices will be necessary, however, in arid regions with high evapotranspiration rates and care will be needed when using wastewater, particularly in areas with naturally high boron levels. It is not anticipated that there will be any significant increase in the discharge of boron to the environment in the foreseeable future. The use of boron-containing products is expected to increase, but glass will remain the dominant market and the use of boron in detergents in Europe is expected to decrease due to the introduction of bleach activators and liquid

  7. Synchronization of cytoplasmic and transferred mitochondrial ribosomal protein gene expression in land plants is linked to Telo-box motif enrichment

    Directory of Open Access Journals (Sweden)

    Zhu Xin-Guang

    2011-06-01

    Full Text Available Abstract Background Chloroplasts and mitochondria evolved from the endosymbionts of once free-living eubacteria, and they transferred most of their genes to the host nuclear genome during evolution. The mechanisms used by plants to coordinate the expression of such transferred genes, as well as other genes in the host nuclear genome, are still poorly understood. Results In this paper, we use nuclear-encoded chloroplast (cpRPGs, as well as mitochondrial (mtRPGs and cytoplasmic (euRPGs ribosomal protein genes to study the coordination of gene expression between organelles and the host. Results show that the mtRPGs, but not the cpRPGs, exhibit strongly synchronized expression with euRPGs in all investigated land plants and that this phenomenon is linked to the presence of a telo-box DNA motif in the promoter regions of mtRPGs and euRPGs. This motif is also enriched in the promoter regions of genes involved in DNA replication. Sequence analysis further indicates that mtRPGs, in contrast to cpRPGs, acquired telo-box from the host nuclear genome. Conclusions Based on our results, we propose a model of plant nuclear genome evolution where coordination of activities in mitochondria and chloroplast and other cellular functions, including cell cycle, might have served as a strong selection pressure for the differential acquisition of telo-box between mtRPGs and cpRPGs. This research also highlights the significance of physiological needs in shaping transcriptional regulatory evolution.

  8. Soil and water warming accelerates phenology and down-regulation of leaf photosynthesis of rice plants grown under free-air CO2 enrichment (FACE).

    Science.gov (United States)

    Adachi, Minaco; Hasegawa, Toshihiro; Fukayama, Hiroshi; Tokida, Takeshi; Sakai, Hidemitsu; Matsunami, Toshinori; Nakamura, Hirofumi; Sameshima, Ryoji; Okada, Masumi

    2014-02-01

    To enable prediction of future rice production in a changing climate, we need to understand the interactive effects of temperature and elevated [CO2] (E[CO2]). We therefore examined if the effect of E[CO2] on the light-saturated leaf photosynthetic rate (Asat) was affected by soil and water temperature (NT, normal; ET, elevated) under open-field conditions at the rice free-air CO2 enrichment (FACE) facility in Shizukuishi, Japan, in 2007 and 2008. Season-long E[CO2] (+200 µmol mol(-1)) increased Asat by 26%, when averaged over two years, temperature regimes and growth stages. The effect of ET (+2°C) on Asat was not significant at active tillering and heading, but became negative and significant at mid-grain filling; Asat in E[CO2]-ET was higher than in ambient [CO2] (A[CO2])-NT by only 4%. Photosynthetic down-regulation at E[CO2] also became apparent at mid-grain filling; Asat compared at the same [CO2] in the leaf cuvette was significantly lower in plants grown in E[CO2] than in those grown in A[CO2]. The additive effects of E[CO2] and ET decreased Asat by 23% compared with that of A[CO2]-NT plants. Although total crop nitrogen (N) uptake was increased by ET, N allocation to the leaves and to Rubisco was reduced under ET and E[CO2] at mid-grain filling, which resulted in a significant decrease (32%) in the maximum rate of ribulose-1,5-bisphosphate carboxylation on a leaf area basis. Because the change in N allocation was associated with the accelerated phenology in E[CO2]-ET plants, we conclude that soil and water warming accelerates photosynthetic down-regulation at E[CO2]. PMID:24406632

  9. Boron in sillimanite.

    Science.gov (United States)

    Grew, E S; Hinthorne, J R

    1983-08-01

    Sillimanite in six granulite-facies, kornerupine-bearing rocks contains 0.035 to 0.43 percent B(2)O(3) and 0.02 to 0.23 percent MgO (by weight). Substitution of boron for silicon and magnesium for aluminum is coupled such that the ratio of magnesium to boron is about 0.5. Sillimanite incorporates more than 0.1 percent B(2)O(3) only at high temperatures in a boron-rich environment at very low partial pressures of water. In the amphibolite facies, the sillimanite boron contents are too low to appreciably affect the stability relations of sillimanite with kyanite and andalusite. PMID:17830955

  10. Enrichment: Dealing with overcapacity

    International Nuclear Information System (INIS)

    Today's surplus of enrichment capacity will continue until at least the end of this century. This will challenge the ingenuity of the separative work unit (SWU) suppliers as they attempt to keep market share and remain profitable in a very competitive marketplace. The utilities will be faced with attractive choices, but making the best choice will require careful analysis and increased attention to market factors. Current demand projections will probably prove too high to the extent that more reactors are canceled or delayed. The DOE has the vast majority of the unused capacity, so it will feel the most immediate impact of this large surplus in productive capacity. The DOE has responded to these market challenges by planning another reorganization of its enriching operations. Without a major agreement among the governments affected by the current surplus in enrichment capacity, the future will see lower prices, more competitive terms, and the gradual substitution of centrifuge or laser enrichment for the gaseous diffusion plants. The competition that is forcing the gaseous diffusion prices down to marginal cost will provide the long-term price basis for the enrichment industry

  11. Boron Removal in Seawater Reverse Osmosis System

    KAUST Repository

    Rahmawati, Karina

    2011-07-01

    Reverse osmosis successfully proves to remove more than 99% of solute in seawater, providing fresh water supply with satisfied quality. Due to some operational constraints, however, some trace contaminants removal, such as boron, cannot be achieved in one pass system. The stringent criterion for boron from World Health Organization (WHO) and Saudi Arabia local standard (0.5 mg/l) is hardly fulfilled by single pass sea water reverse osmosis (SWRO) plants. Some design processes have been proposed to deal with boron removal, but they are not economically efficient due to high energy and chemical consumption. The objective of this study was to study boron removal by different reverse osmosis membranes in two pH conditions, with and without antiscalant addition. Thus, it was expected to observe the possibility of operating single pass system and necessity to operate two pass system using low energy membrane. Five membrane samples were obtained from two different manufacturers. Three types of feed water pH were used, pH 8, pH 10, and pH 10 with antiscalant addition. Experiment was conducted in parallel to compare membrane performance from two manufacturers. Filtration was run with fully recycle mode for three days. Sample of permeate and feed were taken every 12 hours, and analyzed for their boron and TDS concentration. Membrane samples were also tested for their surface charge. The results showed that boron rejection increases as the feed pH increases. This was caused by dissociation of boric acid to negatively charged borate ion and more negatively charged membrane surface at elevated pH which enhance boron rejection. This study found that single pass reverse osmosis system, with and without elevating the pH, may not be possible to be applied because of two reasons. First, permeate quality in term of boron, does not fulfill WHO and local Saudi Arabia regulations. Second, severe scaling occurs due to operation in alkaline condition, since Ca and Mg concentration are

  12. Boron nitride composites

    Energy Technology Data Exchange (ETDEWEB)

    Kuntz, Joshua D.; Ellsworth, German F.; Swenson, Fritz J.; Allen, Patrick G.

    2016-02-16

    According to one embodiment, a composite product includes hexagonal boron nitride (hBN), and a plurality of cubic boron nitride (cBN) particles, wherein the plurality of cBN particles are dispersed in a matrix of the hBN. According to another embodiment, a composite product includes a plurality of cBN particles, and one or more borate-containing binders.

  13. Nonindigenous Plant Advantage in Native and Exotic Australian Grasses under Experimental Drought, Warming, and Atmospheric CO2 Enrichment

    Directory of Open Access Journals (Sweden)

    Brendan J. Lepschi

    2013-03-01

    Full Text Available A general prediction of ecological theory is that climate change will favor invasive nonindigenous plant species (NIPS over native species. However, the relative fitness advantage enjoyed by NIPS is often affected by resource limitation and potentially by extreme climatic events such as drought. Genetic constraints may also limit the ability of NIPS to adapt to changing climatic conditions. In this study, we investigated evidence for potential NIPS advantage under climate change in two sympatric perennial stipoid grasses from southeast Australia, the NIPS Nassella neesiana and the native Austrostipa bigeniculata. We compared the growth and reproduction of both species under current and year 2050 drought, temperature and CO2 regimes in a multifactor outdoor climate simulation experiment, hypothesizing that NIPS advantage would be higher under more favorable growing conditions. We also compared the quantitative variation and heritability of growth traits in populations of both species collected along a 200 km climatic transect. In contrast to our hypothesis we found that the NIPS N. neesiana was less responsive than A. bigeniculata to winter warming but maintained higher reproductive output during spring drought. However, overall tussock expansion was far more rapid in N. neesiana, and so it maintained an overall fitness advantage over A. bigeniculata in all climate regimes. N. neesiana also exhibited similar or lower quantitative variation and growth trait heritability than A. bigeniculata within populations but greater variability among populations, probably reflecting a complex past introduction history. We found some evidence that additional spring warmth increases the impact of drought on reproduction but not that elevated atmospheric CO2 ameliorates drought severity. Overall, we conclude that NIPS advantage under climate change may be limited by a lack of responsiveness to key climatic drivers, reduced genetic variability in range

  14. Uranium enrichment

    International Nuclear Information System (INIS)

    This chapter discusses the development of uranium enrichment processes. In the introduction there is a brief history of uranium enrichment, followed by a summary of the criteria used for the assessment of an isotope separation process, e.g. the separation factor, separative power, and the power consumption of a separating element. This is followed by a discussion of the two main processes used, i.e. gaseous diffusion and centrifugation. The reason for the change from diffusion to centrifugation in the UK, mainly on power costs, is discussed. The development potential of centrifuges is also assessed. Other processes which have been developed up to pilot stage are described, e.g. the Becker jet nozzle and the South African process. This is followed by a description of some plasma-based methods. The next topic is concerned with chemical exchange methods and an attempt is made to assess their potential in the enrichment scene from published information. This chapter concludes with a discussion of the advanced laser isotope-separation methods. The two approaches, i.e. the atomic and the molecular routes are discussed again using published information. This information is insufficient to give a complete assessment of the methods, especially the molecular route, but is enough to give indications of their potential

  15. Mass spectral investigations of boron neutron capture therapy (BNCT) agents

    International Nuclear Information System (INIS)

    Boron neutron capture therapy (BNCT) is a promising technique for the treatment of selected types of brain tumor and potentially for other tumor types. In this therapy, a 10B-enriched species is administered to the bloodstream and selectively deposited in the tumor. The selective deposition in the tumor is due to either the breakdown of the blood-grain barrier or to the chemical nature of the boron-containing compounds. Once a sufficient concentration of boron is attained in the tumor (approximately 25 ppm), the tumor is irradiated with a controlled energy neutron beam (preferable epithermal, 1 eV to 10 keV), at which time neutrons are captured by the incorporated boron atoms. The capture results in the reaction, 10B(n, ) Li, which produces a localized nuclear reaction capable of destroying the tumor cell containing the boron. A variety of boron containing compounds have been evaluated for use in BNCT. This paper addresses some of the most promising of the compounds, the disodium salt of mercaptoundecahydrododecaborate (Na2B12H11SH), commonly referred to as BSH

  16. Application of pathways analyses for site performance prediction for the Gas Centrifuge Enrichment Plant and Oak Ridge Central Waste Disposal Facility

    International Nuclear Information System (INIS)

    The suitability of the Gas Centrifuge Enrichment Plant and the Oak Ridge Central Waste Disposal Facility for shallow-land burial of low-level radioactive waste is evaluated using pathways analyses. The analyses rely on conservative scenarios to describe the generation and migration of contamination and the potential human exposure to the waste. Conceptual and numerical models are developed using data from comprehensive laboratory and field investigations and are used to simulate the long-term transport of contamination to man. Conservatism is built into the analyses when assumptions concerning future events have to be made or when uncertainties concerning site or waste characteristics exist. Maximum potential doses to man are calculated and compared to the appropriate standards. The sites are found to provide adequate buffer to persons outside the DOE reservations. Conclusions concerning site capacity and site acceptability are drawn. In reaching these conclusions, some consideration is given to the uncertainties and conservatisms involved in the analyses. Analytical methods to quantitatively assess the probability of future events to occur and the sensitivity of the results to data uncertainty may prove useful in relaxing some of the conservatism built into the analyses. The applicability of such methods to pathways analyses is briefly discussed. 18 refs., 9 figs

  17. Separation of boron isotopes using NMG type anion exchange resin

    International Nuclear Information System (INIS)

    Ion exchange separation of boron isotopes (B-10 and B-11) has been studied by using a special boron selective ion exchange resin; NMG (n-methyl glucamine)-type anion exchange resin. The resin has shown a large isotope separation coefficient of 1.02 at the experimental conditions of temperature, 80degC, and boric acid concentration, 0.2 M (mole/dm3). Enriched B-10 (92%) was obtained after the migration of 1149 m by a recyclic operation of ion exchange columns in a merry-go-round method. (author)

  18. Boronated liposome development and evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Hawthorne, M.F. [Univ. of California, Los Angeles, CA (United States)

    1995-11-01

    The boronated liposome development and evaluation effort consists of two separate tasks. The first is the development of new boron compounds and the synthesis of known boron species with BNCT potential. These compounds are then encapsulated within liposomes for the second task, biodistribution testing in tumor-bearing mice, which examines the potential for the liposomes and their contents to concentrate boron in cancerous tissues.

  19. The Mouthparts Enriched Odorant Binding Protein 11 of the Alfalfa Plant Bug Adelphocoris lineolatus Displays a Preferential Binding Behavior to Host Plant Secondary Metabolites

    Science.gov (United States)

    Sun, Liang; Wei, Yu; Zhang, Dan-Dan; Ma, Xiao-Yu; Xiao, Yong; Zhang, Ya-Nan; Yang, Xian-Ming; Xiao, Qiang; Guo, Yu-Yuan; Zhang, Yong-Jun

    2016-01-01

    Odorant binding proteins (OBPs) are proposed to be directly required for odorant discrimination and represent potential interesting targets for pest control. In the notoriously agricultural pest Adelphocoris lineolatus, our previous functional investigation of highly expressed antennal OBPs clearly supported this viewpoint, whereas the findings of the current study by characterizing of AlinOBP11 rather indicated that OBP in hemipterous plant bugs might fulfill a different and tantalizing physiological role. The phylogenetic analysis uncovered that AlinOBP11 together with several homologous bug OBP proteins are potential orthologs, implying they could exhibit a conserved function. Next, the results of expression profiles solidly showed that AlinOBP11 was predominantly expressed at adult mouthparts, the most important gustatory organ of Hemiptera mirid bug. Finally, a rigorously selective binding profile was observed in the fluorescence competitive binding assay, in which recombinant AlinOBP11 displayed much stronger binding abilities to non-volatile secondary metabolite compounds than the volatile odorants. These results reflect that AlinOBP11, even its orthologous proteins across bug species, could be associated with a distinctively conserved physiological role such as a crucial carrier for non-volatiles host secondary metabolites in gustatory system. PMID:27313540

  20. The Mouthparts Enriched Odorant Binding Protein 11 of the Alfalfa Plant Bug Adelphocoris lineolatus Displays a Preferential Binding Behavior to Host Plant Secondary Metabolites.

    Science.gov (United States)

    Sun, Liang; Wei, Yu; Zhang, Dan-Dan; Ma, Xiao-Yu; Xiao, Yong; Zhang, Ya-Nan; Yang, Xian-Ming; Xiao, Qiang; Guo, Yu-Yuan; Zhang, Yong-Jun

    2016-01-01

    Odorant binding proteins (OBPs) are proposed to be directly required for odorant discrimination and represent potential interesting targets for pest control. In the notoriously agricultural pest Adelphocoris lineolatus, our previous functional investigation of highly expressed antennal OBPs clearly supported this viewpoint, whereas the findings of the current study by characterizing of AlinOBP11 rather indicated that OBP in hemipterous plant bugs might fulfill a different and tantalizing physiological role. The phylogenetic analysis uncovered that AlinOBP11 together with several homologous bug OBP proteins are potential orthologs, implying they could exhibit a conserved function. Next, the results of expression profiles solidly showed that AlinOBP11 was predominantly expressed at adult mouthparts, the most important gustatory organ of Hemiptera mirid bug. Finally, a rigorously selective binding profile was observed in the fluorescence competitive binding assay, in which recombinant AlinOBP11 displayed much stronger binding abilities to non-volatile secondary metabolite compounds than the volatile odorants. These results reflect that AlinOBP11, even its orthologous proteins across bug species, could be associated with a distinctively conserved physiological role such as a crucial carrier for non-volatiles host secondary metabolites in gustatory system. PMID:27313540

  1. A feasibility study for the application of enriched gadolinia burnable absorber rods in nuclear core design

    International Nuclear Information System (INIS)

    An analysis model using MICBURN-3/CASMO-3 is established for the enriched gadolinia burnable absorber rods. A homogenized cross section editing code, PROLOG, is modified so that it can handle such a fuel assembly that includes two different types of gadolinia rods. Study shows that Gd-155 and Gd-157 are almost same in suppressing the excess reactivity and it is recommended to enrich both odd number isotopes, Gd-155 and Gd-157. It is estimated that the cycle length increases by 2 days if enriched gadolinia rods are used in the commercial nuclear power plant such as YGN-3 of which the cycle length is assumed 2 years. For the advanced integral reactor SMART in which ultra long cycle length and soluble boron-free operation concept is applied, natural gadolinia burnable absorber rods fail to control the excess reactivity. On the other hand, enriched gadolinia rods are successful in controling the excess reactivity. To minimize power peakings, various placements of gadolinia rods are tested. Also initial reactivity holddown and gadolinia burnout time are parametrized with respect to the number of gadolinia rods and gadolinia weight fractions

  2. Magnetron sputter deposition of boron and boron carbide

    International Nuclear Information System (INIS)

    The fabrication of X-ray optical coatings with greater reflectivity required the development of sputter deposition processes for boron and boron carbide. The use of high density boron and boron carbide (B4C) and a vacuum-brazed target design was required to achieve the required sputter process stability and resistance to the thermal stress created by high rate sputtering. Our results include a description of the target fabrication procedures and sputter process parameters necessary to fabricate B4C and boron modulated thin film structures. (orig.)

  3. Standard specification for boron-Based neutron absorbing material systems for use in nuclear spent fuel storage racks

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2011-01-01

    1.1 This specification defines criteria for boron-based neutron absorbing material systems used in racks in a pool environment for storage of nuclear light water reactor (LWR) spent-fuel assemblies or disassembled components to maintain sub-criticality in the storage rack system. 1.2 Boron-based neutron absorbing material systems normally consist of metallic boron or a chemical compound containing boron (for example, boron carbide, B4C) supported by a matrix of aluminum, steel, or other materials. 1.3 In a boron-based absorber, neutron absorption occurs primarily by the boron-10 isotope that is present in natural boron to the extent of 18.3 ± 0.2 % by weight (depending upon the geological origin of the boron). Boron, enriched in boron-10 could also be used. 1.4 The materials systems described herein shall be functional – that is always be capable to maintain a B10 areal density such that subcriticality Keff <0.95 or Keff <0.98 or Keff < 1.0 depending on the design specification for the service...

  4. Uranium enrichment technologies

    International Nuclear Information System (INIS)

    Several technically mature and commercially proven methods of separation are currently available on the enrichment market, such as the diffusion and centrifuge methods. According to the information available, the diffusion technologies, which have dominated the scene so far, will lose much of their influence in favor of the centrifuge technologies which, because of their special process characteristics, such as lower energy consumption and smaller economic plant sizes, can adapt themselves to the conditions of the market in a flexible and economic way. Other methods, such as the gas dynamics Helikon and separation nozzle techniques, and chemical enrichment are on the verge of commercial maturity. However, their economic performance and chances in the enrichment market cannot yet be assessed with any degree of precision. The prospects and possibilities of the laser method, which has received much backing recently, especially in the USA, are difficult to weigh in the light of the knowledge available to date. However, it is hardly to be expected that technically mature and commercially viable plants operating by this technology are going to be available before the turn of the century. (orig.)

  5. Long-term outlook for global natural uranium and uranium enrichment supply and demand situations after the impact of Fukushima Daiichi Nuclear Power Plant accident

    International Nuclear Information System (INIS)

    In this paper, the authors propose long-term projections of global nuclear power generation, uranium production, and uranium enrichment capacities by region, and estimate the trade flows of natural uranium and uranium enrichment activities in 2020 and 2035. In spite of the rapid nuclear power generation capacity growth expected especially in Asia, the natural uranium and uranium enrichment trade will not be tightened by 2020 due to the projected increase in both natural uranium production and uranium enrichment capacities, which may cause a drop in natural uranium and uranium enrichment prices. Thus, there is a great possibility that the current projects for capacity expansion will be delayed considerably. However, in the 'high-demand scenario', where nuclear expansion will be accelerated due to growing concerns about global warming and energy security issues, additional investments in uranium production and enrichment facilities will be needed by 2035. In Asia, the self-sufficiency ratio for both natural uranium supply and uranium enrichment activities will remain relatively low until 2035. However, the Herfindahl-Hirschman (HH) index of natural uranium and uranium enrichment activity trade to Asia will be lowered considerably up to 2035, indicating that nuclear capacity expansion can contribute to enhancing energy security in Asia. (author)

  6. Boron isotope separation by ion exchange chromatography using weakly basic anion exchange resin

    International Nuclear Information System (INIS)

    Isotopic plateau displacement chromatography, a useful method for isotope separation is presented. The boric acid band formed in a column of weakly basic anion exchange resin Diaion WA21 can be eluted with pure water. In order to obtain good accumulation of the isotope effect, a series of experiments with different migration length were carried out. The boron-10 enriched part of the boric acid absorbed band was always preceded by the isotopic plateau part, in which the atomic fraction of boron-10 was maintained at its original value. The atomic fraction of boron-10 at the end of the chromatogram increased with migration length, and in the case of 256-m migration, boron-10 was enriched from its original atomic fraction of 19.84 to 91.00%, the separation factor S being constant irrespective of migration length: S = 1.0100 +- 0.0005. (author)

  7. Neutron beam monitor based on a boron-coated GEM

    Institute of Scientific and Technical Information of China (English)

    ZHOU Jian-Rong; LI Yi; SUN Zhi-Jia; LIU Ben; WANG Yan-Feng; YANG Gui-An; ZHOU Liang; XU Hong; DONG Jing; YANG Lei

    2011-01-01

    A new thermal neutron beam monitor with a Gas Electron Multiplier (GEM) is developed to meet the needs of the next generation of neutron facilities. A prototype chamber has been constructed with two 100 mm×100 mm GEM foils. Enriched boron-10 is coated on one surface of the aluminum cathode plate as the neutron convertor. 96 channel pads with an area of 8 mm×8 mm each are used for fast signal readout.In order to study the basic characteristics of a boron-coated GEM, several irradiation tests were carried out with α source 239pu and neutron source 241Am(Be). The signal induced by the neutron source has a high signal-to-noise ratio. A clear image obtained from α source 239pu is presented, which shows that the neutron beam monitor based on a boron-coated GEM has a good two-dimensional imaging ability.

  8. Determination of residual boron in thermally treated controlled-porosity glasses, by colorimetry, spectrography and isotachophoresis

    International Nuclear Information System (INIS)

    Controlled-porosity glasses (CPGs) are often applied as sorbents in chromatography. Besides having high thermal, chemical and mechanical resistance they are characterized by a very narrow pore-size distribution and the choice of mean pore diameter and porosity covers a wide range. In spite of these advantages, their range of use in chromatography is restricted because of their strong adsorption properties, which are connected with the presence of residual boron atoms in the porous CPG skeleton. The boron concentration on the CPG surface can be increased by proper thermal treatment. When CPGs are heated in the range 400-8000 the residual boron atoms in the network diffuse from the bulk to the surface. The paper discusses the boron content in porous glasses of different mean pore diameters and the determination of the enrichment of boron on the GPG surface, by three independent methods: colorimetry, spectrography and isotachophoresis. (author)

  9. Gaseous diffusion -- the enrichment workhorse

    International Nuclear Information System (INIS)

    Construction of the first large-scale gaseous diffusion facility was started as part of the Manhattan Project in Oak Ridge, Tennessee, in 1943. This facility, code named ''K-25,'' began operation in January 1945 and was fully on stream by September 1945. Four additional process buildings were later added in Oak Ridge as the demand for enriched uranium escalated. New gaseous diffusion plants were constructed at Paducah, Kentucky, and Portsmouth, Ohio, during this period. The three gaseous diffusion plants were the ''workhorses'' which provided the entire enriched uranium demand for the United States during the 1950s and 1960s. As the demand for enriched uranium for military purposes decreased during the early 1960s, power to the diffusion plants was curtailed to reduce production. During the 1960s, as plans for the nuclear power industry were formulated, the role of the diffusion plants gradually changed from providing highly-enriched uranium for the military to providing low-enriched uranium for power reactors

  10. Colorimetric determination of Boron-10 in macromolecular delivery agents

    Energy Technology Data Exchange (ETDEWEB)

    Camillo, Maria A.P.; Moura, Eduardo [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Centro de Biologia Molecular]. E-mail: mcamillo@ipen.br; Queiroz, Alvaro A.A.A.de [Universidade Federal de Itajuba, MG (Brazil). Inst. de Ciencias Exatas. Dept. de Fisica e Quimica]. E-mail: alencar@unifei.edu.br

    2005-07-01

    A polyglycerol with dendritic structure (PGLD) was synthesized by the ring opening polymerization of deprotonated glycidol using a polyglycerol as core functionality in a step-growth process denominated divergent synthesis. After PGLD reaction with {sup 10}B-enriched boric acid there was a marked increase in the bulk viscosity of the PGLD dendrimer evidencing the polyester formation. Gel permeation chromatography (GPC) analysis was used to characterize the molecular weight and the polydispersivity of the synthesized PGLD dendrimer. A dendritic polyglycerol structure with M{sub n} value of 16.7 kDa and a narrow polydispersivity (M{sub w}/M{sub n} = 1.05) was obtained in this work. {sup 1}H-NMR and {sup 13}C-NMR measurements were employed to assess the degree of branching (DB) in PGLD. The DB of 0.85 indicates the tendency of a dentritic structure for the PGLD synthesized in this work. The boron-10 concentration was dependent of the PGLD generation. A selective reagent, curcumine, was studied for spectrophotometric determination of boron in polyglycerol dendrimers. Boron reacts with curcumine to form a complex, which has a maximum absorption peak at 552 nm. Under the optimal conditions, Beer's law was obeyed over the range 0{approx}20 {mu}g of boron in 25 mL of solution. The biological assays indicate the PGLD-B with boron-10 concentration of 25 mg{sup 10}B/gPGLD as the most promising macromolecule enriched with boron-10 for the BNCT therapy. (author)

  11. Boron cures cancer

    International Nuclear Information System (INIS)

    In this work the authors cite a few examples of the use of radiopharmaceuticals for diagnostic and therapeutic purposes in nuclear medicine. They point to the possibility of boron neutron capture therapy and the use for the neutron capture therapy of other light elements.

  12. Isotopic effect on thermal physical properties of isotopically modified boron single crystals

    International Nuclear Information System (INIS)

    The measurement of specific heat and thermal conductivity at low temperature for isotopically modified boron single crystals was performed between 0.5 and 100K using relaxation method and steady heat flow method, respectively. The results indicate that the specific heat has obvious divergences at T10B-enriched crystal is about 570 W/m·K, which is 40% larger than that of natural boron crystal. The influence of lattice vibration modes and the isotopic effect on specific heat and thermal conductivity for isotopically modified boron are discussed. (author)

  13. Process for microwave sintering boron carbide

    International Nuclear Information System (INIS)

    A method of microwave sintering boron carbide comprises leaching boron carbide powder with an aqueous solution of nitric acid to form a leached boron carbide powder. The leached boron carbide powder is coated with a glassy carbon precursor to form a coated boron carbide powder. The coated boron carbide powder is consolidated in an enclosure of boron nitride particles coated with a layer of glassy carbon within a container for microwave heating to form an enclosed coated boron carbide powder. The enclosed coated boron carbide powder is sintered within the container for microwave heating with microwave energy

  14. Salinity's influence on boron toxicity in broccoli: I. Impacts on yield, biomass distribution, and water use

    Science.gov (United States)

    Research addressing the interactive effects of the dual plant stress factors, excess boron and salinity, on crop productivity has expanded considerably over the past few years. The purpose of this research was to determine and quantify the interactive effects of salinity, saltcomposition and boron ...

  15. The interaction of boron with goethite: Experiments and CD-MUSIC modeling

    NARCIS (Netherlands)

    Goli, E.; Rahnemaie, R.; Hiemstra, T.; Malakouti, M.J.

    2011-01-01

    Boron (B) is an essential element for plants and animals growth that interacts with mineral surfaces regulating its bioavailability and mobility in soils, sediments, and natural ecosystems. The interaction with mineral surfaces is quite important because of a narrow range between boron deficiency an

  16. BCM6: New Generation of Boron Meter

    International Nuclear Information System (INIS)

    Full text of publication follows: Rolls-Royce has developed a new generation of boron meter, based on more than 30 years of experience. The Rolls-Royce BCM6 boron meter provides Nuclear Power Plant (NPP) operators with the boron concentration of the primary circuit. The meter provides continuous and safe measurements with no manual sampling and no human contact. In this paper, technical features, advantages and customer benefits of the use of the new generation of Rolls-Royce BCM6 boron meter will be detailed. Values and associated alarms are provides over different media: 4-20 mA outputs, relays, displays in the main control room and in the chemical lab, and digital links. A special alarm avoids unexpected homogeneous dilution of the primary circuit, which is a critical operational parameter. The Rolls-Royce BCM6 boron meter is fully configurable over a set of parameters allowing adaptation to customer needs. It has a differential capability, thus eliminating neutronic noise and keeping measurements accurate, even in the case of fuel clad rupture. Measurements are accurate, reliable, and have a quick response time. Equipment meets state-of-the-art qualification requests. Designed in 2008, the BCM6 boron meter is the newest equipment of Rolls-Royce boron meters product line. It has been chosen to equip the French EPR NPP and complies with the state-of-the-art of the technology. Rolls-Royce has more than 30 years of experience in Instrumentation and Controls with more than 75 NPP units operating worldwide. All of this experience return has been put in this new generation of equipment to provide the customer with the best operation. About Rolls-Royce Rolls-Royce is a global business providing integrated power systems for use on land, at sea and in the air. The Group has a balanced business portfolio with leading market positions. Rolls-Royce has a broad range of civil nuclear expertise, including work related to licensing and safety reviews, engineering design

  17. Optimization of chemistry in PWR and VVER nuclear power plants

    International Nuclear Information System (INIS)

    This paper, based on international feedback and studies, proposes potential improvements for PWR and VVER operation: pH optimization in the primary coolant in order to minimize corrosion product transport/deposition and associated radiation exposure, crud induced power shifts (previously called axial offset anomaly), and fuel failure; use of enriched boron acid (enriched with 10B) to easily optimize the above described pH, particularly with the increased use of higher fuel enrichments; zinc addition in the reactor cooling system; establishment of secondary water chemistry specifications which take into consideration the steam generator tubing materials and design to minimize corrosion risk while keeping sufficient plant availability and decreasing environmental impact; amine selection for the secondary system aimed at mitigating steam generator tube fouling, power loss and maintenance costs as well as corrosion risks; overall operating chemistry options designed to minimize environmental impact, such as elimination of condensate polishers and optimum ion exchange resin use. (orig.)

  18. Boron exposure assessment using drinking water and urine in the North of Chile

    Energy Technology Data Exchange (ETDEWEB)

    Cortes, S., E-mail: scortes@med.puc.cl [Departamento de Salud Publica, Pontificia Universidad Catolica de Chile, Santiago (Chile); Reynaga-Delgado, E. [Centro de Investigaciones Biologicas del Noroeste, La Paz B.C.S. (Mexico); Sancha, A.M. [Facultad de Ciencias Fisicas y Matematicas, Universidad de Chile, Santiago (Chile); Ferreccio, C. [Departamento de Salud Publica, Pontificia Universidad Catolica de Chile, Santiago (Chile)

    2011-12-01

    Boron is an essential trace element for plants and humans however it is still an open question what levels of boron are actually safe for humans. This study, conducted between 2006 and 2010, measured exposure levels of boron in drinking water and urine of volunteers in Arica, an area in the North of Chile with high levels of naturally occurring boron. Samples were taken of tap and bottled water (173 and 22, respectively), as well as urine from 22 volunteers, and subsequently analyzed by inductively coupled plasma spectroscopy (ICP-OES). Boron varied in public tap water from 0.22 to 11.3 mg L{sup -1}, with a median value of 2.9 mg L{sup -1}, while concentrations of boron in bottled water varied from 0.01 to 12.2 mg L{sup -1}. Neither tap nor bottled water samples had concentrations of boron within WHO recommended limits. The concentration of boron in urine varied between 0.45 and 17.4 mg L{sup -1}, with a median of 4.28 mg L{sup -1} and was found to be correlated with tap water sampled from the homes of the volunteers (r = 0.64). Authors highly recommend that in northern Chile - where levels of boron are naturally high - that the tap and bottled water supplies be monitored in order to protect public health and that regulatory standards also be established for boron in drinking water in order to limit exposure.

  19. Boron exposure assessment using drinking water and urine in the North of Chile

    International Nuclear Information System (INIS)

    Boron is an essential trace element for plants and humans however it is still an open question what levels of boron are actually safe for humans. This study, conducted between 2006 and 2010, measured exposure levels of boron in drinking water and urine of volunteers in Arica, an area in the North of Chile with high levels of naturally occurring boron. Samples were taken of tap and bottled water (173 and 22, respectively), as well as urine from 22 volunteers, and subsequently analyzed by inductively coupled plasma spectroscopy (ICP-OES). Boron varied in public tap water from 0.22 to 11.3 mg L−1, with a median value of 2.9 mg L−1, while concentrations of boron in bottled water varied from 0.01 to 12.2 mg L−1. Neither tap nor bottled water samples had concentrations of boron within WHO recommended limits. The concentration of boron in urine varied between 0.45 and 17.4 mg L−1, with a median of 4.28 mg L−1 and was found to be correlated with tap water sampled from the homes of the volunteers (r = 0.64). Authors highly recommend that in northern Chile – where levels of boron are naturally high – that the tap and bottled water supplies be monitored in order to protect public health and that regulatory standards also be established for boron in drinking water in order to limit exposure.

  20. Methods of producing continuous boron carbide fibers

    Energy Technology Data Exchange (ETDEWEB)

    Garnier, John E.; Griffith, George W.

    2015-12-01

    Methods of producing continuous boron carbide fibers. The method comprises reacting a continuous carbon fiber material and a boron oxide gas within a temperature range of from approximately 1400.degree. C. to approximately 2200.degree. C. Continuous boron carbide fibers, continuous fibers comprising boron carbide, and articles including at least a boron carbide coating are also disclosed.

  1. Turkey's regulatory plans for high enriched to low enriched conversion of TR-2 reactor core

    International Nuclear Information System (INIS)

    Turkey is a developing country and has three nuclear facilities two of which are research reactors and one pilot fuel production plant. One of the two research reactors is TR-2 which is located in Cekmece site in Istanbul. TR-2 Reactor's core is composed of both high enriched and low enriched fuel and from high enriched to low enriched core conversion project will take place in year 2005. This paper presents the plans for drafting regulations on the safety analysis report updates for high enriched to low enriched core conversion of TR-2 reactor, the present regulatory structure of Turkey and licensing activities of nuclear facilities. (author)

  2. Uranium enrichment in France

    International Nuclear Information System (INIS)

    Eurodif's uranium enrichment plant in France will undoubtedly remain reliable, flexible and competitive for at least the next twenty years. Its replacement is nevertheless already under study and evaluation by Cogema, the main shareholder, since the investment decisions about the technology chosen for the substitution of the gaseous process diffusion will have to be made in near future. Supporting the efforts of the nuclear utilities to keep the nuclear power option viable and competitive, Cogema presently focuses on the development of laser processes, designed to attractively offer fully loaded costs, i.e. including the returns on investment, not much higher than the variable production costs of today. (orig.)

  3. Effect of boron on creep characteristics in 9Cr-1.5Mo alloys

    Science.gov (United States)

    Kim, Bumjoon; Yun, Haksu; Lee, Dongbok; Lim, Byeongsoo

    2009-01-01

    For thick-section components such as headers and pipes of the power plants, high creep rupture strength and oxidation resistance are required. It is known that the addition of boron can improve the creep strength and oxidation resistance through the stabilization of M23C6 carbides in the vicinity of prior austenite grain boundaries. In this study, the effect of boron addition with the range of 0.0033~0.0133 wt% on the creep behavior of 9Cr-1.5Mo steel was investigated. Small punch creep tests were carried out to investigate the effect of boron addition on creep properties. Microstructure observation was performed to analyze the effect of boron addition on creep strength and rupture life. Also, the relationship between the minimum creep rate and the amount of boron addition were analyzed. The addition of boron is beneficial in lowering the steady-state creep rate.

  4. A Preliminary experimental study of the boron concentration in vapor and the isotopic A preliminary experimental study of the boron concentrationin vapor and the isotopic fractionation of boron betweenseawater and vapor during evaporation of seawater

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    A laboratory experiment was undertaken to investigate the behaviour of boron at theseawater-air interface under air flow conditions. Dried air at 25 and 35℃ was passed over or bub-bled through seawater at the same temperature. A combination of ice-chilled condensers and KOHimpregnated cellulose fibre filters was used to collect boron from the reacted air. When air strippedof boron was passed over the seawater, boron was found in the reacted air, and its concentrationwas higher in the higher temperature test. In the tests where air was bubbled through seawater theconcentration of boron in the reacted air was directly proportional to the air flow rate. In this situa-tion the boron in the reacted air was mainly introduced as a spray of microdroplets. Isotopic analy-sis of the collected boron in the non-bubbled tests yields fractionation factors which demonstratethat the lighter isotope, 10B, is enriched in the reacted air. The size of the fractionation changeswith temperature, ruling out a purely kinetic effect.

  5. Studies on separation of boron isotopes by ion exchange

    International Nuclear Information System (INIS)

    Studies have been carried out for the enrichment of boron isotopes by the ion exchange method using various anion exchange resins available. The elementary separation factors and heights equivalent of theoretical plate were measured at different concentrations and flow rates. A number of experiments were performed to study the displacement of borate band on ion exchange columns. The problem of CO2 evolution during displacement was also studied and a solution was found. (author). 9 refs

  6. Tandem anion and cation exchange solid phase extraction for the enrichment of micropollutants and their transformation products from ozonation in a wastewater treatment plant.

    Science.gov (United States)

    Deeb, Ahmad A; Schmidt, Torsten C

    2016-06-01

    The presence of organic micropollutants and their transformation products (TPs) from biotic and abiotic processes in aquatic environments is receiving intense public and scientific attention. Yet a suitable sample preparation method that would enable extraction and enrichment of a wide range of such compounds from water is missing. The focus of this paper was to develop an enhanced solid phase extraction (SPE) protocol which enabled isolation of parent compounds and low molecular weight transformation products (that are produced after treatment of water with ozone) from different water matrices. Ten SPE sorbents were evaluated with regard to their ability to extract acidic, neutral, and basic compounds from water at several pH values. Highest recoveries (91-99 %) for all analytes in pure water were obtained by combining strong anion and cation exchangers of two manufacturers in a tandem mode without pH adjustment. Tandem Oasis (MAX+MCX) was finally applied to extract the spiked analytes from tap water, surface water, and several wastewater samples. The efficiency of the used SPE procedure was examined using an optimized liquid chromatography-electrospray ionization-tandem mass spectrometry (LC-ESI-MS/MS) method using multiple reaction monitoring (MRM) mode. The occurrence of some of the investigated TPs in environmental water matrices was proven for the first time in this study. Method quantification limits (MQLs) for all compounds ranged from 3.7 to 15.3 ng/L in all matrices. Recoveries (%RE) were between 90 and 110 %. Intraday and interday precision, expressed as relative standard deviation, varied from 0.7 to 5.9 % and 1.8 to 10.3 %, respectively. Matrix effect (%ME) evaluation demonstrated that even complex sample matrices did not show significant ion suppression or enhancement. The applicability of the method was shown during two sampling campaigns at Ruhr river and a wastewater treatment plant (WWTP) equipped with an ozonation step after regular

  7. Warming and Carbon Dioxide Enrichment Alter Plant Production and Ecosystem gas Exchange in a Semi-Arid Grassland Through Direct Responses to Global Change Factors and Indirect Effects on Water Relations

    Science.gov (United States)

    Morgan, J. A.; Pendall, E.; Williams, D. G.; Bachman, S.; Dijkstra, F. A.; Lecain, D. R.; Follett, R.

    2007-12-01

    The Prairie Heating and CO2 Enrichment (PHACE) experiment was initiated in Spring, 2007 to evaluate the combined effects of warming and elevated CO2 on a northern mixed-grass prairie. Thirty 3-m diameter circular experimental plots were installed in Spring, 2006 at the USDA-ARS High Plains Grasslands Research Station, just west of Cheyenne, WY, USA. Twenty plots were assigned to a two-level factorial combination of two CO2 concentrations (present ambient, 380 ppmV; and elevated, 600 ppmV), and two levels of temperature (present ambient; and elevated temperature, 1.5/3.0 C warmer day/night), with five replications for each treatment. Five of the ten remaining plots were subjected to either frequent, small water additions throughout the growing season, and the other five to a deep watering once or twice during the growing season. The watering treatments were imposed to simulate hypothesized water savings in the CO2-enriched plots, and to contrast the influence of variable water dynamics on ecosystem processes. Carbon dioxide enrichment of the ten CO2- enriched plots is accomplished with Free Air CO2 Enrichment (FACE) technology and occurs during daylight hours of the mid-April - October growing season. Warming is done year-round with circularly-arranged ceramic heater arrays positioned above the ring perimeters, and with temperature feed-backs to control day/night canopy surface temperatures. Carbon dioxide enrichment began in Spring, 2006, and warming was added in Spring, 2007. Results from the first year of CO2 enrichment (2006) confirmed earlier reports that CO2 increases productivity in semi-arid grasslands (21% increase in peak seasonal above ground biomass for plants grown under elevated CO2 compared to non-enriched controls), and that the response was related to CO2- induced water savings. Growth at elevated CO2 reduced leaf carbon isotope discrimination and N concentrations in plants compared to results obtained in control plots, but the magnitude of changes

  8. Boron uptake, localization, and speciation in marine brown algae.

    Science.gov (United States)

    Miller, Eric P; Wu, Youxian; Carrano, Carl J

    2016-02-01

    In contrast to the generally boron-poor terrestrial environment, the concentration of boron in the marine environment is relatively high (0.4 mM) and while there has been extensive interest in its use as a surrogate of pH in paleoclimate studies in the context of climate change-related questions, the relatively depth independent, and the generally non-nutrient-like concentration profile of this element have led to boron being neglected as a potentially biologically relevant element in the ocean. Among the marine plant-like organisms the brown algae (Phaeophyta) are one of only five lineages of photosynthetic eukaryotes to have evolved complex multicellularity. Many of unusual and often unique features of brown algae are attributable to this singular evolutionary history. These adaptations are a reflection of the marine coastal environment which brown algae dominate in terms of biomass. Consequently, brown algae are of fundamental importance to oceanic ecology, geochemistry, and coastal industry. Our results indicate that boron is taken up by a facilitated diffusion mechanism against a considerable concentration gradient. Furthermore, in both Ectocarpus and Macrocystis some boron is most likely bound to cell wall constituent alginate and the photoassimilate mannitol located in sieve cells. Herein, we describe boron uptake, speciation, localization and possible biological function in two species of brown algae, Macrocystis pyrifera and Ectocarpus siliculosus. PMID:26679972

  9. The boron efflux transporter ROTTEN EAR is required for maize inflorescence development and fertility.

    Science.gov (United States)

    Chatterjee, Mithu; Tabi, Zara; Galli, Mary; Malcomber, Simon; Buck, Amy; Muszynski, Michael; Gallavotti, Andrea

    2014-07-01

    Although boron has a relatively low natural abundance, it is an essential plant micronutrient. Boron deficiencies cause major crop losses in several areas of the world, affecting reproduction and yield in diverse plant species. Despite the importance of boron in crop productivity, surprisingly little is known about its effects on developing reproductive organs. We isolated a maize (Zea mays) mutant, called rotten ear (rte), that shows distinct defects in vegetative and reproductive development, eventually causing widespread sterility in its inflorescences, the tassel and the ear. Positional cloning revealed that rte encodes a membrane-localized boron efflux transporter, co-orthologous to the Arabidopsis thaliana BOR1 protein. Depending on the availability of boron in the soil, rte plants show a wide range of phenotypic defects that can be fully rescued by supplementing the soil with exogenous boric acid, indicating that rte is crucial for boron transport into aerial tissues. rte is expressed in cells surrounding the xylem in both vegetative and reproductive tissues and is required for meristem activity and organ development. We show that low boron supply to the inflorescences results in widespread defects in cell and cell wall integrity, highlighting the structural importance of boron in the formation of fully fertile reproductive organs. PMID:25035400

  10. An overview of male reproductive studies of boron with an emphasis on studies of highly exposed Chinese workers

    DEFF Research Database (Denmark)

    Scialli, Anthony R; Bonde, Jens Peter; Brüske-Hohlfeld, Irene; Culver, B Dwight; Li, Yanhong; Sullivan, Frank M

    2010-01-01

    Boron treatment of rats, mice, and dogs has been associated with testicular toxicity, characterized by inhibited spermiation at lower dose levels and a reduction in epididymal sperm count at higher dose levels. The no-adverse-effect level for reproductive effects in male rats is 17.5mg B/kg bw...... working in boron (B) mining or processing in Liaoning province in northeast China has been published in several Chinese and a few English language papers. This study included individual assessment of boron exposure, interview data on reproductive experience and semen analysis. Employed men living in the...... same community and in a remote community were used as controls. Boron workers (n=75) had a mean daily boron intake of 31.3mg B/day, and a subset of 16 of these men, employed at a plant where there was heavy boron contamination of the water supply, had an estimated mean daily boron intake of 125 mg B...

  11. Cosmis Lithium-Beryllium-Boron Story

    Science.gov (United States)

    Vangioni-Flam, E.; Cassé, M.

    Light element nucleosynthesis is an important chapter of nuclear astrophysics. Specifically, the rare and fragile light nuclei Lithium, Beryllium and Boron (LiBeB) are not generated in the normal course of stellar nucleosynthesis (except Lithium-7) and are, in fact, destroyed in stellar interiors. This characteristic is reflected in the low abundance of these simple species. Up to recently, the most plausible interpretation was that galactic cosmic rays (GCR) interact with interstellar CNO to form LiBeB. Other origins have been also identified, primordial and stellar (Lithium-7) and supernova neutrino spallation (Lithium-7 and Boron-11). In contrast, Beryllium-9, Boron-10 and Lithium-6 are pure spallative products. This last isotope presents a special interest since the Lithium-7/Lithium-6 ratio has been measured in a few halo stars offering a new constraint on the early galactic evolution. However, in the nineties, new observations prompted astrophysicists to reassess the question. Optical measurements of the beryllium and boron abundances in halo stars have been achieved by the 10 meters KECK telescope and the Hubble Space Telescope. These observations indicate a quasi linear correlation between Be and B vs Fe, at least at low metallicity, unexpected on the basis of GCR scenario, predicting a quadratic relationship. As a consequence, the origin and the evolution of the LiBeB nuclei has been revisited. This linearity implies the acceleration of C and O nuclei freshly synthesized and their fragmentation on the the interstellar Hydrogen and Helium. Wolf-Rayet stars and supernovae via the shock waves induced, are the best candidates to the acceleration of their own material enriched into C and O; so LiBeB is produced independently of the Interstellar Medium chemical composition. Moreover, neutrinos emitted by the newly born neutron stars interacting with the C layer of the supernova could produce specifically Lithium-7 and Boron-11. This process is supported by the

  12. Effect of Nitrogen and Boron in Seed Yield and Yield Attributing Characters of Broccoli

    Directory of Open Access Journals (Sweden)

    A. Khanal

    2015-09-01

    Full Text Available Plant nutrient is one of the limiting factors affecting crop production. Nitrogen and boron are major nutrients in case of broccoli. So, an experiment was carried out to evaluate the effect of nitrogen and boron in seed yield and yield attributing characters of broccoli in Rampur, Chitwan during winter season. The experiment was laid out in factorial RCBD design with four levels of nitrogen and two levels of boron. Each plot consists of 25 plants which were separated by 60 * 60 cm spacing. There are altogether eight treatments replicates thrice. Local variety Calabrese was used. Significant effect of different dose of nitrogen and boron on yield attributing characters was found. Also interactive effect of nitrogen and boron in number of pods, pod length, seed yield and number of seeds per pod was found significantly different.

  13. Sintered boron, production and properties

    International Nuclear Information System (INIS)

    Microhardness HV, tensile properties and Young modulus of sintered boron of different porosity were studied. It was shown that with density growth tensile properties improve. HV and brittle-ductile transition temperature Tsub(b) of sintered boron on the one hand and for silicon and titanium carbide on the other were compared and discussed. It was noted that the general level of HV and Tsub(b) for boron is rather high and at similar relative temperatures these characteristics are much higher. Temperature dependences of linear expansion coefficient, thermal capacity, thermal and temperature conductivity of sintered boron of 20% porosity were studied. Gruneisen parameter was evaluated

  14. Fivefold twinned boron carbide nanowires.

    Science.gov (United States)

    Fu, Xin; Jiang, Jun; Liu, Chao; Yuan, Jun

    2009-09-01

    Chemical composition and crystal structure of fivefold twinned boron carbide nanowires have been determined by electron energy-loss spectroscopy and electron diffraction. The fivefold cyclic twinning relationship is confirmed by systematic axial rotation electron diffraction. Detailed chemical analysis reveals a carbon-rich boron carbide phase. Such boron carbide nanowires are potentially interesting because of their intrinsic hardness and high temperature thermoelectric property. Together with other boron-rich compounds, they may form a set of multiply twinned nanowire systems where the misfit strain could be continuously tuned to influence their mechanical properties. PMID:19687534

  15. New evidences on efficacy of boronic acid-based derivatization method to identify sugars in plant material by gas chromatography-mass spectrometry.

    Science.gov (United States)

    Faraco, Marianna; Fico, Daniela; Pennetta, Antonio; De Benedetto, Giuseppe E

    2016-10-01

    This work presents an analytical procedure based on gas chromatography-mass spectrometry which allows the determination of aldoses (glucose, mannose, galactose, arabinose, xylose, fucose, rhamnose) and chetoses (fructose) in plant material. One peak for each target carbohydrate was obtained by using an efficient derivatization employing methylboronic acid and acetic anhydride sequentially, whereas the baseline separation of the analytes was accomplished using an ionic liquid capillary column. First, the proposed method was optimized and validated. Successively, it was applied to identify the carbohydrates present in plant material. Finally, the procedure was successfully applied to samples from a XVII century painting, thus highlighting the occurrence of starch glue and fruit tree gum as polysaccharide materials. PMID:27474277

  16. Boron in Pariette Wetland Sediments, Aquatic Vegetation & Benthic Organisms

    Science.gov (United States)

    Vasudeva, P.; Jones, C. P.; Powelson, D.; Jacobson, A. R.

    2015-12-01

    The Pariette Wetlands are comprised of 20 ponds located in Utah's Uintah Basin. Boron concentration in the Pariette Wetlands have been observed to exceed the total maximum daily limit of 750 µg L-1. Considering water flow in and out of the wetlands, boron is accumulating within the wetlands where it is sorbed to sediments and bioconcentrated by wetland plant and macro invertebrates. Since boron is an avian teratogen, an estimate of boron ingestion exposure is warranted. Samples from 3 of the 23 Pariette Wetland ponds with one pond near the inlet, one near the outlet, and one in the middle were collected. Five sampling points were designated along a 100 m transect of each pond. At each sampling point duplicate (or triplicate) samples of water, sediments, benthic organisms and wetland vegetation were collected. The sediments were collected with a KB-corer and divided at depths of 0-2 cm, 2-7 cm, and 7+ cm from the sediment surface. Sample splits were sent to the USU Bug lab for identification of invertebrate species. Whenever this transect was not intercepting vegetation, 2-3 additional sample sites were identified at the pond within stands of representative vegetation where bird nests are located. The plant parts used for boron analyses will include seeds, shoot and roots of vascular plants, as well as algae or duckweeds skimmed from the surface. Samples were processed within 2 days of collection. Water samples filtered through a 0.45 μ membrane filter were analyzed for DOC, pH and ECe. The dried and washed vegetation samples were ground and stored. The benthic organisms and macro invertebrates were netted at the water surface. The dried samples were weighed, ground and stored. Samples were weighed, oven dried and reweighed. For plant and macro-invertebrate samples, a nitric and hydrogen peroxide digestion procedure is used to dissolve environmentally available elements. The Hot Water extraction and DTPA-Sorbitol extraction were compared to estimate wetland plant

  17. Spectrographic determination of impurities in enriched uranium solutions

    International Nuclear Information System (INIS)

    A spectrographic procedure for the determination of trace amounts of Al, B, Ba, Be, Bi, Ca, Cd, Co, Cr, Cu, Fe, K, L i , Hg, Mn, Mo, Na, Nb, Ni, P, Pb, Ru, Sb, Sn, Sr, Ti, V, Zn, and Zr in enriched uranyl nitrate solutions from the reprocessing of spent nuclear fuels is described. After removal of uranium by either TBP or TNOA solvent extraction, the aqueous phase Is analysed by the graphite spark technique. TBP is adequate for all impurities, excepting boron and phosphorus; both of these elements can sat is factory be determined by using TNOA after the addition of mannitol to avoid boron losses. (Author) 4 refs

  18. Microwave digestion techniques applied to determination of boron by ICP-AES in BNCT program

    International Nuclear Information System (INIS)

    Recently, boron neutron capture therapy (BNCT) has merged as an interesting option for the treatment of some kind of tumors where established therapies show no success. A molecular boronated species, enriched in 10B is administrated to the subject; it localizes in malignant tissues depending the kind of tumor and localization. Therefore, a very important fact in BNCT research is the detection of boron at trace or ultra trace levels precisely and accurately. This is extremely necessary as boronated species do localize in tumoral tissue and also localize in liver, kidney, spleen, skin, membranes. By this way, before testing a boronated species, it is mandatory to determine its biodistribution in a statistically meaning population, that is related with managing of a great number of samples. In the other hand, it is necessary to exactly predict when to begin the irradiation and to determine the magnitude of radiation to obtain the desired radiological dose for a specified mean boron concentration. This involves the determination of boron in whole blood, which is related with boron concentration in the tumor object of treatment. The methodology selected for the analysis of boron in whole blood and tissues must join certain characteristics: it must not be dependant of the chemical form of boron, it has to be fast and capable to determine boron accurately and precisely in a wide range of concentrations. The design and validation of experimental models involving animals in BNCT studies and the determination of boron in blood of animals and subjects upon treatment require reliable analytical procedures to determine boron quantitatively in those biologic materials. Inductively coupled plasma-atomic emission spectrometry (ICP-AES) using pneumatic nebulization is one of the most promising methods for boron analysis, but the sample must be liquid and have low solid concentration. In our case, biological tissues and blood, it is mandatory to mineralize and/or dilute samples

  19. A study on the nuclear characteristics of enriched gadolinia burnable absorber rods; the first year (2000) report

    International Nuclear Information System (INIS)

    An analysis model using MICBURN-3/CASMO-3 is established for the enriched gadolinia burnable absorber rods. A homogenized cross section editing code, PROLOG, is modified so that it can handle such a fuel assembly that includes two different types of gadolinia rods. Study shows that Gd-155 and Gd-157 are almost same in suppressing the excess reactivity and it is recommended to enrich both odd number isotopes, Gd-155 and Gd-157. It is estimated that the cycle length increases by 2 days if enriched gadolinia rods are used in the commercial nuclear power plant such as YGN-3 of which the cycle length is assumed 2 years. For the advanced integral reactor SMART in which ultra long cycle length and soluble boron-free operation concept is applied, natural gadolinia burnable absorber rods fail to control the excess reactivity. On the other hand, enriched gadolinia rods are successful in controling the excess reactivity. To minimize power peakings, various placements of gadolinia rods are tested. Also initial reactivity holddown and gadolinia burnout time are parametrized with respect to the number of gadolinia rods and gadolinia weight fractions

  20. Analysis of heterogeneous boron dilution sequences

    International Nuclear Information System (INIS)

    In the scope of the international SETH project (focused on boron dilution sequences), the Spanish Nuclear Regulatory Commission (CSN) and the electric energy industry of Spain (UNESA) have promoted in Spain a national project for the analysis and application of the SETH results to the Spanish nuclear power plants. As part of this project, our team has performed a review and analysis of the different sequences that could lead to a boron dilution in the primary circuit of a pressurized water reactor (PWR). On a first stage of the project we have analyzed the different sequences and the phenomenologies that could lead to inadvertent boron dilution in the primary system (about twenty different sequences are described in the literature), the core damage frequency of each one, the projects and experiments carried out on several experimental facilities and the modifications performed in order to avoid or to mitigate this kind of sequences. On a second one we have reviewed the relation between the operating procedures, Westinghouse design reactors, and this kind of sequences. Finally we have analyzed the simulation problems of these kind of sequences and performed several numerical simulations with the TRAC-M (TRACE) code applied to numerical benchmarks and also to a 3D vessel model. (author)

  1. Rice and wheat yield improvement by the application of boron in salt affected soils

    International Nuclear Information System (INIS)

    In recent past studies on wheat, rice and fruit plant showed that fairly large percentage of soils and crops are deficient in boron. Several times a question rose to study the boron responses in a cropping system to see the residual effect of boron. With the objective in mind, a field experiment was conducted at two sites in saline sodic soils to see the rice and wheat crops response to boron. Boron was applied to rice at the rate of 0.25, 0.50, 1.0, 1.5, and 2.0 Kg ha/sub -1/ as sodium tetra borate. The results showed that both paddy and straw yields increased with the increasing rates of boron and highest yield was obtained from 2 Kg ha/sub -l/. After harvesting of rice crop wheat was sown in the same layout. The treatments were divided into two equal portions. Boron was applied to one portion at the same rates as to rice while remaining half remained as such to study the residual effect of B on wheat. The results showed that grain anti straw yields increased with increasing rates of boron. In case of untreated plots to see the residual effect grain and straw yield increased with increasing rates of boron applied to rice. It was concluded that B applied to rice did show residual effect to the following wheat crop. Therefore, there is no need to apply B to following crop when B is applied to the previous crop. (author)

  2. Developing selenium-enriched animal feed and biofuel from canola planted for managing Se-laden drainage waters in the westside of central California.

    Science.gov (United States)

    Bañuelos, G S; Da Roche, J; Robinson, J

    2010-03-01

    We studied the reuse of selenium (Se)-laden effluent for producing canola (Brassica napus) and subsequent bioproducts in central California. Canola was irrigated with poor quality waters [electrical conductivity (EC) of approximately 5 dS m(-1) sulfate-salinity, 5 mg B L(-1), and 0.25 mg Se L(-1)]. Typical seed yields were 2.2 metric tons ha(-1). Seeds were processed for their oil, and transesterified to produce ASTM-quality biodiesel (BD) blends. The resulting Se-enriched seed cake meal (containing approximately 2 mg Se kg(-1) DM) was used in a dairy feed trial. Seventy-two Jersey and Holstein cows, 36 respectively, were fed Se-enriched canola meal as 6.2% of their daily feed ration for five weeks. Blood and milk samples were collected weekly and analyzed for total Se. This study showed that Se-enriched canola meal did not significantly increase total blood Se content in either cow breed. Milk Se concentrations did, however, significantly increase to safe levels of 59 microg Se L(-1) and 52 microg Se L(-1) in Jersey and Holstein cows, respectively. The production of BD 20 biofuels and Se-enriched feed meal from canola irrigated with poor quality waters may help sustain similar phytomanagement strategies under Se-rich conditions. PMID:20734619

  3. Critical experiments on an enriched uranium solution system containing periodically distributed strong thermal neutron absorbers

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, R.E.

    1996-09-30

    A series of 62 critical and critical approach experiments were performed to evaluate a possible novel means of storing large volumes of fissile solution in a critically safe configuration. This study is intended to increase safety and economy through use of such a system in commercial plants which handle fissionable materials in liquid form. The fissile solution`s concentration may equal or slightly exceed the minimum-critical-volume concentration; and experiments were performed for high-enriched uranium solution. Results should be generally applicable in a wide variety of plant situations. The method is called the `Poisoned Tube Tank` because strong neutron absorbers (neutron poisons) are placed inside periodically spaced stainless steel tubes which separate absorber material from solution, keeping the former free of contamination. Eight absorbers are investigated. Both square and triangular pitched lattice patterns are studied. Ancillary topics which closely model typical plant situations are also reported. They include the effect of removing small bundles of absorbers as might occur during inspections in a production plant. Not taking the tank out of service for these inspections would be an economic advantage. Another ancillary topic studies the effect of the presence of a significant volume of unpoisoned solution close to the Poisoned Tube Tank on the critical height. A summary of the experimental findings is that boron compounds were excellent absorbers, as expected. This was true for granular materials such as Gerstley Borate and Borax; but it was also true for the flexible solid composed of boron carbide and rubber, even though only thin sheets were used. Experiments with small bundles of absorbers intentionally removed reveal that quite reasonable tanks could be constructed that would allow a few tubes at a time to be removed from the tank for inspection without removing the tank from production service.

  4. Critical experiments on an enriched uranium solution system containing periodically distributed strong thermal neutron absorbers

    International Nuclear Information System (INIS)

    A series of 62 critical and critical approach experiments were performed to evaluate a possible novel means of storing large volumes of fissile solution in a critically safe configuration. This study is intended to increase safety and economy through use of such a system in commercial plants which handle fissionable materials in liquid form. The fissile solution's concentration may equal or slightly exceed the minimum-critical-volume concentration; and experiments were performed for high-enriched uranium solution. Results should be generally applicable in a wide variety of plant situations. The method is called the 'Poisoned Tube Tank' because strong neutron absorbers (neutron poisons) are placed inside periodically spaced stainless steel tubes which separate absorber material from solution, keeping the former free of contamination. Eight absorbers are investigated. Both square and triangular pitched lattice patterns are studied. Ancillary topics which closely model typical plant situations are also reported. They include the effect of removing small bundles of absorbers as might occur during inspections in a production plant. Not taking the tank out of service for these inspections would be an economic advantage. Another ancillary topic studies the effect of the presence of a significant volume of unpoisoned solution close to the Poisoned Tube Tank on the critical height. A summary of the experimental findings is that boron compounds were excellent absorbers, as expected. This was true for granular materials such as Gerstley Borate and Borax; but it was also true for the flexible solid composed of boron carbide and rubber, even though only thin sheets were used. Experiments with small bundles of absorbers intentionally removed reveal that quite reasonable tanks could be constructed that would allow a few tubes at a time to be removed from the tank for inspection without removing the tank from production service

  5. Basic uranium-235 enrichment by the Asahi Chemical Enrichment Process (ACEP)

    International Nuclear Information System (INIS)

    The development of Asahi Chemical Enrichment Process (ACEP) led to the establishment of basic process technology permitting attainment of 3% enrichment within several months of operation by the mid-1980s, through advances which brought increased electron-exchange and adsorption-desorption reaction rates, effective uranium adsorption band formation and maintenance, and equilibrium plate height reductions based on the elucidation of mobile-phase dispersion. The theoretical and experimental development of redox agent self-regeneration led to a new 'Super Process' characterized by greater simplicity and efficiency than previously thought possible. A semi-commercial plant with enrichment columns of 1 m in diameter and 3 m in height, constructed at Hyuga City in Miyazaki Prefecture, demonstrated 3% uranium enrichment in April 1988. Through the improvement of enrichment efficiency, overall enrichment costs have been greatly lowered. The advantage of the chemical enrichment process, and its low cost of enrichment, have now been clearly demonstrated. (author)

  6. Boron thermal regeneration system

    International Nuclear Information System (INIS)

    An ion exchanger which allows flow in both directions along a selected flow path is described. A separator plate divides the exchanger tank into two chambers each of which has a flow conduit so that flow may enter or leave from either chamber while prohibiting the resin particles from migrating from one side of the tank to the other. This ion exchanger permits a dual-directional flow process to be practised which results in immediate changes in the boron concentration within a nuclear reactor coolant system even if the ion exchanger resins have not been completely equilibrated during a previous operation. (author)

  7. BORONIZING OF STEEL

    Directory of Open Access Journals (Sweden)

    Arzum ULUKÖY

    2006-02-01

    Full Text Available Boride layer has many advantages in comparison with traditional hardening methods. The boride layer has high hardening value and keeps it's hardeness at high temperatures, and it also shows favorible properties, such as the resistance to wear, oxidation and corrosion. The process can be applied at variety of materials, for instance steel, cast iron, cast steel, nickel and cobalt alloys and cermets. In this rewiew, boronizing process properties, boride layer on steel surfaces and specifications and the factors that effect boride layer are examined

  8. Endocytosis and degradation of BOR1, a boron transporter of Arabidopsis thaliana, regulated by boron availability

    OpenAIRE

    Takano, Junpei; Miwa, Kyoko; Yuan, Lixing; von Wirén, Nicolaus; Fujiwara, Toru

    2005-01-01

    Boron (B) is essential for plants but toxic when present in excess. Arabidopsis thaliana BOR1 is a B exporter for xylem loading and is essential for efficient B translocation from roots to shoots under B limitation. B translocation to shoots was enhanced under B limitation in WT but not in bor1-1 mutant plants. The enhanced translocation was suppressed upon resupply of high levels of B within several hours. Unlike a number of transporters for essential mineral nutrients, BOR1 mRNA accumulatio...

  9. Effective go/no go enrichment measurements

    International Nuclear Information System (INIS)

    A simple plumbing bypass modification would eliminate excessive systematic error and improve precision for uranium hexafluoride gas enrichment measurements at centrifuge enrichment plants having small-diameter cascade pipes. Present gas enrichment measurements on typical small-diameter product pipes are indeterminate, because overwhelming systematic errors and large statistical errors result from the high deposit-to-gas ratios. The bypass would essentially eliminate the deposit from measurements. The intended purpose of go/no go measurements is to confirm that the enrichment of randomly selected product streams is ≤20%. The Hexapartite Safeguards Project participants agreed by consensus in 1983 on the importance of go/no go measurements

  10. An inherent boron dilution mechanism in pressurized water reactors

    International Nuclear Information System (INIS)

    The behaviour of boric acid during natural circulation together with Small Break LOCA experimental data shows that in present-day pressurized water reactors (PWR) there exists an inherent mechanism which can accumulate boron- free condensate in the cold leg loop seals. During reflux/boiler condensation, the accumulation rate is typically about 1.6 m3/min for a 1300 MWe UTSG plant. This observation, combined with the results of analyses of externally caused boron dilution transients, suggests that SB LOCA could become a reactivity induced accident (RIA) initiator. The severity of the reactivity accident potential is yet to be quantified. (author). 3 figs., 2 tabs., 30 refs

  11. THE EFFECT OF BORON DOSES ON PARICA (Schizolobium amazonicum Herb.)

    OpenAIRE

    Sebastião Ferreira de Lima; Rodrigo Luz da Cunha; Janice Guedes de Carvalho; Carlos Alberto Spaggiari Souza; Fernando Luiz de Oliveira Corrêa

    2003-01-01

    An experiment was conducted in a greenhouse in order to evaluate the effects of boron on parica growth and on concentration and contents of macro and micronutrients indry matter of shoots and roots. Six treatments constituted by boron doses of 0.0; 0.1; 0.3; 0.9;1.5 and 2.1 mg/dm3 in four replications were used. It was evaluated the characteristics:visual diagnostic, plants height and diameter, dry matter production of shoots and roots,concentration and contents of nutrients in dry matter of ...

  12. Boron isotope fractionation in magma via crustal carbonate dissolution

    Science.gov (United States)

    Deegan, Frances M.; Troll, Valentin R.; Whitehouse, Martin J.; Jolis, Ester M.; Freda, Carmela

    2016-08-01

    Carbon dioxide released by arc volcanoes is widely considered to originate from the mantle and from subducted sediments. Fluids released from upper arc carbonates, however, have recently been proposed to help modulate arc CO2 fluxes. Here we use boron as a tracer, which substitutes for carbon in limestone, to further investigate crustal carbonate degassing in volcanic arcs. We performed laboratory experiments replicating limestone assimilation into magma at crustal pressure-temperature conditions and analysed boron isotope ratios in the resulting experimental glasses. Limestone dissolution and assimilation generates CaO-enriched glass near the reaction site and a CO2-dominated vapour phase. The CaO-rich glasses have extremely low δ11B values down to ‑41.5‰, reflecting preferential partitioning of 10B into the assimilating melt. Loss of 11B from the reaction site occurs via the CO2 vapour phase generated during carbonate dissolution, which transports 11B away from the reaction site as a boron-rich fluid phase. Our results demonstrate the efficacy of boron isotope fractionation during crustal carbonate assimilation and suggest that low δ11B melt values in arc magmas could flag shallow-level additions to the subduction cycle.

  13. Effects of Boron Nutrition on 45Ca Retranslocation and Distribution in Rape (Brassica napus L. ) Cultivars

    Institute of Scientific and Technical Information of China (English)

    WANG Huo-yan; WANG Yun-hua; WU Li-shu; DU Chang-wen; XU Fang-sun

    2003-01-01

    Using tracer techniques with the radioisotope 45Ca, the effects of boron supply from soil andnutrient solution on the retranslocation of 45 Ca from leaves to other parts of rape plants were studied. Resultsindicated that only a small portion of foliar-applied 45Ca could be retranslocated to other parts of the rapeplant. There was no pronounced effect of boron level in the soil on 45 Ca retranslocation. Increasing boron con-centrations in the nutrient solution significantly reduced 45 Ca radioactivity in root and stem, but increased 45 Cauptake and 45 Ca translocation to the upper leaves of rape plants. It was suggested that 45 Ca absorbed by newlydeveloped roots was easily distributed to upper leaves of rape plants. Boron may alter distribution of calciumvia its effect on root development or growth of newly developed roots.

  14. Engineering design feasibility of low boron concentration core in PWR

    International Nuclear Information System (INIS)

    In pressurized water reactor operation, higher level of soluble boron concentration could contribute higher impact from boron dilution situations, higher amount of liquid waste, and higher radiation dose to operators from higher corrosion potential to cladding and structure. Two practical and feasible means to reduce the maximum boron concentration were investigated in this study. A technically straightforward, possible means, can be achieved either by implementation of enriched boric acid (Eba) or by increasing more shim rod (fixed burnable absorber) worth. A simplest option is that the Eba is applied into reference core (Ref) design, OPR-1000 design, Ulchin unit-5 by allowing use of same fuel assemblies and core design without changing any nuclear design methodology used in that Ref design. Although results of Eba option proved its favorable power distribution and peaking factor, its moderator temperature coefficient (MTC) value reached positive, 3.25 pcm/ C at 40 EFPD which is beyond the design safety limit. An alternative option with more shim rods in fuel assemblies was tried with four types of integral burnable absorbers: gadolinia, integral fuel burnable absorber (Ifba), erbium and alumina boron carbide. Four core design candidates have been developed by keeping major engineering designs and preserving equivalent fuel enrichment level used in Ref design. However, all optimal designs were targeted to achieve comparable discharge burnup as well as favorable design safety parameters. The comparative analysis between Ref and optimal core designs is presented here. One of them is suggested as the most promising and favorable low boron core (Lbc) design in this framework. The proper combination of axial and radial enrichment zoning pattern in Lbc design candidate with Ifba-bearing fuel assemblies at equilibrium cycle, could bring 2 times narrower axial offset variation than that of Ref design, and maintain acceptable power peaking factor around 23% lower than

  15. Boron analyses in the reactor coolant system of French PWR by acid-base titration ([B]) and ICP-MS (10B atomic %): key to NPP safety

    International Nuclear Information System (INIS)

    Boron is widely used by Nuclear Power Plants and especially by EDF Pressurized Water Reactors to ensure the control of the neutron rate in the reactor coolant system and, by this way, the fission reaction. The Boron analysis is thus a major factor of safety which enables operators to guarantee the permanent control of the reactor. Two kinds of analyses carried out by EDF on the Boron species, recently upgraded regarding new method validation standards and developed to enhance the measurement quality by reducing uncertainties, will be discussed in this topic: Acid-Base titration of Boron and Boron isotopic composition by Inductively Coupled Plasma Mass Spectrometer - ICP MS. (authors)

  16. Xylem-to-phloem transfer of boron in broccoli and lupin during early reproductive growth

    International Nuclear Information System (INIS)

    The aim of this study was to test the hypothesis that newly-acquired boron (B) undergoes rapid xylem-to-phloem transfer in plants with restricted mobility. Analysis of the element accumulation and water usage by shoots of intact broccoli (Brassica oleracea var. italica Plenck cv. Commander) and lupin (Lupinus albus L. cv. Ultra) plants provided with a non-deficient supply of B, revealed that the concentration of various mineral elements (K, P, Mg, Ca, B, Fe, Zn, Mo, Cu, Mn) in xylem sap of intact plants ranged from 0.3 μM to 3.5 mM, with B being present at 2.9-3.5 μM. For each element assayed, the concentration was higher in phloem exudate (1.6 μM to 91 mM) than in xylem sap; B was present at about 0.4 mM. Intact broccoli and lupin plants or detached transpiring broccoli shoots were supplied simultaneously with enriched 10B, strontium (a xylem marker) and rubidium (a xylem/phloem marker) during early reproductive growth. The contents of these three compounds were determined in foliage and florets or fruits as a function of time (i.e. up to 12 h and 4 days for broccoli and lupin plants, respectively), and the content in florets or fruits was expressed as a percent of the total recovered. In general, the percent recovery of both 10B and rubidium in florets or fruits was similar and markedly greater than that for strontium, even at the earliest harvest times (within 2 h for broccoli and 1 day for lupin). The data indicate that in plants with restricted B mobility, B is supplied to sink tissues in the phloem, and the extent of B xylem-to-phloem transfer is closely determined by current uptake. (au)

  17. Analytical methods for the determination of boron in reactor materials programme

    International Nuclear Information System (INIS)

    Spectrophotometric methods of determination of boron based on the complexation reaction between boric acid and protonated curcumin are briefly reviewed. Direct determination of boron in heavy water, plant leaves, copper and its alloys, and aluminium and its alloys using a modified method of Hayes and Metcalfe is described. A method for determination of boron, when its content is very low as in case of uranium metal, diuranate, uranium oxide and thorium nitrate, is also described. In this method, boron is first separated as methyl borate by distillation of the sample with methanol in acid media. The distilled ester is absorbed by hydroxide solution and boron is analysed after removal of methanol. The precision obtained is indicated. (M.G.B.)

  18. Dietary boron, brain function, and cognitive performance.

    OpenAIRE

    Penland, J G

    1994-01-01

    Although the trace element boron has yet to be recognized as an essential nutrient for humans, recent data from animal and human studies suggest that boron may be important for mineral metabolism and membrane function. To investigate further the functional role of boron, brain electrophysiology and cognitive performance were assessed in response to dietary manipulation of boron (approximately 0.25 versus approximately 3.25 mg boron/2000 kcal/day) in three studies with healthy older men and wo...

  19. A reactivity hold-down strategy for soluble boron free operation by introducing Pu-238 added fuel

    International Nuclear Information System (INIS)

    A new concept of Pu-238 added fuel is introduced to control the reactivity and power distribution in soluble boron free (SBF) pressurized water reactor (PWR) core. Though extensive use of burnable poison and control rods is inevitable for reactivity suppression in SBF core, it causes the core power distribution control to be so difficult that a practical SBF operation is far distant. In this work, it is confirmed that the excess reactivity can be greatly suppressed by introducing the Pu-238 added fuel. As a result of the conceptual core design of the 600 MWe SBF PWR using Pu-238 added fuel, the core reactivity is well controlled in comparison with the results obtained from the earlier 600 MWe SBF core design works. Especially, the axial power shape control is performed successfully with the aid of simple axial zoning scheme, developed in this study, by using Pu-238 enrichment zoning. The Pu-238 added fuel is also tested for 1300 MWe SBF PWR core design, in which the power distribution control can be more difficult than that of smaller plants if soluble boron control is not available. The results show that the core excess reactivity and the power distribution can be well controlled without using soluble boron even in a large-sized PWR. Hence, one of the difficult control problems arising in SBF core design can be greatly mitigated by introducing the new fuel concept. It is further expected that the Pu-238 added fuel, the simple axial zoning scheme, and the control bank operation strategy introduced in this study are directly applicable to practical SBF core design

  20. Banishing brittle bones with boron

    Energy Technology Data Exchange (ETDEWEB)

    A 6-month study indicates that boron, not even considered an essential nutrient for people and animals, may be a key to preventing osteoporosis, say nutritionist Forrest H. Nielsen and anatomist Curtiss D. Hunt at ARS' Grand Forks, North Dakota, Human Nutrition Research Center. They believe the results of the study - the first to look at the nutritional effects of boron in humans - will generate a lot of interest in the element. In the study, 12 postmenopausal women consumed a very low boron diet (0.25 milligrams per day) for 17 weeks then were given a daily 3-mg supplement - representing the boron intake from a well-balanced diet - for 7 more weeks. Within 8 days after the supplement was introduced, the lost 40 percent less calcium, one-third less magnesium, and slightly less phosphorus through the urine. In fact, their calcium and magnesium losses were lower than prestudy levels, when they were on their normal diets. Since boron isn't considered essential for people, there is not recommended intake and no boron supplement on the market. Nielsen says the supplement of sodium borate used in the study was specially prepared based on the amount of boron a person would get from a well-balanced diet containing fruits and vegetables. He says the average boron intake is about 1.5 mg - or half the experimental dose - but average means a lot of people get less and a lot get more. Hunt cautioned that large doses of boron can be toxic, even lethal. The lowest reported lethal dose of boric acid is about 45 grams (1.6 ounces) for an adult and only 2 grams (0.07 ounce) for an infant.

  1. Proceedings of a specialist meeting on boron reactivity transients

    International Nuclear Information System (INIS)

    The CSNI Specialist Meeting on Boron Dilution Reactivity Transients was hosted by the Penn State University in collaboration with the US Nuclear Regulatory Commission and the TRAC Users Group. More than 70 experts from 12 OECD countries, as well as experts from Russia and other non-OECD countries attended the meeting. Thirty papers were presented in five technical sessions. The purpose of the meeting was to bring together experts involved in the different activities related to boron dilution transients. The experts came from all involved parties, including research organizations, regulatory authorities, vendors and utilities. Information was openly shared and discussed on the experimental results, plant and systems analysis, numerical analysis of mixing and probability and consequences of these transients. Regulatory background and licensing implications were also included to provide the proper frame work for the technical discussion. Each of these areas corresponded to a separate session. The meeting focused on the thermal-hydraulic aspects because of the current interest in that subject and the significant amount of new technical information being generated. Three papers of the same conference are already available in INIS as individual reports: Potential for boron dilution during small-break LOCAs in PWRs (Ref. number: 27029412); Analysis of boron dilution in a four-loop PWR (Ref. number: 27051651); Probability and consequences of a rapid boron dilution sequence in a PWR (Ref. number: 27029411)

  2. Development of a method to extend by boron neutron capture process the therapeutic possibilities of a liver autograft

    Science.gov (United States)

    Pinelli, Tazio; Altieri, Saverio; Fossati, F.; Zonta, Aris; Prati, U.; Roveda, L.; Nano, Rosanna

    1997-02-01

    We present results on surgical technique, neutron filed and irradiation facility concerning the original treatment of the liver diffused metastases. Our method plans to irradiate the isolated organ at a thermal neutron field soon after having been explanted and boron enriched and before being grafted into the same donor. In particular the crucial point of boron uptake was investigated by a rat model with a relevant number of procedure. We give for the first time statistically significant results on the selective boron absorption by tumor tissues.

  3. Beyond Job Enrichment to Employment Enrichment

    Science.gov (United States)

    Werther, William B., Jr.

    1975-01-01

    Employment enrichment views the total work environment confronting employees as a system consisting of two overlapping areas: worker-job and worker-organization subsystems. Job enrichment has improved the worker-job subsystem. The focus of this article is on methods of improving the worker-organization relationship. (Author/JB)

  4. New Small LWR Core Designs using Particle Burnable Poisons for Low Boron Concentration

    International Nuclear Information System (INIS)

    The soluble boron has two major important roles in commercial PWR operations : 1) the control of the long-term reactivity to maintain criticality under normal operation, and 2) the shutdown of the reactor under accidents. However, the removal of the soluble boron gives several advantages in SMRs (Small Modular Reactor). These advantages resulted from the elimination of soluble boron include the significant simplification of nuclear power plant through the removal of pipes, pumps, and purification systems. Also, the use of soluble boron mitigates corrosion problems on the primary coolant loop. Furthermore, the soluble boron-free operation can remove an inadvertent boron dilution accident (BDA) which can lead to a significant insertion of positive reactivity. From the viewpoint of core physics, the removal of soluble boron or reduction of soluble boron concentration makes the moderator temperature coefficient (MTC) more negative. From the core design studies using new fuel assemblies, it is shown that the cores have very low critical soluble boron concentrations less than 500ppm, low peaking factors within the design targets, strong negative MTCs over cycles, and large enough shutdown margins both at BOC and EOC. However, the present cores have relatively low average discharge burnups of ∼ 30MWD/kg leading to low fuel economy because the cores use lots of non-fuel burnable poison rods to achieve very low critical boron concentrations. So, in the future, we will perform the trade-off study between the fuel discharge burnup and the boron concentrations by changing fuel assembly design and the core loading pattern

  5. Lattice dynamics of α boron and of boron carbide

    International Nuclear Information System (INIS)

    The atomic structure and the lattice dynamics of α boron and of B4C boron carbide have been studied by Density Functional Theory (D.F.T.) and Density Functional Perturbation Theory (D.F.P.T.). The bulk moduli of the unit-cell and of the icosahedron have been investigated, and the equation of state at zero temperature has been determined. In α boron, Raman diffusion and infrared absorption have been studied under pressure, and the theoretical and experimental Grueneisen coefficients have been compared. In boron carbide, inspection of the theoretical and experimental vibrational spectra has led to the determination of the atomic structure of B4C. Finally, the effects of isotopic disorder have been modeled by an exact method beyond the mean-field approximation, and the effects onto the Raman lines has been investigated. The method has been applied to isotopic alloys of diamond and germanium. (author)

  6. Use of fuel elements and fuel rod arrays of WWER-type with 20 % enriched cermet fuel for reactors of floating power plant KLT-40S

    International Nuclear Information System (INIS)

    It was carried out numerical analysis of the physical characteristics of change from normal active zone to fuel elements and fuel rod arrays using fuel cycle of WWER-1000 type as well as at replacement of oxide fuel to cermet fuel (60%UO2+40% of silumin) with 20% enrichment. At that the main physical characteristics of active zone and reactor are kept - geometric sizes, power, coolant properties etc. It was given the main physical properties of fuel elements and fuel rod arrays of active zone with cermet fuel. Calculation of neutron physical characteristics was carried out. The reactor has internal self-protectability

  7. A new and effective approach to boron removal by using novel boron-specific fungi isolated from boron mining wastewater.

    Science.gov (United States)

    Taştan, Burcu Ertit; Çakir, Dilara Nur; Dönmez, Gönül

    2016-01-01

    Boron-resistant fungi were isolated from the wastewater of a boron mine in Turkey. Boron removal efficiencies of Penicillium crustosum and Rhodotorula mucilaginosa were detected in different media compositions. Minimal Salt Medium (MSM) and two different waste media containing molasses (WM-1) or whey + molasses (WM-2) were tested to make this process cost effective when scaled up. Both isolates achieved high boron removal yields at the highest boron concentrations tested in MSM and WM-1. The maximum boron removal yield by P. crustosum was 45.68% at 33.95 mg l(-1) initial boron concentration in MSM, and was 38.97% at 42.76 mg l(-1) boron for R. mucilaginosa, which seemed to offer an economically feasible method of removing boron from the effluents. PMID:26877036

  8. Nuclear Physics meets Medicine and Biology: Boron Neutron Capture Therapy

    CERN Document Server

    F. Ballarini, F; S. Bortolussi, S; P. Bruschi, P; A.M. Clerici, A M; A. De Bari, A; P. Dionigi, P; C. Ferrari, C; M.A. Gadan, M A; N. Protti, N; S. Stella, S; C. Zonta, C; A. Zonta, A; S. Altieri, S

    2010-01-01

    BNCT is a tumour treatment based on thermal-neutron irradiation of tissues enriched with 10B, which according to the 10B(n, )7Li reaction produces particles with high Linear Energy Transfer and short range. Since this treatment can deliver a therapeutic tumour dose sparing normal tissues, BNCT represents an alternative for diffuse tumours and metastases, which show poor response to surgery and photontherapy. In 2001 and 2003, in Pavia BNCT was applied to an isolated liver, which was infused with boron, explanted, irradiated and re-implanted. A new project was then initiated for lung tumours, developing a protocol for Boron concentration measurements and performing organ-dose Monte Carlo calculations; in parallel, radiobiology studies are ongoing to characterize the BNCT effects down to cellular level. After a brief introduction, herein we will present the main activities ongoing in Pavia including the radiobiological ones, which are under investigation not only experimentally but also theoretically, basing on...

  9. Determination of boron in water solution by an indirect neutron activation technique from a 241Am/Be source

    International Nuclear Information System (INIS)

    Boron content in water solutions has been analysed by Indirect Activation Technique a twin 241Am/Be neutron source with a source strength of 9x106 n/seg. The boron concentration was inferred from the measurement of the activity induced in a vanadium flux monitor. The vanadium rod was located inside the boron solution in a standart geometrical set up with respect to the neutron source. Boron concentrations in the range of 100 to 1000 ppm were determined with an overall accuracy of about 2% during a total analysis time of about 20 minutes. Eventhough the analysis is not selective for boron yet due the rapid, simple and precise nature, it is proposed for the analysis of boron in the primary coolant circuit of Nuclear Power Plants of PWR type. (Author)

  10. Assessment of metal enrichment and their bioavailability in sediment and bioaccumulation by mangrove plant pneumatophores in a tropical (Zuari) estuary, west coast of India.

    Science.gov (United States)

    Noronha-D'Mello, Cheryl A; Nayak, G N

    2016-09-15

    Sediment collected from the estuarine mangroves of the Zuari estuary and Cumbharjua canal were analyzed to assess the concentration, contamination and bioavailability of metals. Mangrove pneumatophores were also analyzed to understand the metal bioaccumulation in mangrove plants. The results indicated the variation of metal concentrations in sediment along the estuary was attributed to changing hydrodynamic conditions, type of sediment and metal sources. Further, speciation studies revealed that Fe, Cr, Co, Ni, Cu and Zn were mainly of lithogenic origin and less bioavailable while high Mn content in the sediment raised concerns over its potential mobility, bioavailability and subsequent toxicity. The mangrove plants exhibited difference in metal accumulation due to variations in sediment parameters and metal availability, in addition to difference in plant species and tissue physiology that affect metal uptake. Moreover, the mangrove plants reflected the quality of the underlying sediment and can be used as a potential bio-indicator tool. PMID:27325605

  11. Structural characterization of electrodeposited boron

    Indian Academy of Sciences (India)

    Ashish Jain; C Ghosh; T R Ravindran; S Anthonysamy; R Divakar; E Mohandas; G S Gupta

    2013-12-01

    Structural characterization of electrodeposited boron was carried out by using transmission electron microscopy and Raman spectroscopy. Electron diffraction and phase contrast imaging were carried out by using transmission electron microscopy. Phase identification was done based on the analysis of electron diffraction patterns and the power spectrum calculated from the lattice images from thin regions of the sample. Raman spectroscopic examination was carried out to study the nature of bonding and the allotropic form of boron obtained after electrodeposition. The results obtained from transmission electron microscopy showed the presence of nanocrystallites embedded in an amorphous mass of boron. Raman microscopic studies showed that amorphous boron could be converted to its crystalline form at high temperatures.

  12. Phosphoprotein Enrichment Combined with Phosphopeptide Enrichment to Identify Putative Phosphoproteins During Defense Response in Arabidopsis thaliana.

    Science.gov (United States)

    Lassowskat, Ines; Hoehenwarter, Wolfgang; Lee, Justin; Scheel, Dierk

    2016-01-01

    Phosphoprotein/peptide enrichment is an important technique to elucidate signaling components of defense responses with mass spectrometry. Normally, proteins can be detected easily by shotgun experiments but the low abundance of phosphoproteins hinders their detection. Here, we describe a combination of prefractionation with desalting, phosphoprotein and phosphopeptide enrichment to effectively accumulate phosphorylated proteins from leaf tissue of stressed Arabidopsis plants. PMID:26867639

  13. Development of a boron-copper neutron absorber composite

    International Nuclear Information System (INIS)

    This report describes the fabrication of a new boron-copper neutron absorbing material that was developed to meet the upgrading needs of the Intense Pulsed Neutron Source (IPNS) at Argonne National Laboratory. To increase the intensity of the neutron beams from the IPNS, the target uranium was changed from depleted uranium to uranium enriched to 77.5% 235U. To keep the multiplication factor, keff (number of fissions in one generation/number of fissions in preceding generation) at a safe level, a new neutron absorber material was needed. The previous materials, boral and cadmium, could not meet the new requirements and a search of the literature showed that no currently available material was acceptable. With previous powder metallurgy used as a base, the composite was fabricated with 43 vol. % 10B (81% enriched 10B) and the balance copper and voids. The powder metallurgy techniques was followed by hot-rolling the composite to a sheet. The material composed of boron particles dispersed in a pure copper matrix and clad with pure copper on both sides, exhibits the following properties: Loadings up to 43 vol. % boron, with the balance copper and voids. A loading of 0.5 x 102210B atoms/cm2 in sections as thin as 0.067 in. (1.7 mm), with copper cladding as thin as 0.010 in. (0.25 mm). Formability to radii as small as 2.1 in. (53.3 mm). No observed reaction between boron and the copper matrix and cladding at temperatures up to 900 degrees C for times as long as 7 h. Retains structural integrity at 900 degrees C

  14. Enrichment technology. Dependable vendor of gas centrifuges

    International Nuclear Information System (INIS)

    Enrichment Technology is an innovative, high-tech company that develops, manufactures and installs gas centrifuges for enriching uranium. In addition, Enrichment Technology designs enrichment plants that use gas centrifuge technology. This technology offers the most efficient and cost-effective method for enriching uranium yet: high-performance, safe technology that dominates the market with a global share of 45 percent. A determining factor in Enrichment Technology's success is its mission: supplying its customers with safe, reliable technology. Production of the centrifuges requires versatile know-how and collaboration between different departments as well as interdisciplinary teams at the various sites. More than 2000 operators at 8 sites in 5 countries contribute their individual knowledge and personal skills in order to produce this exceptional technology. The head office is in Beaconsfield near London and the operational headquarters are in Almelo in the Netherlands. There are other sites in Germany (Juelich und Gronau), Great Britain (Capenhurst) as well as project sites in the USA and France. Capenhurst is where experienced engineers design new enrichment plants and organise their construction. Centrifuge components are manufactured in Almelo and Juelich, while the pipework needed to connect up the centrifuges is produced at the site in Gronau. In Juelich, highly qualified scientists in interdisciplinary teams are continuously researching ways of improving the current centrifuges. Communication between specialists in the fields of chemistry, physics and engineering forms the basis for the company's success and the key to extending this leading position in the global enrichment market. (orig.)

  15. CO2浓度升高对植物种子萌发及叶片的影响%THE IMPACTS OF CO2 CONCENTRATION ENRICHMENT ON PLANT SEED GERMINATION AND LEAF

    Institute of Scientific and Technical Information of China (English)

    高素华; 郭建平; 毛飞; 白月明

    2000-01-01

    利用OTC-1型开顶式气室进行了CO2浓度对植物种子发芽率、发芽势以及叶片形态结构的影响试验研究。结果表明:CO2浓度升高对发芽率影响不大,但发芽势明显增高,CO2浓度有加速种子萌发的作用。CO2浓度升高对C3作物叶面积、叶干物重增加显著,C4作物增加不明显;随着CO2浓度升高,C3作物叶片气孔密度变小,C4作物(玉米)呈相反趋势;水分胁迫使气孔密度增加;CO2浓度升高,气孔阻力增大,蒸腾速率下降。%The experimental study on the impacts of CO2 concentration on plant seed germination percentage, germination energy and leaf structure is conducted by using OTC-1 Open Top Chambers. The results show that the impact of CO2 concentration enrichment on germination percentage is small, but the increase in germination energy is remarkable. The CO2 concentration enrichment can quicken seed germination. CO2 concentration enrichment can apparently increase leaf area and dry weight of C3 crops, but it is not significant for C4 crops. With CO2 concentration enrichment, the leaf stoma density becomes small for C3 crops, but it shows the opposite tendency for C4 crops (maize). The soil water stress leads to the increase in stoma density. With the CO2 concentration enrichment, the stoma resistance will be increased, but the transpiration will be decreased.

  16. Optimization of chemistry in PWR and VVER Nuclear Power Plants

    International Nuclear Information System (INIS)

    Potential improvements for PWR and VVER operation are proposed: pH optimization in the primary coolant in order to minimize corrosion product transport/deposition and associated dosimetry, Crud Induced Power Shifts (CIPS, previously named AOA), fuel failure; use of EBA (enriched Boron 10) to easily optimize above described pH, particularly with the larger use of higher fuel enrichments; zinc addition in the RCS; secondary water chemistry specifications depending on the steam generator tubing materials and design for minimizing corrosion risk while keeping a sufficient plant availability and decreasing environmental impacts; amine selection for the secondary system for mitigating steam generator tube fouling, power loss and maintenance costs as well as corrosion risks; overall operating chemistry options to minimize environmental impacts, such as elimination of condensate polishers, optimum ion exchange resin use. (N.T.)

  17. Boron diffusion in silicon devices

    Science.gov (United States)

    Rohatgi, Ajeet; Kim, Dong Seop; Nakayashiki, Kenta; Rounsaville, Brian

    2010-09-07

    Disclosed are various embodiments that include a process, an arrangement, and an apparatus for boron diffusion in a wafer. In one representative embodiment, a process is provided in which a boric oxide solution is applied to a surface of the wafer. Thereafter, the wafer is subjected to a fast heat ramp-up associated with a first heating cycle that results in a release of an amount of boron for diffusion into the wafer.

  18. Experiments in connection with control of boron acid concentration by ion exchange in Hungary

    International Nuclear Information System (INIS)

    The results obtained with an experimental nuclear power plant output control with boron acid ion exchange technology are presented. The dependence of the ability of the ion exchanger to bind boron acid on the concentration of the boron acid solution, the temperature and the degree of the alkalinity of the resin has been studied. The results obtained for Hungarian resins are compared with those for some Duolite-type ones. Some results for a control system realized in big laboratory size are outlined. (K.A.)

  19. The Boron Efflux Transporter ROTTEN EAR Is Required for Maize Inflorescence Development and Fertility[C][W][OPEN

    Science.gov (United States)

    Chatterjee, Mithu; Tabi, Zara; Galli, Mary; Malcomber, Simon; Buck, Amy; Muszynski, Michael; Gallavotti, Andrea

    2014-01-01

    Although boron has a relatively low natural abundance, it is an essential plant micronutrient. Boron deficiencies cause major crop losses in several areas of the world, affecting reproduction and yield in diverse plant species. Despite the importance of boron in crop productivity, surprisingly little is known about its effects on developing reproductive organs. We isolated a maize (Zea mays) mutant, called rotten ear (rte), that shows distinct defects in vegetative and reproductive development, eventually causing widespread sterility in its inflorescences, the tassel and the ear. Positional cloning revealed that rte encodes a membrane-localized boron efflux transporter, co-orthologous to the Arabidopsis thaliana BOR1 protein. Depending on the availability of boron in the soil, rte plants show a wide range of phenotypic defects that can be fully rescued by supplementing the soil with exogenous boric acid, indicating that rte is crucial for boron transport into aerial tissues. rte is expressed in cells surrounding the xylem in both vegetative and reproductive tissues and is required for meristem activity and organ development. We show that low boron supply to the inflorescences results in widespread defects in cell and cell wall integrity, highlighting the structural importance of boron in the formation of fully fertile reproductive organs. PMID:25035400

  20. Boron Fullerenes: A First-Principles Study

    Directory of Open Access Journals (Sweden)

    Gonzalez Szwacki Nevill

    2007-01-01

    Full Text Available AbstractA family of unusually stable boron cages was identified and examined using first-principles local-density functional method. The structure of the fullerenes is similar to that of the B12icosahedron and consists of six crossing double-rings. The energetically most stable fullerene is made up of 180 boron atoms. A connection between the fullerene family and its precursors, boron sheets, is made. We show that the most stable boron sheets are not necessarily precursors of very stable boron cages. Our finding is a step forward in the understanding of the structure of the recently produced boron nanotubes.

  1. Uranium Enrichment, an overview

    International Nuclear Information System (INIS)

    This general presentation on uranium enrichment will be followed by lectures on more specific topics including descriptions of enrichment processes and assessments of the prevailing commercial and industrial situations. I shall therefore avoid as much as possible duplications with these other lectures, and rather dwell on: some theoretical aspects of enrichment in general, underlying the differences between statistical and selective processes, a review and comparison between enrichment processes, remarks of general order regarding applications, the proliferation potential of enrichment. It is noteworthy that enrichment: may occur twice in the LWR fuel cycle: first by enriching natural uranium, second by reenriching uranium recovered from reprocessing, must meet LWR requirements, and in particular higher assays required by high burn up fuel elements, bears on the structure of the entire front part of the fuel cycle, namely in the conversion/reconversion steps only involving UF6 for the moment. (author). tabs., figs., 4 refs

  2. Use of calcium and boron in the production of grain and sunflower silage

    OpenAIRE

    Thomas Newton Martin; Paulo Sergio Pavinato; Luis Fernando Glassenap de Menezes; Luis Antônio Santi; Patricia Bertoncelli; Sidney Ortiz

    2014-01-01

    Boron and calcium are related to many physiological processes of the plant, which are affected by its deficiency, such as sugar transport, synthesis and cell wall structure, carbohydrate metabolism and plasma membrane integrity. The objective of this study was to evaluate the efficiency of boron and calcium application via leaf and soil on the yield components in silage quality and content of macronutrients in leaves of sunflower. The experiment was conducted at Universidade Tecnológica Feder...

  3. The genome of the of the generalist plant pathogenic fungus Fusarium avenaceum is enriched with genes involved in redox, signaling and secondary metabolism

    Science.gov (United States)

    Fusarium avenaceum is a fungus commonly isolated from soil and with a wide range of host plants. We present here three genome sequences of F. avenaceum, one isolated from barley in Finland and two from spring and winter wheat in Canada. The physical sizes of the three genomes range from 41.6-43.2 MB...

  4. Preliminary results of a new boron coated neutron detector

    Energy Technology Data Exchange (ETDEWEB)

    Gervino, G., E-mail: gervino@to.infn.it [Dipartimento di Fisica Università di Torino (Italy); INFN Torino (Italy); Balma, M.; Devona, D. [SELEX Galileo, San Maurizio Canavese, TO (Italy); Lavagno, A. [Dipartimento di Fisica Politecnico di Torino (Italy); INFN Torino (Italy); Palmisano, C. [Dipartimento di Fisica Università di Torino (Italy); Zamprotta, L. [Dipartimento di Fisica Università di Torino (Italy); INFN Torino (Italy); Scarfone, A. [ISC-CNR Torino (Italy); INFN Torino (Italy); Tintori, C. [C.A.E.N. S.p.A., Viareggio, LU (Italy)

    2013-08-01

    The proliferation of neutron detection applications based upon {sup 3}He counter has triggered a critical shortage of {sup 3}He gas. Nowadays there is an increasing demand for alternative neutron detectors that can cover large solid angles, have low sensitivity to gamma background and low cost. We present a low cost neutron detector based upon 3 cm diameter, 150 cm long cylindrical metal tube coated on the inside with a thin layer of {sup 10}B-enriched boron carbide ({sup 10}B{sub 4}C) fulfilled by 1 atm nitrogen.

  5. Avalanche proton-boron fusion based on elastic nuclear collisions

    Science.gov (United States)

    Eliezer, Shalom; Hora, Heinrich; Korn, Georg; Nissim, Noaz; Martinez Val, Josè Maria

    2016-05-01

    Recent experiments done at Prague with the 600 J/0.2 ns PALS laser interacting with a layer of boron dopants in a hydrogen enriched target have produced around 109 alphas. We suggest that these unexpected very high fusion reactions of proton with 11B indicate an avalanche multiplication for the measured anomalously high nuclear reaction yields. This can be explained by elastic nuclear collisions in the broad 600 keV energy band, which is coincident with the high nuclear p-11B fusion cross section, by the way of multiplication through generation of three secondary alpha particles from a single primarily produced alpha particle.

  6. Status report on uranium enrichment associates

    International Nuclear Information System (INIS)

    Uranium Enrichment Associates (UEA) had as its priority project financing, an approach in which the total project is financially self-liquidating. UEA worked with financial institutions to define the combination of assurances and guarantees required by lenders in order to provide the required debt funding. UEA's assets against which the debt liability for the plant would be balanced would be the facilities under construction and the equipment on order. On the customer side, there was major concern on the part of the utilities of whether private industry would be able to complete and operate the plant owing to many of the same possibilities which concerned financial institutions. The disparity between the conditions under which financing could be obtained and the terms acceptable to utilities was a significant element in EUA's choice of process to use for its enrichment plants. UEA's technical staff then began to parallel conceptual designs of gaseous diffusion and gas cenrifuge plants. UEA negotiated with ERDA on the terms of a Cooperative Arrangement, within the provisions of the NFAA, providing the minimum conditions necessary to obtain financing and contracts with utilities for enrichment sources. The UEA plant has several features different from the ERDA plants. The UEA plant used only two basic stage sizes. The UEA design employed four main process buildings. The partners in UEA have mutually agreed to follow the private uranium enrichment project to a logical conclusion. 6 figures

  7. Cubic boron nitride: a new prospective material for ultracold neutron application

    CERN Document Server

    Sobolev, Yu; Borisov, Yu; Daum, M; Fresne, N du; Goeltl, L; Hampel, G; Heil, W; Knecht, A; Keunecke, M; Kratz, J V; Lang, T; Meister, M; Plonka-Spehr, Ch; Pokotilovski, Yu; Reichert, P; Schmidt, U; Krist, Th; Wiehl, N; Zenner, J

    2009-01-01

    For the first time, the neutron optical wall-potential of natural cubic boron nitride (cBN) was measured at the ultracold neutron (UCN) source of the research reactor TRIGA Mainz using the time-of-flight method (TOF). The samples investigated had a wall-potential of (305 +/- 15) neV. This value is in good agreement with the result extracted from neutron reflectometry data and theoretical expectations. Because of its high critical velocity for UCN and its good dielectric characteristics, cubic boron nitride coatings (isotopically enriched) will be useful for a number of applications in UCN experiments.

  8. Environmental signatures of enrichment facilities

    International Nuclear Information System (INIS)

    Environmental sampling is a potentially useful tool that could be used for the detection of undeclared enrichment facilities. However, this would be likely to require the use of sophisticated and expensive analytical techniques to evaluate 235U/238U ratios. It would be, therefore, unlikely to be an inexpensive approach to detect proliferation. The probability of detecting an enrichment operation will depend on the type of facility. A gaseous diffusion operation will be relatively difficult to detect in relation to an EMIS facility and a gaseous centrifuge plant will be more difficult still. Releases from an enrichment operation are likely to be restricted to atmospheric discharges. Aquatic discharges would be relatively easy to contain and it would be unwise to devise a sampling strategy based on the measurement of these. The detection of atmospheric discharges is likely to be dependent on meteorological conditions, in particular stability. Stable atmospheric conditions are the most favourable for detecting releases at significant distances from the plant. Given stable conditions, detection of an EMIS facility might be possible at a distance of several 10s of km

  9. Wettability of boron carbide

    International Nuclear Information System (INIS)

    The wettability of boron carbide has been examined by means of the sessile drop method, using the following candidate alloys: (96wt%AG-4wt%Ti), (Ag-26.5wt%Cu-3wt%Ti), (Sn-10wt%Ag-4wt%Ti), Sn(99.95wt%) and Al(99.99wt%). The results show that B4C is completely wetted by the Ag-based alloys. Sn-10wt%Ag-4wt%Ti alloy and pure Al partly wet the B4C surface, while pure Sn does not wet B4C at all. For all the alloys used, except pure Sn, a reaction layer was observed at the interface between the ceramic part and the metal drop. Although the spreading kinetics of the Al-drop was much slower compared with the Ti-containing alloys, the reaction rate was considerably higher in the former case. This suggests that aluminium is an attractive candidate material for brazing of B4C. Formation of the low melting B2O3 at the B4C surface may cause oxidation of the filler metal during joining, which, in turn, leads to a low bond strength

  10. Distribution of equilibrium burnup for an homogeneous core with fuel elements of slightly enriched uranium (0.85% U-235) at Atucha I nuclear power plant

    International Nuclear Information System (INIS)

    At Atucha I, the present fuel management with natural uranium comprises three burnup areas and one irradiation path, sometimes performing four steps in the reactor core, according to the requirements. The discharge burnup is 6.0 Mw d/kg U for a waste reactivity of 6.5 m k and a heavy water purity of 99.75%. This is a preliminary study to obtain the distribution of equilibrium burnup of an homogeneous core with slightly enriched uranium (0.85% by weight U-235), using the time-averaged method implemented in the code PUMA and a representative model of one third of core and fixed rod position. It was found a strategy of three areas and two paths that agrees with the present limits of channel power and specific power in fuel rod. The discharge burnup obtained is 11.6 Mw d/kg U. This strategy is calculated with the same method and a full core representation model is used to verify the obtained results. (Author)

  11. Re-translocation of boron in broccoli and lupin during early reproductive growth

    International Nuclear Information System (INIS)

    The objective of the present study was to determine if boron (B) re-translocation depends on plant-B status and external-B supply. The stable 10B isotope was supplied to the root system of broccoli (Brassica oleracea var. italica Plenck cv. Commander) and lupin (Lupinus albus L. cv. Ultra) plants to provide a quantitative picture of B distribution during early reproductive development. Regardless of the B regime (i.e. continuous supply with luxury, sufficient or deficient B; transfer at influorescence emergence from either a luxury- or sufficient-B supply to a deficient one) and whether 10B was acquired before or during influorescence development, a significant proportion of the B recovered in broccoli florest and lupin fruit was 10B enriched. B acquired during inflorescence development was an important source of B for reproductive structures, but the relative importance of B acquired before and after inflorescence emergence appeared to be species dependent. The occurrence of B re-translocation was not dependent upon the induction of B deficiency. The concentrations of B in phloem exsudates (0.38 to 0.03 mM) were 4- to 23-fold those in xylem sap, and more similar to the concentrations in the reproductive structures (0.86 to 0.07 mM) than those in source leaves (2.4 to 0.19 mM). The decreasing acropetal gradient of tissue-B concentrations with luxury-B supply declined dramatically or was reversed in plants grown with sufficient or deficient B. The data are consistent with B being a phloem-mobile element, and suggest that newly acquired B is particularly important during the early reproductive growth of plants. (au) 36 refs

  12. Profile of World Uranium Enrichment Programs - 2007

    Energy Technology Data Exchange (ETDEWEB)

    Laughter, Mark D [ORNL

    2007-11-01

    It is generally agreed that the most difficult step in building a nuclear weapon is acquiring weapons grade fissile material, either plutonium or highly enriched uranium (HEU). Plutonium is produced in a nuclear reactor, while HEU is produced using a uranium enrichment process. Enrichment is also an important step in the civil nuclear fuel cycle, in producing low enriched uranium (LEU) for use in fuel for nuclear reactors. However, the same equipment used to produce LEU for nuclear fuel can also be used to produce HEU for weapons. Safeguards at an enrichment plant are the array of assurances and verification techniques that ensure uranium is only enriched to LEU, no undeclared LEU is produced, and no uranium is enriched to HEU or secretly diverted. There are several techniques for enriching uranium. The two most prevalent are gaseous diffusion, which uses older technology and requires a lot of energy, and gas centrifuge separation, which uses more advanced technology and is more energy efficient. Gaseous diffusion plants (GDPs) provide about 40% of current world enrichment capacity, but are being phased out as newer gas centrifuge enrichment plants (GCEPs) are constructed. Estimates of current and future enrichment capacity are always approximate, due to the constant upgrades, expansions, and shutdowns occurring at enrichment plants, largely determined by economic interests. Currently, the world enrichment capacity is approximately 53 million kg-separative work units (SWU) per year, with 22 million in gaseous diffusion and 31 million in gas centrifuge plants. Another 23 million SWU/year of capacity are under construction or planned for the near future, almost entirely using gas centrifuge separation. Other less-efficient techniques have also been used in the past, including electromagnetic and aerodynamic separations, but these are considered obsolete, at least from a commercial perspective. Laser isotope separation shows promise as a possible enrichment technique

  13. Thermal conductivity of boron carbide-boron nitride composites

    International Nuclear Information System (INIS)

    This paper reports that because of their preferred orientation, the addition of boron nitride dispersions to hot-pressed boron carbide was found to result in a considerable degree of anisotropy in thermal conductivity of the resulting composite, indicated by an increase in the thermal conductivity perpendicular to the hot-pressing direction by as much as a factor of 3 at the highest boron nitride volume fractions of this study, and a decrease in the thermal conductivity parallel to the hot-pressing direction by as much as a factor of 2. The composite data were found to be below the values expected from composite theory, which may represent indirect evidence for the existence of an interfacial thermal barrier

  14. Boron carbide nanolumps on carbon nanotubes

    Science.gov (United States)

    Lao, J. Y.; Li, W. Z.; Wen, J. G.; Ren, Z. F.

    2002-01-01

    Boron carbide nanolumps are formed on the surface of multiwall carbon nanotubes by a solid-state reaction between boron and carbon nanotubes. The reaction is localized so that the integrity of the structure of carbon nanotubes is maintained. Inner layers of multiwall carbon nanotubes are also bonded to boron carbide nanolumps. These multiwall carbon nanotubes with boron carbide nanolumps are expected to be the ideal reinforcing fillers for high-performance composites because of the favorable morphology.

  15. Advanced enrichment techniques

    International Nuclear Information System (INIS)

    BNFL is in a unique position in that it has commercial experience of diffusion enrichment, and of centrifuge enrichment through its associate company Urenco. In addition BNFL is developing laser enrichment techniques as part of a UK development programme in this area. The paper describes the development programme which led to the introduction of competitive centrifuge enrichment technology by Urenco and discusses the areas where improvements have and will continue to be made in the centrifuge process. It also describes the laser development programme currently being undertaken in the UK. The paper concludes by discussing the relative merits of the various methods of uranium enrichment, with particular reference to the enrichment market likely to obtain over the rest of the century. (author)

  16. Uranium enrichment: an overview

    International Nuclear Information System (INIS)

    This paper is a general presentation of uranium enrichment processes and assessments of the prevailing commercial and industrial situations. It gives first some theoretical aspects of enrichment in general and explains the differences between statistical and selective processes in particular. Then a review of the different processes is made with a comparison between them. Finally, some general remarks concerning applications are given and the risks of proliferation related to enrichment are mentioned. (J.S.). 4 refs., 5 figs., 8 tabs

  17. Boron doping a semiconductor particle

    Science.gov (United States)

    Stevens, Gary Don; Reynolds, Jeffrey Scott; Brown, Louanne Kay

    1998-06-09

    A method (10,30) of boron doping a semiconductor particle using boric acid to obtain a p-type doped particle. Either silicon spheres or silicon powder is mixed with a diluted solution of boric acid having a predetermined concentration. The spheres are dried (16), with the boron film then being driven (18) into the sphere. A melt procedure mixes the driven boron uniformly throughout the sphere. In the case of silicon powder, the powder is metered out (38) into piles and melted/fused (40) with an optical furnace. Both processes obtain a p-type doped silicon sphere with desired resistivity. Boric acid is not a restricted chemical, is inexpensive, and does not pose any special shipping, handling, or disposal requirements.

  18. Enriched coalgebraic modal logic

    OpenAIRE

    Wilkinson, Toby

    2013-01-01

    We formalise the notion of enriched coalgebraic modal logic, and determine conditions on the category V (over which we enrich), that allow an enriched logical connection to be extended to a framework for enriched coalgebraic modal logic. Our framework uses V-functors L: A ? A and T: X ? X, where L determines the modalities of the resulting modal logics, and T determines the coalgebras that provide the semantics. We introduce the V-category Mod(A, ?) of models for an L-algebra (A, ?), and ...

  19. Carbon isotope signatures of latest Permian marine successions of the Southern Alps suggest a continental runoff pulse enriched in land plant material

    Directory of Open Access Journals (Sweden)

    S. H. Kraus

    2013-02-01

    Full Text Available The latest Permian mass extinction, the most severe Phanerozoic biotic crisis, is marked by dramatic changes in palaeoenvironments. These changes significantly disrupted the global carbon cycle, reflected by a prominent and well known negative carbon isotope excursion recorded in marine and continental sediments. Carbon isotope trends of bulk carbonate and bulk organic matter in marine deposits of the European Southern Alps near the low-latitude marine event horizon deviate from each other. A positive excursion of several permil in δ13Corg starts earlier and is much more pronounced than the short-term positive 13Ccarb excursion; both excursions interrupt the general negative trend. Throughout the entire period investigated, 13Corg values become lighter with increasing distance from the palaeocoastline. Changing 13Corg values may be due to the influx of comparatively isotopically heavy land plant material. The stronger influence of land plant material on the 13Corg during the positive isotope excursion indicates a temporarily enhanced continental runoff that may either reflect increased precipitation, possibly triggered by aerosols originating from Siberian Trap volcanism, or indicate higher erosion rate in the face of reduced land vegetation cover. doi:10.1002/mmng.201300004

  20. Crescimento e índices de troca gasosa em plantas de pepino irrigadas com água enriquecida com CO2 Growth analysis and gaseous exchange in cucumber plants irrigated with carbon dioxide enriched water

    Directory of Open Access Journals (Sweden)

    Kathia A.L. Canizares

    2004-12-01

    physiological indices and gaseous exchange of leaves of Japanese cucumber plants. The experimental design was of randomized blocks, with four and five replications. The treatments consisted of the hybrids Hokuho and Tsuyataro, irrigated with water enriched or not with CO2, 1‰ in the first semester and 0,25‰ in the second. Dry mass weight and leaf area presented an exponential tendency. The beginning of mass production decrease on dry matter, 63 days after transplanting date (DAT, was not possible to be observed. The growth rate and relative growth rate response of hybrid Hokuho differed between treatments, however, for hybrid Tsuyataro the response was similar. The net assimilation rate reached the pending maxim in the phase of vegetative growth and flowering, and was reduced drastically after 20 DAT for hybrid Hokuho, and after the 35 DAT for hybrid Tsuyataro. The leaf area rate from both hybrids decreases lightly during the cultivation, without differences between enriched and non enriched water after 20 DAT. The CO2 assimilation transpiration rate, stomatal conductance and water use efficiency were similar among plants irrigated with enriched and non enriched water during the first semester. Already in the second semester, higher values were observed in plants irrigated with enriched water.

  1. Boron steel. I Part. Preparation

    International Nuclear Information System (INIS)

    With the advent of the first nuclear reactors arise the need for control rods and shielding duties for some types of radiations. One of the materials used for this purpose has been the high boron steel. This paper describes the melting and casting procedures employed for the production, at laboratory scale, of steels with Boron content ranging from 1 to 4 per cent, as well as the metallographic and X-Ray techniques used for the identification of the present phases. The electrolytic technique employed for the isolation of the Fe2B phase and its subsequent X-Ray identification has proved to be satisfactory. (Author) 11 refs

  2. Shear amorphization of boron suboxide

    International Nuclear Information System (INIS)

    We report for the first time the shear-induced local amorphization of boron suboxide subjected to nanoindentation. The amorphous bands have a width of ∼1–3 nm and a length of 200–300 nm along the (01¯11) crystal plane. We show direct experimental evidence that the amorphous shear bands of boron suboxide are driven from the coalescence of dislocation loops under high shear stresses. These observations provide insights into the microscopic deformation and failure of high-strength and lightweight ceramics

  3. Thermal conductivity of boron carbides

    Science.gov (United States)

    Wood, C.; Emin, D.; Gray, P. E.

    1985-01-01

    Knowledge of the thermal conductivity of boron carbide is necessary to evaluate its potential for high-temperature thermoelectric energy conversion applications. Measurements have been conducted of the thermal diffusivity of hot-pressed boron carbide BxC samples as a function of composition (x in the range from 4 to 9), temperature (300-1700 K), and temperature cycling. These data, in concert with density and specific-heat data, yield the thermal conductivities of these materials. The results are discussed in terms of a structural model that has been previously advanced to explain the electronic transport data. Some novel mechanisms for thermal conduction are briefly discussed.

  4. Mechanical properties of boron coatings

    International Nuclear Information System (INIS)

    Internal stress of coatings will cause reliability problems, such as adhesion failure and peeling. We measured the internal stress in boron coatings, which was prepared by the ion plating method, with an apparatus based on the optically levered laser technique. The boron coatings exhibited large compressive stress in the range from -0.5 GPa to -2.6 GPa. It was found that these compressive stresses were decreasing functions of the deposition rate and were increasing functions of the ion bombardment energy. ((orig.))

  5. Boron-enhanced diffusion of boron from ultralow-energy boron implantation

    International Nuclear Information System (INIS)

    The authors have investigated the diffusion enhancement mechanism of BED (boron enhanced diffusion), wherein the boron diffusivity is enhanced three to four times over the equilibrium diffusivity at 1,050 C in the proximity of a silicon layer containing a high boron concentration. It is shown that BED is associated with the formation of a fine-grain polycrystalline silicon boride phase within an initially amorphous Si layer having a high B concentration. For 0.5 keV B+, the threshold implantation dose which leads to BED lies between 3 x 1014 and of 1 x 1015/cm-2. Formation of the shallowest possible junctions by 0.5 keV B+ requires that the implant dose be kept lower than this threshold

  6. Incorporation and characterization of boron neutron capture therapy agents into mesoporous silicon and silicon nanowires

    International Nuclear Information System (INIS)

    The tunable pore size, biodegradability, and surface chemistry of mesoporous silicon (BioSilicon trademark) are important to a broad spectrum of uses for drug delivery. For the case of Boron Neutron Capture Therapy (BNCT), encapsulation of a given boron-containing drug molecule within a porous BioSilicon trademark microparticle provides a vehicle for a brachytherapy method that avoids the necessity of drug modification. In this work, the loading and characterization of three clinically approved BNCT drugs into mesoporous Si is demonstrated. Because of difficulties associated with light element detection, a method based on a Beer's Law analysis of selected FTIR vibrational bands has been developed to estimate boron-containing drug loading in these materials. As a complementary nanostructural platform, a cathodic deposition process for the surface enriched growth of selected drugs onto the surface of silicon nanowires is also described. (copyright 2009 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  7. Synthesis and biological evaluation of boronated polyglycerol dendrimers as potential agent for neutron capture therapy

    International Nuclear Information System (INIS)

    In this work, the polyglycerol dendrimer (PGLD) generation 5 was used to obtain a boronated macromolecule for boron neutron capture therapy. The PGLD dendrimer was synthesized by the ring opening polymerization of deprotonated glycidol using polyglycerol as core functionality in a step-growth processes denominated divergent synthesis. The PGLD dendritic structure was confirmed by gel permeation chromatography, nuclear magnetic resonance (1H-NMR, 13C-NMR) and matrix assisted laser desorption/ionization techniques. The synthesized dendrimer presented low dispersion in molecular weights (Mw/Mn = 1.05) and a degree of branching of 0.82, which characterize the polymer dendritic structure. Quantitative neutron capture radiography was used to investigate the boron-10 enrichment of the polyglycerol dendrimer. The in vitro cytotoxicity to Chinese hamster ovary cells of 10B-PGLD dendrimer indicate lower cytotoxicity, suggesting that the macromolecule is a biocompatible material. (author)

  8. Incorporation and characterization of boron neutron capture therapy agents into mesoporous silicon and silicon nanowires

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Ke; Coffer, Jeffery L. [Department of Chemistry, Texas Christian University, Fort Worth, TX 76129 (United States); Loni, Armando; Canham, Leigh T. [PSi Medica Ltd., Malvern, Worcestershire, WR14 3SZ (United Kingdom); Intrinsiq Materials Ltd., Malvern, Worcestershire, WR14 3SZ (United Kingdom)

    2009-06-15

    The tunable pore size, biodegradability, and surface chemistry of mesoporous silicon (BioSilicon trademark) are important to a broad spectrum of uses for drug delivery. For the case of Boron Neutron Capture Therapy (BNCT), encapsulation of a given boron-containing drug molecule within a porous BioSilicon trademark microparticle provides a vehicle for a brachytherapy method that avoids the necessity of drug modification. In this work, the loading and characterization of three clinically approved BNCT drugs into mesoporous Si is demonstrated. Because of difficulties associated with light element detection, a method based on a Beer's Law analysis of selected FTIR vibrational bands has been developed to estimate boron-containing drug loading in these materials. As a complementary nanostructural platform, a cathodic deposition process for the surface enriched growth of selected drugs onto the surface of silicon nanowires is also described. (copyright 2009 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  9. Ferrocenyl-substituted Schiff base complexes of boron: Synthesis, structural, physico-chemical and biochemical aspects

    Science.gov (United States)

    Yadav, Sunita; Singh, R. V.

    2011-01-01

    Biological important complexes of boron(III) derived from 1-acetylferrocenehydrazinecarboxamide (L 1H), 1-acetylferrocenehydrazinecarbothioamide (L 2H) and 1-acetylferrocene carbodithioic acid (L 3H) have been prepared and investigated using a combination of microanalytical analysis, melting point, electronic, IR, 1H NMR and 13C NMR spectral studies, cyclic voltammetry and X-ray powder diffraction studies. Boron isopropoxide interacts with the ligands in 1:1, 1:2 and 1:3 molar ratios (boron:ligand) resulting in the formation of coloured products. On the basis of conductance and spectral evidences, tetrahedral structures for boron(III) complexes have been assigned. The ligands are coordinated to the boron(III) via the azomethine nitrogen atom and the thiolic sulfur atom/enolic oxygen atom. On the basis of X-ray powder diffraction study one of the representative boron complex was found to have orthorhombic lattice, having lattice parameters: a = 9.9700, b = 15.0000 and c = 7.0000. Both the ligands and their complexes have been screened for their biological activity on several pathogenic fungi and bacteria and were found to possess appreciable fungicidal and bactericidal properties. Plant growth regulating activity of one of the ligand and its complexes has also been recorded on gram plant, and results have been discussed.

  10. Analytical boron diffusivity model in silicon for thermal diffusion from boron silicate glass film

    Science.gov (United States)

    Kurachi, Ikuo; Yoshioka, Kentaro

    2015-09-01

    An analytical boron diffusivity model in silicon for thermal diffusion from a boron silicate glass (BSG) film has been proposed in terms of enhanced diffusion due to boron-silicon interstitial pair formation. The silicon interstitial generation is considered to be a result of the silicon kick-out mechanism by the diffused boron at the surface. The additional silicon interstitial generation in the bulk silicon is considered to be the dissociation of the diffused pairs. The former one causes the surface boron concentration dependent diffusion. The latter one causes the local boron concentration dependent diffusion. The calculated boron profiles based on the diffusivity model are confirmed to agree with the actual diffusion profiles measured by secondary ion mass spectroscopy (SIMS) for a wide range of the BSG boron concentration. This analytical diffusivity model is a helpful tool for p+ boron diffusion process optimization of n-type solar cell manufacturing.

  11. Uranium enrichment. Principles

    International Nuclear Information System (INIS)

    Uranium enrichment industry is a more than 60 years old history and has developed without practically no cost, efficiency or profit constraints. However, remarkable improvements have been accomplished since the Second World War and have led to the development of various competing processes which reflect the diversity of uranium compositions and of uranium needs. Content: 1 - general considerations: uranium isotopes, problem of uranium enrichment, first realizations (USA, Russia, Europe, Asia, other countries), present day situation, future needs and market evolution; 2 - principles of isotopic separation: processes classification (high or low enrichment), low elementary enrichment processes, equilibrium time, cascade star-up and monitoring, multi-isotopes case, uranium reprocessing; 3 - enrichment and proliferation. (J.S.)

  12. 利用富氧技术提高硫回收装置的处理能力和效率%Oxygen enrichment technology for process capacity and efficiency enhancement in sulphur plants

    Institute of Scientific and Technical Information of China (English)

    M.BAERENDS; J.S.FLOWERS; V.W.WONG; T.K.CHOW; 王爱群

    2011-01-01

    By replacing some or all of the nitrogen present in combustion air with oxygen,flow rates though the SRU/TGTU can be substantially reduced.In the design of a new unit,this translates to smaller equipment and thus a reduced capital cost.When applied to a revamp,oxygen enrichment can provide a cost-effective incremental capacity increase.This technology not only provides economic benefits,but can also improve the operation of the SRU/TGTU.Enhanced contaminant destruction,sulphur recovery efficiency,reliability and robustness of operation have all been realized though implementation of this technology.The extent of oxygen enrichment can be custom-tailored depending on the plant configuration,processing capacity requirement,plot space availability, feed gas compositions,and desired operating scenario.%用氧气代替空气中的部分或全部氮气可大大降低克劳斯硫回收及尾气处理装置的气体流量。对于新建装置,富氧技术可减小设备尺寸从而减少投资;对于改造项目,富氧技术是一个高投资效益的扩能方案。除经济优点外,富氧技术还可改善硫回收及尾气处理装置的操作,提高污染物分解率、硫回收率、操作可靠性和稳健性。富氧浓度可根据装置布局、处理能力、可利用空间、原料气组成和工况要求而定制。

  13. Analysis of boronized wall in LHD

    International Nuclear Information System (INIS)

    Boronization has been carried out in some experimental fusion devices as one of wall conditioning Methods. The well-known merits of the boronization are as follows: 1) coated-boron on the first wall has strong gettering function for oxygen impurities and oxygen has been kept into boron films as a boron-oxide and 2) boron film covers first wall with apparently low Z materials facing the plasma. However, an operation scenario of boronization for next generation devices such as ITER is not optimized. In this paper, we discuss an optimized method of coated film uniformity in a wide area and a lifetime of boron film as an oxygen getter using experimental data in the large helical device (LHD). In LHD, boronization by glow discharges has been carried out a few times during each experimental campaign. Helium-diborane mixtured gas is used and plasma facing components (PFM) are stainless steel (SS) for the first wall and carbon for the divertor plates kept in the room temperature. Material probes made of SS316 and Si were installed in the vacuum vessel and exposed during the experimental campaign. Depth profiles of their impurities were analyzed using the X-ray Photoelectron Spectroscopy (XPS) and the Auger electron spectroscopy (AES). Two types of gettering process by boron film have been investigated. One is the process during boronization and the other is that after boronization. Concerning a lifetime of boron film, the distribution of oxygen near the top surface region (0 to 20 nm) indicates a process of oxygen gettering, it shows a contribution after boronization. In this paper, these kinds of process using material probes are shown. (authors)

  14. Advanced microstructure of boron carbide.

    Science.gov (United States)

    Werheit, Helmut; Shalamberidze, Sulkhan

    2012-09-26

    The rhombohedral elementary cell of the complex boron carbide structure is composed of B(12) or B(11)C icosahedra and CBC, CBB or B□B (□, vacancy) linear arrangements, whose shares vary depending on the actual chemical compound. The evaluation of the IR phonon spectra of isotopically pure boron carbide yields the quantitative concentrations of these components within the homogeneity range. The structure formula of B(4.3)C at the carbon-rich limit of the homogeneity range is (B(11)C) (CBC)(0.91) (B□B)(0.09) (□, vacancy); and the actual structure formula of B(13)C(2) is (B(12))(0.5)(B(11)C)(0.5)(CBC)(0.65)(CBB)(0.16) (B□B)(0.19), and deviates fundamentally from (B(12))CBC, predicted by theory to be the energetically most favourable structure of boron carbide. In reality, it is the most distorted structure in the homogeneity range. The spectra of (nat)B(x)C make it evident that boron isotopes are not randomly distributed in the structure. However, doping with 2% silicon brings about a random distribution. PMID:22945740

  15. Boron isotopes in geothermal systems

    International Nuclear Information System (INIS)

    Boron is a highly mobile element and during water-rock reactions, boron is leached out of rocks with no apparent fractionation. In geothermal systems where the water recharging the systems are meteoric in origin, the B isotope ratio of the geothermal fluid reflects the B isotope ratio of the rocks. Seawater has a distinctive B isotope ratio and where seawater recharges the geothermal system, the B isotope ratio of the geothermal system reflects the mixing of rock derived B and seawater derived B. Any deviations of the actual B isotope ratio of a mixture reflects subtle differences in the water-rock ratios in the cold downwelling limb of the hydrothermal system. This paper will present data from a variety of different geothermal systems, including New Zealand; Iceland; Yellowston, USA; Ibusuki, Japan to show the range in B isotope ratios in active geothermal systems. Some of these systems show well defined mixing trends between seawater and the host rocks, whilst others show the boron isotope ratios of the host rock only. In geothermal systems containing high amounts of CO2 boron isotope ratios from a volatile B source can also be inferred. (auth)

  16. Improved detection of extended spectrum beta-lactamase (ESBL-producing Escherichia coli in input and output samples of German biogas plants by a selective pre-enrichment procedure.

    Directory of Open Access Journals (Sweden)

    Thorsten Schauss

    Full Text Available The presence of extended-spectrum beta-lactamase (ESBL-producing Escherichia coli was investigated in input (manure from livestock husbandry and output samples of six German biogas plants in 2012 (one sampling per biogas plant and two German biogas plants investigated in an annual cycle four times in 2013/2014. ESBL-producing Escherichia coli were cultured by direct plating on CHROMagar ESBL from input samples in the range of 100 to 104 colony forming units (CFU per g dry weight but not from output sample. This initially indicated a complete elimination of ESBL-producing E. coli by the biogas plant process. Detected non target bacteria were assigned to the genera Acinetobacter, Pseudomonas, Bordetella, Achromobacter, Castellaniella, and Ochrobactrum. A selective pre-enrichment procedure increased the detection efficiency of ESBL-producing E. coli in input samples and enabled the detection in five of eight analyzed output samples. In total 119 ESBL-producing E. coli were isolated from input and 46 from output samples. Most of the E. coli isolates carried CTX-M-type and/or TEM-type beta lactamases (94%, few SHV-type beta lactamase (6%. Sixty-four blaCTX-M genes were characterized more detailed and assigned mainly to CTX-M-groups 1 (85% and 9 (13%, and one to group 2. Phylogenetic grouping of 80 E. coli isolates showed that most were assigned to group A (71% and B1 (27%, only one to group D (2%. Genomic fingerprinting and multilocus sequence typing (MLST showed a high clonal diversity with 41 BOX-types and 19 ST-types. The two most common ST-types were ST410 and ST1210. Antimicrobial susceptibility testing of 46 selected ESBL-producing E. coli revealed that several isolates were additionally resistant to other veterinary relevant antibiotics and some grew on CHROMagar STEC but shiga-like toxine (SLT genes were not detected. Resistance to carbapenems was not detected. In summary the study showed for the first time the presence of ESBL-producing E

  17. Raman spectroscopy of boron carbides and related boron-containing materials

    International Nuclear Information System (INIS)

    Raman spectra of crystalline boron, boron carbide, boron arsenide (B12As2), and boron phosphide (B12P2) are reported. The spectra are compared with other boron-containing materials containing the boron icosahedron as a structural unit. The spectra exhibit similar features some of which correlate with the structure of the icosahedral units of the crystals. The highest Raman lines appear to be especially sensitive to the B-B distance in the polar triangle of the icosahedron. Such Raman structural markers are potentially useful in efforts to tailor electronic properties of these high temperature semiconductors and thermoelectrics

  18. Friction anisotropy in boronated graphite

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, N., E-mail: niranjan@igcar.gov.in [Materials Science Group, Indira Gandhi Centre for Atomic Research, Kalpakkam (India); Radhika, R. [Crystal Growth Centre, Anna University, Chennai (India); Kozakov, A.T. [Research Institute of Physics, Southern Federal University, Rostov-on-Don (Russian Federation); Pandian, R. [Materials Science Group, Indira Gandhi Centre for Atomic Research, Kalpakkam (India); Chakravarty, S. [UGC-DAE CSR, Kalpakkam (India); Ravindran, T.R.; Dash, S.; Tyagi, A.K. [Materials Science Group, Indira Gandhi Centre for Atomic Research, Kalpakkam (India)

    2015-01-01

    Graphical abstract: - Highlights: • Friction anisotropy in boronated graphite is observed in macroscopic sliding condition. • Low friction coefficient is observed in basal plane and becomes high in prismatic direction. • 3D phase of boronated graphite transformed into 2D structure after friction test. • Chemical activity is high in prismatic plane forming strong bonds between the sliding interfaces. - Abstract: Anisotropic friction behavior in macroscopic scale was observed in boronated graphite. Depending upon sliding speed and normal loads, this value was found to be in the range 0.1–0.35 in the direction of basal plane and becomes high 0.2–0.8 in prismatic face. Grazing-incidence X-ray diffraction analysis shows prominent reflection of (0 0 2) plane at basal and prismatic directions of boronated graphite. However, in both the wear tracks (1 1 0) plane become prominent and this transformation is induced by frictional energy. The structural transformation in wear tracks is supported by micro-Raman analysis which revealed that 3D phase of boronated graphite converted into a disordered 2D lattice structure. Thus, the structural aspect of disorder is similar in both the wear tracks and graphite transfer layers. Therefore, the crystallographic aspect is not adequate to explain anisotropic friction behavior. Results of X-ray photoelectron spectroscopy and Fourier transform infrared spectroscopy shows weak signature of oxygen complexes and functional groups in wear track of basal plane while these species dominate in prismatic direction. Abundance of these functional groups in prismatic plane indicates availability of chemically active sites tends to forming strong bonds between the sliding interfaces which eventually increases friction coefficient.

  19. Friction anisotropy in boronated graphite

    International Nuclear Information System (INIS)

    Graphical abstract: - Highlights: • Friction anisotropy in boronated graphite is observed in macroscopic sliding condition. • Low friction coefficient is observed in basal plane and becomes high in prismatic direction. • 3D phase of boronated graphite transformed into 2D structure after friction test. • Chemical activity is high in prismatic plane forming strong bonds between the sliding interfaces. - Abstract: Anisotropic friction behavior in macroscopic scale was observed in boronated graphite. Depending upon sliding speed and normal loads, this value was found to be in the range 0.1–0.35 in the direction of basal plane and becomes high 0.2–0.8 in prismatic face. Grazing-incidence X-ray diffraction analysis shows prominent reflection of (0 0 2) plane at basal and prismatic directions of boronated graphite. However, in both the wear tracks (1 1 0) plane become prominent and this transformation is induced by frictional energy. The structural transformation in wear tracks is supported by micro-Raman analysis which revealed that 3D phase of boronated graphite converted into a disordered 2D lattice structure. Thus, the structural aspect of disorder is similar in both the wear tracks and graphite transfer layers. Therefore, the crystallographic aspect is not adequate to explain anisotropic friction behavior. Results of X-ray photoelectron spectroscopy and Fourier transform infrared spectroscopy shows weak signature of oxygen complexes and functional groups in wear track of basal plane while these species dominate in prismatic direction. Abundance of these functional groups in prismatic plane indicates availability of chemically active sites tends to forming strong bonds between the sliding interfaces which eventually increases friction coefficient

  20. Research on shielding neutron efficiency of some boron-bearing fabric and transparent resin materials

    International Nuclear Information System (INIS)

    The shielding neutron efficiency of boron-bearing materials developed recently is introduced. The thermal neutron shield ratios for two kinds of non-woven cloth with thickness of 58 mg/cm2 and 153 mg/cm2 are 51% and 79% respectively. Their mass attenuation coefficient for 0.186, 24.4 and 144 keV neutron are 1.56, 1.29 and 0.9 cm2/g respectively. The thermal neutron shield ratio is 85% for the natural boron-bearing transparent resin plate with the thickness of 0.59 g/cm2, and 97% for enriched boron or gadolinium bearing resin plate. The shield ratios of all three materials for 24.4 keV neutrons are 38%. The transparence of natural light for enriched boron-bearing resin plates shows no considerable change after they were exposed to thermal neutrons up to 6 Sv. After they were exposed up to 20 Sv, the transparence decreases to 50% but thermal neutron shield ratio does not change. The gadolinium-bearing plate has a very strong thermal neutron-capture gamma radiation and its dose-equivalent is greater than that of incident thermal neutrons

  1. TRIGA low enrichment fuel

    International Nuclear Information System (INIS)

    Sixty TRIGA reactors have been sold and the earliest of these are now passing twenty years of operation. All of these reactors use the uranium-zirconium hydride fuel (UZrH) which provides certain unique advantages arising out of its large prompt negative temperature coefficient, very low fission product release, and high temperature capability. Eleven of these Sixty reactors are conversions from plate fuel to TRIGA fuel which were made as a result of these advantages. With only a few exceptions, TRIGA reactors have always used low-enriched-uranium (LEU) fuel with an enrichment of 19.9%. The exceptions have either been converted from the standard low-enriched fuel to the 70% enriched FLIP fuel in order to achieve extended lifetime, or are higher powered reactors which were designed for long life using 93%-enriched uranium during the time when the use and export of highly enriched uranium (HEU) was not restricted. The advent of international policies focusing attention on nonproliferation and safeguards made the HEU fuels obsolete. General Atomic immediately undertook a development effort (nearly two years ago) in order to be in a position to comply with these policies for all future export sales and also to provide a low-enriched alternative to fully enriched plate-type fuels. This important work was subsequently partially supported by the U.S. Department of Energy. The laboratory and production tests have shown that higher uranium densities can be achieved to compensate for reducing the enrichment to 20%, and that the fuels maintain the characteristics of the very thoroughly proven standard TRIGA fuels. In May of 1978, General Atomic announced that these fuels were available for TRIGA reactors and for plate-type reactors with power levels up to 15 MW with GA's standard commercial warranty

  2. TRIGA low enrichment fuel

    International Nuclear Information System (INIS)

    Sixty TRIGA reactors have been sold and the earliest of these are now passing twenty years of operation. All of these reactors use the uranium zirconium hydride fuel (UZrH) which provides certain unique advantages arising out of its large prompt negative temperature coefficient, very low fission product release, and high temperature capability. Eleven of these Sixty reactors are conversions from plate fuel to TRIGA fuel which were made as a result of these advantages. With only a few exceptions, TRIGA reactors have always used low-enriched uranium (LEU) fuel with an enrichment of 19.9%. The exceptions have either been converted from the standard low-enriched fuel to the 70% enriched FLIP fuel in order to achieve extended lifetime, or are higher powered reactors which were designed for long life using 93%-enriched uranium during the time when the use and export of highly enriched uranium (HEU) was not restricted. The advent of international policies focusing attention on nonproliferation and safeguards made the HEU fuels obsolete. General Atomic immediately undertook a development effort (nearly two years ago) in order to be in a position to comply with these policies for all future export sales and also to provide a low-enriched alternative to fully enriched plate-type fuels. This important work was subsequently partially supported by the U.S. Department of Energy. The laboratory and production tests have shown that higher uranium densities can be achieved to compensate for reducing the enrichment to 20%, and that the fuels maintain the characteristics of the very thoroughly proven standard TRIGA fuels. In May of 1978, General Atomic announced that these fuels were available for TRIGA reactors and for plate-type reactors with power levels up to 15 MW with General Atomic's standard commercial warranty

  3. U.S. forms uranium enrichment corporation

    International Nuclear Information System (INIS)

    After almost 40 years of operation, the federal government is withdrawing from the uranium enrichment business. On July 1, the Department of Energy turned over to a new government-owned entity--the US Enrichment Corp. (USEC)--both the DOE enrichment plants at Paducah, Ky., and Portsmouth, Ohio, and domestic and international marketing of enriched uranium from them. Pushed by the inability of DOE's enrichment operations to meet foreign competition, Congress established USEC under the National Energy Policy Act of 1992, envisioning the new corporation as the first step to full privatization. With gross revenues of $1.5 billion in fiscal 1992, USEC would rank 275th on the Fortune 500 list of top US companies. USEC will lease from DOE the Paducah and Portsmouth facilities, built in the early 1950s, which use the gaseous diffusion process for uranium enrichment. USEC's stock is held by the US Treasury, to which it will pay annual dividends. Martin Marietta Energy Systems, which has operated Paducah since 1984 and Portsmouth since 1986 for DOE, will continue to operate both plants for USEC. Closing one of the two facilities will be studied, especially in light of a 40% world surplus of capacity over demand. USEC also will consider other nuclear-fuel-related ventures. USEC will produce only low-enriched uranium, not weapons-grade material. Indeed, USEC will implement a contract now being completed under which the US will purchase weapons-grade uranium from dismantled Russian nuclear weapons and convert it into low-enriched uranium for power reactor fuel

  4. The production, characterization, and neutronic performance of boron nitride coated uranium dioxide fuel

    International Nuclear Information System (INIS)

    The fuel pellets produced by sol-gel technique were coated with boron nitride (BN). This was achieved through chemical vapor deposition (CVD) using boron trichloride and ammonia. Mixing and chemical reaction take place at a temperature around 875 K. The coated samples were then sintered at 1600 K. Thermal reactor physics lattice-cell code WIMS-D/4 was used in the neutronic analysis of CANDU fuel bundle to observe the neutronic performance of the coated fuel. Three types of fuel were considered; fuel made of natural uranium, slightly enriched uranium (SEU, enrichment: 0.82 % U-235), and SEU with various BN coatings. The burnup calculations showed that feasible coating thickness is between 1 to 2 μm. (author)

  5. The prospects of using boron nitride in nuclear reactors as an absorbant and decelerator of neutrons

    International Nuclear Information System (INIS)

    Full text: The given work tells us that there are a widespread materials having an ability of amorphism, magnezation, hightemperature stability, wear resistance and corrosion resisting. To special requests which being presented to modern materials by some spheres of science and technics concern an ability of materials to work not only within the conditions of radioactive irradiation nor also capture heating neutrons. Hexagonal boron nitride has the most of these features. Boron nitride is used by the aircraft industry, because of its hightemperature resistance for a long time in extreme conditions. That is why the given material had been suggested as a neutron immerse material during production of containers for radioactive wastes long-lived storage. Using of enriched boron nitride in the first wall of thermonuclear reactor gives an oppotunity of refining nuclear and physical characteristics of reactor installation as a whole. Boron nitride has feeble activation in reactor neutron shell and high radiation resistance. All abovementioned boron nitride features, also its lower atmoic weight are very important for application in plasma devices, such as for using in installations of thermonuclear synthesis.

  6. Development of Digital Boron Dilution Alarm System (DBDAS)

    International Nuclear Information System (INIS)

    It is imperative that a reactor which has been shutdown remain subcritical and not inadvertently return to power. Such an event could occur for instance through failure of a component in the complex control system or inadvertent action taken by the operator. In any case, during such an event the reactor approaches criticality exponentially with respect to time thus making it more difficult for the operator to detect the event and take appropriate action before the reactor goes to criticality [Ref. 1]. This paper is prepared for the development of the Digital Boron Dilution Alarm System (DBDAS) to improve the sub-criticality monitoring of Advanced Power Reactor 1400 Standard Nuclear Power Plant (APR1400). This system is designed to provide operators with useful information about an inadvertent boron dilution event occurring with the plant in Modes 3, 4, 5, and 6 before the reactor coolant system is diluted sufficiently to result in a total loss of shutdown margin. The acceptance criteria of APR1400 for an unplanned boron (moderator) dilution specify at least 30 minutes in all operational modes. The main features of DBAS are the use of digital information from the startup neutron monitoring channels and a boronometer

  7. Development of Digital Boron Dilution Alarm System (DBDAS)

    Energy Technology Data Exchange (ETDEWEB)

    Shin, Ho Cheol; Lee, Hwan Soo; Moon, Chan Kook [Korea Hydro and Nuclear Power Co., Daejeon (Korea, Republic of)

    2012-05-15

    It is imperative that a reactor which has been shutdown remain subcritical and not inadvertently return to power. Such an event could occur for instance through failure of a component in the complex control system or inadvertent action taken by the operator. In any case, during such an event the reactor approaches criticality exponentially with respect to time thus making it more difficult for the operator to detect the event and take appropriate action before the reactor goes to criticality [Ref. 1]. This paper is prepared for the development of the Digital Boron Dilution Alarm System (DBDAS) to improve the sub-criticality monitoring of Advanced Power Reactor 1400 Standard Nuclear Power Plant (APR1400). This system is designed to provide operators with useful information about an inadvertent boron dilution event occurring with the plant in Modes 3, 4, 5, and 6 before the reactor coolant system is diluted sufficiently to result in a total loss of shutdown margin. The acceptance criteria of APR1400 for an unplanned boron (moderator) dilution specify at least 30 minutes in all operational modes. The main features of DBAS are the use of digital information from the startup neutron monitoring channels and a boronometer

  8. Velocities of Reacting Boron Particles within a Solid Fuel Ramjet Combustion Chamber

    OpenAIRE

    Sender, J.; H.K. Ciezki

    1998-01-01

    A 2D-laser doppler velocimeter was used to measure velocities of reacting boron (B) particles during the combustion of a metallised solid fuel slab inside a 20-combustion chamber. The solid fuel hydroxyl-terminated polybutadiene (HTPB) was enriched with B particles to increase its specific heat. To obtain information on the combustion process and on the movement of B particles, their velocities were measured. The experiments were performed at ambient pressure. The behaviour of the B pa...

  9. Development of a new TIMS for boron isotopic ratio analysis

    International Nuclear Information System (INIS)

    Thermal Ionization Mass Spectrometry is the widely used technique for precise isotopic ratio measurements of materials of interest in the fields of nuclear technology and geochronology. The basic evaluation of the instrument shows that the instrument is suitable for precise isotopic ratio measurements for Boron. It can be used for other masses falling in the mass range of 1-200 amu. The sensitivity and precision obtained are highly satisfactory for the analysis of Boron samples. Analysis time involved in measurement on one sample is 30-35 minutes. Moreover, the provision of turret with 12 filament assemblies increases the throughput of the system and makes it more useful for the plant where the operator has to routinely analyse more number of samples

  10. Synthesis of boron nitride nanotubes by boron ink annealing.

    Science.gov (United States)

    Li, Lu Hua; Chen, Ying; Glushenkov, Alexey M

    2010-03-12

    Ball-milling and annealing is one effective method for the mass production of boron nitride nanotubes (BNNTs). We report that the method has been modified to a boron (B) ink annealing method. In this new process, the nanosize ball-milled B particles are mixed with metal nitrate in ethanol to form an ink-like solution, and then the ink is annealed in nitrogen-containing gas to form nanotubes. The new method greatly enhances the yield of BNNTs, giving a higher density of nanotubes. These improvements are caused by the addition of metal nitrate and ethanol, both of which can strongly boost the nitriding reaction, as revealed by thermogravimetric analysis. The size and structure of BNNTs can be controlled by varying the annealing conditions. This high-yield production of BNNTs in large quantities enables the large-scale application of BNNTs. PMID:20154372

  11. Synthesis of boron nitride nanotubes by boron ink annealing

    International Nuclear Information System (INIS)

    Ball-milling and annealing is one effective method for the mass production of boron nitride nanotubes (BNNTs). We report that the method has been modified to a boron (B) ink annealing method. In this new process, the nanosize ball-milled B particles are mixed with metal nitrate in ethanol to form an ink-like solution, and then the ink is annealed in nitrogen-containing gas to form nanotubes. The new method greatly enhances the yield of BNNTs, giving a higher density of nanotubes. These improvements are caused by the addition of metal nitrate and ethanol, both of which can strongly boost the nitriding reaction, as revealed by thermogravimetric analysis. The size and structure of BNNTs can be controlled by varying the annealing conditions. This high-yield production of BNNTs in large quantities enables the large-scale application of BNNTs.

  12. 水培条件下几种观赏植物对铅的富集特征%Enrichment Characteristics of Pb by Several Kinds of Ornamental Plants Under Hydroponic Culture

    Institute of Scientific and Technical Information of China (English)

    李翠兰; 邵泽强; 王玉军; 张晋京

    2011-01-01

    通过水培试验,研究了铅处理质量浓度为0~200 mg·L-1条件下,7种观赏植物(包括四季海棠、百日草、茶花凤仙、金鱼草、金盏菊、天竺葵和雁来红)的生长反应和富集特征.结果表明:供试观赏植物在试验的铅胁迫水平下都具有较强的耐性;四季海棠和百日草的地上部最大铅质量分数分别达到了1 229.2、1 209.7 mg·kg-1,满足超富集植物的临界质量分数标准,同时它们在试验铅处理质量浓度下的地上部铅质量分数和富集系数均显著高于其他观赏植物;四季海棠和百日草的铅转移系数最高值可达到0.9以上,并且百日草铅质量浓度在200 mg·L-1时的转移系数仍高于100 mg·L-1时的转移系数.%The growth response and enrichment characteristics of seven ornamental plants, Begonia semperflorens, Zinnia elegan, Impatiens balsamina, Antirrhinum majus, Calendula officinalis, Pelargonium hortorum and Amaranthus tricolo, were studied under hydroponic culture with 0-200 mg · L-1 of Pb. Results showed that all the tested ornamental plants had higher tolerance to Pb in the range of experimental Pb stress levels. The highest Pb mass fractions in the above-ground parts of B. semperflorens and Z. elegan were 1 229.2 and 1 209.7 mg · kg-1, respectively, which reached the critical standard of Pb hyperaccumulating plants. And the Pb mass fraction and bioaccumulation coefficient in the above-ground parts of B. semperflorens and Z. elegan was significantly higher than those of the other five ornamental plants. The highest Pb translocation factors for B. semperflorens and Z. elegan were over 0.9, and the Pb translocation factor for Z. elegan was still higher under 200 mg · L-1 than under 100 mg · L-1 of Pb.

  13. Synthesis of vinyl boronates from aldehydes by a practical boron-Wittig reaction.

    Science.gov (United States)

    Coombs, John R; Zhang, Liang; Morken, James P

    2015-04-01

    A highly stereoselective boron-Wittig reaction between stable and readily accessible 1,1-bis(pinacolboronates) and aldehydes furnishes a variety of synthetically useful di- and trisubstituted vinyl boronate esters. PMID:25799147

  14. The case for enrichment of uranium in Australia

    International Nuclear Information System (INIS)

    Information is presented on the number of nuclear power plants in operation and under construction and on the extent of the use of uranium. The case for enrichment of uranium in Australia is then considered in detail and the status of feasbility studies being carried out is discussed. Arguments to support an enrichment industry include: the need for additional enrichment capacity; added value; potential profitability; increased employment and industrial opportunities; and retention of depleted uranium

  15. Development of an enrichment monitor for the Portsmouth GCEP

    International Nuclear Information System (INIS)

    We have developed a gas-phase UF6 enrichment monitor for use by the International Atomic Energy Agency at the Portsmouth Gas Centrifuge Enrichment Plant. The enrichment monitoring system provides a method for effective nuclear materials accountability verification while reducing the effort for both the facility operator and the inspector. The experience with an inplant prototype monitor, the facility and operational constraints, and the constraints related to international safeguards inspection are described in terms of the impact on the monitor design

  16. Helium behaviour in implanted boron carbide

    Directory of Open Access Journals (Sweden)

    Motte Vianney

    2015-01-01

    Full Text Available When boron carbide is used as a neutron absorber in nuclear power plants, large quantities of helium are produced. To simulate the gas behaviour, helium implantations were carried out in boron carbide. The samples were then annealed up to 1500 °C in order to observe the influence of temperature and duration of annealing. The determination of the helium diffusion coefficient was carried out using the 3He(d,p4He nuclear reaction (NRA method. From the evolution of the width of implanted 3He helium profiles (fluence 1 × 1015/cm2, 3 MeV corresponding to a maximum helium concentration of about 1020/cm3 as a function of annealing temperatures, an Arrhenius diagram was plotted and an apparent diffusion coefficient was deduced (Ea = 0.52 ± 0.11 eV/atom. The dynamic of helium clusters was observed by transmission electron microscopy (TEM of samples implanted with 1.5 × 1016/cm2, 2.8 to 3 MeV 4He ions, leading to an implanted slab about 1 μm wide with a maximum helium concentration of about 1021/cm3. After annealing at 900 °C and 1100 °C, small (5–20 nm flat oriented bubbles appeared in the grain, then at the grain boundaries. At 1500 °C, due to long-range diffusion, intra-granular bubbles were no longer observed; helium segregates at the grain boundaries, either as bubbles or inducing grain boundaries opening.

  17. Synthesis of Boron Nanowires, Nanotubes, and Nanosheets

    Directory of Open Access Journals (Sweden)

    Rajen B. Patel

    2015-01-01

    Full Text Available The synthesis of boron nanowires, nanotubes, and nanosheets using a thermal vapor deposition process is reported. This work confirms previous research and provides a new method capable of synthesizing boron nanomaterials. The materials were made by using various combinations of MgB2, Mg(BH42, MCM-41, NiB, and Fe wire. Unlike previously reported methods, a nanoparticle catalyst and a silicate substrate are not required for synthesis. Two types of boron nanowires, boron nanotubes, and boron nanosheets were made. Their morphology and chemical composition were determined through the use of scanning electron microscopy, transmission electron microscopy, and electron energy loss spectroscopy. These boron-based materials have potential for electronic and hydrogen storage applications.

  18. Analysis of magnetron sputtered boron oxide films

    Energy Technology Data Exchange (ETDEWEB)

    Buc, Dalibor [Slovak University of Technology in Bratislava (Slovakia); Bello, Igor [City University of Hong Kong, Kowloon, Hong Kong (China); Caplovicova, Maria [Comenius University in Bratislava (Slovakia); Mikula, Milan; Kovac, Jaroslav; Hotovy, Ivan [Slovak University of Technology in Bratislava (Slovakia); Chong, Yat Min [City University of Hong Kong, Kowloon, Hong Kong (China); Siu, Guei Gu [City University of Hong Kong, Kowloon, Hong Kong (China)], E-mail: apggsiu@cityu.edu.hk

    2007-10-15

    Boron oxide films were grown on silicon substrates by radio-frequency (rf) unbalanced magnetron sputtering of a boron target in argon-oxygen gas mixtures with different compositions. Microscopic analyses show that overall boron oxide films are amorphous. The film prepared at oxygen/argon flow rate ratio > 0.05 developed large crystallites of boric acid in localize areas of amorphous boron oxide matrices. These crystallites were unstable and at electron microscopic analysis they continuously transformed to a cubic HBO{sub 2} phase and then completely vanished leaving an underlying amorphous boron oxide film behind. The analyses indicate the coexistence of B{sub 6}O, HBO{sub 2} crystallites and amorphous boron oxide matrices. Fourier transform infrared (FTIR) spectra revealed spectral bands of BOH, BO, BOB and BH groups. Nanohardness and elastic modulus of a film prepared at low oxygen concentration approach 30 and 300 GPa, respectively. These parameters however vary with deposition conditions.

  19. Microwave sintering of boron carbide composites

    International Nuclear Information System (INIS)

    Boron carbide is an important ceramic material because of its high hardness and low specific gravity. it is used for applications involving impact and wear resistance. The disadvantages of boron carbide materials are difficulty in fabrication and sensitivity to brittle fracture. These problems are significantly reduced by production of cermets based on boron carbide and aluminum or aluminum alloys. Microwave heating of boron carbide materials results in ultrarapid heating and high temperatures. Therefore, a finer microstructure is obtained. The objective of this work was to define a technology that would allow the manufacture of boron carbide ceramics having mechanical properties similar to those exhibited by hot-pressed specimens. microwave heating would be used for the densification step. Mixtures of boron carbide and aluminum were considered for this research because aluminum simultaneously acts as a sintering aid and introduces phases that contribute to toughness enhancement

  20. Prediction of boron carbon nitrogen phase diagram

    Science.gov (United States)

    Yao, Sanxi; Zhang, Hantao; Widom, Michael

    We studied the phase diagram of boron, carbon and nitrogen, including the boron-carbon and boron-nitrogen binaries and the boron-carbon-nitrogen ternary. Based on the idea of electron counting and using a technique of mixing similar primitive cells, we constructed many ''electron precise'' structures. First principles calculation is performed on these structures, with either zero or high pressures. For the BN binary, our calculation confirms that a rhmobohedral phase can be stablized at high pressure, consistent with some experimental results. For the BCN ternary, a new ground state structure is discovered and an Ising-like phase transition is suggested. Moreover, we modeled BCN ternary phase diagram and show continuous solubility from boron carbide to the boron subnitride phase.

  1. Boron evaluation of diffusion phenomenon and distribution in the core using fluent

    International Nuclear Information System (INIS)

    In the design of pressurized water reactor (PWR), the control rods, the burnable poison rods and the boron acid solution are used to control the core power. Among these facilities, the boron acid solution is indispensable to maintain the critical condition for normal core operation during the compensation of negative reactivity for the fuel consumption and the accumulation of the fission product. The high head safety injection of Maanshan power plant once malfunctioned and therefore the reactor coolant system obtained unnecessary boron. In this study, the validated Computation Fluid Dynamics (CFD) commercial software FLUENT is employed to investigate the boron diffusion phenomenon during the boron acid solution flow into the core, in the high head safety injection malfunction accident. The calculation scope of the model in this paper is cold leg to top of core. The diffusion behaviors within the model can be reasonably captured by the present CFD commercial code. According to the calculation result, the non-uniform boron distribution at the core support forging and the core can be found. (author)

  2. CVD-produced boron filaments

    Science.gov (United States)

    Wawner, F. E.; Debolt, H. E.; Suplinskas, R. D.

    1980-01-01

    A technique for producing boron filaments with an average tensile strength of 6.89 GPa has been developed which involves longitudinal splitting of the filament and core (substrate) removal by etching. Splitting is accomplished by a pinch wheel device which continuously splits filaments in lengths of 3.0 m by applying a force to the side of the filament to create a crack which is then propagated along the axis by a gentle sliding action. To facilitate the splitting, a single 10 mil tungsten substrate is used instead of the usual 0.5 mil substrate. A solution of hot 30% hydrogen peroxide is used to remove the core without attacking the boron. An alternative technique is to alter the residual stress by heavily etching the filament. Average strengths in the 4.83-5.52 GPa range have been obtained by etching an 8 mil filament to 4 mil.

  3. Boron clusters in luminescent materials.

    Science.gov (United States)

    Mukherjee, Sanjoy; Thilagar, Pakkirisamy

    2016-01-21

    In recent times, luminescent materials with tunable emission properties have found applications in almost all aspects of modern material sciences. Any discussion on the recent developments in luminescent materials would be incomplete if one does not account for the versatile photophysical features of boron containing compounds. Apart from triarylboranes and tetra-coordinate borate dyes, luminescent materials consisting of boron clusters have also found immense interest in recent times. Recent studies have unveiled the opportunities hidden within boranes, carboranes and metalloboranes, etc. as active constituents of luminescent materials. From simple illustrations of luminescence, to advanced applications in LASERs, OLEDs and bioimaging, etc., the unique features of such compounds and their promising versatility have already been established. In this review, recent revelations about the excellent photophysical properties of such materials are discussed. PMID:26574714

  4. Profile of World Uranium Enrichment Programs-2009

    Energy Technology Data Exchange (ETDEWEB)

    Laughter, Mark D [ORNL

    2009-04-01

    It is generally agreed that the most difficult step in building a nuclear weapon is acquiring fissile material, either plutonium or highly enriched uranium (HEU). Plutonium is produced in a nuclear reactor, whereas HEU is produced using a uranium enrichment process. Enrichment is also an important step in the civil nuclear fuel cycle, in producing low enriched uranium (LEU) for use as fuel for nuclear reactors to generate electricity. However, the same equipment used to produce LEU for nuclear reactor fuel can also be used to produce HEU for weapons. Safeguards at an enrichment plant are the array of assurances and verification techniques that ensure uranium is not diverted or enriched to HEU. There are several techniques for enriching uranium. The two most prevalent are gaseous diffusion, which uses older technology and requires a lot of energy, and gas centrifuge separation, which uses more advanced technology and is more energy efficient. Gaseous diffusion plants (GDPs) provide about 40% of current world enrichment capacity but are being phased out as newer gas centrifuge enrichment plants (GCEPs) are constructed. Estimates of current and future enrichment capacity are always approximate, due to the constant upgrades, expansions, and shutdowns occurring at enrichment plants, largely determined by economic interests. Currently, the world enrichment capacity is approximately 56 million kilogram separative work units (SWU) per year, with 22.5 million in gaseous diffusion and more than 33 million in gas centrifuge plants. Another 34 million SWU/year of capacity is under construction or planned for the near future, almost entirely using gas centrifuge separation. Other less-efficient techniques have also been used in the past, including electromagnetic and aerodynamic separations, but these are considered obsolete, at least from a commercial perspective. Laser isotope separation shows promise as a possible enrichment technique of the future but has yet to be

  5. Conduction mechanism in boron carbide

    Science.gov (United States)

    Wood, C.; Emin, D.

    1984-01-01

    Electrical conductivity, Seebeck-coefficient, and Hall-effect measurements have been made on single-phase boron carbides, B(1-x)C(x), in the compositional range from 0.1 to 0.2 X, and between room temperature and 1273 K. The results indicate that the predominant conduction mechanism is small-polaron hopping between carbon atoms at geometrically inequivalent sites.

  6. Sintering behavior of boron carbide

    International Nuclear Information System (INIS)

    Pressureless sintering behavior of boron carbide (B4C) in argon was studied, with change in time and temperature, using carbon as sintering aid. Carbon was added via fenolic resin, acting also as a binder. After isostatic pressing the specimens were sintered in a graphite furnace at 19600C/1h, 21600C/15 minutes and 1h and 22000C/1h. The achieved density was 97% of the theoretical. Some mechanical properties and microstructural aspects have been evaluated. (author)

  7. Methods for separating boron from borated paraffin wax and its determination by ion chromatography

    International Nuclear Information System (INIS)

    Boron compounds are found to be useful in shielding against high-energy neutrons. In radiotherapy treatments, in order to protect occupational workers and patients from the undesirable neutron and gamma doses, paraffin wax containing B4C/boric acid is used. Low-level borate wastes generated from the nuclear power plants have been immobilized with paraffin wax using a concentrate waste drying system (CWDS). Borated paraffin waxes are prepared by mixing calculated amounts of either boric acid or boron carbide with the molten wax. This necessitates the determination of boron at different locations in order to check the homogeneous distribution of B over the borated wax. The determination of boron in nuclear materials is inevitable due to its high neutron absorption cross section. For the determination of boron in borated waxes, not many methods have been reported. A method based on the pyrohydrolysis extraction of boron and its quantification with ion chromatography was proposed for paraffin waxes borated with H3BO3 and B4C. The B4C optimum pyrohydrolysis conditions were identified. Wax samples were mixed with U3O8, which prevents the sample from flare up, and also accelerates the extraction of boron. Pyrohydrolysis was carried out with moist O2 at 950℃ for 60 and 90 min for wax with H3BO3 and wax with B4C, respectively. Two simple methods of separation based on alkali extraction and melting wax in alkali were also developed exclusively for wax with H3BO3. In all the separations, the recovery of B was above 98%. During IC separation, B was separated as boron-mannitol anion complex. Linear calibration was obtained between 0.1 and 50 ppm of B, and LOD was calculated as 5 ppb (S/N=3). The reproducibility was better than 5% (RSD)

  8. Review of uranium enrichment prospects in Canada, 1976

    International Nuclear Information System (INIS)

    Developments since 1971 which affect the prospects for uranium enrichment in Canada from the federal government point of view are reviewed. The market for enriched uranium to the year 2000 is similar to that projected in 1971. The committed enrichment capacity of the world will be sufficient until 1990. The Canadian uranium mining capability may be adequate to supply an enrichment plant, but the present reserves policy along with the currently known resources are likely to restrict exports of its products during the plant life. Prices for enriched uranium produced in Canada would be higher than those reported by other proposed new plants; however, newer enrichment techniques have some potential for cost reductions. Application of enrichment with U235 (or plutonium and U233/thorium) to CANDU offers some uranium resource conservation and possible slight power cost reductions. Construction of an enrichment plant in Canada to supply the export market is less attractive in 1976 than in 1971, but there is potential for such a business in the future. (L.L.)

  9. Use of boron cluster-containing redox nanoparticles with ROS scavenging ability in boron neutron capture therapy to achieve high therapeutic efficiency and low adverse effects.

    Science.gov (United States)

    Gao, Zhenyu; Horiguchi, Yukichi; Nakai, Kei; Matsumura, Akira; Suzuki, Minoru; Ono, Koji; Nagasaki, Yukio

    2016-10-01

    A boron delivery system with high therapeutic efficiency and low adverse effects is crucial for a successful boron neutron capture therapy (BNCT). In this study, we developed boron cluster-containing redox nanoparticles (BNPs) via polyion complex (PIC) formation, using a newly synthesized poly(ethylene glycol)-polyanion (PEG-polyanion, possessing a (10)B-enriched boron cluster as a side chain of one of its segments) and PEG-polycation (possessing a reactive oxygen species (ROS) scavenger as a side chain of one of its segments). The BNPs exhibited high colloidal stability, selective uptake in tumor cells, specific accumulation, and long retention in tumor tissue and ROS scavenging ability. After thermal neutron irradiation, significant suppression of tumor growth was observed in the BNP-treated group, with only 5-ppm (10)B in tumor tissues, whereas at least 20-ppm (10)B is generally required for low molecular weight (LMW) (10)B agents. In addition, increased leukocyte levels were observed in the LMW (10)B agent-treated group after thermal neutron irradiation, and not in BNP-treated group, which might be attributed to its ROS scavenging ability. No visual metastasis of tumor cells to other organs was observed 1 month after irradiation in the BNP-treated group. These results suggest that BNPs are promising for enhancing the BNCT performance. PMID:27467416

  10. Compared economic features of enrichment processes

    International Nuclear Information System (INIS)

    Several attempts made in the past have shown that comparing economic features of enrichment processes is a difficult endeavour. The separative work cost concept can be used as a guiding criteria, but other aspects are also important. Dealing solely with enrichment costs leads to qualify the various items which appear in the cost breakdowns of separative work delivered by various enrichment processes. Among these items, a broad distinction can be made between intrinsic characteristics of the processes (i.e. component sophistication, operating staff, energy consumption, material hold-up, etc.) and economic features or assumptions of a more general nature (costs of manpower; rates of return, energy, inflation, etc.). The paper briefly reviews these various aspects and points out some of the difficulties met in attempting comparisons: for instance, the processes under survey rarely attain the same state of development and the general economic backgrounds vary from one country to another. Moreover, differences appear when coping with a real plant project instead of a simple didactic exercise. Although it can hardly be quantified, the ability of the project's sponsoring team then becomes of prime importance. The conclusion of this short paper can only be expressed in very cautious terms. Attaining low enrichment costs is undoubtedly a stimulating challenge which every enrichment producer keeps in mind. But there are many ways to attain or maintain competitivity. Beyond such endeavours, one may simply express the wish to see fair pricing applied within a large and healthy enrichment market. (author). 2 figs, 1 tab

  11. Boron removal from geothermal waters by electrocoagulation

    International Nuclear Information System (INIS)

    Most of the geothermal waters in Turkey contain extremely high concentration of boron when they are used for irrigation. The use of geothermal waters for irrigation can results in excess amount deposition of boron in soil. On the other hand, a minimal boron concentration is required for irrigational waters. In this study, electrocoagulation (EC) was selected as a treatment process for the removal of boron from thermal waters obtained from Ilica-Erzurum in Turkey. Current density (CD), pH of solution and temperature of solution were selected as operational parameters. The results showed that boron removal efficiency increased from pH 4.0 to 8.0 and decreased at pH 10.0. Although boron removal efficiency was highest at pH 8.0, energy consumption was very high at this pH value compared to other pH intervals. Boron removal efficiency reached to 95% with increasing current density from 1.5 to 6.0 mA/cm2, but energy consumption was also increased in this interval. At higher temperatures of solution, such as 313 and 333 K, boron removal efficiency increased. At optimum conditions, boron removal efficiency in geothermal water reached up to 95%

  12. Boron removal from geothermal waters by electrocoagulation

    Energy Technology Data Exchange (ETDEWEB)

    Yilmaz, A. Erdem [Atatuerk University, Faculty of Engineering, Department of Environmental Engineering., 25240 Erzurum (Turkey)], E-mail: aerdemy@atauni.edu.tr; Boncukcuoglu, Recep [Atatuerk University, Faculty of Engineering, Department of Environmental Engineering., 25240 Erzurum (Turkey); Kocakerim, M. Muhtar [Atatuerk University, Faculty of Engineering, Department of Chemical Engineering, 25240 Erzurum (Turkey); Yilmaz, M. Tolga; Paluluoglu, Cihan [Atatuerk University, Faculty of Engineering, Department of Environmental Engineering., 25240 Erzurum (Turkey)

    2008-05-01

    Most of the geothermal waters in Turkey contain extremely high concentration of boron when they are used for irrigation. The use of geothermal waters for irrigation can results in excess amount deposition of boron in soil. On the other hand, a minimal boron concentration is required for irrigational waters. In this study, electrocoagulation (EC) was selected as a treatment process for the removal of boron from thermal waters obtained from Ilica-Erzurum in Turkey. Current density (CD), pH of solution and temperature of solution were selected as operational parameters. The results showed that boron removal efficiency increased from pH 4.0 to 8.0 and decreased at pH 10.0. Although boron removal efficiency was highest at pH 8.0, energy consumption was very high at this pH value compared to other pH intervals. Boron removal efficiency reached to 95% with increasing current density from 1.5 to 6.0 mA/cm{sup 2}, but energy consumption was also increased in this interval. At higher temperatures of solution, such as 313 and 333 K, boron removal efficiency increased. At optimum conditions, boron removal efficiency in geothermal water reached up to 95%.

  13. Boron deposition from fused salts. Final report

    International Nuclear Information System (INIS)

    A partial evaluation of the feasibility of a process to electrodeposit pure coherent coatings of elemental boron from molten fluorides has been performed. The deposit produced was powdery and acicular, unless the fluoride melt was purified to have very low oxygen concentration. When the oxygen activity was reduced in the melt by addition of crystalline elemental boron, dense, amorphous boron deposit was produced. The boron deposits produced had cracks but were otherwise pure and dense and ranged up to 0.35 mm thick. Information derived during this project suggests that similar deposits might be obtained crack-free up to 1.00 mm thick by process modifications and improvements

  14. SE-ENRICHMENT OF CARROT AND ONION VIA FOLIAR APPLICATION

    OpenAIRE

    Kapolna, Emese; Laursen, Kristian H; Hillestrøm, Peter; Husted, Søren; Larsen, Erik H.

    2008-01-01

    The aim of this work was to study the selenium accumulation in carrot and onion plants using foliar application by sodium selenite and sodium selenate. Furthermore, we aimed at identifying the Se species biosynthesised by onion and carrot plants. The results were used to prepare for production of 77Se enriched plants for an ongoing human absorption study.

  15. Uranium enrichment activities: the SILVA program

    Energy Technology Data Exchange (ETDEWEB)

    Guyot, J.; Cazalet, J.; Camarcat, N.; Figuet, J.

    1994-12-31

    Through its commitment to a nuclear electricity generation policy, France holds today a specific position in the uranium enrichment market thanks to the modern multinational EURODIF gaseous diffusion plant. France has, altogether, a long-term goal in developing SILVA, a laser uranium enrichment process, based on the selective photo-ionization of U-235. After reviewing the fundamentals of SILVA (the laser system with copper vapor lasers and dye lasers and the separator system), a description of the general organization of the R and D program is provided going through basic research, subsystems assessment, production demonstrations and simulations (with the LACAN code), plant design and economics. The general schedule of SILVA is outlined, leading to the possible construction of a commercial plant. 7 figs., 11 refs.

  16. Uranium enrichment activities: the SILVA program

    International Nuclear Information System (INIS)

    Through its commitment to a nuclear electricity generation policy, France holds today a specific position in the uranium enrichment market thanks to the modern multinational EURODIF gaseous diffusion plant. France has, altogether, a long-term goal in developing SILVA, a laser uranium enrichment process, based on the selective photo-ionization of U-235. After reviewing the fundamentals of SILVA (the laser system with copper vapor lasers and dye lasers and the separator system), a description of the general organization of the R and D program is provided going through basic research, subsystems assessment, production demonstrations and simulations (with the LACAN code), plant design and economics. The general schedule of SILVA is outlined, leading to the possible construction of a commercial plant. 7 figs., 11 refs

  17. Method for determination of boron carbide in wurtzite-like boron nitride

    International Nuclear Information System (INIS)

    A technique for increase of sensitivity and analysis accuracy while boron carbide determination in wurtzite-like boron nitride is proposed. Boron nitride with an addition of boron carbide is bjected to treatment by the mixture of concentrated sulphuric acid and 0.1-0.5 N of porassium bichromate solution at ratio of (2-1):1 at the temperature of mixture boiling. Boron carboide content is calculated according to the quantity of restored Cr(3+), which is determined by titration of Cr(6+) excess with the Mohr's salt solution

  18. Boron coating on boron nitride coated nuclear fuels by chemical vapor deposition

    Energy Technology Data Exchange (ETDEWEB)

    Durmazucar, Hasan H.; Guenduez, Guengoer E-mail: ggunduz@metu.edu.tr

    2000-12-01

    Uranium dioxide-only and uranium dioxide-gadolinium oxide (5% and 10%) ceramic nuclear fuel pellets which were already coated with boron nitride were coated with thin boron layer by chemical vapor deposition to increase the burn-up efficiency of the fuel during reactor operation. Coating was accomplished from the reaction of boron trichloride with hydrogen at 1250 K in a tube furnace, and then sintering at 1400 and 1525 K. The deposited boron was identified by infrared spectrum. The morphology of the coating was studied by using scanning electron microscope. The plate, grainy and string (fiber)-like boron structures were observed.

  19. Boron coating on boron nitride coated nuclear fuels by chemical vapor deposition

    International Nuclear Information System (INIS)

    Uranium dioxide-only and uranium dioxide-gadolinium oxide (5% and 10%) ceramic nuclear fuel pellets which were already coated with boron nitride were coated with thin boron layer by chemical vapor deposition to increase the burn-up efficiency of the fuel during reactor operation. Coating was accomplished from the reaction of boron trichloride with hydrogen at 1250 K in a tube furnace, and then sintering at 1400 and 1525 K. The deposited boron was identified by infrared spectrum. The morphology of the coating was studied by using scanning electron microscope. The plate, grainy and string (fiber)-like boron structures were observed

  20. Oxygen enrichment incineration

    International Nuclear Information System (INIS)

    Oxygen enriched combustion technology has recently been used in waste incineration. To apply the oxygen enrichment on alpha-bearing waste incineration, which is being developed, a state-of-an-art review has been performed. The use of oxygen or oxygen-enriched air instead of air in incineration would result in increase of combustion efficiency and capacity, and reduction of off-gas product. Especially, the off-gas could be reduced below a quarter, which might reduce off-gas treatment facilities, and also increase an efficiency of off-gas treatment. However, the use of oxygen might also lead to local overheating and high nitrogen oxides (NOx) formation. To overcome these problems, an application of low NOx oxy-fuel burner and recycling of a part of off-gas to combustion chamber have been suggested

  1. Oxygen enrichment incineration

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jeong Guk; Yang, Hee Chul; Park, Geun Il; Kim, Joon Hyung

    2000-10-01

    Oxygen enriched combustion technology has recently been used in waste incineration. To apply the oxygen enrichment on alpha-bearing waste incineration, which is being developed, a state-of-an-art review has been performed. The use of oxygen or oxygen-enriched air instead of air in incineration would result in increase of combustion efficiency and capacity, and reduction of off-gas product. Especially, the off-gas could be reduced below a quarter, which might reduce off-gas treatment facilities, and also increase an efficiency of off-gas treatment. However, the use of oxygen might also lead to local overheating and high nitrogen oxides (NOx) formation. To overcome these problems, an application of low NOx oxy-fuel burner and recycling of a part of off-gas to combustion chamber have been suggested.

  2. Laser and gas centrifuge enrichment

    Energy Technology Data Exchange (ETDEWEB)

    Heinonen, Olli [Senior Fellow, Belfer Center for Science and International Affairs, Harvard Kennedy School, Cambridge, Massachusetts (United States)

    2014-05-09

    Principles of uranium isotope enrichment using various laser and gas centrifuge techniques are briefly discussed. Examples on production of high enriched uranium are given. Concerns regarding the possibility of using low end technologies to produce weapons grade uranium are explained. Based on current assessments commercial enrichment services are able to cover the global needs of enriched uranium in the foreseeable future.

  3. Laser and gas centrifuge enrichment

    Science.gov (United States)

    Heinonen, Olli

    2014-05-01

    Principles of uranium isotope enrichment using various laser and gas centrifuge techniques are briefly discussed. Examples on production of high enriched uranium are given. Concerns regarding the possibility of using low end technologies to produce weapons grade uranium are explained. Based on current assessments commercial enrichment services are able to cover the global needs of enriched uranium in the foreseeable future.

  4. Advanced uranium enrichment processes

    International Nuclear Information System (INIS)

    Three advanced Uranium enrichment processes are dealt with in the report: AVLIS (Atomic Vapour LASER Isotope Separation), MLIS (Molecular LASER Isotope Separation) and PSP (Plasma Separation Process). The description of the physical and technical features of the processes constitutes a major part of the report. If further presents comparisons with existing industrially used enrichment technologies, gives information on actual development programmes and budgets and ends with a chapter on perspectives and conclusions. An extensive bibliography of the relevant open literature is added to the different subjects discussed. The report was drawn up by the nuclear research Centre (CEA) Saclay on behalf of the Commission of the European Communities

  5. Segal Enriched Categories I

    CERN Document Server

    Bacard, Hugo V

    2010-01-01

    We develop a theory of enriched categories over a (higher) category M equipped with a class W of morphisms called homotopy equivalences. We call them Segal M_W -categories. Our motivation was to generalize the notion of "up-to-homotopy monoids" in a monoidal category M, introduced by Leinster. The formalism adopted generalizes the classical Segal categories and extends the theory of enriched category over a bicategory. In particular we have a linear version of Segal categories which did not exist so far. Our goal in this paper is to present the theory and provide some examples. Applications are reserved for the future.

  6. Fluent and Trac-Pei Analyses of Boron Dilution

    International Nuclear Information System (INIS)

    In this paper a chronological overview is presented of the work done at KEMA on boron dilution in a Pressurized Water Reactor (PWR). This work has been focused on calculating boron dilution when an un-borated water slug enters the reactor vessel at a pump start-up. Two different thermal-hydraulic codes have been used for this purpose: FLUENT and TRAC-PF1. FLUENT is a computational fluid dynamics code, while TRAC-PF1 is specifically written to analyse transients in a pressurized water reactor. This paper gives an idea of the advantages and the disadvantages of these two codes and shows some comparisons between the results. Both codes appear to provide reasonable results for scoping analyses purposes and show that prompt criticality would require a substantial volume of un-borated water feed. A phenomenon which appeared to be very important is numerical diffusion. For plant specific quantitative analyses it is recommended to improve TRAC-PF1 to better model the boron dilution (reduce numerical diffusion, model turbulent diffusion). A detailed comparison between TRAC-PF1 and a code as FLUENT for a relatively simple case would enable a quantitative verification of the improved TRAC-PF1 model, and would provide confidence to use TRAC-PF1 for more complicated transients

  7. Some physical properties of compacted specimens of highly dispersed boron carbide and boron suboxide

    International Nuclear Information System (INIS)

    Structure, shear modulus and internal friction (IF) of compacted specimens of boron carbide and boron suboxide have been investigated. Microtwins and stacking faults were observed along the {100} plane systems of polycrystalline specimens of boron carbide. Electrical conductivity of the specimens was that of p-type. Concentration of holes varied from 1017 to 1019 cm-3. The IF was measured in the temperature range 80-300 K. It was shown that the IF of boron carbide and that of boron suboxide were characterized with a set of similar relaxation processes. Mechanisms of the relaxation processes in boron carbide and boron suboxide are discussed in terms of the Hasiguti model of interaction between dislocations and point defects

  8. Boron carbide synthesis by carbothermic reduction of boron oxide

    International Nuclear Information System (INIS)

    Boron carbide (B4C) is a ceramic material of technological applications due to its extreme hardness and high chemical as well as thermal stability. Some parameters of the process for obtaining B4C by carbothermic reduction of B2O3 have been determined. The starting powders and the final products have been analysed by chemical, spectrographic and X-ray diffraction methods. The results show that the B4C obtained by the carbothermic reduction process is suitable for applications with a definite determination of the free carbon content. (author)

  9. Report of Sectional Committee on Industrialization of Uranium Enrichment

    International Nuclear Information System (INIS)

    In order to accelerate the development and utilization of atomic energy which is the core of the substitute energies for petroleum, it is indispensable requirement to establish independent fuel cycle as the base. In particular, the domestic production of enriched uranium is necessary to eliminate the obstacles to secure the energy supply in Japan. The construction and operation of the pilot plant for uranium enrichment by centrifugal separation method have progressed smoothly, and the technical base for the domestic production of enriched uranium is being consolidated. For the time being, the service of uranium enrichment is given by USA and France, but it is expected that the short supply will arise around 1990. The start of operation of the uranium enrichment plant in Japan is scheduled around 1990, and the scale of the plant will be expanded stepwise thereafter. The scale of production is assumed as 3000 t SWU/year in 2000. Prior to this commercial plant, the prototype plant of up to 250 t SWU/year capacity will be operated in 1986, starting the production of centrifugal separators in 1983. The production line for centrifugal separators will have the capacity of up to 125 t SWU/year. The organization for operating these plants, the home production of natural uranium conversion, the uranium enrichment by chemical method and others are described. (Kako, I.)

  10. The Combined Effects of Salinity and Excess Boron on Mineral Ion Relations in Broccoli

    Science.gov (United States)

    Two plant stress factors, salinity and high levels of boron, often co-occur in natural and agricultural environments. Many investigations have been conducted to document the influence of the combined stresses on crop growth and yield. Only limited information, however, is available concerning the c...

  11. Is The Boron Uptake Affected When Sunflower (Helianthus annuus L.) Grown At Poly Culture Systems?

    OpenAIRE

    YILDIZTEKİN, Mahmut; TUNA, Atilla Levent

    2015-01-01

    n this study, sunflower (Helianthus annuus L.) was growth alone and with wheat (Triticum aestivum L.) and clover plants (Medicago sativa L.). Boron at 25-50-75 mg L-1 concentrations was applied by the foliarly in the forms of Boric

  12. Uranium enrichment and the environment

    International Nuclear Information System (INIS)

    The three gaseous diffusion plants comprise one of the largest industrial complexes in the free world. Since all of the enrichment is done inside a very large plumbing maze, the control of radioactivity does not present a serious problem. Conventional, nonexotic engineering and administrative measures adequately control the minor levels of radioactivity associated with support activities such as equipment decontamination and maintenance. The treatment and control of chemical waste streams to comply with Federal and state regulations has required the commitment of 47 million dollars since 1974. Through 1982, an additional 84 million dollars may be required. The high cost is not a reflection of initially poor conditions but is rather the result of providing large treatment systems to meet very low discharge limits. Examples that will be discussed include airborne particulate removal, recirculating cooling water treatment, and hazardous waste disposal concepts

  13. Possible toxicity of boron on sugar cane

    Energy Technology Data Exchange (ETDEWEB)

    Bravo C., M.

    Analyses of necrotic and green leaf tissues from sugar cane grown in the Tambo Valley (Arequipa, Peru) have shown that the boron concentration in necrotic tissue (average 657.7 ppm) is several times higher than that in the green tissue (average 55.7 ppm). This suggests that the necrosis may be due to boron toxicity.

  14. New techniques for producing thin boron films

    International Nuclear Information System (INIS)

    A review will be presented of methods for producing thin boron films using an electron gun. Previous papers have had the problem of spattering of the boron source during the evaporation. Methods for reducing this problem will also be presented. 12 refs., 4 figs

  15. Fabrication of boron-phosphide neutron detectors

    International Nuclear Information System (INIS)

    Boron phosphide is a potentially viable candidate for high neutron flux neutron detectors. The authors have explored chemical vapor deposition methods to produce such detectors and have not been able to produce good boron phosphide coatings on silicon carbide substrates. However, semi-conducting quality films have been produced. Further testing is required

  16. Computational Evidence for the Smallest Boron Nanotube

    Institute of Scientific and Technical Information of China (English)

    Xian Jie LIN; Dong Ju ZHANG; Cheng Bu LIU

    2006-01-01

    The structure of boron nanotubes (BNTs) was found not to be limited to hexagonal pyramidal structures. Based on density functional theory calculations we provided evidence for the smallest boron nanotube, a geometrical analog of the corresponding carbon nanotube. As shown by our calculations, the smallest BNT possesses highly structural, dynamical, and thermal stability, which should be interest for attempts at its synthesis.

  17. Boron carbide whiskers produced by vapor deposition

    Science.gov (United States)

    1965-01-01

    Boron carbide whiskers have an excellent combination of properties for use as a reinforcement material. They are produced by vaporizing boron carbide powder and condensing the vapors on a substrate. Certain catalysts promote the growth rate and size of the whiskers.

  18. Boron Carbides As Thermo-electric Materials

    Science.gov (United States)

    Wood, Charles

    1988-01-01

    Report reviews recent theoretical and experimental research on thermoelectric materials. Recent work with narrow-band semiconductors demonstrated possibility of relatively high thermoelectric energy-conversion efficiencies in materials withstanding high temperatures needed to attain such efficiencies. Among promising semiconductors are boron-rich borides, especially boron carbides.

  19. Nuclear fuel management and boron carbide coating

    International Nuclear Information System (INIS)

    In recent years one way of introducing burnable absorber is to coat the fuel pellets by a thin layer of burnable absorber so called integral fuel burnable absorber (IFBA). In this method the fuel is coated with boron nitride or boron carbide. Boron has low absorption cross-section and when it exists on the surface of the fuel, it interacts with thermalized neutron. B4C is a boron compound, which can be used for coating the nuclear fuel. It has high thermal stability and withstands high pressure and temperatures. High technology product of boron carbide has different ratio of B: C. But in nuclear reactor when boron carbide is used, it must be rich with boron. In this research chemical vapor decomposition (CVD) has been using boron trichloride and carbon tetra chloride for reactant materials. The experiments were carried out at high temperatures (1050 degree Celsius, 1225 degree Celsius and 1325 degree Celsius). The coated samples were analyzed using X-Ray diffractometer (XRD), scanning electron microscopy (SEM) and will be presented in this paper. It was seen that decreasing the reaction temperature caused an increase on the quality and thickness of the coating

  20. Nutrient enrichment increases mortality of mangroves.

    Directory of Open Access Journals (Sweden)

    Catherine E Lovelock

    Full Text Available Nutrient enrichment of the coastal zone places intense pressure on marine communities. Previous studies have shown that growth of intertidal mangrove forests is accelerated with enhanced nutrient availability. However, nutrient enrichment favours growth of shoots relative to roots, thus enhancing growth rates but increasing vulnerability to environmental stresses that adversely affect plant water relations. Two such stresses are high salinity and low humidity, both of which require greater investment in roots to meet the demands for water by the shoots. Here we present data from a global network of sites that documents enhanced mortality of mangroves with experimental nutrient enrichment at sites where high sediment salinity was coincident with low rainfall and low humidity. Thus the benefits of increased mangrove growth in response to coastal eutrophication is offset by the costs of decreased resilience due to mortality during drought, with mortality increasing with soil water salinity along climatic gradients.

  1. Enriching Number Knowledge

    Science.gov (United States)

    Mack, Nancy K.

    2011-01-01

    Exploring number systems of other cultures can be an enjoyable learning experience that enriches students' knowledge of numbers and number systems in important ways. It helps students deepen mental computation fluency, knowledge of place value, and equivalent representations for numbers. This article describes how the author designed her…

  2. Everyone Vegetarian, World Enriching

    OpenAIRE

    Wu, John Y.

    2014-01-01

    This essay advocates global vegetarian diet. Firstly, seven personal health benefits and four global benefits of vegetarian dinners are specified to enrich the entire globe, and then, secondly, I explore concretely how to overcome internal hurdle and external hurdle, so as to effectively propagate vegetarian dinners throughout the world. Everyone wins, including animals!

  3. Methodology for content enrichment

    NARCIS (Netherlands)

    Nederbragt, H.; Heerlien, M.

    2010-01-01

    The STERNA project mainly focuses on enrichment of existing content of content holding organisations in the natural history domain. Therefore, developing a methodology on how to best integrate one’s content into the STERNA information space is an essential part of the project. This document is the o

  4. Designing job enrichment projects.

    Science.gov (United States)

    Clakeley, G L

    1988-01-01

    This paper describes a management strategy for a job satisfaction program utilized in a large occupational therapy department. The goal of the program is to retain satisfied, productive employees and reduce attrition of therapists and assistants. The use of job enrichment projects for occupational therapy assistants will be presented with brief descriptions of two projects. PMID:23944880

  5. Job Enrichment in Extension.

    Science.gov (United States)

    Fourman, Louis S.; Jones, Jo

    1997-01-01

    Interviews with 10 participants in Ohio State University's job enrichment program for midcareer extension agents found that 5 returned to their same jobs after the experience but only 2 felt challenged/renewed. Part-time participation while working made it difficult to balance responsibilities. More information and a structured orientation were…

  6. Study of boron detection limit using the in-air PIGE set-up at LAMFI-USP

    Science.gov (United States)

    Moro, M. V.; Silva, T. F.; Trindade, G. F.; Added, N.; Tabacniks, M. H.

    2014-11-01

    The quantification of small amounts of boron in materials is of extreme importance in different areas of materials science. Boron is an important contaminant and also a silicon dopant in the semiconductor industry. Boron is also extensively used in nuclear power plants, either for neutron shielding or for safety control and boron is an essential nutrient for life, either vegetable or animal. The production of silicon solar cells, by refining metallurgical-grade silicon (MG-Si) requires the control and reduction of several silicon contaminants to very low concentration levels. Boron is one of the contaminants of solar-grade silicon (SG-Si) that must be controlled and quantified at sub-ppm levels. In the metallurgical purification, boron quantification is usually made by Inductive Coupled Plasma Mass Spectrometry, (ICP-MS) but the results need to be verified by an independent analytical method. In this work we present the results of the analysis of silicon samples by Particle Induced Gamma-Ray Emission (PIGE) aiming the quantification of low concentrations of boron. PIGE analysis was carried out using the in-air external beam line of the Laboratory for Materials Analysis with Ion Beans (LAMFI-USP) by the 10B ( p ,αγ(7Be nuclear reaction, and measuring the 429 keV γ-ray. The in-air PIGE measurements at LAMFI have a quantification limit of the order of 1016 at/cm2.

  7. Stabilization of boron carbide via silicon doping.

    Science.gov (United States)

    Proctor, J E; Bhakhri, V; Hao, R; Prior, T J; Scheler, T; Gregoryanz, E; Chhowalla, M; Giulani, F

    2015-01-14

    Boron carbide is one of the lightest and hardest ceramics, but its applications are limited by its poor stability against a partial phase separation into separate boron and carbon. Phase separation is observed under high non-hydrostatic stress (both static and dynamic), resulting in amorphization. The phase separation is thought to occur in just one of the many naturally occurring polytypes in the material, and this raises the possibility of doping the boron carbide to eliminate this polytype. In this work, we have synthesized boron carbide doped with silicon. We have conducted a series of characterizations (transmission electron microscopy, scanning electron microscopy, Raman spectroscopy and x-ray diffraction) on pure and silicon-doped boron carbide following static compression to 50 GPa non-hydrostatic pressure. We find that the level of amorphization under static non-hydrostatic pressure is drastically reduced by the silicon doping. PMID:25427850

  8. Stabilization of boron carbide via silicon doping

    Science.gov (United States)

    Proctor, J. E.; Bhakhri, V.; Hao, R.; Prior, T. J.; Scheler, T.; Gregoryanz, E.; Chhowalla, M.; Giulani, F.

    2015-01-01

    Boron carbide is one of the lightest and hardest ceramics, but its applications are limited by its poor stability against a partial phase separation into separate boron and carbon. Phase separation is observed under high non-hydrostatic stress (both static and dynamic), resulting in amorphization. The phase separation is thought to occur in just one of the many naturally occurring polytypes in the material, and this raises the possibility of doping the boron carbide to eliminate this polytype. In this work, we have synthesized boron carbide doped with silicon. We have conducted a series of characterizations (transmission electron microscopy, scanning electron microscopy, Raman spectroscopy and x-ray diffraction) on pure and silicon-doped boron carbide following static compression to 50 GPa non-hydrostatic pressure. We find that the level of amorphization under static non-hydrostatic pressure is drastically reduced by the silicon doping.

  9. Burnup performances of boron nitride and boron coated nuclear fuels

    International Nuclear Information System (INIS)

    The nuclear fuels of urania (UOV) and 5% and 10% gadolinia (Gd2O3) containing UO2 previously produced by sol-gel technique were coated with first boron nitride (BN) then boron (B) thin layer by chemical vapor deposition (CVD) and also by plasma enhanced chemical vapor deposition (PECVD) techniques to increase the fuel cycle length and to improve the physical properties. From the cross-sectional view of BN and B layers taken from scanning electron microscope (SEM), the excellent adherence of BN onto fuel and B onto BN layer was observed in both cases. The behavior of fuel burnup, depletion of BN and B, the effect of coating thickness and also Gd2O3 content on the burnup performances of the fuels were identified by using the code WIMS-D/4 for Pressurized Water Reactor (PWR) and Boiling Water Reactor (BWR) cores. The optimum thickness ratio of B to BN was found as 4 and their thicknesses were chosen as 40 mm and 10 mm respectively in both reactor types to get extended cycle length. The assemblies consisting of fuels with 5% Gd2O3 and also coated with 10 mm BN and 40 mm B layers were determined as candidates for getting higher burnup in both types of reactors

  10. Evaluation of Ground-Water and Boron Sources by Use of Boron Stable-Isotope Ratios, Tritium, and Selected Water-Chemistry Constituents near Beverly Shores, Northwestern Indiana, 2004

    Science.gov (United States)

    Buszka, Paul M.; Fitzpatrick, John A.; Watson, Lee R.; Kay, Robert T.

    2007-01-01

    from human-affected boron sources. Boron concentrations in potential ground-water sources of boron were largest (15,700 to 24,400 ?g/L) in samples of CCP-affected surficial aquifer water from four wells at a CCP landfill and smallest (27 to 63 ?g/L) in three wells in the surficial aquifer that were distant from human-affected boron sources. Boron concentrations in water from the basal sand aquifer ranged from 656 ?g/L to 1,800 ?g/L. Boron concentrations in water from three domestic-wastewater-affected surficial aquifer wells ranged from 84 to 387 ?g/L. Among the representative ground-water samples, boron concentrations from all four samples of CCP-affected surficial aquifer water and four of five samples of water from the basal sand aquifer had concentrations greater than the RAL. A comparison of boron concentrations in acid-preserved and unacidified samples indicated that boron concentrations reported for this investigation may be from about 11 to 16 percent less than would be reported in a standard analysis of an acidified sample. The stable isotope boron-11 was most enriched in comparison to boron-10 in ground water from a confined aquifer, the basal sand aquifer (d11B, 24.6 to 34.0 per mil, five samples); it was most depleted in CCP-affected water from the surficial aquifer (d11B, 0.1 to 6.6 per mil, four samples). Domestic-wastewater-affected water from the surficial aquifer (d11B, 8.7 to 11.7 per mil, four samples) was enriched in boron-11, in comparison to individual samples of a borax detergent additive and a detergent with perborate bleach; it was intermediate in composition between basal sand aquifer water and CCP-affected water from the surficial aquifer. The similarity between a ground-water sample from the surficial aquifer and a hypothetical mixture of unaffected surficial aquifer and basal sand aquifer waters indicates the potential for long-term upward discharge of ground water into the surficial aquifer from one or more confined aquifers. Est

  11. Boronate Affinity-Molecularly Imprinted Biocompatible Probe: An Alternative for Specific Glucose Monitoring.

    Science.gov (United States)

    Chen, Guosheng; Qiu, Junlang; Fang, Xu'an; Xu, Jianqiao; Cai, Siying; Chen, Qing; Liu, Yan; Zhu, Fang; Ouyang, Gangfeng

    2016-08-19

    A biocompatible probe for specific glucose recognition is based on photoinitiated boronate affinity-molecular imprinted polymers (BA-MIPs). The unique pre-self-assembly between glucose and boronic acids creates glucose-specific memory cavities in the BA-MIPs coating. As a result, the binding constant toward glucose was enhanced by three orders of magnitude. The BA-MIPs probe was applied to glucose determination in serum and urine and implanted into plant tissues for low-destructive and long-term in vivo continuous glucose monitoring. PMID:27411946

  12. Synchronous derivative fluorimetric determination of boron in Uranium fuel samples

    International Nuclear Information System (INIS)

    We report a sensitive and selective method for determination of boron in uranium samples by spectrofluorimetry in synchronous derivative mode. This method is based on the complexation of non-fluorescent boron with fluorescent chromotropic acid to form fluorescent boron–chromotrope complex. The spectrum of native fluorescence of chromotropic acid seriously overlaps with that of the complex and hence, synchronous derivative mode was employed in which physical separation of excess ligand and complex is not necessary. With the optimized experimental and instrumental conditions, limit of detection obtained is 2 ng mL−1. The linear concentration range is 5–100 ng mL−1 with regression coefficient better than 0.997. The precision is better than 5% at 10 ng mL−1 level and 3% at 50 ng mL−1 level (n=9). Fluorescence quenching by residual matrix elements in the final sample solution is corrected by slope-ratio method. The method is validated with reference materials and successfully applied to the uranium nuclear fuels with the accuracy of ±10%. The proposed method reduces sample size requirement; thereby reducing load of uranium recovery from analytical waste in case of enriched uranium based samples. - Highlights: • Selectivity and sensitivity increases in synchronous derivative mode. • Sample size reduction that reduces load of enriched uranium recovery. • Eliminates need of physical separation of excess ligand and complex. • Quenching by residual matrix elements corrected by the slope-ratio method. • Important contribution to quality control of fuel materials in nuclear technology

  13. How is uranium supply affecting enrichment?

    International Nuclear Information System (INIS)

    As a result of the enlivened uranium market, momentum has in turn picked up in the enrichment sector. What are the consequences of higher uranium prices? There is, of course, a link between uranium and enrichment supply to the extent that they are at least partial substitutes. On the enrichment supply side, the most obvious feature is the gradual replacement of the old gas diffusion facilities of Usec in the USA and EURODIF in France with more modern and economical centrifuge plants. Assuming Usec can overcome the financing and technical issues surrounding its plans, the last gas diffusion capacity should disappear around 2015 and the entire enrichment market should then be using centrifuges. On the commercial side, the key anticipated developments are mostly in Russia. Although there should still continue to be substantial quantities of surplus Russian HEU available for down blending in the period beyond 2013, it is now reasonable to expect that it will be mostly consumed by internal needs, to fuel Russian-origin reactors both at home and in export markets such as China and India. Finally, as a key sensitive area for the non-proliferation of nuclear weapons, the enrichment sector is likely to be a central point of the new international arrangements which must be developed to support a buoyant nuclear sector throughout this century.

  14. Enrichment of denitrifying anaerobic methane oxidizing microorganisms.

    Science.gov (United States)

    Hu, Shihu; Zeng, Raymond J; Burow, Luke C; Lant, Paul; Keller, Jurg; Yuan, Zhiguo

    2009-10-01

    The microorganisms responsible for anaerobic oxidation of methane (AOM) coupled to denitrification have not been clearly elucidated. Three recent publications suggested it can be achieved by a denitrifying bacterium with or without the involvement of anaerobic methanotrophic archaea. A key factor limiting the progress in this research field is the shortage of enrichment cultures performing denitrifying anaerobic methane oxidation (DAMO). In this study, DAMO cultures were enriched from mixed inoculum including sediment from a freshwater lake, anaerobic digester sludge and return activated sludge from a sewage treatment plant. Two reactors, operated at 35°C and at 22°C, respectively, showed simultaneous methane oxidation and nitrate reduction after several months of operation. Analysis of 16S rRNA gene clone libraries from the 35°C enrichment showed the presence of an archaeon closely related to other DAMO archaea and a dominated bacterium belonging to the yet uncultivated NC10 phylum. This culture preferred nitrite to nitrate as the electron acceptor. The present study suggests that the archaea are rather methanotrophs than methanogens. The highest denitrification rate achieved was 2.35 mmol NO3 (-) -N gVSS(-1)  day(-1) . The culture enriched at 22°C contained the same NC10 bacterium observed in the culture enriched at 35°C but no archaea. PMID:23765890

  15. Experimental boron neutron capture therapy for melanoma: Systemic delivery of boron to melanotic and amelanotic melanoma

    International Nuclear Information System (INIS)

    The boron-containing melanin precursor analogue p-boronophenylalanine (BPA) has previously been shown to selectively deliver boron to pigmented murine melanomas when administered in a single intragastric dose. If boron neutron capture therapy is to become a clinically useful method of radiation therapy for human malignant melanoma, the boron carrier must be capable of delivering useful amounts of boron to remote tumor sites (metastases) and to poorly pigmented melanomas. The authors have now determined the ability of BPA to accumulate in several nonpigmented melanoma models including human melanoma xenografts in nude mice. The absolute amount of boron in the nonpigmented melanomas was about 50% of the observed in the pigmented counterparts but was still selectively concentrated in the tumor relative to normal tissues in amounts sufficient for effective neutron capture therapy. Single intragastric doses of BPA resulted in selective localization of boron in the amelanotic Greene melanoma carried in the anterior chamber of the rabbit eye and in a pigmented murine melanoma growing in the lungs. The ratio of the boron concentration in these tumors to the boron concentration in the immediately adjacent normal tissue was in the range of 3:1 to 4:1. These distribution studies support the proposal that boron neutron capture therapy may be useful as a regional therapy for malignant melanoma

  16. Alternative water chemistry for the primary loop of PWR plants

    International Nuclear Information System (INIS)

    Advanced fuel element concepts (longer cycles, higher burnup, increased rod power) call for more reactivity binding capacity and, moreover, might produce higher void fractions, particularly in the hot channel. Thus, on the one hand, more alcalizing agent is needed to maintain a high coolant pH according to the approved ''modified boron-lithium mode of operation'' in the presence of more boric acid (chemical shim); on the other hand, increasing enrichment of coolant constituents due to local boiling (higher void fraction), which must not result in accelerated corrosion of fuel cladding and structural materials, imposes enhanced requirements on both, materials technology and water chemistry. At present, the use of boric acid enriched in B10 (the isotope effective in terms of reactivity control) appears to advantageously compromise in capturing more neutrons with less total boron while maintaining or even slightly reducing lithium concentrations at the same time. There is no feasible alternative for boric acid used as the chemical shim and for hydrogen gas as the reducing agent used to suppress oxygen formation by water radiolysis. Systematic screening as performed in phase 1 of a recent project proved potassium hydroxide to be the only potential candidate to favourably replace lithium 7 hydroxide as an alcalizing agent. Unfortunately, the results of pertinent comparative corrosion tests are not unambiguous, and available operational experience with potassium hydroxide in WWER plants is not readily applicable to western world-type PWR plants. Therefore, a switch-over from lithium to potassium can be envisaged only subsequent to a comprehensive qualification program which is planned to be the objective of phase 2 of the project. This program should also comprise zinc addition tests in order to confirm the alleged positive impact of this element on corrosion rates and activity buildup. Supplementary, it is recommended to consider amendments to existing water chemistry

  17. Time-of-flight neutron detection using PECVD grown boron carbide diode detector

    International Nuclear Information System (INIS)

    The development of novel neutron detectors requires an understanding of the entire neutron detection process, a process which depends strongly on material properties. Here we present accurate measurements of the neutron detection efficiency of an unenriched 640 nm thick boron carbide solid state neutron detector grown by plasma enhanced chemical vapor deposition as a function of the neutron wavelength at a time-of-flight facility. The data were compared to that obtained simultaneously by a calibrated nitrogen detector over the same wavelength range. The measured spectra of both detectors fit a Maxwell–Boltzmann wavelength distribution, thereby indicating that the boron carbide detector can be used as a reliable beam monitor. Measurements of the material properties (density, thickness and elemental composition) of the semiconducting boron carbide enable a precise calculation of the ideal expected neutron detection efficiency. The calculated neutron detection efficiency for the effective moderator temperature (obtained from a fit to the Maxwell–Boltzmann distribution) showed excellent agreement with the experimentally determined neutron detection efficiency of 1.25%. Higher efficiencies may be obtained either by increased film thickness and/or 100% 10B enrichment of the boron carbide source molecule

  18. UK studies of the performance of boron carbide control rod pins for the fast reactor

    International Nuclear Information System (INIS)

    The preferred neutron absorbing material in control rods for modern fast reactors is boron carbide. This report presents the current status of the UK programme on the development of boron carbide control rod pins. The objective of the programme is to maximise the life of the pins, initially for the UK Prototype Fast Reactor (PFR) and, more recently, for the European Fast Reactor (EFR). The pin life is currently assessed against three criteria, the onset of pellet-cladding mechanical interaction at power, the boron carbide pellet centre temperature, and cladding embrittlement due to the combined effects of irradiation damage and pellet-cladding chemical interaction. Results are presented from the post-irradiation examination of static pins exposed in demountable sub-assemblies in PFR and pins from PFR control rods. The variables include stainless steel [M316 (CW)] and nimonic [PE16] cladding, sodium and helium pin filling, top and bottom pin gas venting and boron carbide with two levels of 10B enrichment from different sources. The results obtained are compared with the 'BORCON' computer model of fast reactor control rod pin performance. (author)

  19. Comparison of effect of zinc-enriched pod of Phaseolus vulgaris and inner rice husk composts with zinc sulphate and zinc 14% chelate on zinc availability in maize plant in a calcareous soil

    OpenAIRE

    Rasouli, Mrs. Shabnam; Azizi, Prof. Pirouz; Forghani, Dr. Akbar; Asghar Zade, Dr. Ahmad

    2008-01-01

    Mixtures of Zn salts and organic matter have been used successfully in controlling zinc deficiency in various crops. The aim of the present study was to optimize the effectiveness, on zinc availability in maize, of natural organic substances by enriching them with zinc sulfate. For this purpose pod of Phaseolus vulgaris and inner rice husk, as abundant organic wastes in the north of Iran, were incubated with increasing quantities of zinc sulphate. The effect of these zinc-enriched composts, z...

  20. Enrichment Strategies in Phosphoproteomics.

    Science.gov (United States)

    Leitner, Alexander

    2016-01-01

    The comprehensive study of the phosphoproteome is heavily dependent on appropriate enrichment strategies that are most often, but not exclusively, carried out on the peptide level. In this chapter, I give an overview of the most widely used techniques. In addition to dedicated antibodies, phosphopeptides are enriched by their selective interaction with metals in the form of chelated metal ions or metal oxides. The negative charge of the phosphate group is also exploited in a variety of chromatographic fractionation methods that include different types of ion exchange chromatography, hydrophilic interaction chromatography (HILIC), and electrostatic repulsion HILIC (ERLIC) chromatography. Selected examples from the literature will demonstrate how a combination of these techniques with current high-performance mass spectrometry enables the identification of thousands of phosphorylation sites from various sample types. PMID:26584921

  1. What is Enrichment For (?)

    OpenAIRE

    Matsangos, P.

    2011-01-01

    It has long been held that schooling, the curriculum (hidden or otherwise), and the pedagogical practices pertaining to them are the perpetrators of social and economic inequalities in Western society. My interest surrounds the role of ‘enrichment’, as an auxiliary of education, in perpetuating or restricting social justice. As the enrichment coordinator within an inner city Sixth Form college, it became part of my remit to research the dispositions held by our largely underprivileged student...

  2. In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

    Directory of Open Access Journals (Sweden)

    Ertuğrul Filiz

    2013-01-01

    Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

  3. Colorimetric Sugar Sensing Using Boronic Acid-Substituted Azobenzenes

    OpenAIRE

    Yuya Egawa; Ryotaro Miki; Toshinobu Seki

    2014-01-01

    In association with increasing diabetes prevalence, it is desirable to develop new glucose sensing systems with low cost, ease of use, high stability and good portability. Boronic acid is one of the potential candidates for a future alternative to enzyme-based glucose sensors. Boronic acid derivatives have been widely used for the sugar recognition motif, because boronic acids bind adjacent diols to form cyclic boronate esters. In order to develop colorimetric sugar sensors, boronic acid-conj...

  4. Short-term coral bleaching is not recorded by skeletal boron isotopes.

    Directory of Open Access Journals (Sweden)

    Verena Schoepf

    Full Text Available Coral skeletal boron isotopes have been established as a proxy for seawater pH, yet it remains unclear if and how this proxy is affected by seawater temperature. Specifically, it has never been directly tested whether coral bleaching caused by high water temperatures influences coral boron isotopes. Here we report the results from a controlled bleaching experiment conducted on the Caribbean corals Porites divaricata, Porites astreoides, and Orbicella faveolata. Stable boron (δ11B, carbon (δ13C, oxygen (δ18O isotopes, Sr/Ca, Mg/Ca, U/Ca, and Ba/Ca ratios, as well as chlorophyll a concentrations and calcification rates were measured on coral skeletal material corresponding to the period during and immediately after the elevated temperature treatment and again after 6 weeks of recovery on the reef. We show that under these conditions, coral bleaching did not affect the boron isotopic signature in any coral species tested, despite significant changes in coral physiology. This contradicts published findings from coral cores, where significant decreases in boron isotopes were interpreted as corresponding to times of known mass bleaching events. In contrast, δ13C and δ18O exhibited major enrichment corresponding to decreases in calcification rates associated with bleaching. Sr/Ca of bleached corals did not consistently record the 1.2°C difference in seawater temperature during the bleaching treatment, or alternatively show a consistent increase due to impaired photosynthesis and calcification. Mg/Ca, U/Ca, and Ba/Ca were affected by coral bleaching in some of the coral species, but the observed patterns could not be satisfactorily explained by temperature dependence or changes in coral physiology. This demonstrates that coral boron isotopes do not record short-term bleaching events, and therefore cannot be used as a proxy for past bleaching events. The robustness of coral boron isotopes to changes in coral physiology, however, suggests that

  5. The determination of boron and carbon in reactor grade boron carbide

    International Nuclear Information System (INIS)

    The sealed tube method of dissolution at high temperature and pressure has been successfully applied in the analysis of reactor grade boron carbide for the determination of boron. A 50 mg sample of boron carbide is completely dissolved by heating with concentrated nitric acid in a sealed tube at 3000C. The boron content of the resultant sample solution is determined by the mannitol potentiometric titration method. The precision of the method for the determination of 2.5 mg of boron using the Harwell automatic potentiometric titrator is 0.2% (coefficient of variation). The carbon content of a boron carbide sample is determined by combustion of the sample at 10500C in a stream of oxygen using vanadium pentoxide to ensure the complete oxidation of the sample. The carbon dioxide produced from the sample is measured manometrically and the precision of the method for the determination of 4 mg of carbon is 0.4% (coefficient of variation). (author)

  6. Proceedings of workshop on 'Boron Chemistry and Boron Neutron Capture Therapy'

    International Nuclear Information System (INIS)

    This volume contains the proceedings of the 3rd Workshop on 'the Boron Chemistry and Boron Neutron Capture Therapy' held on February 12, in 1991. In this workshop, our attention was focused on the chemical nature of boron compounds and the boron neutron capture therapy (BNCT). First, clinical experiences of BNCT in KURRI in 1990 and 1991 were reported (Chap. 3). The feasibility of the gadolinium neutron capture therapy for brain tumors was discussed (Chap. 4). In the chemical field, a rapid spectrophotometric determination of trace amounts of borons in biological samples is described (Chap. 5). The chemical behaviours of p-boronophenylalanine and its analogs in aqueous solutions were investigated by a paper electrophoresis and infrared spectroscopy (Chap. 6). On the molecular design and synthesis of new boron carriers for BNCT, several new synthetic methods for B-10 containing nucleoside derivatives were shown (Chap. 7). (author)

  7. Quantitative boron detection by neutron transmission method

    International Nuclear Information System (INIS)

    //Quantitative boron detection is mainly performed by chemical methods like colorimetric titration. High neutron absorption cross section of natural boron makes attractive its detection by absorption measurements. This work is an extension of earlier investigations where neutron radiography technique was used for boron detection. In the present investigation, the neutron absorption rate of boron containing solutions is the way to measure quantitatively the boron content of the solutions. The investigation was carried out in Istanbul TRIGA Mark-II reactor. In the end of the experiments, it was observed that even |ppw| grade boron in aqueous solution can be easily detected. The use of this method is certainly very useful for boron utilizing industries like glass and steel industries.The major disadvantage of the method is the obligation to use always aqueous solutions to be able to detect homogeneously the boron content. Then, steel or glass samples have to be put first in an appropriate solution form. The irradiation of steel samples can give the distribution of boron by the help of a imaging and this suggested method will give its quantitative measurement. The superiority of this method are its quick response time and its accuracy. To test this accuracy, a supposed unknown , solution of boric acid is irradiated and then calculated by the help of the calibration curve. The measured value of boric acid was 0.89 mg and the calculated value was found to be 0.98 mg which gives an accuracy of 10 %. It was also seen that the method is more accurate for low concentration. (authors)

  8. Growth and yield response of sunflower (helianthus annuus l.) to sulphur and boron application

    International Nuclear Information System (INIS)

    An experiment was conducted to study the growth and yield response of sunflower to sulphur and boron application. Sulphur (control, 15, 30 kg/ha) and foliar sprays of 1% boron solution (control, spray at 4 week after emergence, 20 days after first spray, at 4 weeks after germination + 20 days after first spray) was applied in soil. The results showed significant increase of all growth and yield parameters by varying levels of sulphur and boron application. Application of 30 kg sulphur/ha enhanced stem diameter (1.99 cm), number of achene per head (765.75) and oil content (36.42%). In case of combined use of sulphur and boron application, maximum plant height (171 cm), head diameter (20.71 cm), 1000-achene weight (54.56 g), biological yield (16.49 t/ha) and achene yield (3.99 t/ha) was recorded by the application of 2 sprays of boron solution (1%) at 4 weeks after germination and reproductive stage. (author)

  9. Enrichment marketplace - today (and tomorrow)

    International Nuclear Information System (INIS)

    The technologies and capacities of the four primary sources of enrichment services, the United States Department of Energy, Eurodif, Techsnabexport of the Soviet Union, and Urenco, were given. Forecasts of future capacities and prices of enriched uranium were also included

  10. X-ray diffraction study of boron produced by pyrolysis of boron tribromide

    Science.gov (United States)

    Rosenberg, David

    The goal of this research was to determine the composition of boron deposits produced by pyrolysis of boron tribromide, and to use the results to (a) determine the experimental conditions (reaction temperature, etc.) necessary to produce alpha-rhombohedral boron and (b) guide the development/refinement of the pyrolysis experiments such that large, high purity crystals of alpha-rhombohedral boron can be produced with consistency. Developing a method for producing large, high purity alpha-rhombohedral boron crystals is of interest because such crystals could potentially be used to achieve an alpha-rhombohedral boron based neutron detector design (a solid-state detector) that could serve as an alternative to existing neutron detector technologies. The supply of neutron detectors in the United States has been hampered for a number of years due to the current shortage of helium-3 (a gas used in many existing neutron detector technologies); the development of alternative neutron detector technology such as an alpha-rhombohedral boron based detector would help provide a more sustainable supply of neutron detectors in this country. In addition, the prospect/concept of an alpha-rhombohedral boron based neutron detector is attractive because it offers the possibility of achieving a design that is smaller, longer life, less power consuming, and potentially more sensitive than existing neutron detectors. The main difficulty associated with creating an alpha-rhombohedral boron based neutron detector is that producing large, high purity crystals of alpha-rhombohedral boron is extremely challenging. Past researchers have successfully made alpha-rhombohedral boron via a number of methods, but no one has developed a method for consistently producing large, high purity crystals. Alpha-rhombohedral boron is difficult to make because it is only stable at temperatures below around 1100-1200 °C, its formation is very sensitive to impurities, and the conditions necessary for its

  11. Sintering of boron carbide (B4C)

    International Nuclear Information System (INIS)

    Boron carbide (B4C) is used as a control element in different types of reactors due to the high fast and thermal neutron absorption cross-section of B-10. Requirements of the Advanced Reactor Division of the Bariloche Atomic Center triggered the study of the possibilities of fabricating B4C pellets by cold-pressing and sintering. The results of essays of sinterability of two different commercial boron carbide powders, sintered at temperatures between 1200 and 2200 deg C, are given. Characterizations of the samples were made to determine the evolution of density, porosity, microstructure and boron content as a function of sintering temperature. (Author)

  12. Developments in boron magnetic resonance imaging (MRI)

    Energy Technology Data Exchange (ETDEWEB)

    Schweizer, M.

    1995-11-01

    This report summarizes progress during the past year on maturing Boron-11 magnetic resonance imaging (MRI) methodology for noninvasive determination of BNCT agents (BSH) spatially in time. Three major areas are excerpted: (1) Boron-11 MRI of BSH distributions in a canine intracranial tumor model and the first human glioblastoma patient, (2) whole body Boron-11 MRI of BSH pharmacokinetics in a rat flank tumor model, and (3) penetration of gadolinium salts through the BBB as a function of tumor growth in the canine brain.

  13. First boronization in KSTAR: Experiences on carborane

    Energy Technology Data Exchange (ETDEWEB)

    Hong, Suk-Ho, E-mail: sukhhong@nfri.re.kr [National Fusion Research Institute, 113 Gwahangno, Yusung-Gu, Daejeon 305-333 (Korea, Republic of); Center for Edge Plasma Science (cEps), Hanyang University, Seoul 133-791 (Korea, Republic of); Lee, Kun-Su; Kim, Kwang-Pyo; Kim, Kyung-Min; Kim, Hong-Tack [National Fusion Research Institute, 113 Gwahangno, Yusung-Gu, Daejeon 305-333 (Korea, Republic of); Sun, Jong-Ho; Woo, Hyun-Jong [Center for Edge Plasma Science (cEps), Hanyang University, Seoul 133-791 (Korea, Republic of); Department of Electrical Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Park, Jae-Min [National Fusion Research Institute, 113 Gwahangno, Yusung-Gu, Daejeon 305-333 (Korea, Republic of); Park, Eun-Kyong [Center for Edge Plasma Science (cEps), Hanyang University, Seoul 133-791 (Korea, Republic of); Department of Electrical Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Kim, Woong-Chae; Kim, Hak-Kun; Park, Kap-Rai; Yang, Hyung-Lyeol; Oh, Yeong-Kook; Na, Hoon-Kyun [National Fusion Research Institute, 113 Gwahangno, Yusung-Gu, Daejeon 305-333 (Korea, Republic of); Lho, Taehyeop [National Fusion Research Institute, 113 Gwahangno, Yusung-Gu, Daejeon 305-333 (Korea, Republic of); Center for Edge Plasma Science (cEps), Hanyang University, Seoul 133-791 (Korea, Republic of); Chung, Kyu-Sun [Center for Edge Plasma Science (cEps), Hanyang University, Seoul 133-791 (Korea, Republic of); Department of Electrical Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of)

    2011-08-01

    First boronization was performed in KSTAR tokamak during 2009 campaign in order to reduce oxygen impurities and to lower the power loss due to radiation. We report the results from the experiences on carborane during the first boronization in KSTAR. After the boronization, H{sub 2}O and O{sub 2} level in the vacuum vessel are reduced significantly. The characteristics of the deposited thin films were analyzed by variable angle spectroscopic ellipsometry, XPS, and AES. {approx}1.78 x 10{sup 16} cm{sup -2} s{sup -1} of carbon flux on the wall is estimated by using cavity technique.

  14. Boron site preference in ternary Ta and Nb boron silicides

    International Nuclear Information System (INIS)

    X-ray single crystal (XSC) and neutron powder diffraction data (NPD) were used to elucidate boron site preference for five ternary phases. Ta3Si1−xBx (x=0.112(4)) crystallizes with the Ti3P-type (space group P42/n) with B-atoms sharing the 8g site with Si atoms. Ta5Si3−x (x=0.03(1); Cr5B3- type) crystallizes with space group I4/mcm, exhibiting a small amount of vacancies on the 4a site. Both, Ta5(Si1−xBx)3, x=0.568(3), and Nb5(Si1−xBx)3, x=0.59(2), are part of solid solutions of M5Si3 with Cr5B3-type into the ternary M–Si–B systems (M=Nb or Ta) with B replacing Si on the 8h site. The D88-phase in the Nb–Si–B system crystallizes with the Ti5Ga4-type revealing the formula Nb5Si3B1−x (x=0.292(3)) with B partially filling the voids in the 2b site of the Mn5Si3 parent type. - Graphical abstract: The crystal structures of a series of compounds have been solved from X-ray single crystal diffractometry revealing details on the boron incorporation. Highlights: ► Structure of a series of compounds have been solved by X-ray single crystal diffractometry. ► Ta3(Si1−xBx) (x=0.112) crystallizes with the Ti3P-type, B and Si atoms randomly share the 8g site. ► Structure of Nb5Si3B1−x (x=0.292; Ti5Ga4-type) was solved from NPD.

  15. Synthesis of Boron Nanorods by Smelting Non-Toxic Boron Oxide in Liquid Lithium

    OpenAIRE

    Amartya Chakrabarti; Tao Xu; Laura K. Paulson; Krise, Kate J.; Maguire, John A; Hosmane, Narayan S.

    2010-01-01

    In contrast to the conventional bottom-up syntheses of boron nanostructures, a unique top-down and greener synthetic strategy is presented for boron nanorods involving nontoxic boron oxide powders ultrasonically smelted in liquid lithium under milder conditions. The product was thoroughly characterized by energy dispersive X-ray analysis, atomic emission spectroscopy, thermogravimetric analysis and, UV-Vis spectroscopy, including structural characterization by transmission electron microscop...

  16. Determination of boron isotope ratios in boron carbide by mass spectrometry

    International Nuclear Information System (INIS)

    This paper introduces the direct determination of boron isotope ratios in the boron carbide powder by thermal ionization mass spectrometry. The technique for sample loading, the procedure for heating and the eliminating of effects induced by oxygen are studied. The study indicates that the preparing process for the sample will be shorted, and the time for determination and the exposure dose of the laboratory assistant will be reduced for the reason of directly determination of boron carbide. (authors)

  17. Effect of boron concentration on physicochemical properties of boron-doped carbon nanotubes

    International Nuclear Information System (INIS)

    Boron-doped carbon nanotubes (B-CNTs) were synthesized using chemical vapour deposition (CVD) floating catalyst method. Toluene was used as the carbon source, triphenylborane as boron as well as the carbon source while ferrocene was used as the catalyst. The amount of triphenylborane used was varied in a solution of toluene and ferrocene. Ferrocene was kept constant at 2.5 wt.%. while a maximum temperature of 900 °C was used for the synthesis of the shaped carbon nanomaterial (SCNMs). SCNMs obtained were characterized by the use of transmission electron microscope (TEM), scanning electron microscope (SEM), high resolution-electron microscope, electron dispersive X-ay spectroscopy (EDX), Raman spectroscopy, inductively coupled plasma-optical emission spectroscopy (ICP-OES), vibrating sample magnetometer (VSM), nitrogen adsorption at 77 K, and inverse gas chromatography. TEM and SEM analysis confirmed SCNMs obtained were a mixture of B-CNTs and carbon nanofibres (B-CNF). EDX and ICP-OES results showed that boron was successively incorporated into the carbon hexagonal network of CNTs and its concentration was dependent on the amount of triphenylborane used. From the VSM results, the boron doping within the CNTs introduced ferromagnetic properties, and as the percentage of boron increased the magnetic coactivity and squareness changed. In addition, boron doping changed the conductivity and the surface energy among other physicochemical properties of B-CNTs. - Highlights: • Boron-doping of carbon nanotubes (CNTs) changes their physiochemical properties. • Amount of boron-doping was dependent on the wt.% of boron precursor used. • Boron-doping changed CNTs surfaces and the distribution of dispersive energy sites. • Boron-doping affected the conductivity and ferromagnetic properties. • Increased boron-doping results in a more favourable interaction with polar probes

  18. New Prototype Safeguards Technology Offers Improved Confidence and Automation for Uranium Enrichment Facilities

    Energy Technology Data Exchange (ETDEWEB)

    Brim, Cornelia P.

    2013-04-01

    An important requirement for the international safeguards community is the ability to determine the enrichment level of uranium in gas centrifuge enrichment plants and nuclear fuel fabrication facilities. This is essential to ensure that countries with nuclear nonproliferation commitments, such as States Party to the Nuclear Nonproliferation Treaty, are adhering to their obligations. However, current technologies to verify the uranium enrichment level in gas centrifuge enrichment plants or nuclear fuel fabrication facilities are technically challenging and resource-intensive. NNSA’s Office of Nonproliferation and International Security (NIS) supports the development, testing, and evaluation of future systems that will strengthen and sustain U.S. safeguards and security capabilities—in this case, by automating the monitoring of uranium enrichment in the entire inventory of a fuel fabrication facility. One such system is HEVA—hybrid enrichment verification array. This prototype was developed to provide an automated, nondestructive assay verification technology for uranium hexafluoride (UF6) cylinders at enrichment plants.

  19. The effect of changing enrichments on core performance

    International Nuclear Information System (INIS)

    Highlights: • Five cores were analyzed with the same core configuration but with higher enrichments. • The highest enrichment core produced longest possible cycle length of 750 days. • New method for designing BP placement was introduced for the longer cycle lengths. • Fuel costs were calculated showing fuel costs decrease with increasing cycle length. - Abstract: The information presented in this paper has been developed as a follow on to two previous papers published using the same low leakage core configuration with the addition in this paper of evaluating fuel costs. The two previous publications studied the characteristics of this low leakage core with two different enrichment sets, where each enrichment set represents the three batches in the core. The purpose of the two previous papers proved the effectiveness of using the Haling Power Depletion (HPD) method as a guide. The first purpose of this paper is to extend this study to higher enrichment sets to finally attain a core having close to the highest possible cycle length. Three additional similar enrichment sets are studied increasing the number of enrichment sets to five. The ratio between the enrichment sets was maintained constant except for the highest enrichment set. This was done to increase the cycle length to approximately the longest possible cycle length of 800 days for a 1000 MWe reactor limited to a maximum 5% enrichment. The core reactor physics characteristics of these five cores are presented in this paper together with the evaluating of the fuel costs. These core characteristics include radial power fractions (RPF), Haling Power Depletion, RPF distributions, maximum pin peak powers (PPPMAX), and other important data. The HPD RPFs of all 5 cores were similar and used to help develop the burnable poison placement designs for each core. The longest two cycles required an improved technique using more information than the HPD results to develop successful BP placement designs. Also, it

  20. Investigation of boron extraction process with aid magnesium hydroxide from mother liquor of boron production

    International Nuclear Information System (INIS)

    Conditions of boron - magnesium concentrate preparation from mother liquor by coprecipitation of borate - ions by magnesium hydroxide are investigated. It is shown that boron - magnesium concentrate and products of its heat treatment at 100 - 500 deg C in water are dissolved partially, and in ammonium citrate - practically completely. Suppositions are made on the composition of the product prepared, on the the structure of its crystal lattice and the processes taking place in it during heat treatment. The conclusion is made on the perspectiveness of processing of mother liquor of boron industry for boron - magnesium concentrate

  1. CEA contribution to power plant operation with high burnup level

    International Nuclear Information System (INIS)

    High level burnup in PWR leads to investigate again the choices carried out in the field of fuel management. French CEA has studied the economic importance of reshuffling technique, cycle length, discharge burnup, and non-operation period between two cycles. Power plants operators wish to work with increased length cycles of 18 months instead of 12. That leads to control problems because the core reactivity cannot be controlled with the only soluble boron: moderator temperature coefficient must be negative. With such cycles, it is necessary to use burnable poisons and for economic reasons with a low penalty in end of cycle. CEA has studied the use of Gd2O3 mixed with fuel or with inert element like Al2O3. Parametric studies of specific weights, efficacities relatively to the fuel burnup and the fuel enrichment have been carried out. Particular studies of 1 month cycles with Gd2O3 have shown the possibility to control power distribution with a very low reactivity penalty in EOC. In the same time, in the 100 MW PWR-CAP, control reactivity has been made with large use of gadolinia in parallel with soluble boron for the two first cycles

  2. Fundamental studies on the ion-exchange separation of boron isotopes

    International Nuclear Information System (INIS)

    The single-stage separation factors for boron isotopes between an ion-exchange resin and an external solution were determined, using an ion-exchange breakthrough operation. The lighter isotope boron-10 was considerably enriched in the anion-exchange resin phase. The separation factor was very much influenced by the boric acid concentration in the external solution, but not as much influenced by the kind of the anion exchange resin used and operation temperature. The separation factor increased with a decrease in the boric acid concentration of external solution from 1.008 (0.501 mol/l) to 1.016 (0.010 mol/l). The value of the separation factors obtained experimentally were compared with those estimated on the basis of the theory of the two-phase distribution of isotopes. (auth.)

  3. A passive rem counter based on CR39 SSNTD coupled with a boron converter

    CERN Document Server

    Agosteo, S; Ferrarini, c, M; Silari, M

    2009-01-01

    A passive neutron rem counter using a CR39 SSNTD coupled with a boron converter has been developed. The rem counter is a polythene sphere with cadmium and lead insets, designed to have a response function proportional to the fluence to ambient dose equivalent conversion coefficients, H*(10)/Φ, for energies ranging from thermal up to 1 GeV. At its centre is a thermal neutron detector made of a CR39 SSNTD coupled with an enriched boron neutron converter. The rem counter was first calibrated at CERN and at the Politecnico di Milano, and then tested in high-energy neutron fields at GSI, Darmstadt, Germany and at the CERF facility at CERN. Its most important features are a very high neutron sensitivity and conversely a complete insensitivity to gamma radiation.

  4. Development of a process to recover boron carbide from nuclear reactor absorber rods

    International Nuclear Information System (INIS)

    Boron carbide enriched with 10B is used as a control rod in reactor engineering. At present spent rods are disposed of, although major amounts of 10B are still 'unused'. The objective was to recover 10B from the control rods by an energy and cost saving method in order to use it for making new control rods, thus saving raw materials and minimizing the radioactive waste volume. For this purpose, the well-known pyrohydrolysis process was taken and analysed for possible improvements. By mixing boron carbide with CO2 as an oxidation-supporting agent, a lowering of the reaction temperature by 300deg C, and an increase in the oxidation speed by 350% were achieved. Since C02 is not consumed and can be circulated, the method for reprocessing spent control rods presented in this paper is both an economy-priced an energy-saving one. (orig.) With 98 refs., 9 tabs., 14 figs

  5. Thermal neutron response of a boron-coated GEM detector via GEANT4 Monte Carlo code.

    Science.gov (United States)

    Jamil, M; Rhee, J T; Kim, H G; Ahmad, Farzana; Jeon, Y J

    2014-10-22

    In this work, we report the design configuration and the performance of the hybrid Gas Electron Multiplier (GEM) detector. In order to make the detector sensitive to thermal neutrons, the forward electrode of the GEM has been coated with the enriched boron-10 material, which works as a neutron converter. A total of 5×5cm(2) configuration of GEM has been used for thermal neutron studies. The response of the detector has been estimated via using GEANT4 MC code with two different physics lists. Using the QGSP_BIC_HP physics list, the neutron detection efficiency was determined to be about 3%, while with QGSP_BERT_HP physics list the efficiency was around 2.5%, at the incident thermal neutron energies of 25meV. The higher response of the detector proves that GEM-coated with boron converter improves the efficiency for thermal neutrons detection. PMID:25464183

  6. Boron Drug Delivery via Encapsulated Magnetic Nanocomposites: A New Approach for BNCT in Cancer Treatment

    Directory of Open Access Journals (Sweden)

    Yinghuai Zhu

    2010-01-01

    Full Text Available Ortho-carborane cages have been successfully attached to modified magnetic nanoparticles via catalytic azide-alkyne cycloadditions between 1-R-2-butyl-Ortho-C2B10H10(R=Me,3;Ph,4 and propargyl group-enriched magnetic nanoparticles. A loading amount of 9.83 mmol boron atom/g starch-matrixed magnetic nanoparticles has been reached. The resulting nanocomposites have been found to be highly tumor-targeted vehicles under the influence of an external magnetic field (1.14T, yielding a high boron concentration of 51.4 μg/g tumor and ratios of around 10 : 1 tumor to normal tissues.

  7. Development of gamma compensated boron lined ionization chamber with intermediate range monitor for reactor applications

    International Nuclear Information System (INIS)

    Gamma compensated boron lined ionization chamber with indigenously developed 40.5% enriched boron-10 and polyetheretherketone insulating spacers has been developed. The detector has an overall diameter of 85 mm and overall length of 315 mm. Tests on the chamber with intermediate range monitor have been conducted in both gamma and neutron fields. The detector has good saturation characteristics, adequate neutron sensitivity and required gamma compensation. The linearity of response of the detector at various reactor power levels was also found to be within the required limits. The Log P signal output variation due to change in amplifier temperature of IRM, was found to be within limits for temperature variations from 25℃ to 30.13℃ thus indicating stable output against changes in temperature of IRM amplifier at steady reactor power operation. (author)

  8. Boron

    International Nuclear Information System (INIS)

    This paper reports that borate minerals and refined borates are used extensively for the manufacture of vitreous materials such as insulation and textile fiberglasses, borosilicate glass, and porcelain enamels and frits. In North America, these applications are estimated to account for over 54% of the borate consumption. Other substantial uses are in soaps and detergents, metallurgy, fire retardants, industrial biocides, agriculture, and various miscellaneous applications. Reported domestic borate consumption in 1990 was estimated by the U.S. Bureau of Mines to be 320 000 metric tons B2O3 versus 354 000 metric tons B2O3 in 1989. Consumption is projected to remain essentially static in 1991. Imports were estimated by the Bureau to be 50 000 metric tons B2O3 in 1990. Exports of boric acid and refined borates were approximately 650 000 metric tons of product, a 15 000 metric ton increase from the 1989 level. This increase partially offsets the drop in the 1990 consumption level

  9. Enriching recycled uranium

    International Nuclear Information System (INIS)

    The paper reviews the progress of the use of recycled uranium during the period 1985-8. This article was originally presented as a paper at the 1988 Uranium Institute symposium (which was held in London). A description is given of the differences between natural and recycled uranium, and the presence of U236 in recycled uranium. The concept of equivalent reactivity is described, as well as the cost benefit of using recycled uranium. A summary of Urenco tests and trials with reprocessed uranium is given. Enrichment, UF6 conversion and fuel fabrication are also discussed. (U.K.)

  10. Clogging the enrichment bypass

    International Nuclear Information System (INIS)

    The issue that has come to be known as the bypass is the latest dispute in the continuing saga of uranium trade between the United States and the Commonwealth of Indepenent States. Bypass deals now being conducted by US utilities have drawn heavy criticism from the US Department of Commerce but are perfectly legal under the terms of the Suspension Agreements. Urged on by the United States Enrichment Corporation, the US DOC intends to stop, or at least severely restrict, bypass deals. Using a recent agreement with Kazakhstan as a case study, this article reviews the implications of such bypass deals

  11. Synthesis of Boron-Containing Primary Amines

    Directory of Open Access Journals (Sweden)

    Sheng-Hsuan Chung

    2013-10-01

    Full Text Available In this study, boron-containing primary amines were synthesized for use as building blocks in the study of peptoids. In the first step, Gabriel synthesis conditions were modified to enable the construction of seven different aminomethylphenyl boronate esters in good to excellent yields. These compounds were further utilized to build peptoid analogs via an Ugi four-component reaction (Ugi-4CR under microwave irradiation. The prepared Ugi-4CR boronate esters were then successfully converted to the corresponding boronic acids. Finally, the peptoid structures were successfully modified by cross-coupling to aryl/heteroaryl chlorides via a palladium-mediated Suzuki coupling reaction to yield the corresponding derivatives in moderate to good yields.

  12. Boron adsorption on hematite and clinoptilolite

    International Nuclear Information System (INIS)

    This thesis describes experiments performed to determine the suitability of boron as a potential reactive tracer for use in saturated-zone C-well reactive tracer studies for the Yucca Mountain Project (YMP). Experiments were performed to identify the prevalent sorption mechanism of boron and to determine adsorption of boron on hematite and clinoptilolite as a function of pH. These minerals are present in the Yucca Mountain tuff in which the C-well studies will be conducted. Evaluation of this sorption mechanism was done by determining the equilibration time of boron-mineral suspensions, by measuring changes in equilibrium to titrations, and by measuring electrophoretic mobility. Experiments were performed with the minerals suspended in NaCl electrolytes of concentrations ranging from 0.1 N NaCl to 0.001 N NaCl. Experimentalconditions included pH values between 3 and 12 and temperature of about 38 degrees C

  13. Boron-Filled Hybrid Carbon Nanotubes.

    Science.gov (United States)

    Patel, Rajen B; Chou, Tsengming; Kanwal, Alokik; Apigo, David J; Lefebvre, Joseph; Owens, Frank; Iqbal, Zafar

    2016-01-01

    A unique nanoheterostructure, a boron-filled hybrid carbon nanotube (BHCNT), has been synthesized using a one-step chemical vapor deposition process. The BHCNTs can be considered to be a novel form of boron carbide consisting of boron doped, distorted multiwalled carbon nanotubes (MWCNTs) encapsulating boron nanowires. These MWCNTs were found to be insulating in spite of their graphitic layered outer structures. While conventional MWCNTs have great axial strength, they have weak radial compressive strength, and do not bond well to one another or to other materials. In contrast, BHCNTs are shown to be up to 31% stiffer and 233% stronger than conventional MWCNTs in radial compression and have excellent mechanical properties at elevated temperatures. The corrugated surface of BHCNTs enables them to bond easily to themselves and other materials, in contrast to carbon nanotubes (CNTs). BHCNTs can, therefore, be used to make nanocomposites, nanopaper sheets, and bundles that are stronger than those made with CNTs. PMID:27460526

  14. Boron neutron capture therapy. What is next?

    International Nuclear Information System (INIS)

    BNCT (Boron Neutron Capture Therapy) will have difficulties establishing itself without efficient and conclusive clinical trials of glioma, without the expansion to other tumors, and without efficient programs for compound development and testing. (author)

  15. Ni doping of semiconducting boron carbide

    International Nuclear Information System (INIS)

    The wide band gap, temperature stability, high resistivity, and robustness of semiconducting boron carbide make it an attractive material for device applications. Undoped boron carbide is p type; Ni acts as a n-type dopant. Here we present the results of controlled doping of boron carbide with Ni on thin film samples grown using plasma enhanced chemical vapor deposition. The change in the dopant concentration within the thin film as a function of the dopant flow rate in the precursor gas mixture was confirmed by x-ray photoelectron spectroscopy measurements; with increasing dopant concentration, current-voltage (I-V) curves clearly establish the trend from p-type to n-type boron carbide.

  16. Analysis of boron at Koeberg Power Station

    International Nuclear Information System (INIS)

    Soluble reactivity poisons, also called chemical shim, produce spatially uniform neutron absorption when dissolved in reactor coolant water. The boron-10 isotope having a high neutron absorption coefficient is used in commercial pressurised water reactors (PWR) to limit and control reactivity. This is achieved at Koeberg Nuclear Power Station (KNPS) and the majority of commercial PWR's worldwide by the addition of natural boric acid to the reactor coolant. The boric acid dissolved in the coolant decreases the thermal utilisation factor, causing a decrease in reactivity. By varying the concentration of boric acid (and hence also the B-10 concentration) in the coolant, a process referred to as boration and dilution, the reactivity of the core can be easily managed. An increase in boron concentration (boration) creates negative reactivity and if the boron concentration is reduced (dilution), positive reactivity is added. The changing of boron concentration in a PWR is used primarily to compensate for fuel burn-up or poison build-up. The variation in boron concentration allows control rod use to be minimised, which results in a flatter flux profile over the core than can be produced by control rod manipulation. Accurate laboratory and on-line chemical analysis of boron concentration is important because of its operational implications associated with reactivity control and also for nuclear safety. In a normal fuel cycle, as the nuclear fuel is being consumed, the reactor coolant boric acid (B-10) concentration must be reduced by dilution with purified water to maintain the reactor at constant power. Besides in the reactor coolant water, boric acid concentration is also important in the chemical and volume control system and reactor make-up system for operation. For nuclear safety, boric acid concentrations are technical specification parameters, maintained and monitored in the spent fuel system and safety injection systems. Boron concentration determination is

  17. High temperature thermoelectric properties of boron carbide

    International Nuclear Information System (INIS)

    Boron carbides are refractory solids with potential for application as very high temperature p-type thermoelectrics in power conversion applications. The thermoelectric properties of boron carbides are unconventional. In particular, the electrical conductivity is consistent with the thermally activated hopping of a high density (∼1021/cm3) of bipolarons; the Seebeck coefficient is anomalously large and increases with increasing temperature; and the thermal conductivity is surprisingly low. In this paper, these unusual properties and their relationship to the unusual structure and bonding present in boron carbides are reviewed. Finally, the potential for utilization of boron carbides at very high temperatures (up to 2200 degrees C) and for preparing n-type materials is discussed

  18. Development of a novel neutron detection technique by using a boron layer coating a Charge Coupled Device

    OpenAIRE

    Blostein, Juan Jerónimo; Estrada, Juan; Tartaglione, Aureliano; Haro, Miguel Sofo; Moroni, Guillermo Fernández; Cancelo, Gustavo

    2014-01-01

    This article describes the design features and the first test measurements obtained during the installation of a novel high resolution 2D neutron detection technique. The technique proposed in this work consists of a boron layer (enriched in ${^{10}}$B) placed on a scientific Charge Coupled Device (CCD). After the nuclear reaction ${^{10}}$B(n,$\\alpha$)${^{7}}$Li, the CCD detects the emitted charge particles thus obtaining information on the neutron absorption position. The above mentioned io...

  19. Lithium-Beryllium-Boron : Origin and Evolution

    OpenAIRE

    Vangioni-Flam, Elisabeth; Casse, Michel; Audouze, Jean

    1999-01-01

    The origin and evolution of Lithium-Beryllium-Boron is a crossing point between different astrophysical fields : optical and gamma spectroscopy, non thermal nucleosynthesis, Big Bang and stellar nucleosynthesis and finally galactic evolution. We describe the production and the evolution of Lithium-Beryllium-Boron from Big Bang up to now through the interaction of the Standard Galactic Cosmic Rays with the interstellar medium, supernova neutrino spallation and a low energy component related to...

  20. Innovative boron nitride-doped propellants

    OpenAIRE

    Thelma Manning; Richard Field; Kenneth Klingaman; Michael Fair; John Bolognini; Robin Crownover; Carlton P. Adam; Viral Panchal; Eugene Rozumov; Henry Grau; Paul Matter; Michael Beachy; Christopher Holt; Samuel Sopok

    2016-01-01

    The U.S. military has a need for more powerful propellants with balanced/stoichiometric amounts of fuel and oxidants. However, balanced and more powerful propellants lead to accelerated gun barrel erosion and markedly shortened useful barrel life. Boron nitride (BN) is an interesting potential additive for propellants that could reduce gun wear effects in advanced propellants (US patent pending 2015-026P). Hexagonal boron nitride is a good lubricant that can provide wear resistance and lower ...